F493225

General Info

Members Datasets Scaffolds Average Seq Length
1349 330 1349 178

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100004792|Ga0070688_1000047927
Length 207
Sequence MNLSRRGAVRGAVLSGRGVETGTIKGSQAMSDIRRGLIIVNTGPGKGKTTAAMGTGLRAVGQGMRVLMLQFLKGSWHYGELDAVQAFGDKFVMKQLGRGFVKVGAEKPDPEDVRMVEDAWAEGEKAIQSGQWDLVILDEINYAISYGMLDPAKVVASLQRKPEMVHVILTGRNAHPTIVELADTVTEMRQVKHAYEKGVMAQRGIEY

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
132 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
133 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 1.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.56
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000065 3300000546 Bacteria 14444
2 JGI24752J21851_1000229 3300001976 Bacteria 7763
3 JGI24748J21848_1007642 3300002074 Bacteria 1269
4 JGI24751J29686_10003136 3300002459 Bacteria 3330
5 Ga0058862_12892892 3300004803 Bacteria 782
6 Ga0065715_10001009 3300005293 Bacteria 12640
7 Ga0070658_10029704 3300005327 Bacteria 4392
8 Ga0070676_10040855 3300005328 Bacteria 2687
9 Ga0070683_100059266 3300005329 Bacteria 3556
10 Ga0070683_100230143 3300005329 Unclassified 1762
11 Ga0070683_100352260 3300005329 Bacteria 1402
12 Ga0070683_100667247 3300005329 Bacteria 996
13 Ga0070683_101134218 3300005329 Bacteria 751
14 Ga0070690_100035044 3300005330 Bacteria 3147
15 Ga0070690_100112359 3300005330 Bacteria 1819
16 Ga0070690_100509145 3300005330 Bacteria 902
17 Ga0070670_100029442 3300005331 Bacteria 4728
18 Ga0070670_100506824 3300005331 Unclassified 1074
19 Ga0070677_10002757 3300005333 Bacteria 5623
20 Ga0068869_100049894 3300005334 Bacteria 3032
21 Ga0068869_100595052 3300005334 Unclassified 934
22 Ga0070666_10058994 3300005335 Bacteria 2595
23 Ga0070680_100003035 3300005336 Bacteria 12458
24 Ga0070680_100053210 3300005336 Bacteria 3304
25 Ga0070680_100060507 3300005336 Unclassified 3099
26 Ga0070680_100061282 3300005336 Bacteria 3079
27 Ga0070680_100138915 3300005336 Bacteria 2037
28 Ga0070680_100159346 3300005336 Unclassified 1896
29 Ga0070680_100287418 3300005336 Bacteria 1394
30 Ga0070680_100349779 3300005336 Bacteria 1257
31 Ga0070682_100013400 3300005337 Bacteria 4715
32 Ga0070682_100072059 3300005337 Bacteria 2213
33 Ga0070682_100222517 3300005337 Bacteria 1344
34 Ga0068868_100003810 3300005338 Bacteria 10532
35 Ga0068868_100004803 3300005338 Bacteria 9487
36 Ga0068868_100037951 3300005338 Bacteria 3737
37 Ga0068868_100039208 3300005338 Unclassified 3680
38 Ga0068868_100039267 3300005338 Bacteria 3678
39 Ga0068868_100041287 3300005338 Bacteria 3594
40 Ga0068868_100163942 3300005338 Bacteria 1837
41 Ga0070660_100003383 3300005339 Bacteria 10973
42 Ga0070660_100025220 3300005339 Bacteria 4418
43 Ga0070660_100035373 3300005339 Bacteria 3780
44 Ga0070660_100142536 3300005339 Bacteria 1923
45 Ga0070689_100503710 3300005340 Bacteria 1038
46 Ga0070661_100011272 3300005344 Bacteria 6227
47 Ga0070661_100018686 3300005344 Bacteria 4932
48 Ga0070661_100020921 3300005344 Bacteria 4669
49 Ga0070661_100078408 3300005344 Bacteria 2437
50 Ga0070661_100176040 3300005344 Unclassified 1626
51 Ga0070661_100299480 3300005344 Bacteria 1251
52 Ga0070661_100398265 3300005344 Bacteria 1088
53 Ga0070661_100451503 3300005344 Bacteria 1023
54 Ga0070668_100020921 3300005347 Bacteria 4942
55 Ga0070668_100022722 3300005347 Bacteria 4742
56 Ga0070668_100033009 3300005347 Bacteria 3940
57 Ga0070669_100099646 3300005353 Bacteria 2190
58 Ga0070669_100227806 3300005353 Bacteria 1476
59 Ga0070675_100024325 3300005354 Bacteria 4850
60 Ga0070675_100126857 3300005354 Unclassified 2171
61 Ga0070671_100086792 3300005355 Bacteria 2618
62 Ga0070671_100227797 3300005355 Bacteria 1581
63 Ga0070671_100629480 3300005355 Bacteria 928
64 Ga0070673_100026626 3300005364 Bacteria 4274
65 Ga0070673_100070899 3300005364 Bacteria 2798
66 Ga0070673_100173191 3300005364 Bacteria 1843
67 Ga0070688_100004792 3300005365 Bacteria 7072
68 Ga0070688_100387794 3300005365 Bacteria 1031
69 Ga0070659_100006817 3300005366 Bacteria 8268
70 Ga0070659_100522563 3300005366 Bacteria 1013
71 Ga0070659_100704687 3300005366 Bacteria 873
72 Ga0070667_100065072 3300005367 Bacteria 3095
73 Ga0070667_100354301 3300005367 Bacteria 1329
74 Ga0070709_10004241 3300005434 Bacteria 7731
75 Ga0070709_10007723 3300005434 Bacteria 5905
76 Ga0070709_10010229 3300005434 Bacteria 5187
77 Ga0070709_10011412 3300005434 Bacteria 4951
78 Ga0070709_10019249 3300005434 Unclassified 3944
79 Ga0070709_10062899 3300005434 Bacteria 2368
80 Ga0070709_10127707 3300005434 Bacteria 1732
81 Ga0070709_10322920 3300005434 Bacteria 1133
82 Ga0070714_100000194 3300005435 Bacteria 49287
83 Ga0070714_100012321 3300005435 Bacteria 6823
84 Ga0070714_100035323 3300005435 Bacteria 4189
85 Ga0070714_100182062 3300005435 Bacteria 1912
86 Ga0070714_100246963 3300005435 Bacteria 1649
87 Ga0070714_100262459 3300005435 Bacteria 1600
88 Ga0070714_100280287 3300005435 Bacteria 1548
89 Ga0070714_100280315 3300005435 Bacteria 1548
90 Ga0070714_100354173 3300005435 Bacteria 1379
91 Ga0070714_100576065 3300005435 Unclassified 1079
92 Ga0070714_100710510 3300005435 Bacteria 970
93 Ga0070714_101444903 3300005435 Unclassified 672
94 Ga0070713_100000207 3300005436 Bacteria 39199
95 Ga0070713_100003636 3300005436 Bacteria 10200
96 Ga0070713_100011854 3300005436 Bacteria 6369
97 Ga0070713_100014622 3300005436 Bacteria 5838
98 Ga0070713_100026153 3300005436 Bacteria 4577
99 Ga0070713_100029543 3300005436 Bacteria 4343
100 Ga0070713_100031562 3300005436 Bacteria 4221
101 Ga0070713_100100072 3300005436 Bacteria 2509
102 Ga0070713_100318498 3300005436 Bacteria 1436
103 Ga0070713_100336257 3300005436 Bacteria 1398
104 Ga0070713_100482193 3300005436 Unclassified 1168
105 Ga0070713_100525483 3300005436 Bacteria 1118
106 Ga0070713_100749890 3300005436 Bacteria 934
107 Ga0070713_101491453 3300005436 Bacteria 656
108 Ga0070713_101634139 3300005436 Bacteria 625
109 Ga0070710_10038518 3300005437 Bacteria 2626
110 Ga0070710_10122586 3300005437 Bacteria 1575
111 Ga0070710_10192248 3300005437 Unclassified 1284
112 Ga0070710_10198533 3300005437 Bacteria 1265
113 Ga0070701_10031168 3300005438 Bacteria 2644
114 Ga0070711_100000521 3300005439 Bacteria 19947
115 Ga0070711_100010512 3300005439 Bacteria 5729
116 Ga0070711_100015972 3300005439 Bacteria 4759
117 Ga0070711_100129930 3300005439 Bacteria 1875
118 Ga0070711_100255471 3300005439 Unclassified 1376
119 Ga0070711_100432065 3300005439 Bacteria 1075
120 Ga0070711_100790417 3300005439 Bacteria 804
121 Ga0070705_100232743 3300005440 Bacteria 1283
122 Ga0070705_100411626 3300005440 Bacteria 1004
123 Ga0070700_100287123 3300005441 Bacteria 1195
124 Ga0070708_100000219 3300005445 Bacteria 42551
125 Ga0070708_100002478 3300005445 Bacteria 14259
126 Ga0070708_100009535 3300005445 Bacteria 7829
127 Ga0070708_100019633 3300005445 Bacteria 5683
128 Ga0070708_100091546 3300005445 Bacteria 2769
129 Ga0070708_100150591 3300005445 Bacteria 2163
130 Ga0070708_100153634 3300005445 Unclassified 2141
131 Ga0070708_100179898 3300005445 Bacteria 1976
132 Ga0070708_100262820 3300005445 Bacteria 1623
133 Ga0070708_100321337 3300005445 Bacteria 1458
134 Ga0070663_100042890 3300005455 Bacteria 3181
135 Ga0070663_100046950 3300005455 Bacteria 3058
136 Ga0070662_100013709 3300005457 Bacteria 5398
137 Ga0070662_100024443 3300005457 Bacteria 4162
138 Ga0070662_100123816 3300005457 Bacteria 1984
139 Ga0070681_10000241 3300005458 Bacteria 43183
140 Ga0070681_10002945 3300005458 Bacteria 15786
141 Ga0070681_10040232 3300005458 Bacteria 4685
142 Ga0070681_10051457 3300005458 Bacteria 4108
143 Ga0070681_10051712 3300005458 Bacteria 4098
144 Ga0070681_10080710 3300005458 Bacteria 3209
145 Ga0070681_10173831 3300005458 Bacteria 2075
146 Ga0070681_10221492 3300005458 Bacteria 1807
147 Ga0070681_10267502 3300005458 Bacteria 1621
148 Ga0070681_10273130 3300005458 Bacteria 1602
149 Ga0070681_10352931 3300005458 Bacteria 1381
150 Ga0070681_10439521 3300005458 Bacteria 1216
151 Ga0070681_10514218 3300005458 Bacteria 1110
152 Ga0070681_10674060 3300005458 Bacteria 949
153 Ga0070681_10853020 3300005458 Bacteria 829
154 Ga0070681_10937869 3300005458 Unclassified 784
155 Ga0068867_100012609 3300005459 Bacteria 5978
156 Ga0068867_100080359 3300005459 Bacteria 2455
157 Ga0070685_10002057 3300005466 Bacteria 10406
158 Ga0070685_10110754 3300005466 Bacteria 1690
159 Ga0070706_100001249 3300005467 Bacteria 27215
160 Ga0070706_100005510 3300005467 Bacteria 12051
161 Ga0070706_100042155 3300005467 Bacteria 4215
162 Ga0070706_100143551 3300005467 Bacteria 2229
163 Ga0070706_100195407 3300005467 Bacteria 1890
164 Ga0070706_100283917 3300005467 Bacteria 1545
165 Ga0070706_100844491 3300005467 Bacteria 847
166 Ga0070706_101064839 3300005467 Bacteria 745
167 Ga0070707_100016693 3300005468 Bacteria 6893
168 Ga0070707_100024246 3300005468 Bacteria 5743
169 Ga0070707_100060143 3300005468 Bacteria 3643
170 Ga0070707_100073240 3300005468 Bacteria 3302
171 Ga0070707_100098432 3300005468 Bacteria 2833
172 Ga0070707_100230813 3300005468 Unclassified 1801
173 Ga0070707_100551719 3300005468 Bacteria 1114
174 Ga0070698_100000091 3300005471 Bacteria 71604
175 Ga0070698_100009320 3300005471 Bacteria 10529
176 Ga0070698_100343454 3300005471 Bacteria 1424
177 Ga0070698_100479186 3300005471 Bacteria 1181
178 Ga0070699_100000177 3300005518 Bacteria 61679
179 Ga0070699_100017251 3300005518 Bacteria 6199
180 Ga0070699_100030687 3300005518 Bacteria 4640
181 Ga0070679_100003532 3300005530 Bacteria 14319
182 Ga0070679_100011138 3300005530 Bacteria 8564
183 Ga0070679_100015241 3300005530 Bacteria 7385
184 Ga0070679_100059605 3300005530 Bacteria 3804
185 Ga0070679_100080307 3300005530 Bacteria 3250
186 Ga0070679_100258415 3300005530 Bacteria 1697
187 Ga0070679_100287232 3300005530 Bacteria 1597
188 Ga0070679_100300511 3300005530 Bacteria 1556
189 Ga0070679_101158581 3300005530 Bacteria 718
190 Ga0070684_100005322 3300005535 Bacteria 9854
191 Ga0070684_100056787 3300005535 Bacteria 3417
192 Ga0070684_100130489 3300005535 Unclassified 2267
193 Ga0070684_100270822 3300005535 Bacteria 1554
194 Ga0070684_100657075 3300005535 Bacteria 976
195 Ga0070684_100804461 3300005535 Bacteria 879
196 Ga0070684_100918007 3300005535 Bacteria 821
197 Ga0070697_100000324 3300005536 Bacteria 37814
198 Ga0070697_100000727 3300005536 Bacteria 24562
199 Ga0070697_100000728 3300005536 Bacteria 24548
200 Ga0070697_100001046 3300005536 Bacteria 20897
201 Ga0070697_100028320 3300005536 Bacteria 4485
202 Ga0070697_100079637 3300005536 Bacteria 2697
203 Ga0070697_100144813 3300005536 Bacteria 1999
204 Ga0070697_100281054 3300005536 Bacteria 1428
205 Ga0070697_100779099 3300005536 Bacteria 846
206 Ga0070697_101061619 3300005536 Bacteria 720
207 Ga0068853_100000135 3300005539 Bacteria 50106
208 Ga0068853_100034680 3300005539 Bacteria 4284
209 Ga0068853_100057141 3300005539 Bacteria 3366
210 Ga0068853_100067794 3300005539 Bacteria 3101
211 Ga0068853_100256002 3300005539 Bacteria 1608
212 Ga0068853_100301362 3300005539 Bacteria 1481
213 Ga0068853_100314578 3300005539 Unclassified 1450
214 Ga0068853_100411908 3300005539 Bacteria 1266
215 Ga0068853_100512318 3300005539 Bacteria 1133
216 Ga0070672_100006656 3300005543 Bacteria 7784
217 Ga0070686_100191227 3300005544 Bacteria 1461
218 Ga0070695_100530747 3300005545 Bacteria 914
219 Ga0070696_100032766 3300005546 Bacteria 3567
220 Ga0070696_100142530 3300005546 Bacteria 1753
221 Ga0070696_100147585 3300005546 Bacteria 1724
222 Ga0070696_100398510 3300005546 Bacteria 1076
223 Ga0070693_100025295 3300005547 Bacteria 3194
224 Ga0070693_100036701 3300005547 Bacteria 2727
225 Ga0070693_100084840 3300005547 Bacteria 1896
226 Ga0070665_100009521 3300005548 Bacteria 9826
227 Ga0070665_100012790 3300005548 Bacteria 8455
228 Ga0070665_100152636 3300005548 Bacteria 2312
229 Ga0070665_100390755 3300005548 Bacteria 1399
230 Ga0068855_100000712 3300005563 Bacteria 40749
231 Ga0068855_100001850 3300005563 Bacteria 26318
232 Ga0068855_100033291 3300005563 Bacteria 6152
233 Ga0068855_100128995 3300005563 Bacteria 2889
234 Ga0068855_100145128 3300005563 Bacteria 2702
235 Ga0068855_100206871 3300005563 Bacteria 2207
236 Ga0068855_100208630 3300005563 Bacteria 2196
237 Ga0068855_100213465 3300005563 Bacteria 2167
238 Ga0068855_100277503 3300005563 Bacteria 1862
239 Ga0068855_100379750 3300005563 Bacteria 1552
240 Ga0068855_100408489 3300005563 Bacteria 1487
241 Ga0068855_100444382 3300005563 Bacteria 1416
242 Ga0068855_100523960 3300005563 Bacteria 1285
243 Ga0068855_100614246 3300005563 Bacteria 1171
244 Ga0068855_100789944 3300005563 Bacteria 1010
245 Ga0070664_100024680 3300005564 Bacteria 4976
246 Ga0070664_100032297 3300005564 Unclassified 4378
247 Ga0070664_100232524 3300005564 Bacteria 1652
248 Ga0070664_100636751 3300005564 Bacteria 990
249 Ga0068857_100002931 3300005577 Bacteria 14070
250 Ga0068857_100008567 3300005577 Bacteria 8845
251 Ga0068857_100020107 3300005577 Bacteria 5869
252 Ga0068857_100024421 3300005577 Bacteria 5321
253 Ga0068857_100052049 3300005577 Bacteria 3633
254 Ga0068857_100454040 3300005577 Unclassified 1198
255 Ga0068854_100000866 3300005578 Bacteria 18145
256 Ga0068854_100011289 3300005578 Bacteria 5809
257 Ga0068854_100020955 3300005578 Bacteria 4430
258 Ga0068854_100084141 3300005578 Bacteria 2353
259 Ga0068854_100086715 3300005578 Bacteria 2321
260 Ga0068854_100199661 3300005578 Bacteria 1571
261 Ga0068856_100000706 3300005614 Bacteria 36274
262 Ga0068856_100001186 3300005614 Bacteria 27468
263 Ga0068856_100001480 3300005614 Bacteria 24601
264 Ga0068856_100014836 3300005614 Bacteria 7520
265 Ga0068856_100033606 3300005614 Bacteria 5022
266 Ga0068856_100035487 3300005614 Bacteria 4887
267 Ga0068856_100035614 3300005614 Bacteria 4878
268 Ga0068856_100102872 3300005614 Bacteria 2850
269 Ga0068856_100129227 3300005614 Bacteria 2530
270 Ga0068856_100147048 3300005614 Bacteria 2364
271 Ga0068856_100166066 3300005614 Bacteria 2218
272 Ga0068856_100178123 3300005614 Bacteria 2138
273 Ga0068856_100272105 3300005614 Bacteria 1710
274 Ga0068856_100316876 3300005614 Unclassified 1577
275 Ga0068856_101669477 3300005614 Bacteria 650
276 Ga0070702_100006319 3300005615 Bacteria 5599
277 Ga0070702_100386009 3300005615 Bacteria 997
278 Ga0068852_100002133 3300005616 Bacteria 13559
279 Ga0068852_100002443 3300005616 Bacteria 12796
280 Ga0068852_100017056 3300005616 Bacteria 5687
281 Ga0068852_100017271 3300005616 Bacteria 5657
282 Ga0068852_100058357 3300005616 Bacteria 3343
283 Ga0068852_100065853 3300005616 Unclassified 3163
284 Ga0068852_100081934 3300005616 Bacteria 2866
285 Ga0068852_100089378 3300005616 Unclassified 2753
286 Ga0068852_100099272 3300005616 Bacteria 2624
287 Ga0068852_100556577 3300005616 Bacteria 1148
288 Ga0068852_100881445 3300005616 Bacteria 911
289 Ga0068859_100000418 3300005617 Bacteria 42477
290 Ga0068859_100016315 3300005617 Bacteria 7462
291 Ga0068859_100019604 3300005617 Bacteria 6794
292 Ga0068859_100024397 3300005617 Bacteria 6066
293 Ga0068859_100337231 3300005617 Bacteria 1602
294 Ga0068864_100006714 3300005618 Bacteria 9427
295 Ga0068864_100008302 3300005618 Bacteria 8566
296 Ga0068864_100043013 3300005618 Bacteria 3866
297 Ga0068866_10001698 3300005718 Bacteria 9274
298 Ga0068866_10031135 3300005718 Bacteria 2567
299 Ga0068866_10196318 3300005718 Unclassified 1203
300 Ga0068861_100013067 3300005719 Bacteria 5805
301 Ga0068861_100082252 3300005719 Bacteria 2523
302 Ga0068861_100508936 3300005719 Bacteria 1090
303 Ga0068861_100638038 3300005719 Unclassified 982
304 Ga0068861_100651254 3300005719 Bacteria 973
305 Ga0068851_10187503 3300005834 Bacteria 1148
306 Ga0068851_10200813 3300005834 Unclassified 1113
307 Ga0068870_10000907 3300005840 Bacteria 11599
308 Ga0068863_100011286 3300005841 Bacteria 8654
309 Ga0068863_100112963 3300005841 Bacteria 2587
310 Ga0068858_100003408 3300005842 Bacteria 15812
311 Ga0068858_100017216 3300005842 Bacteria 6782
312 Ga0068858_100059277 3300005842 Bacteria 3538
313 Ga0068858_100072181 3300005842 Unclassified 3203
314 Ga0068858_100108812 3300005842 Bacteria 2587
315 Ga0068858_100126603 3300005842 Bacteria 2392
316 Ga0068858_100187754 3300005842 Bacteria 1952
317 Ga0068858_100360270 3300005842 Unclassified 1394
318 Ga0068860_100100123 3300005843 Bacteria 2765
319 Ga0068860_100105542 3300005843 Unclassified 2690
320 Ga0068860_100135737 3300005843 Bacteria 2362
321 Ga0068860_100195129 3300005843 Bacteria 1961
322 Ga0068862_100012946 3300005844 Bacteria 6902
323 Ga0068862_100028129 3300005844 Bacteria 4734
324 Ga0068862_100070395 3300005844 Unclassified 3020
325 Ga0068862_100132514 3300005844 Bacteria 2206
326 Ga0081540_1055592 3300005983 Bacteria 1927
327 Ga0070717_10000643 3300006028 Bacteria 22445
328 Ga0070717_10004428 3300006028 Bacteria 10142
329 Ga0070717_10005064 3300006028 Bacteria 9608
330 Ga0070717_10007397 3300006028 Bacteria 8154
331 Ga0070717_10010992 3300006028 Bacteria 6856
332 Ga0070717_10060733 3300006028 Bacteria 3131
333 Ga0070717_10075985 3300006028 Bacteria 2810
334 Ga0070717_10112975 3300006028 Bacteria 2319
335 Ga0070717_10116497 3300006028 Bacteria 2284
336 Ga0070717_10184783 3300006028 Bacteria 1819
337 Ga0070717_10192367 3300006028 Bacteria 1783
338 Ga0070717_10254292 3300006028 Bacteria 1553
339 Ga0070717_10304165 3300006028 Unclassified 1418
340 Ga0070717_10527749 3300006028 Bacteria 1068
341 Ga0070715_10015597 3300006163 Bacteria 2838
342 Ga0070715_10016421 3300006163 Bacteria 2781
343 Ga0070715_10030397 3300006163 Bacteria 2183
344 Ga0070715_10331700 3300006163 Unclassified 824
345 Ga0070716_100000427 3300006173 Bacteria 17423
346 Ga0070716_100062664 3300006173 Bacteria 2157
347 Ga0070716_100106531 3300006173 Bacteria 1729
348 Ga0070716_100377085 3300006173 Bacteria 1013
349 Ga0070716_100543837 3300006173 Bacteria 865
350 Ga0070712_100001635 3300006175 Bacteria 13696
351 Ga0070712_100001637 3300006175 Bacteria 13691
352 Ga0070712_100002252 3300006175 Bacteria 11869
353 Ga0070712_100002945 3300006175 Bacteria 10545
354 Ga0070712_100011018 3300006175 Bacteria 5721
355 Ga0070712_100040934 3300006175 Bacteria 3179
356 Ga0070712_100066876 3300006175 Bacteria 2556
357 Ga0070712_100260634 3300006175 Bacteria 1389
358 Ga0070712_100336781 3300006175 Bacteria 1231
359 Ga0070712_100546460 3300006175 Unclassified 976
360 Ga0070712_100661937 3300006175 Bacteria 888
361 Ga0097621_100000071 3300006237 Bacteria 52258
362 Ga0097621_100000133 3300006237 Bacteria 43711
363 Ga0097621_100000296 3300006237 Bacteria 33629
364 Ga0097621_100005720 3300006237 Bacteria 8779
365 Ga0097621_100014967 3300006237 Bacteria 5822
366 Ga0097621_100103668 3300006237 Bacteria 2396
367 Ga0097621_100108252 3300006237 Bacteria 2346
368 Ga0097621_100144196 3300006237 Bacteria 2037
369 Ga0097621_100521717 3300006237 Bacteria 1078
370 Ga0097621_100685151 3300006237 Bacteria 943
371 Ga0068871_100000137 3300006358 Bacteria 47104
372 Ga0068871_100000448 3300006358 Bacteria 28345
373 Ga0068871_100000989 3300006358 Bacteria 19030
374 Ga0068871_100026666 3300006358 Bacteria 4511
375 Ga0068871_100026960 3300006358 Bacteria 4489
376 Ga0068871_100027315 3300006358 Bacteria 4463
377 Ga0068871_100029113 3300006358 Bacteria 4336
378 Ga0068871_100071447 3300006358 Bacteria 2855
379 Ga0068871_100138019 3300006358 Bacteria 2072
380 Ga0068871_100282115 3300006358 Bacteria 1453
381 Ga0068871_100505710 3300006358 Bacteria 1090
382 Ga0075433_10000213 3300006852 Bacteria 32853
383 Ga0075433_10030691 3300006852 Bacteria 4588
384 Ga0075433_10747672 3300006852 Unclassified 855
385 Ga0075434_100000122 3300006871 Bacteria 45781
386 Ga0075434_100001886 3300006871 Bacteria 18145
387 Ga0075434_100077063 3300006871 Bacteria 3329
388 Ga0068865_100051529 3300006881 Unclassified 2849
389 Ga0068865_100059944 3300006881 Bacteria 2663
390 Ga0068865_100061672 3300006881 Unclassified 2630
391 Ga0068865_100182985 3300006881 Bacteria 1615
392 Ga0068865_100278997 3300006881 Bacteria 1330
393 Ga0068865_100382565 3300006881 Bacteria 1148
394 Ga0075436_100002330 3300006914 Bacteria 13098
395 Ga0075436_100008125 3300006914 Bacteria 7183
396 Ga0075436_100019629 3300006914 Bacteria 4633
397 Ga0075436_100110438 3300006914 Bacteria 1919
398 Ga0075436_100134274 3300006914 Bacteria 1737
399 Ga0075436_100287884 3300006914 Unclassified 1176
400 Ga0097620_100000418 3300006931 Bacteria 42477
401 Ga0097620_100016316 3300006931 Bacteria 7462
402 Ga0097620_100019604 3300006931 Bacteria 6794
403 Ga0097620_100024397 3300006931 Bacteria 6066
404 Ga0097620_100337236 3300006931 Bacteria 1602
405 Ga0075435_100000038 3300007076 Bacteria 67821
406 Ga0075435_100134675 3300007076 Bacteria 2069
407 Ga0075435_100211879 3300007076 Bacteria 1644
408 Ga0075435_100334518 3300007076 Bacteria 1297
409 Ga0075435_100557286 3300007076 Unclassified 993
410 Ga0099795_10017687 3300007788 Bacteria 2277
411 Ga0099795_10141810 3300007788 Bacteria 978
412 Ga0099795_10156512 3300007788 Bacteria 937
413 Ga0099795_10158922 3300007788 Unclassified 931
414 Ga0105240_10002457 3300009093 Bacteria 29782
415 Ga0105240_10002467 3300009093 Bacteria 29726
416 Ga0105240_10011828 3300009093 Bacteria 12120
417 Ga0105240_10028761 3300009093 Bacteria 7251
418 Ga0105240_10048681 3300009093 Bacteria 5355
419 Ga0105240_10055349 3300009093 Unclassified 4966
420 Ga0105240_10063020 3300009093 Bacteria 4614
421 Ga0105240_10102903 3300009093 Bacteria 3470
422 Ga0105240_10206466 3300009093 Bacteria 2299
423 Ga0105240_10409263 3300009093 Bacteria 1526
424 Ga0105240_10445681 3300009093 Bacteria 1450
425 Ga0105240_10447900 3300009093 Bacteria 1445
426 Ga0105240_10474692 3300009093 Bacteria 1395
427 Ga0105240_10477386 3300009093 Bacteria 1391
428 Ga0105240_10516073 3300009093 Bacteria 1327
429 Ga0105240_10802231 3300009093 Bacteria 1020
430 Ga0105245_10000516 3300009098 Bacteria 35436
431 Ga0105245_10017772 3300009098 Bacteria 6207
432 Ga0105245_10050660 3300009098 Bacteria 3722
433 Ga0105245_10056355 3300009098 Unclassified 3532
434 Ga0105245_10182908 3300009098 Bacteria 2004
435 Ga0105245_11152722 3300009098 Unclassified 822
436 Ga0105247_10003144 3300009101 Bacteria 10877
437 Ga0105247_10144553 3300009101 Bacteria 1562
438 Ga0114129_10006460 3300009147 Bacteria 16625
439 Ga0114129_10186491 3300009147 Bacteria 2819
440 Ga0105243_10249472 3300009148 Bacteria 1584
441 Ga0105243_10352693 3300009148 Bacteria 1352
442 Ga0105241_10000276 3300009174 Bacteria 38340
443 Ga0105241_10001178 3300009174 Bacteria 19935
444 Ga0105241_10002428 3300009174 Bacteria 13981
445 Ga0105241_10025863 3300009174 Bacteria 4364
446 Ga0105241_10036117 3300009174 Bacteria 3718
447 Ga0105241_10073412 3300009174 Unclassified 2661
448 Ga0105241_10100182 3300009174 Bacteria 2302
449 Ga0105241_10111809 3300009174 Bacteria 2187
450 Ga0105241_10130281 3300009174 Bacteria 2036
451 Ga0105241_10184554 3300009174 Bacteria 1732
452 Ga0105241_10201653 3300009174 Bacteria 1662
453 Ga0105241_10288950 3300009174 Bacteria 1403
454 Ga0105241_10332742 3300009174 Bacteria 1313
455 Ga0105242_10068694 3300009176 Unclassified 2932
456 Ga0105242_10083515 3300009176 Bacteria 2675
457 Ga0105242_10124916 3300009176 Bacteria 2213
458 Ga0105242_10138058 3300009176 Bacteria 2112
459 Ga0105242_10252096 3300009176 Bacteria 1591
460 Ga0105242_10644364 3300009176 Bacteria 1029
461 Ga0105242_10979084 3300009176 Bacteria 852
462 Ga0105242_11280768 3300009176 Bacteria 756
463 Ga0105248_10003784 3300009177 Bacteria 16758
464 Ga0105248_10010694 3300009177 Bacteria 10125
465 Ga0105248_10199986 3300009177 Bacteria 2251
466 Ga0105248_10367767 3300009177 Bacteria 1619
467 Ga0105248_10536094 3300009177 Bacteria 1320
468 Ga0105248_10646804 3300009177 Bacteria 1193
469 Ga0105237_10013239 3300009545 Bacteria 8655
470 Ga0105237_10016568 3300009545 Bacteria 7657
471 Ga0105237_10031675 3300009545 Bacteria 5355
472 Ga0105237_10034389 3300009545 Bacteria 5132
473 Ga0105237_10078097 3300009545 Bacteria 3300
474 Ga0105237_10115021 3300009545 Bacteria 2683
475 Ga0105237_10147378 3300009545 Bacteria 2349
476 Ga0105237_10159626 3300009545 Bacteria 2253
477 Ga0105237_10217058 3300009545 Bacteria 1913
478 Ga0105237_10352200 3300009545 Bacteria 1477
479 Ga0105237_10410516 3300009545 Bacteria 1359
480 Ga0105237_11663895 3300009545 Bacteria 645
481 Ga0105238_10000368 3300009551 Bacteria 48371
482 Ga0105238_10003298 3300009551 Bacteria 16116
483 Ga0105238_10013303 3300009551 Bacteria 8301
484 Ga0105238_10031980 3300009551 Bacteria 5354
485 Ga0105238_10035657 3300009551 Bacteria 5056
486 Ga0105238_10040693 3300009551 Bacteria 4709
487 Ga0105238_10042861 3300009551 Bacteria 4581
488 Ga0105238_10079296 3300009551 Bacteria 3274
489 Ga0105238_10118567 3300009551 Bacteria 2627
490 Ga0105238_10279537 3300009551 Bacteria 1650
491 Ga0105238_10380787 3300009551 Bacteria 1402
492 Ga0105238_10566541 3300009551 Bacteria 1141
493 Ga0105238_10577437 3300009551 Bacteria 1130
494 Ga0105249_10009498 3300009553 Bacteria 8520
495 Ga0105249_10284497 3300009553 Unclassified 1652
496 Ga0105249_10772591 3300009553 Unclassified 1024
497 Ga0105239_10004815 3300010375 Bacteria 16004
498 Ga0105239_10007299 3300010375 Bacteria 12691
499 Ga0105239_10022069 3300010375 Bacteria 7018
500 Ga0105239_10096667 3300010375 Bacteria 3263
501 Ga0105239_10162705 3300010375 Bacteria 2494
502 Ga0105239_10564527 3300010375 Bacteria 1297
503 Ga0105239_10806570 3300010375 Bacteria 1076
504 Ga0105239_11027958 3300010375 Bacteria 948
505 Ga0105246_10003660 3300011119 Bacteria 9305
506 Ga0105246_10022064 3300011119 Bacteria 4105
507 Ga0157327_1010456 3300012512 Bacteria 876
508 Ga0157373_10004599 3300013100 Bacteria 10375
509 Ga0157373_10039159 3300013100 Bacteria 3394
510 Ga0157373_10076501 3300013100 Bacteria 2361
511 Ga0157371_10006488 3300013102 Bacteria 9637
512 Ga0157371_10008669 3300013102 Bacteria 8077
513 Ga0157371_10100574 3300013102 Bacteria 2051
514 Ga0157371_10131479 3300013102 Bacteria 1781
515 Ga0157371_10160747 3300013102 Unclassified 1604
516 Ga0157370_10028648 3300013104 Bacteria 5476
517 Ga0157370_10034673 3300013104 Bacteria 4910
518 Ga0157370_10116280 3300013104 Bacteria 2498
519 Ga0157370_10407701 3300013104 Bacteria 1251
520 Ga0157370_10584100 3300013104 Bacteria 1023
521 Ga0157370_10723777 3300013104 Bacteria 907
522 Ga0157369_10000750 3300013105 Bacteria 41791
523 Ga0157369_10002157 3300013105 Bacteria 23721
524 Ga0157369_10003112 3300013105 Bacteria 19830
525 Ga0157369_10003177 3300013105 Bacteria 19610
526 Ga0157369_10012621 3300013105 Bacteria 9579
527 Ga0157369_10021573 3300013105 Bacteria 7204
528 Ga0157369_10024326 3300013105 Bacteria 6740
529 Ga0157369_10100090 3300013105 Bacteria 3090
530 Ga0157369_10101682 3300013105 Bacteria 3063
531 Ga0157369_10132021 3300013105 Bacteria 2646
532 Ga0157369_10207874 3300013105 Unclassified 2052
533 Ga0157369_10349969 3300013105 Bacteria 1534
534 Ga0157369_10407765 3300013105 Bacteria 1410
535 Ga0157369_10417379 3300013105 Bacteria 1391
536 Ga0157369_10437667 3300013105 Bacteria 1355
537 Ga0157369_10771352 3300013105 Bacteria 989
538 Ga0157369_10934693 3300013105 Unclassified 889
539 Ga0157369_11400632 3300013105 Bacteria 712
540 Ga0157374_10000254 3300013296 Bacteria 49194
541 Ga0157374_10000302 3300013296 Bacteria 45742
542 Ga0157374_10002020 3300013296 Bacteria 17029
543 Ga0157374_10006337 3300013296 Bacteria 10034
544 Ga0157374_10007926 3300013296 Bacteria 9068
545 Ga0157374_10010724 3300013296 Bacteria 7896
546 Ga0157374_10037873 3300013296 Bacteria 4430
547 Ga0157374_10050655 3300013296 Bacteria 3861
548 Ga0157374_10107857 3300013296 Bacteria 2676
549 Ga0157374_10234138 3300013296 Unclassified 1805
550 Ga0157374_10239442 3300013296 Bacteria 1784
551 Ga0157374_10311949 3300013296 Bacteria 1557
552 Ga0157374_10332954 3300013296 Unclassified 1506
553 Ga0157374_10511694 3300013296 Unclassified 1206
554 Ga0157374_10536140 3300013296 Unclassified 1177
555 Ga0157374_10763550 3300013296 Bacteria 982
556 Ga0157378_10000055 3300013297 Bacteria 97875
557 Ga0157378_10000554 3300013297 Bacteria 35545
558 Ga0157378_10000671 3300013297 Bacteria 32243
559 Ga0157378_10006811 3300013297 Bacteria 9969
560 Ga0157378_10014366 3300013297 Bacteria 6932
561 Ga0157378_10022268 3300013297 Bacteria 5578
562 Ga0157378_10116416 3300013297 Bacteria 2458
563 Ga0157378_10216560 3300013297 Bacteria 1819
564 Ga0157378_10310045 3300013297 Bacteria 1530
565 Ga0157378_10532228 3300013297 Bacteria 1178
566 Ga0157378_11579117 3300013297 Bacteria 702
567 Ga0163162_10018861 3300013306 Bacteria 6763
568 Ga0163162_10020399 3300013306 Bacteria 6512
569 Ga0163162_10021252 3300013306 Bacteria 6387
570 Ga0163162_10053147 3300013306 Unclassified 4071
571 Ga0163162_10166366 3300013306 Bacteria 2329
572 Ga0163162_10267698 3300013306 Bacteria 1840
573 Ga0163162_10320159 3300013306 Bacteria 1683
574 Ga0163162_10478017 3300013306 Bacteria 1377
575 Ga0157372_10001110 3300013307 Bacteria 29226
576 Ga0157372_10001984 3300013307 Bacteria 22243
577 Ga0157372_10002196 3300013307 Bacteria 21209
578 Ga0157372_10005384 3300013307 Bacteria 13608
579 Ga0157372_10009900 3300013307 Bacteria 10139
580 Ga0157372_10014952 3300013307 Bacteria 8308
581 Ga0157372_10015839 3300013307 Bacteria 8089
582 Ga0157372_10040068 3300013307 Bacteria 5172
583 Ga0157372_10055165 3300013307 Bacteria 4437
584 Ga0157372_10058477 3300013307 Bacteria 4310
585 Ga0157372_10058753 3300013307 Bacteria 4300
586 Ga0157372_10071991 3300013307 Bacteria 3895
587 Ga0157372_10097959 3300013307 Bacteria 3345
588 Ga0157372_10167594 3300013307 Bacteria 2540
589 Ga0157372_10278036 3300013307 Bacteria 1946
590 Ga0157372_10278046 3300013307 Bacteria 1946
591 Ga0157372_10346535 3300013307 Bacteria 1731
592 Ga0157372_10364148 3300013307 Bacteria 1685
593 Ga0157372_10450015 3300013307 Bacteria 1501
594 Ga0157372_10924513 3300013307 Bacteria 1011
595 Ga0157372_11449948 3300013307 Bacteria 791
596 Ga0157375_10002920 3300013308 Bacteria 14822
597 Ga0157375_10045075 3300013308 Bacteria 4291
598 Ga0157375_10057116 3300013308 Bacteria 3857
599 Ga0157375_10088787 3300013308 Bacteria 3146
600 Ga0163163_10002249 3300014325 Bacteria 16265
601 Ga0163163_10090048 3300014325 Unclassified 3081
602 Ga0163163_10124623 3300014325 Bacteria 2613
603 Ga0163163_10224122 3300014325 Unclassified 1929
604 Ga0163163_10234247 3300014325 Bacteria 1885
605 Ga0163163_10536604 3300014325 Bacteria 1232
606 Ga0182008_10011762 3300014497 Unclassified 4643
607 Ga0182008_10025038 3300014497 Unclassified 3034
608 Ga0157377_10000465 3300014745 Bacteria 17447
609 Ga0157379_10008732 3300014968 Bacteria 8832
610 Ga0157379_10038093 3300014968 Bacteria 4290
611 Ga0157379_10085807 3300014968 Bacteria 2822
612 Ga0157379_10086676 3300014968 Bacteria 2807
613 Ga0157379_10099678 3300014968 Unclassified 2608
614 Ga0157379_10204604 3300014968 Bacteria 1786
615 Ga0157379_10500802 3300014968 Bacteria 1126
616 Ga0157376_10025796 3300014969 Bacteria 4634
617 Ga0157376_10026011 3300014969 Bacteria 4618
618 Ga0157376_10032266 3300014969 Bacteria 4204
619 Ga0157376_10042525 3300014969 Bacteria 3724
620 Ga0157376_10057173 3300014969 Unclassified 3262
621 Ga0157376_10096845 3300014969 Bacteria 2569
622 Ga0157376_10162891 3300014969 Bacteria 2024
623 Ga0157376_10450279 3300014969 Bacteria 1256
624 Ga0157376_10572428 3300014969 Bacteria 1120
625 Ga0182006_1040412 3300015261 Bacteria 1836
626 Ga0182006_1068248 3300015261 Bacteria 1325
627 Ga0182007_10018808 3300015262 Bacteria 2497
628 Ga0182007_10052545 3300015262 Bacteria 1342
629 Ga0163161_10005860 3300017792 Bacteria 8519
630 Ga0184596_128878 3300019176 Bacteria 1115
631 Ga0184601_120629 3300019183 Bacteria 987
632 Ga0184599_104727 3300019188 Bacteria 1005
633 Ga0184600_113135 3300019190 Bacteria 633
634 Ga0184603_111301 3300019192 Bacteria 702
635 Ga0206355_1020444 3300020076 Bacteria 1456
636 Ga0206351_11014315 3300020077 Bacteria 663
637 Ga0206352_10398647 3300020078 Unclassified 1095
638 Ga0206352_10693439 3300020078 Bacteria 957
639 Ga0206350_11568350 3300020080 Unclassified 778
640 Ga0154015_1023356 3300020610 Bacteria 932
641 Ga0213872_10019106 3300021361 Bacteria 3156
642 Ga0213872_10035895 3300021361 Bacteria 2266
643 Ga0213872_10043905 3300021361 Bacteria 2035
644 Ga0224712_10326633 3300022467 Unclassified 722
645 Ga0224569_100968 3300022732 Bacteria 2442
646 Ga0224571_100032 3300022734 Bacteria 4426
647 Ga0247553_101899 3300023672 Bacteria 928
648 Ga0224572_1012573 3300024225 Bacteria 1611
649 Ga0224572_1014715 3300024225 Bacteria 1495
650 Ga0228598_1002332 3300024227 Bacteria 4150
651 Ga0228598_1004726 3300024227 Bacteria 2877
652 Ga0228598_1040561 3300024227 Bacteria 918
653 Ga0207697_10020044 3300025315 Bacteria 2739
654 Ga0207697_10111353 3300025315 Unclassified 1172
655 Ga0207656_10014772 3300025321 Bacteria 3016
656 Ga0207656_10146160 3300025321 Bacteria 1117
657 Ga0207656_10154110 3300025321 Bacteria 1090
658 Ga0207682_10011377 3300025893 Bacteria 3475
659 Ga0207692_10077687 3300025898 Bacteria 1767
660 Ga0207692_10102660 3300025898 Bacteria 1573
661 Ga0207692_10125712 3300025898 Unclassified 1442
662 Ga0207692_10572390 3300025898 Unclassified 724
663 Ga0207642_10027988 3300025899 Bacteria 2315
664 Ga0207642_10281264 3300025899 Bacteria 957
665 Ga0207710_10050374 3300025900 Bacteria 1868
666 Ga0207680_10052956 3300025903 Bacteria 2434
667 Ga0207680_10099825 3300025903 Bacteria 1863
668 Ga0207647_10005709 3300025904 Bacteria 9083
669 Ga0207647_10007182 3300025904 Bacteria 8072
670 Ga0207647_10007397 3300025904 Bacteria 7936
671 Ga0207647_10017482 3300025904 Bacteria 4874
672 Ga0207647_10039479 3300025904 Bacteria 2977
673 Ga0207685_10004115 3300025905 Bacteria 3648
674 Ga0207685_10008806 3300025905 Bacteria 2897
675 Ga0207685_10113141 3300025905 Unclassified 1180
676 Ga0207685_10181980 3300025905 Unclassified 975
677 Ga0207685_10480648 3300025905 Bacteria 651
678 Ga0207699_10006716 3300025906 Bacteria 5585
679 Ga0207699_10009295 3300025906 Bacteria 4888
680 Ga0207699_10059479 3300025906 Bacteria 2290
681 Ga0207699_10067515 3300025906 Bacteria 2174
682 Ga0207699_10102424 3300025906 Bacteria 1819
683 Ga0207699_10119399 3300025906 Unclassified 1703
684 Ga0207699_10252064 3300025906 Unclassified 1217
685 Ga0207699_10917770 3300025906 Bacteria 646
686 Ga0207645_10000038 3300025907 Bacteria 88349
687 Ga0207645_10003405 3300025907 Bacteria 12090
688 Ga0207643_10003645 3300025908 Bacteria 8300
689 Ga0207705_10261461 3300025909 Bacteria 1321
690 Ga0207705_10288388 3300025909 Bacteria 1257
691 Ga0207684_10000383 3300025910 Bacteria 59620
692 Ga0207684_10000395 3300025910 Bacteria 58309
693 Ga0207684_10039608 3300025910 Bacteria 3996
694 Ga0207684_10046661 3300025910 Bacteria 3675
695 Ga0207684_10341887 3300025910 Bacteria 1289
696 Ga0207684_10627654 3300025910 Bacteria 916
697 Ga0207654_10000325 3300025911 Bacteria 28589
698 Ga0207654_10000600 3300025911 Bacteria 20304
699 Ga0207654_10006778 3300025911 Bacteria 5762
700 Ga0207654_10012614 3300025911 Bacteria 4334
701 Ga0207654_10026315 3300025911 Bacteria 3149
702 Ga0207654_10048664 3300025911 Bacteria 2427
703 Ga0207654_10086887 3300025911 Bacteria 1896
704 Ga0207654_10359703 3300025911 Unclassified 1004
705 Ga0207707_10003331 3300025912 Bacteria 14273
706 Ga0207707_10031562 3300025912 Bacteria 4636
707 Ga0207707_10043565 3300025912 Bacteria 3914
708 Ga0207707_10051253 3300025912 Bacteria 3594
709 Ga0207707_10070708 3300025912 Bacteria 3041
710 Ga0207707_10078851 3300025912 Bacteria 2876
711 Ga0207707_10131332 3300025912 Bacteria 2190
712 Ga0207707_10323416 3300025912 Bacteria 1331
713 Ga0207707_10373260 3300025912 Bacteria 1227
714 Ga0207707_10412964 3300025912 Bacteria 1158
715 Ga0207707_10454477 3300025912 Bacteria 1096
716 Ga0207707_10611735 3300025912 Bacteria 921
717 Ga0207707_10817953 3300025912 Unclassified 775
718 Ga0207695_10000466 3300025913 Bacteria 87899
719 Ga0207695_10007531 3300025913 Bacteria 13802
720 Ga0207695_10044199 3300025913 Bacteria 4740
721 Ga0207695_10047498 3300025913 Bacteria 4542
722 Ga0207695_10049644 3300025913 Bacteria 4421
723 Ga0207695_10079367 3300025913 Bacteria 3327
724 Ga0207695_10087017 3300025913 Bacteria 3149
725 Ga0207695_10102821 3300025913 Bacteria 2850
726 Ga0207695_10139160 3300025913 Bacteria 2378
727 Ga0207695_10145577 3300025913 Bacteria 2314
728 Ga0207695_10207870 3300025913 Bacteria 1869
729 Ga0207695_10250643 3300025913 Bacteria 1670
730 Ga0207695_10390110 3300025913 Bacteria 1277
731 Ga0207695_10392264 3300025913 Unclassified 1273
732 Ga0207695_10394208 3300025913 Bacteria 1269
733 Ga0207695_10490810 3300025913 Bacteria 1110
734 Ga0207695_10877906 3300025913 Unclassified 777
735 Ga0207671_10000403 3300025914 Bacteria 60340
736 Ga0207671_10026322 3300025914 Bacteria 4362
737 Ga0207671_10063321 3300025914 Bacteria 2748
738 Ga0207671_10254587 3300025914 Bacteria 1381
739 Ga0207693_10000092 3300025915 Bacteria 80077
740 Ga0207693_10000131 3300025915 Bacteria 67893
741 Ga0207693_10000557 3300025915 Bacteria 33720
742 Ga0207693_10007111 3300025915 Bacteria 9231
743 Ga0207693_10009131 3300025915 Bacteria 8095
744 Ga0207693_10016645 3300025915 Bacteria 5875
745 Ga0207693_10022278 3300025915 Bacteria 5035
746 Ga0207693_10095024 3300025915 Unclassified 2336
747 Ga0207693_10113828 3300025915 Unclassified 2122
748 Ga0207693_10205769 3300025915 Bacteria 1547
749 Ga0207663_10000389 3300025916 Bacteria 19118
750 Ga0207663_10007309 3300025916 Bacteria 5719
751 Ga0207663_10008120 3300025916 Bacteria 5470
752 Ga0207663_10059705 3300025916 Bacteria 2414
753 Ga0207663_10086553 3300025916 Bacteria 2067
754 Ga0207663_10106123 3300025916 Bacteria 1898
755 Ga0207663_10504072 3300025916 Bacteria 941
756 Ga0207660_10000640 3300025917 Bacteria 23556
757 Ga0207660_10044946 3300025917 Bacteria 3109
758 Ga0207660_10065946 3300025917 Bacteria 2618
759 Ga0207660_10139798 3300025917 Unclassified 1851
760 Ga0207660_10221454 3300025917 Bacteria 1485
761 Ga0207660_10242137 3300025917 Bacteria 1421
762 Ga0207660_10310981 3300025917 Bacteria 1256
763 Ga0207662_10170617 3300025918 Bacteria 1395
764 Ga0207657_10001099 3300025919 Bacteria 28732
765 Ga0207657_10001231 3300025919 Bacteria 27330
766 Ga0207657_10002581 3300025919 Bacteria 19598
767 Ga0207657_10002611 3300025919 Bacteria 19469
768 Ga0207649_10008275 3300025920 Bacteria 5667
769 Ga0207649_10103298 3300025920 Bacteria 1890
770 Ga0207649_10386494 3300025920 Bacteria 1044
771 Ga0207649_10890692 3300025920 Bacteria 697
772 Ga0207652_10008448 3300025921 Bacteria 8284
773 Ga0207652_10013462 3300025921 Bacteria 6619
774 Ga0207652_10050851 3300025921 Bacteria 3551
775 Ga0207652_10309347 3300025921 Bacteria 1426
776 Ga0207652_10395765 3300025921 Bacteria 1247
777 Ga0207652_10487234 3300025921 Bacteria 1110
778 Ga0207646_10000229 3300025922 Bacteria 77035
779 Ga0207646_10003563 3300025922 Bacteria 17485
780 Ga0207646_10028954 3300025922 Bacteria 5038
781 Ga0207646_10045421 3300025922 Bacteria 3944
782 Ga0207646_10207633 3300025922 Bacteria 1769
783 Ga0207646_10744065 3300025922 Bacteria 875
784 Ga0207681_10022807 3300025923 Bacteria 3996
785 Ga0207681_10662873 3300025923 Bacteria 866
786 Ga0207694_10000098 3300025924 Bacteria 96679
787 Ga0207694_10003750 3300025924 Bacteria 12046
788 Ga0207694_10003818 3300025924 Bacteria 11919
789 Ga0207694_10092802 3300025924 Bacteria 2384
790 Ga0207694_10110509 3300025924 Bacteria 2186
791 Ga0207694_10138757 3300025924 Bacteria 1954
792 Ga0207694_10188157 3300025924 Bacteria 1676
793 Ga0207694_10203757 3300025924 Bacteria 1610
794 Ga0207694_10204357 3300025924 Bacteria 1608
795 Ga0207694_10320274 3300025924 Bacteria 1279
796 Ga0207694_10381063 3300025924 Bacteria 1171
797 Ga0207694_10401177 3300025924 Bacteria 1140
798 Ga0207694_10546453 3300025924 Bacteria 972
799 Ga0207650_10000104 3300025925 Bacteria 111268
800 Ga0207650_10066987 3300025925 Bacteria 2693
801 Ga0207650_10514413 3300025925 Unclassified 1001
802 Ga0207659_10015202 3300025926 Bacteria 4981
803 Ga0207659_10361975 3300025926 Bacteria 1206
804 Ga0207687_10003641 3300025927 Bacteria 10389
805 Ga0207687_10004419 3300025927 Bacteria 9375
806 Ga0207687_10063764 3300025927 Bacteria 2610
807 Ga0207687_10116326 3300025927 Bacteria 1993
808 Ga0207687_10346330 3300025927 Unclassified 1209
809 Ga0207687_10416195 3300025927 Bacteria 1108
810 Ga0207687_10962323 3300025927 Unclassified 732
811 Ga0207700_10001982 3300025928 Bacteria 11656
812 Ga0207700_10005245 3300025928 Bacteria 7727
813 Ga0207700_10005753 3300025928 Bacteria 7445
814 Ga0207700_10040179 3300025928 Bacteria 3412
815 Ga0207700_10041416 3300025928 Bacteria 3369
816 Ga0207700_10077194 3300025928 Bacteria 2587
817 Ga0207700_10088662 3300025928 Bacteria 2436
818 Ga0207700_10103509 3300025928 Bacteria 2276
819 Ga0207700_10147831 3300025928 Bacteria 1939
820 Ga0207700_10171735 3300025928 Unclassified 1809
821 Ga0207700_10218155 3300025928 Unclassified 1616
822 Ga0207700_10300058 3300025928 Bacteria 1387
823 Ga0207700_10436778 3300025928 Bacteria 1152
824 Ga0207664_10001088 3300025929 Bacteria 18116
825 Ga0207664_10018871 3300025929 Bacteria 5086
826 Ga0207664_10043647 3300025929 Bacteria 3508
827 Ga0207664_10127594 3300025929 Bacteria 2137
828 Ga0207664_10174981 3300025929 Bacteria 1839
829 Ga0207664_10262711 3300025929 Bacteria 1510
830 Ga0207664_10550697 3300025929 Bacteria 1035
831 Ga0207664_10658643 3300025929 Bacteria 941
832 Ga0207664_11175066 3300025929 Bacteria 685
833 Ga0207664_11497669 3300025929 Bacteria 596
834 Ga0207644_10028299 3300025931 Bacteria 3878
835 Ga0207644_10113953 3300025931 Bacteria 2048
836 Ga0207644_10331354 3300025931 Bacteria 1233
837 Ga0207644_10398609 3300025931 Unclassified 1124
838 Ga0207644_10815338 3300025931 Bacteria 781
839 Ga0207690_10100295 3300025932 Bacteria 2066
840 Ga0207690_10206454 3300025932 Unclassified 1495
841 Ga0207706_10000108 3300025933 Bacteria 87903
842 Ga0207706_10001714 3300025933 Bacteria 21604
843 Ga0207706_10026004 3300025933 Bacteria 5241
844 Ga0207686_10070065 3300025934 Bacteria 2252
845 Ga0207686_10709915 3300025934 Bacteria 800
846 Ga0207670_10067098 3300025936 Bacteria 2467
847 Ga0207704_10017600 3300025938 Bacteria 3710
848 Ga0207704_10034342 3300025938 Bacteria 2893
849 Ga0207704_10056520 3300025938 Bacteria 2405
850 Ga0207704_10115328 3300025938 Unclassified 1825
851 Ga0207665_10010945 3300025939 Bacteria 5954
852 Ga0207665_10018667 3300025939 Bacteria 4556
853 Ga0207665_10028046 3300025939 Bacteria 3719
854 Ga0207665_10041938 3300025939 Bacteria 3058
855 Ga0207665_10138615 3300025939 Bacteria 1733
856 Ga0207665_10165911 3300025939 Bacteria 1592
857 Ga0207665_10173745 3300025939 Bacteria 1557
858 Ga0207665_10476214 3300025939 Bacteria 961
859 Ga0207691_10000280 3300025940 Bacteria 50497
860 Ga0207691_10012006 3300025940 Bacteria 8309
861 Ga0207691_10206089 3300025940 Bacteria 1710
862 Ga0207711_10004791 3300025941 Bacteria 11486
863 Ga0207711_10005368 3300025941 Bacteria 10853
864 Ga0207711_10006809 3300025941 Bacteria 9605
865 Ga0207711_10014595 3300025941 Bacteria 6528
866 Ga0207711_10016426 3300025941 Bacteria 6151
867 Ga0207711_10028247 3300025941 Bacteria 4720
868 Ga0207711_10355279 3300025941 Unclassified 1357
869 Ga0207689_10000068 3300025942 Bacteria 83861
870 Ga0207689_10000279 3300025942 Bacteria 46428
871 Ga0207689_10008300 3300025942 Bacteria 9049
872 Ga0207689_10061528 3300025942 Bacteria 3087
873 Ga0207689_10166388 3300025942 Bacteria 1817
874 Ga0207661_10000619 3300025944 Bacteria 22786
875 Ga0207661_10055561 3300025944 Bacteria 3176
876 Ga0207661_10063983 3300025944 Bacteria 2981
877 Ga0207661_10083177 3300025944 Bacteria 2648
878 Ga0207661_10096335 3300025944 Bacteria 2476
879 Ga0207661_10184458 3300025944 Unclassified 1825
880 Ga0207661_10227303 3300025944 Bacteria 1651
881 Ga0207661_10333233 3300025944 Unclassified 1366
882 Ga0207661_10553410 3300025944 Bacteria 1054
883 Ga0207661_10703975 3300025944 Bacteria 929
884 Ga0207679_10000089 3300025945 Bacteria 79512
885 Ga0207679_10009023 3300025945 Bacteria 6373
886 Ga0207679_10075049 3300025945 Bacteria 2564
887 Ga0207679_10399445 3300025945 Bacteria 1209
888 Ga0207679_10581799 3300025945 Bacteria 1007
889 Ga0207667_10000894 3300025949 Bacteria 37989
890 Ga0207667_10002624 3300025949 Bacteria 22252
891 Ga0207667_10002983 3300025949 Bacteria 21021
892 Ga0207667_10004094 3300025949 Bacteria 17913
893 Ga0207667_10051959 3300025949 Bacteria 4319
894 Ga0207667_10171266 3300025949 Bacteria 2231
895 Ga0207667_10465859 3300025949 Bacteria 1283
896 Ga0207667_10514484 3300025949 Bacteria 1213
897 Ga0207667_10544634 3300025949 Bacteria 1174
898 Ga0207667_10843700 3300025949 Bacteria 911
899 Ga0207651_10006120 3300025960 Bacteria 6254
900 Ga0207668_10000933 3300025972 Bacteria 17560
901 Ga0207668_10052050 3300025972 Unclassified 2832
902 Ga0207668_10174903 3300025972 Bacteria 1687
903 Ga0207640_10009050 3300025981 Bacteria 5557
904 Ga0207640_10017647 3300025981 Bacteria 4179
905 Ga0207640_10019761 3300025981 Bacteria 3986
906 Ga0207640_10049822 3300025981 Unclassified 2714
907 Ga0207640_10107918 3300025981 Bacteria 1966
908 Ga0207640_10218841 3300025981 Bacteria 1456
909 Ga0207658_10019740 3300025986 Bacteria 4661
910 Ga0207658_10024102 3300025986 Bacteria 4253
911 Ga0207658_10369217 3300025986 Bacteria 1254
912 Ga0207677_10002414 3300026023 Bacteria 9800
913 Ga0207677_10007316 3300026023 Bacteria 6096
914 Ga0207677_10013672 3300026023 Bacteria 4712
915 Ga0207677_10051738 3300026023 Bacteria 2786
916 Ga0207677_10107489 3300026023 Bacteria 2069
917 Ga0207677_10210196 3300026023 Bacteria 1553
918 Ga0207677_10614709 3300026023 Bacteria 955
919 Ga0207677_10883285 3300026023 Bacteria 805
920 Ga0207703_10002566 3300026035 Bacteria 15694
921 Ga0207703_10011107 3300026035 Bacteria 7013
922 Ga0207703_10017594 3300026035 Bacteria 5581
923 Ga0207703_10060587 3300026035 Bacteria 3095
924 Ga0207703_10065203 3300026035 Unclassified 2992
925 Ga0207703_10342696 3300026035 Bacteria 1374
926 Ga0207703_11875832 3300026035 Bacteria 575
927 Ga0207639_10000039 3300026041 Bacteria 143047
928 Ga0207639_10005601 3300026041 Bacteria 8498
929 Ga0207639_10027239 3300026041 Bacteria 4162
930 Ga0207639_10049320 3300026041 Bacteria 3192
931 Ga0207639_10055770 3300026041 Bacteria 3025
932 Ga0207639_10142493 3300026041 Unclassified 1998
933 Ga0207639_10175077 3300026041 Bacteria 1821
934 Ga0207639_10222753 3300026041 Bacteria 1630
935 Ga0207639_10497389 3300026041 Bacteria 1113
936 Ga0207639_10501812 3300026041 Bacteria 1109
937 Ga0207639_10813459 3300026041 Bacteria 871
938 Ga0207639_11201703 3300026041 Bacteria 712
939 Ga0207678_10001258 3300026067 Bacteria 23384
940 Ga0207678_10024576 3300026067 Bacteria 5262
941 Ga0207678_10035637 3300026067 Unclassified 4332
942 Ga0207678_10067605 3300026067 Bacteria 3067
943 Ga0207702_10001337 3300026078 Bacteria 24659
944 Ga0207702_10002152 3300026078 Bacteria 18929
945 Ga0207702_10033840 3300026078 Bacteria 4271
946 Ga0207702_10039228 3300026078 Bacteria 3967
947 Ga0207702_10056098 3300026078 Bacteria 3343
948 Ga0207702_10066241 3300026078 Bacteria 3095
949 Ga0207702_10157188 3300026078 Bacteria 2073
950 Ga0207702_10314314 3300026078 Bacteria 1490
951 Ga0207702_10374815 3300026078 Bacteria 1367
952 Ga0207702_10402669 3300026078 Bacteria 1320
953 Ga0207702_10538589 3300026078 Bacteria 1141
954 Ga0207702_11736992 3300026078 Unclassified 617
955 Ga0207641_10000020 3300026088 Bacteria 286415
956 Ga0207641_10026781 3300026088 Bacteria 4760
957 Ga0207641_10030451 3300026088 Unclassified 4470
958 Ga0207641_10037094 3300026088 Bacteria 4070
959 Ga0207648_10001305 3300026089 Bacteria 27759
960 Ga0207648_10113152 3300026089 Bacteria 2383
961 Ga0207648_10719560 3300026089 Bacteria 926
962 Ga0207676_10000108 3300026095 Bacteria 74129
963 Ga0207676_10008595 3300026095 Bacteria 7255
964 Ga0207674_10000512 3300026116 Bacteria 50807
965 Ga0207674_10000514 3300026116 Bacteria 50775
966 Ga0207674_10001113 3300026116 Bacteria 34899
967 Ga0207674_10002979 3300026116 Bacteria 21005
968 Ga0207674_10180886 3300026116 Bacteria 2060
969 Ga0207674_10613780 3300026116 Unclassified 1050
970 Ga0207674_11016191 3300026116 Bacteria 798
971 Ga0207675_100006587 3300026118 Bacteria 10988
972 Ga0207675_100115129 3300026118 Bacteria 2540
973 Ga0207675_100314635 3300026118 Unclassified 1527
974 Ga0207683_10000338 3300026121 Bacteria 42662
975 Ga0207683_10000901 3300026121 Bacteria 27353
976 Ga0207683_10169373 3300026121 Bacteria 1977
977 Ga0207698_10007174 3300026142 Bacteria 6979
978 Ga0207698_10022358 3300026142 Bacteria 4392
979 Ga0207698_10046373 3300026142 Bacteria 3281
980 Ga0207698_10086674 3300026142 Bacteria 2547
981 Ga0207698_10091660 3300026142 Bacteria 2488
982 Ga0207698_10093540 3300026142 Bacteria 2468
983 Ga0207698_10186809 3300026142 Bacteria 1841
984 Ga0207698_10251896 3300026142 Bacteria 1616
985 Ga0207698_11914477 3300026142 Unclassified 608
986 Ga0265356_1000089 3300028017 Bacteria 15437
987 Ga0265356_1004243 3300028017 Bacteria 1761
988 Ga0268266_10002727 3300028379 Bacteria 18521
989 Ga0268266_10025372 3300028379 Bacteria 5042
990 Ga0268266_10037812 3300028379 Bacteria 4109
991 Ga0268266_10163314 3300028379 Bacteria 2016
992 Ga0268266_10291347 3300028379 Bacteria 1520
993 Ga0268266_10597968 3300028379 Bacteria 1059
994 Ga0268265_10020295 3300028380 Bacteria 4636
995 Ga0268265_10051133 3300028380 Bacteria 3118
996 Ga0268265_10093200 3300028380 Bacteria 2412
997 Ga0268264_10049593 3300028381 Unclassified 3493
998 Ga0268264_10052779 3300028381 Bacteria 3390
999 Ga0268264_10211321 3300028381 Bacteria 1781
1000 Ga0268264_10211423 3300028381 Bacteria 1781
1001 Ga0268264_10302087 3300028381 Bacteria 1507
1002 Ga0265318_10083111 3300028577 Bacteria 1182
1003 Ga0265323_10044904 3300028653 Bacteria 1590
1004 Ga0265336_10000690 3300028666 Bacteria 18147
1005 Ga0265336_10020963 3300028666 Bacteria 2092
1006 Ga0265338_10003155 3300028800 Bacteria 23525
1007 Ga0265338_10004667 3300028800 Bacteria 18396
1008 Ga0265338_10013138 3300028800 Bacteria 9379
1009 Ga0265338_10100909 3300028800 Bacteria 2351
1010 Ga0265338_10109205 3300028800 Bacteria 2232
1011 Ga0265324_10056549 3300029957 Bacteria 1344
1012 Ga0265762_1000444 3300030760 Bacteria 7151
1013 Ga0265770_1047723 3300030878 Unclassified 767
1014 Ga0265761_107395 3300030889 Bacteria 600
1015 Ga0265760_10000657 3300031090 Bacteria 9832
1016 Ga0265760_10001080 3300031090 Bacteria 7914
1017 Ga0265760_10001419 3300031090 Bacteria 7053
1018 Ga0265760_10050308 3300031090 Bacteria 1254
1019 Ga0265760_10064283 3300031090 Bacteria 1119
1020 Ga0265330_10000773 3300031235 Bacteria 20088
1021 Ga0265330_10051884 3300031235 Bacteria 1797
1022 Ga0265330_10156639 3300031235 Bacteria 967
1023 Ga0265332_10003390 3300031238 Bacteria 7711
1024 Ga0265328_10001179 3300031239 Bacteria 12089
1025 Ga0265320_10037975 3300031240 Bacteria 2421
1026 Ga0265320_10163779 3300031240 Unclassified 1001
1027 Ga0265325_10002440 3300031241 Bacteria 12559
1028 Ga0265325_10003695 3300031241 Bacteria 9901
1029 Ga0265325_10007159 3300031241 Bacteria 6707
1030 Ga0265325_10024769 3300031241 Bacteria 3261
1031 Ga0265325_10057159 3300031241 Bacteria 1990
1032 Ga0265325_10095920 3300031241 Bacteria 1457
1033 Ga0265329_10007984 3300031242 Bacteria 4051
1034 Ga0265340_10003620 3300031247 Bacteria 8691
1035 Ga0265340_10009673 3300031247 Bacteria 5167
1036 Ga0265340_10019157 3300031247 Bacteria 3523
1037 Ga0265340_10097734 3300031247 Bacteria 1367
1038 Ga0265339_10000023 3300031249 Bacteria 169980
1039 Ga0265339_10000956 3300031249 Bacteria 22109
1040 Ga0265339_10032065 3300031249 Bacteria 2966
1041 Ga0265339_10048759 3300031249 Bacteria 2322
1042 Ga0265339_10059479 3300031249 Bacteria 2060
1043 Ga0265331_10023716 3300031250 Bacteria 3112
1044 Ga0265331_10250095 3300031250 Bacteria 795
1045 Ga0265316_10003318 3300031344 Bacteria 16311
1046 Ga0265316_10005538 3300031344 Bacteria 12247
1047 Ga0265316_10031564 3300031344 Bacteria 4330
1048 Ga0265316_10045139 3300031344 Bacteria 3501
1049 Ga0265316_10055070 3300031344 Bacteria 3113
1050 Ga0265316_10109174 3300031344 Bacteria 2097
1051 Ga0265316_10152502 3300031344 Unclassified 1731
1052 Ga0265316_10367435 3300031344 Bacteria 1039
1053 Ga0265316_10925666 3300031344 Bacteria 608
1054 Ga0265313_10003395 3300031595 Bacteria 12927
1055 Ga0265313_10009123 3300031595 Bacteria 6485
1056 Ga0265313_10055262 3300031595 Bacteria 1881
1057 Ga0265313_10110711 3300031595 Bacteria 1208
1058 Ga0265313_10181797 3300031595 Unclassified 883
1059 Ga0265314_10000920 3300031711 Bacteria 34667
1060 Ga0265314_10023696 3300031711 Bacteria 4673
1061 Ga0265314_10045585 3300031711 Bacteria 3099
1062 Ga0265314_10096051 3300031711 Bacteria 1918
1063 Ga0265342_10000246 3300031712 Bacteria 60721
1064 Ga0265342_10010606 3300031712 Bacteria 6372
1065 Ga0265342_10075291 3300031712 Bacteria 1959
1066 Ga0265342_10120238 3300031712 Bacteria 1480
1067 Ga0265342_10267784 3300031712 Bacteria 907
1068 Ga0316212_1011107 3300033547 Bacteria 1288
1069 Ga0373959_0084181 3300034820 Bacteria 737
1070 Ga0373938_0030968 3300034957 Bacteria 1145
1071 Ga0373926_0002357 3300035083 Bacteria 5988
1072 Ga0373934_0001891 3300035086 Bacteria 7682
1073 Ga0373934_0074375 3300035086 Bacteria 1361
1074 Ga0373940_0055364 3300035088 Bacteria 1123
1075 Ga0373944_0012527 3300035089 Bacteria 2339
1076 Ga0373923_0003850 3300035111 Bacteria 4885
1077 Ga0373923_0097680 3300035111 Bacteria 1292
1078 Ga0373923_0194678 3300035111 Bacteria 935
1079 Ga0373932_0071521 3300035112 Bacteria 1077
1080 Ga0373936_0003211 3300035113 Bacteria 6131
1081 Ga0373936_0008529 3300035113 Bacteria 3860
1082 Ga0373936_0047563 3300035113 Bacteria 1730
1083 Ga0373941_0022768 3300035115 Bacteria 1782
1084 Ga0373945_0001694 3300035116 Bacteria 6786
1085 Ga0373945_0127326 3300035116 Bacteria 1018
1086 Ga0373953_0092713 3300035117 Bacteria 1265
1087 Ga0373953_0165104 3300035117 Bacteria 952
1088 Ga0373954_0066770 3300035118 Bacteria 1703
1089 Ga0373954_0137140 3300035118 Bacteria 1193
1090 Ga0373954_0413441 3300035118 Bacteria 667
1091 Ga0373956_0026184 3300035119 Bacteria 2526
1092 Ga0373956_0041996 3300035119 Bacteria 2032
1093 Ga0373957_0046084 3300035120 Bacteria 1654
1094 Ga0373943_0016509 3300035170 Bacteria 3368
1095 Ga0373943_0225106 3300035170 Bacteria 1046
1096 Ga0373946_0026579 3300035171 Bacteria 2284
1097 Ga0373946_0072128 3300035171 Bacteria 1494
1098 Ga0373946_0319506 3300035171 Bacteria 771
1099 Ga0373955_0014842 3300035172 Bacteria 3801
1100 Ga0373955_0294895 3300035172 Bacteria 977
1101 Ga0373955_0402713 3300035172 Bacteria 832
1102 Ga0373942_0174181 3300035207 Bacteria 702
1103 Ga0373961_0118487 3300035241 Bacteria 875
1104 Ga0373962_0234035 3300035242 Bacteria 633
1105 Ga0373924_0038593 3300035410 Bacteria 1949
1106 Ga0373924_0057188 3300035410 Bacteria 1626
1107 Ga0373924_0105065 3300035410 Bacteria 1217
1108 Ga0373931_0012837 3300035691 Bacteria 4067
1109 Ga0373931_0055596 3300035691 Bacteria 2119
1110 Ga0373931_0122980 3300035691 Bacteria 1485
1111 Ga0373931_0402983 3300035691 Bacteria 866
1112 Ga0373935_0000635 3300035692 Bacteria 18475
1113 Ga0373935_0068571 3300035692 Unclassified 2282
1114 Ga0373935_0234625 3300035692 Bacteria 1279
1115 Ga0373935_0435370 3300035692 Bacteria 945
1116 Ga0373927_0000129 3300035695 Bacteria 57926
1117 Ga0373927_0001713 3300035695 Bacteria 16383
1118 Ga0373927_0021495 3300035695 Bacteria 4230
1119 Ga0373927_0326999 3300035695 Bacteria 1010
1120 Ga0373933_0010474 3300035724 Bacteria 5084
1121 Ga0373933_0023540 3300035724 Bacteria 3520
1122 Ga0373933_0027412 3300035724 Bacteria 3280
1123 Ga0373933_0035020 3300035724 Unclassified 2930
1124 Ga0373933_0349245 3300035724 Bacteria 961
1125 Ga0373947_0001395 3300035725 Bacteria 14864
1126 Ga0373947_0029480 3300035725 Bacteria 3220
1127 Ga0373947_0034325 3300035725 Bacteria 3000
1128 Ga0373947_0132243 3300035725 Bacteria 1594
1129 Ga0373947_0177063 3300035725 Bacteria 1387
1130 Ga0373937_0000026 3300036401 Bacteria 124071
1131 Ga0373937_0006803 3300036401 Bacteria 9867
1132 Ga0373937_0042418 3300036401 Bacteria 4151
1133 Ga0373937_0048394 3300036401 Bacteria 3892
1134 Ga0373937_0181400 3300036401 Bacteria 1977
1135 Ga0373937_0398267 3300036401 Bacteria 1306
1136 Ga0373937_0493545 3300036401 Bacteria 1163
1137 Ga0373937_0508147 3300036401 Bacteria 1145
1138 Ga0373937_1216903 3300036401 Unclassified 702
1139 Ga0373925_0016669 3300037068 Bacteria 5321
1140 Ga0373925_0042992 3300037068 Bacteria 3352
1141 Ga0373925_0120081 3300037068 Bacteria 2040
1142 Ga0395898_0556310 3300037466 Bacteria 1089
1143 Ga0395905_0183081 3300037471 Unclassified 1967
1144 Ga0436365_0917558 3300039437 Bacteria 3078
1145 Ga0436360_0636776 3300039438 Bacteria 1119
1146 Ga0436360_1008501 3300039438 Bacteria 1177
1147 Ga0436360_1036143 3300039438 Bacteria 11353
1148 Ga0436360_1342551 3300039438 Bacteria 2080
1149 Ga0436361_0038755 3300039447 Bacteria 48544
1150 Ga0436361_0061101 3300039447 Bacteria 18221
1151 Ga0436361_0581985 3300039447 Bacteria 1803
1152 Ga0436361_0937014 3300039447 Bacteria 923
1153 Ga0436363_0438067 3300039450 Unclassified 731
1154 Ga0451839_0203465 3300041496 Bacteria 888
1155 Ga0451577_0000334 3300042876 Bacteria 87832
1156 Ga0466969_0030079 3300044656 Bacteria 2769
1157 Ga0453683_0027092 3300044673 Bacteria 3639
1158 Ga0453683_0034678 3300044673 Bacteria 3181
1159 Ga0466961_0052368 3300044693 Bacteria 2605
1160 Ga0466963_0003711 3300044694 Bacteria 8780
1161 Ga0466963_0011178 3300044694 Bacteria 5462
1162 Ga0466963_0041850 3300044694 Bacteria 3006
1163 Ga0453684_0000429 3300044712 Bacteria 171513
1164 Ga0453684_0231671 3300044712 Bacteria 2132
1165 Ga0466968_0519656 3300044735 Bacteria 595
1166 Ga0466957_0092402 3300044842 Bacteria 1898
1167 Ga0466957_0803115 3300044842 Bacteria 668
1168 Ga0466959_0091061 3300045049 Bacteria 2190
1169 Ga0466959_0279844 3300045049 Unclassified 1145
1170 Ga0451576_0027033 3300045051 Bacteria 6166
1171 Ga0451576_0046090 3300045051 Bacteria 4591
1172 Ga0451576_0330742 3300045051 Bacteria 1595
1173 Ga0451576_0735149 3300045051 Bacteria 1037
1174 Ga0466958_0568379 3300045836 Bacteria 737
1175 Ga0466967_0005265 3300045976 Bacteria 8920
1176 Ga0466967_0014407 3300045976 Bacteria 6157
1177 Ga0466967_0014854 3300045976 Bacteria 6085
1178 Ga0466967_0100642 3300045976 Unclassified 2641
1179 Ga0466967_0365244 3300045976 Bacteria 1399
1180 Ga0495590_0055420 3300046457 Unclassified 1385
1181 Ga0495629_0253557 3300046459 Bacteria 1210
1182 Ga0495651_0271800 3300046462 Bacteria 1149
1183 Ga0495651_0325550 3300046462 Unclassified 1023
1184 Ga0495651_0654993 3300046462 Bacteria 658
1185 Ga0495580_0000205 3300046472 Bacteria 45568
1186 Ga0495580_0027377 3300046472 Bacteria 4148
1187 Ga0495580_0030976 3300046472 Bacteria 3868
1188 Ga0495580_0033882 3300046472 Bacteria 3678
1189 Ga0495580_0044870 3300046472 Bacteria 3143
1190 Ga0495580_0047100 3300046472 Bacteria 3057
1191 Ga0495580_0066793 3300046472 Bacteria 2517
1192 Ga0495580_0092557 3300046472 Bacteria 2104
1193 Ga0495580_0184812 3300046472 Unclassified 1439
1194 Ga0495580_0210050 3300046472 Bacteria 1339
1195 Ga0495580_0311994 3300046472 Unclassified 1070
1196 Ga0495580_0600732 3300046472 Unclassified 727
1197 Ga0495582_0001193 3300046473 Bacteria 14634
1198 Ga0495664_0247664 3300046477 Bacteria 1078
1199 Ga0495584_0174954 3300046491 Unclassified 1091
1200 Ga0495608_0083196 3300046511 Bacteria 2078
1201 Ga0495630_0079346 3300046517 Bacteria 2476
1202 Ga0495630_0089158 3300046517 Unclassified 2330
1203 Ga0495630_0462374 3300046517 Bacteria 972
1204 Ga0495652_0069992 3300046529 Bacteria 2935
1205 Ga0495652_0117031 3300046529 Bacteria 2133
1206 Ga0495652_0230675 3300046529 Bacteria 1385
1207 Ga0495665_0038406 3300046531 Unclassified 2553
1208 Ga0495665_0262145 3300046531 Bacteria 889
1209 Ga0495665_0506843 3300046531 Bacteria 608
1210 Ga0495587_0051708 3300046536 Bacteria 2428
1211 Ga0495587_0152561 3300046536 Bacteria 1317
1212 Ga0495587_0367482 3300046536 Bacteria 801
1213 Ga0495587_0535483 3300046536 Unclassified 647
1214 Ga0495645_0364012 3300046543 Unclassified 929
1215 Ga0495635_0276839 3300046663 Bacteria 1128
1216 Ga0495635_0305265 3300046663 Bacteria 1067
1217 Ga0495588_0275236 3300046674 Bacteria 887
1218 Ga0495623_0075012 3300046679 Unclassified 2101
1219 Ga0495623_0198361 3300046679 Bacteria 1155
1220 Ga0495623_0443095 3300046679 Bacteria 693
1221 Ga0495646_0208705 3300046680 Bacteria 1061
1222 Ga0495658_0509085 3300046683 Bacteria 770
1223 Ga0495613_0149539 3300046689 Bacteria 1666
1224 Ga0495624_0335881 3300046690 Bacteria 909
1225 Ga0495624_0501738 3300046690 Bacteria 726
1226 Ga0495581_0092987 3300047315 Bacteria 1750
1227 Ga0495581_0102040 3300047315 Bacteria 1667
1228 Ga0495674_0056217 3300047319 Bacteria 3448
1229 Ga0495674_0088956 3300047319 Bacteria 2640
1230 Ga0495676_0153372 3300047321 Bacteria 1637
1231 Ga0495675_0095348 3300047444 Bacteria 1865
1232 Ga0495675_0129950 3300047444 Bacteria 1566
1233 Ga0495675_0516537 3300047444 Bacteria 684
1234 Ga0495684_0761296 3300047471 Bacteria 636
1235 Ga0495593_0200586 3300047673 Bacteria 1003
1236 Ga0495602_0021528 3300048088 Bacteria 6343
1237 Ga0495602_0084417 3300048088 Bacteria 2657
1238 Ga0495602_0109196 3300048088 Bacteria 2251
1239 Ga0495602_0164898 3300048088 Bacteria 1726
1240 Ga0495602_0187691 3300048088 Bacteria 1588
1241 Ga0496100_0049155 3300048903 Bacteria 2726
1242 Ga0496100_0263859 3300048903 Bacteria 1278
1243 Ga0496100_0299268 3300048903 Bacteria 1204
1244 Ga0496100_0362859 3300048903 Bacteria 1096
1245 Ga0496100_0778061 3300048903 Bacteria 749
1246 Ga0496101_0330883 3300048904 Bacteria 1196
1247 Ga0496101_0398031 3300048904 Bacteria 1084
1248 Ga0496101_0966658 3300048904 Unclassified 670
1249 Ga0496102_0021508 3300048905 Bacteria 5705
1250 Ga0496102_0025853 3300048905 Bacteria 5230
1251 Ga0496102_0131874 3300048905 Bacteria 2340
1252 Ga0496102_0144522 3300048905 Bacteria 2231
1253 Ga0496102_0332665 3300048905 Bacteria 1430
1254 Ga0496102_0473300 3300048905 Bacteria 1174
1255 Ga0496103_0014424 3300048906 Bacteria 4691
1256 Ga0496103_0019906 3300048906 Bacteria 4030
1257 Ga0496103_0349340 3300048906 Bacteria 951
1258 Ga0496103_0415392 3300048906 Bacteria 864
1259 Ga0496104_0006973 3300048907 Bacteria 9965
1260 Ga0496104_0008836 3300048907 Bacteria 8957
1261 Ga0496104_0047108 3300048907 Bacteria 4062
1262 Ga0496104_0058232 3300048907 Bacteria 3657
1263 Ga0496104_0180160 3300048907 Bacteria 2023
1264 Ga0496104_0306233 3300048907 Bacteria 1501
1265 Ga0496104_0585365 3300048907 Bacteria 1026
1266 Ga0496104_0667363 3300048907 Unclassified 948
1267 Ga0496105_0463964 3300048908 Unclassified 998
1268 Ga0496105_0731221 3300048908 Bacteria 757
1269 Ga0496106_0012270 3300048909 Bacteria 6325
1270 Ga0496106_0045170 3300048909 Bacteria 3309
1271 Ga0496106_0083956 3300048909 Bacteria 2450
1272 Ga0496106_0090384 3300048909 Bacteria 2363
1273 Ga0496106_0402577 3300048909 Unclassified 1100
1274 Ga0496106_0408041 3300048909 Bacteria 1092
1275 Ga0496106_0830185 3300048909 Bacteria 732
1276 Ga0496107_0107228 3300048910 Bacteria 2052
1277 Ga0496107_0818732 3300048910 Bacteria 681
1278 Ga0496108_0000215 3300048911 Bacteria 52714
1279 Ga0496109_0000018 3300048912 Bacteria 191977
1280 Ga0496109_0021295 3300048912 Bacteria 5732
1281 Ga0496109_0075051 3300048912 Bacteria 3109
1282 Ga0496110_0001385 3300048913 Bacteria 17494
1283 Ga0496110_0013034 3300048913 Bacteria 6857
1284 Ga0496110_0296417 3300048913 Bacteria 1473
1285 Ga0496111_0008136 3300048914 Bacteria 6929
1286 Ga0496111_0047840 3300048914 Bacteria 3080
1287 Ga0496111_0163931 3300048914 Unclassified 1651
1288 Ga0496111_0384509 3300048914 Bacteria 1038
1289 Ga0496112_0000248 3300048915 Bacteria 34475
1290 Ga0496112_0004294 3300048915 Bacteria 12037
1291 Ga0496112_0008088 3300048915 Bacteria 9391
1292 Ga0496112_0013775 3300048915 Bacteria 7479
1293 Ga0496112_0025914 3300048915 Bacteria 5635
1294 Ga0496112_0036283 3300048915 Bacteria 4809
1295 Ga0496112_0075002 3300048915 Bacteria 3345
1296 Ga0496112_0107651 3300048915 Bacteria 2758
1297 Ga0496112_0162792 3300048915 Bacteria 2197
1298 Ga0496112_0168272 3300048915 Bacteria 2157
1299 Ga0496112_0559524 3300048915 Unclassified 1077
1300 Ga0496112_0857752 3300048915 Unclassified 831
1301 Ga0496112_1110656 3300048915 Bacteria 709
1302 Ga0496112_1379769 3300048915 Bacteria 619
1303 Ga0496113_0000297 3300048916 Bacteria 23541
1304 Ga0496113_0009290 3300048916 Bacteria 6449
1305 Ga0496113_0266319 3300048916 Bacteria 1369
1306 Ga0496113_0287917 3300048916 Bacteria 1314
1307 Ga0496113_0411395 3300048916 Bacteria 1086
1308 Ga0496113_1195498 3300048916 Bacteria 594
1309 Ga0496114_0034080 3300048917 Bacteria 4199
1310 Ga0496114_0653956 3300048917 Unclassified 924
1311 Ga0496115_0021813 3300048918 Bacteria 4951
1312 Ga0496115_0039205 3300048918 Bacteria 3761
1313 Ga0496115_0061029 3300048918 Unclassified 3039
1314 Ga0496115_0273053 3300048918 Bacteria 1389
1315 Ga0496115_0471330 3300048918 Bacteria 1012
1316 Ga0496120_0298142 3300048923 Bacteria 739
1317 Ga0496126_0000018 3300048929 Bacteria 581170
1318 Ga0496126_0005215 3300048929 Bacteria 14995
1319 Ga0495682_0106806 3300049460 Bacteria 1003
1320 Ga0495682_0157956 3300049460 Bacteria 808
1321 Ga0501067_0050464 3300049583 Bacteria 2306
1322 Ga0501067_0096834 3300049583 Unclassified 1639
1323 Ga0501067_0223044 3300049583 Unclassified 1050
1324 Ga0501073_0067240 3300049589 Bacteria 2498
1325 Ga0501077_0480392 3300049593 Bacteria 796
1326 nmdc:mga05p37_291762_c1 3300050507 Bacteria 1941
1327 nmdc:mga05p37_45380_c1 3300050507 Bacteria 5405
1328 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
1329 nmdc:mga0n895_220843_c1 3300050512 Bacteria 1924
1330 nmdc:mga0n895_5895_c1 3300050512 Bacteria 10298
1331 nmdc:mga0rr50_110_c1 3300050513 Bacteria 20297
1332 nmdc:mga0rr50_122804_c1 3300050513 Bacteria 2069
1333 nmdc:mga0rr50_489156_c1 3300050513 Bacteria 1045
1334 nmdc:mga0rr50_844412_c1 3300050513 Unclassified 781
1335 nmdc:mga08x19_136557_c1 3300050514 Bacteria 1654
1336 nmdc:mga08x19_2079_c1 3300050514 Bacteria 12247
1337 nmdc:mga08x19_51372_c1 3300050514 Bacteria 2648
1338 nmdc:mga08x19_51721_c1 3300050514 Bacteria 2640
1339 nmdc:mga08x19_53017_c1 3300050514 Bacteria 2609
1340 nmdc:mga08x19_5766_c1 3300050514 Bacteria 7322
1341 nmdc:mga08x19_847256_c1 3300050514 Bacteria 649
1342 nmdc:mga08x19_94853_c1 3300050514 Bacteria 1973
1343 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
1344 nmdc:mga0a205_924037_c1 3300050515 Unclassified 719
1345 Ga0495601_0124129 3300053077 Unclassified 1679
1346 Ga0495601_0154737 3300053077 Bacteria 1497
1347 Ga0495595_0099139 3300053084 Bacteria 1405
1348 Ga0495619_0148361 3300053085 Bacteria 1617
1349 Ga0501084_0061125 3300054114 Bacteria 3154

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026041 Ga0207639_10813459 Ga0207639_108134592 160
2 3300005435 Ga0070714_100576065 Ga0070714_1005760652 166
3 3300005436 Ga0070713_100749890 Ga0070713_1007498901 166
4 3300005614 Ga0068856_100129227 Ga0068856_1001292272 166
5 3300006028 Ga0070717_10304165 Ga0070717_103041652 166
6 3300025929 Ga0207664_10127594 Ga0207664_101275943 166
7 3300013296 Ga0157374_10010724 Ga0157374_100107244 168
8 3300005329 Ga0070683_100230143 Ga0070683_1002301433 169
9 3300005336 Ga0070680_100060507 Ga0070680_1000605072 169
10 3300005458 Ga0070681_10040232 Ga0070681_100402324 169
11 3300005530 Ga0070679_100059605 Ga0070679_1000596053 169
12 3300005563 Ga0068855_100277503 Ga0068855_1002775032 169
13 3300005563 Ga0068855_100444382 Ga0068855_1004443822 169
14 3300005563 Ga0068855_100789944 Ga0068855_1007899442 169
15 3300005577 Ga0068857_100052049 Ga0068857_1000520494 169
16 3300009093 Ga0105240_10477386 Ga0105240_104773862 169
17 3300013105 Ga0157369_10934693 Ga0157369_109346931 169
18 3300025912 Ga0207707_10078851 Ga0207707_100788514 169
19 3300025913 Ga0207695_10047498 Ga0207695_100474984 169
20 3300025913 Ga0207695_10394208 Ga0207695_103942081 169
21 3300025944 Ga0207661_10184458 Ga0207661_101844582 169
22 3300026078 Ga0207702_10402669 Ga0207702_104026692 169
23 3300026116 Ga0207674_10180886 Ga0207674_101808862 169
24 3300005336 Ga0070680_100053210 Ga0070680_1000532102 170
25 3300005339 Ga0070660_100003383 Ga0070660_1000033836 170
26 3300005458 Ga0070681_10051712 Ga0070681_100517122 170
27 3300005535 Ga0070684_100657075 Ga0070684_1006570752 170
28 3300005563 Ga0068855_100523960 Ga0068855_1005239603 170
29 3300005616 Ga0068852_100002133 Ga0068852_1000021334 170
30 3300009093 Ga0105240_10048681 Ga0105240_100486813 170
31 3300009545 Ga0105237_10217058 Ga0105237_102170582 170
32 3300009551 Ga0105238_10013303 Ga0105238_100133035 170
33 3300013102 Ga0157371_10008669 Ga0157371_100086694 170
34 3300013104 Ga0157370_10028648 Ga0157370_100286483 170
35 3300013105 Ga0157369_10100090 Ga0157369_101000903 170
36 3300013307 Ga0157372_10005384 Ga0157372_100053843 170
37 3300021361 Ga0213872_10035895 Ga0213872_100358953 170
38 3300025909 Ga0207705_10288388 Ga0207705_102883882 170
39 3300025917 Ga0207660_10310981 Ga0207660_103109812 170
40 3300025919 Ga0207657_10001099 Ga0207657_100010996 170
41 3300025924 Ga0207694_10401177 Ga0207694_104011772 170
42 3300026142 Ga0207698_10251896 Ga0207698_102518962 170
43 3300039447 Ga0436361_0061101 Ga0436361_0061101_14941_15453 170
44 3300013307 Ga0157372_10924513 Ga0157372_109245132 171
45 3300048909 Ga0496106_0402577 Ga0496106_0402577_406_921 171
46 3300048918 Ga0496115_0061029 Ga0496115_0061029_432_947 171
47 3300009553 Ga0105249_10284497 Ga0105249_102844971 172
48 3300014968 Ga0157379_10099678 Ga0157379_100996782 173
49 3300035724 Ga0373933_0349245 Ga0373933_0349245_52_579 175
50 3300026023 Ga0207677_10883285 Ga0207677_108832851 176
51 3300000546 LJNas_1000065 LJNas_10000658 178
52 3300001976 JGI24752J21851_1000229 JGI24752J21851_10002295 178
53 3300002074 JGI24748J21848_1007642 JGI24748J21848_10076422 178
54 3300002459 JGI24751J29686_10003136 JGI24751J29686_100031363 178
55 3300004803 Ga0058862_12892892 Ga0058862_128928921 178
56 3300005293 Ga0065715_10001009 Ga0065715_100010096 178
57 3300005327 Ga0070658_10029704 Ga0070658_100297044 178
58 3300005328 Ga0070676_10040855 Ga0070676_100408553 178
59 3300005329 Ga0070683_100059266 Ga0070683_1000592663 178
60 3300005329 Ga0070683_100352260 Ga0070683_1003522602 178
61 3300005329 Ga0070683_100667247 Ga0070683_1006672472 178
62 3300005329 Ga0070683_101134218 Ga0070683_1011342181 178
63 3300005330 Ga0070690_100035044 Ga0070690_1000350443 178
64 3300005330 Ga0070690_100112359 Ga0070690_1001123592 178
65 3300005330 Ga0070690_100509145 Ga0070690_1005091451 178
66 3300005331 Ga0070670_100029442 Ga0070670_1000294423 178
67 3300005331 Ga0070670_100506824 Ga0070670_1005068242 178
68 3300005333 Ga0070677_10002757 Ga0070677_100027574 178
69 3300005334 Ga0068869_100049894 Ga0068869_1000498945 178
70 3300005334 Ga0068869_100595052 Ga0068869_1005950522 178
71 3300005335 Ga0070666_10058994 Ga0070666_100589943 178
72 3300005336 Ga0070680_100003035 Ga0070680_10000303516 178
73 3300005336 Ga0070680_100061282 Ga0070680_1000612824 178
74 3300005336 Ga0070680_100138915 Ga0070680_1001389152 178
75 3300005336 Ga0070680_100159346 Ga0070680_1001593461 178
76 3300005336 Ga0070680_100287418 Ga0070680_1002874182 178
77 3300005336 Ga0070680_100349779 Ga0070680_1003497793 178
78 3300005337 Ga0070682_100013400 Ga0070682_1000134005 178
79 3300005337 Ga0070682_100072059 Ga0070682_1000720591 178
80 3300005337 Ga0070682_100222517 Ga0070682_1002225171 178
81 3300005338 Ga0068868_100003810 Ga0068868_1000038102 178
82 3300005338 Ga0068868_100004803 Ga0068868_1000048035 178
83 3300005338 Ga0068868_100037951 Ga0068868_1000379513 178
84 3300005338 Ga0068868_100039208 Ga0068868_1000392082 178
85 3300005338 Ga0068868_100039267 Ga0068868_1000392674 178
86 3300005338 Ga0068868_100041287 Ga0068868_1000412874 178
87 3300005338 Ga0068868_100163942 Ga0068868_1001639423 178
88 3300005339 Ga0070660_100025220 Ga0070660_1000252207 178
89 3300005339 Ga0070660_100035373 Ga0070660_1000353735 178
90 3300005339 Ga0070660_100142536 Ga0070660_1001425362 178
91 3300005340 Ga0070689_100503710 Ga0070689_1005037102 178
92 3300005344 Ga0070661_100011272 Ga0070661_1000112723 178
93 3300005344 Ga0070661_100018686 Ga0070661_1000186863 178
94 3300005344 Ga0070661_100020921 Ga0070661_1000209217 178
95 3300005344 Ga0070661_100078408 Ga0070661_1000784082 178
96 3300005344 Ga0070661_100176040 Ga0070661_1001760402 178
97 3300005344 Ga0070661_100299480 Ga0070661_1002994802 178
98 3300005344 Ga0070661_100398265 Ga0070661_1003982652 178
99 3300005344 Ga0070661_100451503 Ga0070661_1004515032 178
100 3300005347 Ga0070668_100020921 Ga0070668_1000209217 178
101 3300005347 Ga0070668_100022722 Ga0070668_1000227223 178
102 3300005347 Ga0070668_100033009 Ga0070668_1000330094 178
103 3300005353 Ga0070669_100099646 Ga0070669_1000996462 178
104 3300005353 Ga0070669_100227806 Ga0070669_1002278062 178
105 3300005354 Ga0070675_100024325 Ga0070675_1000243255 178
106 3300005354 Ga0070675_100126857 Ga0070675_1001268573 178
107 3300005355 Ga0070671_100086792 Ga0070671_1000867922 178
108 3300005355 Ga0070671_100227797 Ga0070671_1002277971 178
109 3300005355 Ga0070671_100629480 Ga0070671_1006294802 178
110 3300005364 Ga0070673_100026626 Ga0070673_1000266265 178
111 3300005364 Ga0070673_100070899 Ga0070673_1000708991 178
112 3300005364 Ga0070673_100173191 Ga0070673_1001731912 178
113 3300005365 Ga0070688_100004792 Ga0070688_1000047927 178
114 3300005365 Ga0070688_100387794 Ga0070688_1003877941 178
115 3300005366 Ga0070659_100006817 Ga0070659_1000068177 178
116 3300005366 Ga0070659_100522563 Ga0070659_1005225631 178
117 3300005366 Ga0070659_100704687 Ga0070659_1007046872 178
118 3300005367 Ga0070667_100065072 Ga0070667_1000650723 178
119 3300005367 Ga0070667_100354301 Ga0070667_1003543012 178
120 3300005434 Ga0070709_10004241 Ga0070709_100042412 178
121 3300005434 Ga0070709_10007723 Ga0070709_100077235 178
122 3300005434 Ga0070709_10010229 Ga0070709_100102295 178
123 3300005434 Ga0070709_10011412 Ga0070709_100114123 178
124 3300005434 Ga0070709_10019249 Ga0070709_100192491 178
125 3300005434 Ga0070709_10062899 Ga0070709_100628993 178
126 3300005434 Ga0070709_10127707 Ga0070709_101277072 178
127 3300005434 Ga0070709_10322920 Ga0070709_103229202 178
128 3300005435 Ga0070714_100000194 Ga0070714_10000019442 178
129 3300005435 Ga0070714_100012321 Ga0070714_1000123216 178
130 3300005435 Ga0070714_100035323 Ga0070714_1000353233 178
131 3300005435 Ga0070714_100182062 Ga0070714_1001820622 178
132 3300005435 Ga0070714_100246963 Ga0070714_1002469632 178
133 3300005435 Ga0070714_100262459 Ga0070714_1002624592 178
134 3300005435 Ga0070714_100280287 Ga0070714_1002802872 178
135 3300005435 Ga0070714_100280315 Ga0070714_1002803151 178
136 3300005435 Ga0070714_100354173 Ga0070714_1003541732 178
137 3300005435 Ga0070714_100710510 Ga0070714_1007105101 178
138 3300005435 Ga0070714_101444903 Ga0070714_1014449031 178
139 3300005436 Ga0070713_100000207 Ga0070713_1000002074 178
140 3300005436 Ga0070713_100003636 Ga0070713_10000363611 178
141 3300005436 Ga0070713_100011854 Ga0070713_1000118545 178
142 3300005436 Ga0070713_100014622 Ga0070713_1000146225 178
143 3300005436 Ga0070713_100026153 Ga0070713_1000261532 178
144 3300005436 Ga0070713_100029543 Ga0070713_1000295432 178
145 3300005436 Ga0070713_100031562 Ga0070713_1000315622 178
146 3300005436 Ga0070713_100100072 Ga0070713_1001000726 178
147 3300005436 Ga0070713_100318498 Ga0070713_1003184982 178
148 3300005436 Ga0070713_100336257 Ga0070713_1003362572 178
149 3300005436 Ga0070713_100482193 Ga0070713_1004821931 178
150 3300005436 Ga0070713_100525483 Ga0070713_1005254831 178
151 3300005436 Ga0070713_101491453 Ga0070713_1014914531 178
152 3300005436 Ga0070713_101634139 Ga0070713_1016341391 178
153 3300005437 Ga0070710_10038518 Ga0070710_100385184 178
154 3300005437 Ga0070710_10122586 Ga0070710_101225862 178
155 3300005437 Ga0070710_10192248 Ga0070710_101922482 178
156 3300005437 Ga0070710_10198533 Ga0070710_101985332 178
157 3300005438 Ga0070701_10031168 Ga0070701_100311681 178
158 3300005439 Ga0070711_100000521 Ga0070711_1000005219 178
159 3300005439 Ga0070711_100010512 Ga0070711_1000105125 178
160 3300005439 Ga0070711_100015972 Ga0070711_1000159721 178
161 3300005439 Ga0070711_100129930 Ga0070711_1001299302 178
162 3300005439 Ga0070711_100255471 Ga0070711_1002554713 178
163 3300005439 Ga0070711_100432065 Ga0070711_1004320651 178
164 3300005439 Ga0070711_100790417 Ga0070711_1007904172 178
165 3300005440 Ga0070705_100232743 Ga0070705_1002327432 178
166 3300005440 Ga0070705_100411626 Ga0070705_1004116262 178
167 3300005441 Ga0070700_100287123 Ga0070700_1002871231 178
168 3300005445 Ga0070708_100000219 Ga0070708_10000021913 178
169 3300005445 Ga0070708_100002478 Ga0070708_10000247815 178
170 3300005445 Ga0070708_100009535 Ga0070708_1000095352 178
171 3300005445 Ga0070708_100019633 Ga0070708_1000196337 178
172 3300005445 Ga0070708_100091546 Ga0070708_1000915462 178
173 3300005445 Ga0070708_100150591 Ga0070708_1001505912 178
174 3300005445 Ga0070708_100153634 Ga0070708_1001536341 178
175 3300005445 Ga0070708_100179898 Ga0070708_1001798983 178
176 3300005445 Ga0070708_100262820 Ga0070708_1002628202 178
177 3300005445 Ga0070708_100321337 Ga0070708_1003213371 178
178 3300005455 Ga0070663_100042890 Ga0070663_1000428903 178
179 3300005455 Ga0070663_100046950 Ga0070663_1000469502 178
180 3300005457 Ga0070662_100013709 Ga0070662_1000137093 178
181 3300005457 Ga0070662_100024443 Ga0070662_1000244435 178
182 3300005457 Ga0070662_100123816 Ga0070662_1001238162 178
183 3300005458 Ga0070681_10000241 Ga0070681_1000024134 178
184 3300005458 Ga0070681_10002945 Ga0070681_100029453 178
185 3300005458 Ga0070681_10051457 Ga0070681_100514575 178
186 3300005458 Ga0070681_10080710 Ga0070681_100807103 178
187 3300005458 Ga0070681_10173831 Ga0070681_101738312 178
188 3300005458 Ga0070681_10221492 Ga0070681_102214922 178
189 3300005458 Ga0070681_10267502 Ga0070681_102675022 178
190 3300005458 Ga0070681_10273130 Ga0070681_102731301 178
191 3300005458 Ga0070681_10352931 Ga0070681_103529312 178
192 3300005458 Ga0070681_10439521 Ga0070681_104395212 178
193 3300005458 Ga0070681_10514218 Ga0070681_105142182 178
194 3300005458 Ga0070681_10674060 Ga0070681_106740601 178
195 3300005458 Ga0070681_10853020 Ga0070681_108530202 178
196 3300005458 Ga0070681_10937869 Ga0070681_109378691 178
197 3300005459 Ga0068867_100012609 Ga0068867_1000126092 178
198 3300005459 Ga0068867_100080359 Ga0068867_1000803593 178
199 3300005466 Ga0070685_10002057 Ga0070685_100020575 178
200 3300005466 Ga0070685_10110754 Ga0070685_101107542 178
201 3300005467 Ga0070706_100001249 Ga0070706_10000124920 178
202 3300005467 Ga0070706_100005510 Ga0070706_1000055103 178
203 3300005467 Ga0070706_100042155 Ga0070706_1000421553 178
204 3300005467 Ga0070706_100143551 Ga0070706_1001435512 178
205 3300005467 Ga0070706_100195407 Ga0070706_1001954072 178
206 3300005467 Ga0070706_100283917 Ga0070706_1002839172 178
207 3300005467 Ga0070706_100844491 Ga0070706_1008444912 178
208 3300005467 Ga0070706_101064839 Ga0070706_1010648391 178
209 3300005468 Ga0070707_100016693 Ga0070707_1000166938 178
210 3300005468 Ga0070707_100024246 Ga0070707_1000242464 178
211 3300005468 Ga0070707_100060143 Ga0070707_1000601431 178
212 3300005468 Ga0070707_100073240 Ga0070707_1000732403 178
213 3300005468 Ga0070707_100098432 Ga0070707_1000984323 178
214 3300005468 Ga0070707_100230813 Ga0070707_1002308133 178
215 3300005468 Ga0070707_100551719 Ga0070707_1005517192 178
216 3300005471 Ga0070698_100000091 Ga0070698_10000009122 178
217 3300005471 Ga0070698_100009320 Ga0070698_1000093208 178
218 3300005471 Ga0070698_100343454 Ga0070698_1003434542 178
219 3300005471 Ga0070698_100479186 Ga0070698_1004791862 178
220 3300005518 Ga0070699_100000177 Ga0070699_10000017747 178
221 3300005518 Ga0070699_100017251 Ga0070699_1000172513 178
222 3300005518 Ga0070699_100030687 Ga0070699_1000306877 178
223 3300005530 Ga0070679_100003532 Ga0070679_1000035324 178
224 3300005530 Ga0070679_100011138 Ga0070679_1000111383 178
225 3300005530 Ga0070679_100015241 Ga0070679_1000152415 178
226 3300005530 Ga0070679_100080307 Ga0070679_1000803071 178
227 3300005530 Ga0070679_100258415 Ga0070679_1002584151 178
228 3300005530 Ga0070679_100287232 Ga0070679_1002872323 178
229 3300005530 Ga0070679_100300511 Ga0070679_1003005113 178
230 3300005530 Ga0070679_101158581 Ga0070679_1011585811 178
231 3300005535 Ga0070684_100005322 Ga0070684_1000053224 178
232 3300005535 Ga0070684_100056787 Ga0070684_1000567871 178
233 3300005535 Ga0070684_100130489 Ga0070684_1001304892 178
234 3300005535 Ga0070684_100270822 Ga0070684_1002708222 178
235 3300005535 Ga0070684_100804461 Ga0070684_1008044611 178
236 3300005535 Ga0070684_100918007 Ga0070684_1009180072 178
237 3300005536 Ga0070697_100000324 Ga0070697_10000032428 178
238 3300005536 Ga0070697_100000727 Ga0070697_10000072722 178
239 3300005536 Ga0070697_100000728 Ga0070697_1000007286 178
240 3300005536 Ga0070697_100001046 Ga0070697_10000104615 178
241 3300005536 Ga0070697_100028320 Ga0070697_1000283203 178
242 3300005536 Ga0070697_100079637 Ga0070697_1000796372 178
243 3300005536 Ga0070697_100144813 Ga0070697_1001448132 178
244 3300005536 Ga0070697_100281054 Ga0070697_1002810542 178
245 3300005536 Ga0070697_100779099 Ga0070697_1007790992 178
246 3300005536 Ga0070697_101061619 Ga0070697_1010616192 178
247 3300005539 Ga0068853_100000135 Ga0068853_10000013512 178
248 3300005539 Ga0068853_100034680 Ga0068853_1000346802 178
249 3300005539 Ga0068853_100057141 Ga0068853_1000571414 178
250 3300005539 Ga0068853_100067794 Ga0068853_1000677943 178
251 3300005539 Ga0068853_100256002 Ga0068853_1002560022 178
252 3300005539 Ga0068853_100301362 Ga0068853_1003013623 178
253 3300005539 Ga0068853_100314578 Ga0068853_1003145782 178
254 3300005539 Ga0068853_100411908 Ga0068853_1004119082 178
255 3300005539 Ga0068853_100512318 Ga0068853_1005123182 178
256 3300005543 Ga0070672_100006656 Ga0070672_1000066562 178
257 3300005544 Ga0070686_100191227 Ga0070686_1001912272 178
258 3300005545 Ga0070695_100530747 Ga0070695_1005307471 178
259 3300005546 Ga0070696_100032766 Ga0070696_1000327664 178
260 3300005546 Ga0070696_100142530 Ga0070696_1001425303 178
261 3300005546 Ga0070696_100147585 Ga0070696_1001475852 178
262 3300005546 Ga0070696_100398510 Ga0070696_1003985102 178
263 3300005547 Ga0070693_100025295 Ga0070693_1000252954 178
264 3300005547 Ga0070693_100036701 Ga0070693_1000367012 178
265 3300005547 Ga0070693_100084840 Ga0070693_1000848402 178
266 3300005548 Ga0070665_100009521 Ga0070665_1000095216 178
267 3300005548 Ga0070665_100012790 Ga0070665_1000127903 178
268 3300005548 Ga0070665_100152636 Ga0070665_1001526362 178
269 3300005548 Ga0070665_100390755 Ga0070665_1003907552 178
270 3300005563 Ga0068855_100000712 Ga0068855_10000071235 178
271 3300005563 Ga0068855_100001850 Ga0068855_10000185016 178
272 3300005563 Ga0068855_100033291 Ga0068855_1000332914 178
273 3300005563 Ga0068855_100128995 Ga0068855_1001289953 178
274 3300005563 Ga0068855_100145128 Ga0068855_1001451283 178
275 3300005563 Ga0068855_100206871 Ga0068855_1002068712 178
276 3300005563 Ga0068855_100208630 Ga0068855_1002086301 178
277 3300005563 Ga0068855_100213465 Ga0068855_1002134652 178
278 3300005563 Ga0068855_100379750 Ga0068855_1003797501 178
279 3300005563 Ga0068855_100408489 Ga0068855_1004084893 178
280 3300005563 Ga0068855_100614246 Ga0068855_1006142462 178
281 3300005564 Ga0070664_100024680 Ga0070664_1000246805 178
282 3300005564 Ga0070664_100032297 Ga0070664_1000322973 178
283 3300005564 Ga0070664_100232524 Ga0070664_1002325242 178
284 3300005564 Ga0070664_100636751 Ga0070664_1006367512 178
285 3300005577 Ga0068857_100002931 Ga0068857_1000029314 178
286 3300005577 Ga0068857_100008567 Ga0068857_1000085677 178
287 3300005577 Ga0068857_100020107 Ga0068857_1000201075 178
288 3300005577 Ga0068857_100024421 Ga0068857_1000244216 178
289 3300005577 Ga0068857_100454040 Ga0068857_1004540402 178
290 3300005578 Ga0068854_100000866 Ga0068854_10000086616 178
291 3300005578 Ga0068854_100011289 Ga0068854_1000112896 178
292 3300005578 Ga0068854_100020955 Ga0068854_1000209552 178
293 3300005578 Ga0068854_100084141 Ga0068854_1000841413 178
294 3300005578 Ga0068854_100086715 Ga0068854_1000867152 178
295 3300005578 Ga0068854_100199661 Ga0068854_1001996612 178
296 3300005614 Ga0068856_100000706 Ga0068856_10000070630 178
297 3300005614 Ga0068856_100001186 Ga0068856_1000011866 178
298 3300005614 Ga0068856_100001480 Ga0068856_10000148019 178
299 3300005614 Ga0068856_100014836 Ga0068856_1000148363 178
300 3300005614 Ga0068856_100033606 Ga0068856_1000336063 178
301 3300005614 Ga0068856_100035487 Ga0068856_1000354877 178
302 3300005614 Ga0068856_100035614 Ga0068856_1000356145 178
303 3300005614 Ga0068856_100102872 Ga0068856_1001028721 178
304 3300005614 Ga0068856_100147048 Ga0068856_1001470482 178
305 3300005614 Ga0068856_100166066 Ga0068856_1001660662 178
306 3300005614 Ga0068856_100178123 Ga0068856_1001781232 178
307 3300005614 Ga0068856_100272105 Ga0068856_1002721052 178
308 3300005614 Ga0068856_100316876 Ga0068856_1003168762 178
309 3300005614 Ga0068856_101669477 Ga0068856_1016694771 178
310 3300005615 Ga0070702_100006319 Ga0070702_1000063192 178
311 3300005615 Ga0070702_100386009 Ga0070702_1003860092 178
312 3300005616 Ga0068852_100002443 Ga0068852_1000024438 178
313 3300005616 Ga0068852_100017056 Ga0068852_1000170565 178
314 3300005616 Ga0068852_100017271 Ga0068852_1000172713 178
315 3300005616 Ga0068852_100058357 Ga0068852_1000583572 178
316 3300005616 Ga0068852_100065853 Ga0068852_1000658535 178
317 3300005616 Ga0068852_100081934 Ga0068852_1000819343 178
318 3300005616 Ga0068852_100089378 Ga0068852_1000893783 178
319 3300005616 Ga0068852_100099272 Ga0068852_1000992722 178
320 3300005616 Ga0068852_100556577 Ga0068852_1005565772 178
321 3300005616 Ga0068852_100881445 Ga0068852_1008814451 178
322 3300005617 Ga0068859_100000418 Ga0068859_10000041814 178
323 3300005617 Ga0068859_100016315 Ga0068859_1000163159 178
324 3300005617 Ga0068859_100019604 Ga0068859_1000196043 178
325 3300005617 Ga0068859_100024397 Ga0068859_1000243977 178
326 3300005617 Ga0068859_100337231 Ga0068859_1003372312 178
327 3300005618 Ga0068864_100006714 Ga0068864_1000067147 178
328 3300005618 Ga0068864_100008302 Ga0068864_1000083026 178
329 3300005618 Ga0068864_100043013 Ga0068864_1000430132 178
330 3300005718 Ga0068866_10001698 Ga0068866_100016986 178
331 3300005718 Ga0068866_10031135 Ga0068866_100311353 178
332 3300005718 Ga0068866_10196318 Ga0068866_101963182 178
333 3300005719 Ga0068861_100013067 Ga0068861_1000130679 178
334 3300005719 Ga0068861_100082252 Ga0068861_1000822522 178
335 3300005719 Ga0068861_100508936 Ga0068861_1005089362 178
336 3300005719 Ga0068861_100638038 Ga0068861_1006380382 178
337 3300005719 Ga0068861_100651254 Ga0068861_1006512542 178
338 3300005834 Ga0068851_10187503 Ga0068851_101875032 178
339 3300005834 Ga0068851_10200813 Ga0068851_102008132 178
340 3300005840 Ga0068870_10000907 Ga0068870_100009079 178
341 3300005841 Ga0068863_100011286 Ga0068863_1000112869 178
342 3300005841 Ga0068863_100112963 Ga0068863_1001129632 178
343 3300005842 Ga0068858_100003408 Ga0068858_10000340811 178
344 3300005842 Ga0068858_100017216 Ga0068858_1000172165 178
345 3300005842 Ga0068858_100059277 Ga0068858_1000592774 178
346 3300005842 Ga0068858_100072181 Ga0068858_1000721812 178
347 3300005842 Ga0068858_100108812 Ga0068858_1001088123 178
348 3300005842 Ga0068858_100126603 Ga0068858_1001266032 178
349 3300005842 Ga0068858_100187754 Ga0068858_1001877543 178
350 3300005842 Ga0068858_100360270 Ga0068858_1003602702 178
351 3300005843 Ga0068860_100100123 Ga0068860_1001001233 178
352 3300005843 Ga0068860_100105542 Ga0068860_1001055423 178
353 3300005843 Ga0068860_100135737 Ga0068860_1001357373 178
354 3300005843 Ga0068860_100195129 Ga0068860_1001951293 178
355 3300005844 Ga0068862_100012946 Ga0068862_1000129464 178
356 3300005844 Ga0068862_100028129 Ga0068862_1000281293 178
357 3300005844 Ga0068862_100070395 Ga0068862_1000703953 178
358 3300005844 Ga0068862_100132514 Ga0068862_1001325143 178
359 3300005983 Ga0081540_1055592 Ga0081540_10555924 178
360 3300006028 Ga0070717_10000643 Ga0070717_1000064311 178
361 3300006028 Ga0070717_10004428 Ga0070717_100044288 178
362 3300006028 Ga0070717_10005064 Ga0070717_100050646 178
363 3300006028 Ga0070717_10007397 Ga0070717_100073978 178
364 3300006028 Ga0070717_10010992 Ga0070717_100109924 178
365 3300006028 Ga0070717_10060733 Ga0070717_100607333 178
366 3300006028 Ga0070717_10075985 Ga0070717_100759852 178
367 3300006028 Ga0070717_10112975 Ga0070717_101129751 178
368 3300006028 Ga0070717_10116497 Ga0070717_101164974 178
369 3300006028 Ga0070717_10184783 Ga0070717_101847832 178
370 3300006028 Ga0070717_10192367 Ga0070717_101923671 178
371 3300006028 Ga0070717_10254292 Ga0070717_102542922 178
372 3300006028 Ga0070717_10527749 Ga0070717_105277491 178
373 3300006163 Ga0070715_10015597 Ga0070715_100155973 178
374 3300006163 Ga0070715_10016421 Ga0070715_100164212 178
375 3300006163 Ga0070715_10030397 Ga0070715_100303973 178
376 3300006163 Ga0070715_10331700 Ga0070715_103317001 178
377 3300006173 Ga0070716_100000427 Ga0070716_1000004271 178
378 3300006173 Ga0070716_100062664 Ga0070716_1000626644 178
379 3300006173 Ga0070716_100106531 Ga0070716_1001065313 178
380 3300006173 Ga0070716_100377085 Ga0070716_1003770852 178
381 3300006173 Ga0070716_100543837 Ga0070716_1005438371 178
382 3300006175 Ga0070712_100001635 Ga0070712_1000016352 178
383 3300006175 Ga0070712_100001637 Ga0070712_1000016375 178
384 3300006175 Ga0070712_100002252 Ga0070712_10000225211 178
385 3300006175 Ga0070712_100002945 Ga0070712_10000294511 178
386 3300006175 Ga0070712_100011018 Ga0070712_1000110187 178
387 3300006175 Ga0070712_100040934 Ga0070712_1000409342 178
388 3300006175 Ga0070712_100066876 Ga0070712_1000668762 178
389 3300006175 Ga0070712_100260634 Ga0070712_1002606342 178
390 3300006175 Ga0070712_100336781 Ga0070712_1003367812 178
391 3300006175 Ga0070712_100546460 Ga0070712_1005464601 178
392 3300006175 Ga0070712_100661937 Ga0070712_1006619372 178
393 3300006237 Ga0097621_100000071 Ga0097621_10000007116 178
394 3300006237 Ga0097621_100000133 Ga0097621_10000013332 178
395 3300006237 Ga0097621_100000296 Ga0097621_10000029616 178
396 3300006237 Ga0097621_100005720 Ga0097621_1000057203 178
397 3300006237 Ga0097621_100014967 Ga0097621_1000149672 178
398 3300006237 Ga0097621_100103668 Ga0097621_1001036684 178
399 3300006237 Ga0097621_100108252 Ga0097621_1001082522 178
400 3300006237 Ga0097621_100144196 Ga0097621_1001441962 178
401 3300006237 Ga0097621_100521717 Ga0097621_1005217171 178
402 3300006237 Ga0097621_100685151 Ga0097621_1006851512 178
403 3300006358 Ga0068871_100000137 Ga0068871_10000013740 178
404 3300006358 Ga0068871_100000448 Ga0068871_10000044823 178
405 3300006358 Ga0068871_100000989 Ga0068871_10000098916 178
406 3300006358 Ga0068871_100026666 Ga0068871_1000266663 178
407 3300006358 Ga0068871_100026960 Ga0068871_1000269606 178
408 3300006358 Ga0068871_100027315 Ga0068871_1000273153 178
409 3300006358 Ga0068871_100029113 Ga0068871_1000291132 178
410 3300006358 Ga0068871_100071447 Ga0068871_1000714473 178
411 3300006358 Ga0068871_100138019 Ga0068871_1001380192 178
412 3300006358 Ga0068871_100282115 Ga0068871_1002821153 178
413 3300006358 Ga0068871_100505710 Ga0068871_1005057102 178
414 3300006852 Ga0075433_10000213 Ga0075433_1000021318 178
415 3300006852 Ga0075433_10030691 Ga0075433_100306915 178
416 3300006852 Ga0075433_10747672 Ga0075433_107476721 178
417 3300006871 Ga0075434_100000122 Ga0075434_10000012210 178
418 3300006871 Ga0075434_100001886 Ga0075434_10000188616 178
419 3300006871 Ga0075434_100077063 Ga0075434_1000770633 178
420 3300006881 Ga0068865_100051529 Ga0068865_1000515292 178
421 3300006881 Ga0068865_100059944 Ga0068865_1000599442 178
422 3300006881 Ga0068865_100061672 Ga0068865_1000616722 178
423 3300006881 Ga0068865_100182985 Ga0068865_1001829852 178
424 3300006881 Ga0068865_100278997 Ga0068865_1002789972 178
425 3300006881 Ga0068865_100382565 Ga0068865_1003825651 178
426 3300006914 Ga0075436_100002330 Ga0075436_1000023303 178
427 3300006914 Ga0075436_100008125 Ga0075436_1000081256 178
428 3300006914 Ga0075436_100019629 Ga0075436_1000196296 178
429 3300006914 Ga0075436_100110438 Ga0075436_1001104382 178
430 3300006914 Ga0075436_100134274 Ga0075436_1001342742 178
431 3300006914 Ga0075436_100287884 Ga0075436_1002878842 178
432 3300006931 Ga0097620_100000418 Ga0097620_10000041814 178
433 3300006931 Ga0097620_100016316 Ga0097620_1000163169 178
434 3300006931 Ga0097620_100019604 Ga0097620_1000196043 178
435 3300006931 Ga0097620_100024397 Ga0097620_1000243971 178
436 3300006931 Ga0097620_100337236 Ga0097620_1003372362 178
437 3300007076 Ga0075435_100000038 Ga0075435_1000000389 178
438 3300007076 Ga0075435_100134675 Ga0075435_1001346752 178
439 3300007076 Ga0075435_100211879 Ga0075435_1002118792 178
440 3300007076 Ga0075435_100334518 Ga0075435_1003345182 178
441 3300007076 Ga0075435_100557286 Ga0075435_1005572862 178
442 3300007788 Ga0099795_10017687 Ga0099795_100176874 178
443 3300007788 Ga0099795_10141810 Ga0099795_101418101 178
444 3300007788 Ga0099795_10156512 Ga0099795_101565121 178
445 3300007788 Ga0099795_10158922 Ga0099795_101589222 178
446 3300009093 Ga0105240_10002457 Ga0105240_100024579 178
447 3300009093 Ga0105240_10002467 Ga0105240_100024673 178
448 3300009093 Ga0105240_10011828 Ga0105240_100118289 178
449 3300009093 Ga0105240_10028761 Ga0105240_100287616 178
450 3300009093 Ga0105240_10055349 Ga0105240_100553493 178
451 3300009093 Ga0105240_10063020 Ga0105240_100630205 178
452 3300009093 Ga0105240_10102903 Ga0105240_101029033 178
453 3300009093 Ga0105240_10206466 Ga0105240_102064662 178
454 3300009093 Ga0105240_10409263 Ga0105240_104092632 178
455 3300009093 Ga0105240_10445681 Ga0105240_104456812 178
456 3300009093 Ga0105240_10447900 Ga0105240_104479002 178
457 3300009093 Ga0105240_10474692 Ga0105240_104746922 178
458 3300009093 Ga0105240_10516073 Ga0105240_105160732 178
459 3300009093 Ga0105240_10802231 Ga0105240_108022312 178
460 3300009098 Ga0105245_10000516 Ga0105245_100005164 178
461 3300009098 Ga0105245_10017772 Ga0105245_100177724 178
462 3300009098 Ga0105245_10050660 Ga0105245_100506603 178
463 3300009098 Ga0105245_10056355 Ga0105245_100563552 178
464 3300009098 Ga0105245_10182908 Ga0105245_101829084 178
465 3300009098 Ga0105245_11152722 Ga0105245_111527221 178
466 3300009101 Ga0105247_10003144 Ga0105247_100031446 178
467 3300009101 Ga0105247_10144553 Ga0105247_101445532 178
468 3300009147 Ga0114129_10006460 Ga0114129_100064605 178
469 3300009147 Ga0114129_10186491 Ga0114129_101864913 178
470 3300009148 Ga0105243_10249472 Ga0105243_102494722 178
471 3300009148 Ga0105243_10352693 Ga0105243_103526932 178
472 3300009174 Ga0105241_10000276 Ga0105241_100002763 178
473 3300009174 Ga0105241_10001178 Ga0105241_100011786 178
474 3300009174 Ga0105241_10002428 Ga0105241_1000242816 178
475 3300009174 Ga0105241_10025863 Ga0105241_100258634 178
476 3300009174 Ga0105241_10036117 Ga0105241_100361172 178
477 3300009174 Ga0105241_10073412 Ga0105241_100734123 178
478 3300009174 Ga0105241_10100182 Ga0105241_101001822 178
479 3300009174 Ga0105241_10111809 Ga0105241_101118091 178
480 3300009174 Ga0105241_10130281 Ga0105241_101302812 178
481 3300009174 Ga0105241_10184554 Ga0105241_101845542 178
482 3300009174 Ga0105241_10201653 Ga0105241_102016531 178
483 3300009174 Ga0105241_10288950 Ga0105241_102889502 178
484 3300009174 Ga0105241_10332742 Ga0105241_103327422 178
485 3300009176 Ga0105242_10068694 Ga0105242_100686943 178
486 3300009176 Ga0105242_10083515 Ga0105242_100835154 178
487 3300009176 Ga0105242_10124916 Ga0105242_101249162 178
488 3300009176 Ga0105242_10138058 Ga0105242_101380581 178
489 3300009176 Ga0105242_10252096 Ga0105242_102520962 178
490 3300009176 Ga0105242_10644364 Ga0105242_106443642 178
491 3300009176 Ga0105242_10979084 Ga0105242_109790841 178
492 3300009176 Ga0105242_11280768 Ga0105242_112807681 178
493 3300009177 Ga0105248_10003784 Ga0105248_100037845 178
494 3300009177 Ga0105248_10010694 Ga0105248_100106942 178
495 3300009177 Ga0105248_10199986 Ga0105248_101999863 178
496 3300009177 Ga0105248_10367767 Ga0105248_103677672 178
497 3300009177 Ga0105248_10536094 Ga0105248_105360943 178
498 3300009177 Ga0105248_10646804 Ga0105248_106468042 178
499 3300009545 Ga0105237_10013239 Ga0105237_100132392 178
500 3300009545 Ga0105237_10016568 Ga0105237_100165683 178
501 3300009545 Ga0105237_10031675 Ga0105237_100316753 178
502 3300009545 Ga0105237_10034389 Ga0105237_100343894 178
503 3300009545 Ga0105237_10078097 Ga0105237_100780974 178
504 3300009545 Ga0105237_10115021 Ga0105237_101150213 178
505 3300009545 Ga0105237_10147378 Ga0105237_101473781 178
506 3300009545 Ga0105237_10159626 Ga0105237_101596262 178
507 3300009545 Ga0105237_10352200 Ga0105237_103522002 178
508 3300009545 Ga0105237_10410516 Ga0105237_104105162 178
509 3300009545 Ga0105237_11663895 Ga0105237_116638951 178
510 3300009551 Ga0105238_10000368 Ga0105238_1000036832 178
511 3300009551 Ga0105238_10003298 Ga0105238_100032985 178
512 3300009551 Ga0105238_10031980 Ga0105238_100319803 178
513 3300009551 Ga0105238_10035657 Ga0105238_100356572 178
514 3300009551 Ga0105238_10040693 Ga0105238_100406933 178
515 3300009551 Ga0105238_10042861 Ga0105238_100428613 178
516 3300009551 Ga0105238_10079296 Ga0105238_100792965 178
517 3300009551 Ga0105238_10118567 Ga0105238_101185672 178
518 3300009551 Ga0105238_10279537 Ga0105238_102795372 178
519 3300009551 Ga0105238_10380787 Ga0105238_103807872 178
520 3300009551 Ga0105238_10566541 Ga0105238_105665412 178
521 3300009551 Ga0105238_10577437 Ga0105238_105774372 178
522 3300009553 Ga0105249_10009498 Ga0105249_100094987 178
523 3300009553 Ga0105249_10772591 Ga0105249_107725912 178
524 3300010375 Ga0105239_10004815 Ga0105239_1000481511 178
525 3300010375 Ga0105239_10007299 Ga0105239_100072993 178
526 3300010375 Ga0105239_10022069 Ga0105239_100220697 178
527 3300010375 Ga0105239_10096667 Ga0105239_100966674 178
528 3300010375 Ga0105239_10162705 Ga0105239_101627055 178
529 3300010375 Ga0105239_10564527 Ga0105239_105645272 178
530 3300010375 Ga0105239_10806570 Ga0105239_108065701 178
531 3300010375 Ga0105239_11027958 Ga0105239_110279581 178
532 3300011119 Ga0105246_10003660 Ga0105246_100036603 178
533 3300011119 Ga0105246_10022064 Ga0105246_100220647 178
534 3300012512 Ga0157327_1010456 Ga0157327_10104561 178
535 3300013100 Ga0157373_10004599 Ga0157373_100045995 178
536 3300013100 Ga0157373_10039159 Ga0157373_100391593 178
537 3300013100 Ga0157373_10076501 Ga0157373_100765013 178
538 3300013102 Ga0157371_10006488 Ga0157371_100064886 178
539 3300013102 Ga0157371_10100574 Ga0157371_101005742 178
540 3300013102 Ga0157371_10131479 Ga0157371_101314792 178
541 3300013102 Ga0157371_10160747 Ga0157371_101607472 178
542 3300013104 Ga0157370_10034673 Ga0157370_100346736 178
543 3300013104 Ga0157370_10116280 Ga0157370_101162803 178
544 3300013104 Ga0157370_10407701 Ga0157370_104077012 178
545 3300013104 Ga0157370_10584100 Ga0157370_105841002 178
546 3300013104 Ga0157370_10723777 Ga0157370_107237771 178
547 3300013105 Ga0157369_10000750 Ga0157369_100007502 178
548 3300013105 Ga0157369_10002157 Ga0157369_1000215713 178
549 3300013105 Ga0157369_10003112 Ga0157369_100031125 178
550 3300013105 Ga0157369_10003177 Ga0157369_1000317711 178
551 3300013105 Ga0157369_10012621 Ga0157369_100126212 178
552 3300013105 Ga0157369_10021573 Ga0157369_100215737 178
553 3300013105 Ga0157369_10024326 Ga0157369_100243268 178
554 3300013105 Ga0157369_10101682 Ga0157369_101016821 178
555 3300013105 Ga0157369_10132021 Ga0157369_101320212 178
556 3300013105 Ga0157369_10207874 Ga0157369_102078742 178
557 3300013105 Ga0157369_10349969 Ga0157369_103499692 178
558 3300013105 Ga0157369_10407765 Ga0157369_104077651 178
559 3300013105 Ga0157369_10417379 Ga0157369_104173792 178
560 3300013105 Ga0157369_10437667 Ga0157369_104376672 178
561 3300013105 Ga0157369_10771352 Ga0157369_107713522 178
562 3300013105 Ga0157369_11400632 Ga0157369_114006321 178
563 3300013296 Ga0157374_10000254 Ga0157374_1000025434 178
564 3300013296 Ga0157374_10000302 Ga0157374_1000030220 178
565 3300013296 Ga0157374_10002020 Ga0157374_1000202013 178
566 3300013296 Ga0157374_10006337 Ga0157374_100063374 178
567 3300013296 Ga0157374_10007926 Ga0157374_100079262 178
568 3300013296 Ga0157374_10037873 Ga0157374_100378733 178
569 3300013296 Ga0157374_10050655 Ga0157374_100506553 178
570 3300013296 Ga0157374_10107857 Ga0157374_101078573 178
571 3300013296 Ga0157374_10234138 Ga0157374_102341382 178
572 3300013296 Ga0157374_10239442 Ga0157374_102394422 178
573 3300013296 Ga0157374_10311949 Ga0157374_103119492 178
574 3300013296 Ga0157374_10332954 Ga0157374_103329542 178
575 3300013296 Ga0157374_10511694 Ga0157374_105116942 178
576 3300013296 Ga0157374_10536140 Ga0157374_105361401 178
577 3300013296 Ga0157374_10763550 Ga0157374_107635502 178
578 3300013297 Ga0157378_10000055 Ga0157378_1000005587 178
579 3300013297 Ga0157378_10000554 Ga0157378_1000055418 178
580 3300013297 Ga0157378_10000671 Ga0157378_1000067115 178
581 3300013297 Ga0157378_10006811 Ga0157378_100068111 178
582 3300013297 Ga0157378_10014366 Ga0157378_100143662 178
583 3300013297 Ga0157378_10022268 Ga0157378_100222682 178
584 3300013297 Ga0157378_10116416 Ga0157378_101164162 178
585 3300013297 Ga0157378_10216560 Ga0157378_102165602 178
586 3300013297 Ga0157378_10310045 Ga0157378_103100452 178
587 3300013297 Ga0157378_10532228 Ga0157378_105322281 178
588 3300013297 Ga0157378_11579117 Ga0157378_115791171 178
589 3300013306 Ga0163162_10018861 Ga0163162_100188614 178
590 3300013306 Ga0163162_10020399 Ga0163162_100203994 178
591 3300013306 Ga0163162_10021252 Ga0163162_100212522 178
592 3300013306 Ga0163162_10053147 Ga0163162_100531472 178
593 3300013306 Ga0163162_10166366 Ga0163162_101663663 178
594 3300013306 Ga0163162_10267698 Ga0163162_102676984 178
595 3300013306 Ga0163162_10320159 Ga0163162_103201592 178
596 3300013306 Ga0163162_10478017 Ga0163162_104780172 178
597 3300013307 Ga0157372_10001110 Ga0157372_1000111010 178
598 3300013307 Ga0157372_10001984 Ga0157372_1000198418 178
599 3300013307 Ga0157372_10002196 Ga0157372_1000219615 178
600 3300013307 Ga0157372_10009900 Ga0157372_1000990010 178
601 3300013307 Ga0157372_10014952 Ga0157372_100149526 178
602 3300013307 Ga0157372_10015839 Ga0157372_100158392 178
603 3300013307 Ga0157372_10040068 Ga0157372_100400685 178
604 3300013307 Ga0157372_10055165 Ga0157372_100551653 178
605 3300013307 Ga0157372_10058477 Ga0157372_100584773 178
606 3300013307 Ga0157372_10058753 Ga0157372_100587536 178
607 3300013307 Ga0157372_10071991 Ga0157372_100719912 178
608 3300013307 Ga0157372_10097959 Ga0157372_100979592 178
609 3300013307 Ga0157372_10167594 Ga0157372_101675941 178
610 3300013307 Ga0157372_10278036 Ga0157372_102780362 178
611 3300013307 Ga0157372_10278046 Ga0157372_102780461 178
612 3300013307 Ga0157372_10346535 Ga0157372_103465352 178
613 3300013307 Ga0157372_10364148 Ga0157372_103641482 178
614 3300013307 Ga0157372_10450015 Ga0157372_104500153 178
615 3300013307 Ga0157372_11449948 Ga0157372_114499481 178
616 3300013308 Ga0157375_10002920 Ga0157375_100029206 178
617 3300013308 Ga0157375_10045075 Ga0157375_100450756 178
618 3300013308 Ga0157375_10057116 Ga0157375_100571163 178
619 3300013308 Ga0157375_10088787 Ga0157375_100887873 178
620 3300014325 Ga0163163_10002249 Ga0163163_100022494 178
621 3300014325 Ga0163163_10090048 Ga0163163_100900482 178
622 3300014325 Ga0163163_10124623 Ga0163163_101246232 178
623 3300014325 Ga0163163_10224122 Ga0163163_102241222 178
624 3300014325 Ga0163163_10234247 Ga0163163_102342472 178
625 3300014325 Ga0163163_10536604 Ga0163163_105366042 178
626 3300014497 Ga0182008_10011762 Ga0182008_100117623 178
627 3300014497 Ga0182008_10025038 Ga0182008_100250384 178
628 3300014745 Ga0157377_10000465 Ga0157377_100004652 178
629 3300014968 Ga0157379_10008732 Ga0157379_100087327 178
630 3300014968 Ga0157379_10038093 Ga0157379_100380936 178
631 3300014968 Ga0157379_10085807 Ga0157379_100858072 178
632 3300014968 Ga0157379_10086676 Ga0157379_100866762 178
633 3300014968 Ga0157379_10204604 Ga0157379_102046042 178
634 3300014968 Ga0157379_10500802 Ga0157379_105008021 178
635 3300014969 Ga0157376_10025796 Ga0157376_100257965 178
636 3300014969 Ga0157376_10026011 Ga0157376_100260115 178
637 3300014969 Ga0157376_10032266 Ga0157376_100322665 178
638 3300014969 Ga0157376_10042525 Ga0157376_100425253 178
639 3300014969 Ga0157376_10057173 Ga0157376_100571733 178
640 3300014969 Ga0157376_10096845 Ga0157376_100968453 178
641 3300014969 Ga0157376_10162891 Ga0157376_101628912 178
642 3300014969 Ga0157376_10450279 Ga0157376_104502792 178
643 3300014969 Ga0157376_10572428 Ga0157376_105724281 178
644 3300015261 Ga0182006_1040412 Ga0182006_10404121 178
645 3300015261 Ga0182006_1068248 Ga0182006_10682482 178
646 3300015262 Ga0182007_10018808 Ga0182007_100188084 178
647 3300015262 Ga0182007_10052545 Ga0182007_100525452 178
648 3300017792 Ga0163161_10005860 Ga0163161_100058605 178
649 3300019176 Ga0184596_128878 Ga0184596_1288782 178
650 3300019183 Ga0184601_120629 Ga0184601_1206291 178
651 3300019188 Ga0184599_104727 Ga0184599_1047271 178
652 3300019190 Ga0184600_113135 Ga0184600_1131351 178
653 3300019192 Ga0184603_111301 Ga0184603_1113011 178
654 3300020076 Ga0206355_1020444 Ga0206355_10204442 178
655 3300020077 Ga0206351_11014315 Ga0206351_110143151 178
656 3300020078 Ga0206352_10398647 Ga0206352_103986472 178
657 3300020078 Ga0206352_10693439 Ga0206352_106934391 178
658 3300020080 Ga0206350_11568350 Ga0206350_115683501 178
659 3300020610 Ga0154015_1023356 Ga0154015_10233562 178
660 3300021361 Ga0213872_10019106 Ga0213872_100191063 178
661 3300021361 Ga0213872_10043905 Ga0213872_100439053 178
662 3300022467 Ga0224712_10326633 Ga0224712_103266331 178
663 3300022732 Ga0224569_100968 Ga0224569_1009684 178
664 3300022734 Ga0224571_100032 Ga0224571_1000323 178
665 3300023672 Ga0247553_101899 Ga0247553_1018991 178
666 3300024225 Ga0224572_1012573 Ga0224572_10125733 178
667 3300024225 Ga0224572_1014715 Ga0224572_10147151 178
668 3300024227 Ga0228598_1002332 Ga0228598_10023322 178
669 3300024227 Ga0228598_1004726 Ga0228598_10047262 178
670 3300024227 Ga0228598_1040561 Ga0228598_10405611 178
671 3300025315 Ga0207697_10020044 Ga0207697_100200442 178
672 3300025315 Ga0207697_10111353 Ga0207697_101113531 178
673 3300025321 Ga0207656_10014772 Ga0207656_100147725 178
674 3300025321 Ga0207656_10146160 Ga0207656_101461602 178
675 3300025321 Ga0207656_10154110 Ga0207656_101541102 178
676 3300025893 Ga0207682_10011377 Ga0207682_100113774 178
677 3300025898 Ga0207692_10077687 Ga0207692_100776872 178
678 3300025898 Ga0207692_10102660 Ga0207692_101026601 178
679 3300025898 Ga0207692_10125712 Ga0207692_101257122 178
680 3300025898 Ga0207692_10572390 Ga0207692_105723901 178
681 3300025899 Ga0207642_10027988 Ga0207642_100279883 178
682 3300025899 Ga0207642_10281264 Ga0207642_102812641 178
683 3300025900 Ga0207710_10050374 Ga0207710_100503742 178
684 3300025903 Ga0207680_10052956 Ga0207680_100529563 178
685 3300025903 Ga0207680_10099825 Ga0207680_100998252 178
686 3300025904 Ga0207647_10005709 Ga0207647_100057098 178
687 3300025904 Ga0207647_10007182 Ga0207647_100071822 178
688 3300025904 Ga0207647_10007397 Ga0207647_100073971 178
689 3300025904 Ga0207647_10017482 Ga0207647_100174823 178
690 3300025904 Ga0207647_10039479 Ga0207647_100394792 178
691 3300025905 Ga0207685_10004115 Ga0207685_100041154 178
692 3300025905 Ga0207685_10008806 Ga0207685_100088063 178
693 3300025905 Ga0207685_10113141 Ga0207685_101131412 178
694 3300025905 Ga0207685_10181980 Ga0207685_101819802 178
695 3300025905 Ga0207685_10480648 Ga0207685_104806481 178
696 3300025906 Ga0207699_10006716 Ga0207699_100067163 178
697 3300025906 Ga0207699_10009295 Ga0207699_100092953 178
698 3300025906 Ga0207699_10059479 Ga0207699_100594793 178
699 3300025906 Ga0207699_10067515 Ga0207699_100675154 178
700 3300025906 Ga0207699_10102424 Ga0207699_101024241 178
701 3300025906 Ga0207699_10119399 Ga0207699_101193993 178
702 3300025906 Ga0207699_10252064 Ga0207699_102520642 178
703 3300025906 Ga0207699_10917770 Ga0207699_109177701 178
704 3300025907 Ga0207645_10000038 Ga0207645_100000386 178
705 3300025907 Ga0207645_10003405 Ga0207645_100034058 178
706 3300025908 Ga0207643_10003645 Ga0207643_100036453 178
707 3300025909 Ga0207705_10261461 Ga0207705_102614612 178
708 3300025910 Ga0207684_10000383 Ga0207684_1000038340 178
709 3300025910 Ga0207684_10000395 Ga0207684_1000039523 178
710 3300025910 Ga0207684_10039608 Ga0207684_100396082 178
711 3300025910 Ga0207684_10046661 Ga0207684_100466614 178
712 3300025910 Ga0207684_10341887 Ga0207684_103418872 178
713 3300025910 Ga0207684_10627654 Ga0207684_106276541 178
714 3300025911 Ga0207654_10000325 Ga0207654_100003253 178
715 3300025911 Ga0207654_10000600 Ga0207654_100006006 178
716 3300025911 Ga0207654_10006778 Ga0207654_100067785 178
717 3300025911 Ga0207654_10012614 Ga0207654_100126143 178
718 3300025911 Ga0207654_10026315 Ga0207654_100263153 178
719 3300025911 Ga0207654_10048664 Ga0207654_100486643 178
720 3300025911 Ga0207654_10086887 Ga0207654_100868872 178
721 3300025911 Ga0207654_10359703 Ga0207654_103597032 178
722 3300025912 Ga0207707_10003331 Ga0207707_100033319 178
723 3300025912 Ga0207707_10031562 Ga0207707_100315625 178
724 3300025912 Ga0207707_10043565 Ga0207707_100435656 178
725 3300025912 Ga0207707_10051253 Ga0207707_100512532 178
726 3300025912 Ga0207707_10070708 Ga0207707_100707083 178
727 3300025912 Ga0207707_10131332 Ga0207707_101313322 178
728 3300025912 Ga0207707_10323416 Ga0207707_103234162 178
729 3300025912 Ga0207707_10373260 Ga0207707_103732602 178
730 3300025912 Ga0207707_10412964 Ga0207707_104129642 178
731 3300025912 Ga0207707_10454477 Ga0207707_104544771 178
732 3300025912 Ga0207707_10611735 Ga0207707_106117352 178
733 3300025912 Ga0207707_10817953 Ga0207707_108179531 178
734 3300025913 Ga0207695_10000466 Ga0207695_100004661 178
735 3300025913 Ga0207695_10007531 Ga0207695_100075316 178
736 3300025913 Ga0207695_10044199 Ga0207695_100441993 178
737 3300025913 Ga0207695_10049644 Ga0207695_100496443 178
738 3300025913 Ga0207695_10079367 Ga0207695_100793675 178
739 3300025913 Ga0207695_10087017 Ga0207695_100870173 178
740 3300025913 Ga0207695_10102821 Ga0207695_101028213 178
741 3300025913 Ga0207695_10139160 Ga0207695_101391602 178
742 3300025913 Ga0207695_10145577 Ga0207695_101455773 178
743 3300025913 Ga0207695_10207870 Ga0207695_102078702 178
744 3300025913 Ga0207695_10250643 Ga0207695_102506432 178
745 3300025913 Ga0207695_10390110 Ga0207695_103901102 178
746 3300025913 Ga0207695_10392264 Ga0207695_103922642 178
747 3300025913 Ga0207695_10490810 Ga0207695_104908101 178
748 3300025913 Ga0207695_10877906 Ga0207695_108779061 178
749 3300025914 Ga0207671_10000403 Ga0207671_1000040329 178
750 3300025914 Ga0207671_10026322 Ga0207671_100263222 178
751 3300025914 Ga0207671_10063321 Ga0207671_100633212 178
752 3300025914 Ga0207671_10254587 Ga0207671_102545873 178
753 3300025915 Ga0207693_10000092 Ga0207693_1000009223 178
754 3300025915 Ga0207693_10000131 Ga0207693_100001314 178
755 3300025915 Ga0207693_10000557 Ga0207693_1000055727 178
756 3300025915 Ga0207693_10007111 Ga0207693_100071119 178
757 3300025915 Ga0207693_10009131 Ga0207693_100091315 178
758 3300025915 Ga0207693_10016645 Ga0207693_100166457 178
759 3300025915 Ga0207693_10022278 Ga0207693_100222786 178
760 3300025915 Ga0207693_10095024 Ga0207693_100950242 178
761 3300025915 Ga0207693_10113828 Ga0207693_101138281 178
762 3300025915 Ga0207693_10205769 Ga0207693_102057692 178
763 3300025916 Ga0207663_10000389 Ga0207663_1000038914 178
764 3300025916 Ga0207663_10007309 Ga0207663_100073093 178
765 3300025916 Ga0207663_10008120 Ga0207663_100081205 178
766 3300025916 Ga0207663_10059705 Ga0207663_100597053 178
767 3300025916 Ga0207663_10086553 Ga0207663_100865532 178
768 3300025916 Ga0207663_10106123 Ga0207663_101061233 178
769 3300025916 Ga0207663_10504072 Ga0207663_105040721 178
770 3300025917 Ga0207660_10000640 Ga0207660_1000064021 178
771 3300025917 Ga0207660_10044946 Ga0207660_100449463 178
772 3300025917 Ga0207660_10065946 Ga0207660_100659462 178
773 3300025917 Ga0207660_10139798 Ga0207660_101397983 178
774 3300025917 Ga0207660_10221454 Ga0207660_102214541 178
775 3300025917 Ga0207660_10242137 Ga0207660_102421373 178
776 3300025918 Ga0207662_10170617 Ga0207662_101706172 178
777 3300025919 Ga0207657_10001231 Ga0207657_1000123121 178
778 3300025919 Ga0207657_10002581 Ga0207657_100025817 178
779 3300025919 Ga0207657_10002611 Ga0207657_100026112 178
780 3300025920 Ga0207649_10008275 Ga0207649_100082752 178
781 3300025920 Ga0207649_10103298 Ga0207649_101032981 178
782 3300025920 Ga0207649_10386494 Ga0207649_103864941 178
783 3300025920 Ga0207649_10890692 Ga0207649_108906921 178
784 3300025921 Ga0207652_10008448 Ga0207652_100084485 178
785 3300025921 Ga0207652_10013462 Ga0207652_100134625 178
786 3300025921 Ga0207652_10050851 Ga0207652_100508513 178
787 3300025921 Ga0207652_10309347 Ga0207652_103093472 178
788 3300025921 Ga0207652_10395765 Ga0207652_103957651 178
789 3300025921 Ga0207652_10487234 Ga0207652_104872341 178
790 3300025922 Ga0207646_10000229 Ga0207646_1000022955 178
791 3300025922 Ga0207646_10003563 Ga0207646_1000356317 178
792 3300025922 Ga0207646_10028954 Ga0207646_100289545 178
793 3300025922 Ga0207646_10045421 Ga0207646_100454212 178
794 3300025922 Ga0207646_10207633 Ga0207646_102076333 178
795 3300025922 Ga0207646_10744065 Ga0207646_107440652 178
796 3300025923 Ga0207681_10022807 Ga0207681_100228072 178
797 3300025923 Ga0207681_10662873 Ga0207681_106628731 178
798 3300025924 Ga0207694_10000098 Ga0207694_1000009817 178
799 3300025924 Ga0207694_10003750 Ga0207694_100037502 178
800 3300025924 Ga0207694_10003818 Ga0207694_100038183 178
801 3300025924 Ga0207694_10092802 Ga0207694_100928022 178
802 3300025924 Ga0207694_10110509 Ga0207694_101105092 178
803 3300025924 Ga0207694_10138757 Ga0207694_101387572 178
804 3300025924 Ga0207694_10188157 Ga0207694_101881572 178
805 3300025924 Ga0207694_10203757 Ga0207694_102037571 178
806 3300025924 Ga0207694_10204357 Ga0207694_102043571 178
807 3300025924 Ga0207694_10320274 Ga0207694_103202741 178
808 3300025924 Ga0207694_10381063 Ga0207694_103810632 178
809 3300025924 Ga0207694_10546453 Ga0207694_105464531 178
810 3300025925 Ga0207650_10000104 Ga0207650_1000010439 178
811 3300025925 Ga0207650_10066987 Ga0207650_100669873 178
812 3300025925 Ga0207650_10514413 Ga0207650_105144132 178
813 3300025926 Ga0207659_10015202 Ga0207659_100152023 178
814 3300025926 Ga0207659_10361975 Ga0207659_103619751 178
815 3300025927 Ga0207687_10003641 Ga0207687_100036419 178
816 3300025927 Ga0207687_10004419 Ga0207687_100044194 178
817 3300025927 Ga0207687_10063764 Ga0207687_100637643 178
818 3300025927 Ga0207687_10116326 Ga0207687_101163262 178
819 3300025927 Ga0207687_10346330 Ga0207687_103463302 178
820 3300025927 Ga0207687_10416195 Ga0207687_104161951 178
821 3300025927 Ga0207687_10962323 Ga0207687_109623231 178
822 3300025928 Ga0207700_10001982 Ga0207700_100019823 178
823 3300025928 Ga0207700_10005245 Ga0207700_100052455 178
824 3300025928 Ga0207700_10005753 Ga0207700_100057533 178
825 3300025928 Ga0207700_10040179 Ga0207700_100401793 178
826 3300025928 Ga0207700_10041416 Ga0207700_100414162 178
827 3300025928 Ga0207700_10077194 Ga0207700_100771943 178
828 3300025928 Ga0207700_10088662 Ga0207700_100886622 178
829 3300025928 Ga0207700_10103509 Ga0207700_101035092 178
830 3300025928 Ga0207700_10147831 Ga0207700_101478312 178
831 3300025928 Ga0207700_10171735 Ga0207700_101717352 178
832 3300025928 Ga0207700_10218155 Ga0207700_102181552 178
833 3300025928 Ga0207700_10300058 Ga0207700_103000582 178
834 3300025928 Ga0207700_10436778 Ga0207700_104367782 178
835 3300025929 Ga0207664_10001088 Ga0207664_1000108810 178
836 3300025929 Ga0207664_10018871 Ga0207664_100188713 178
837 3300025929 Ga0207664_10043647 Ga0207664_100436472 178
838 3300025929 Ga0207664_10174981 Ga0207664_101749812 178
839 3300025929 Ga0207664_10262711 Ga0207664_102627113 178
840 3300025929 Ga0207664_10550697 Ga0207664_105506971 178
841 3300025929 Ga0207664_10658643 Ga0207664_106586431 178
842 3300025929 Ga0207664_11175066 Ga0207664_111750661 178
843 3300025929 Ga0207664_11497669 Ga0207664_114976691 178
844 3300025931 Ga0207644_10028299 Ga0207644_100282995 178
845 3300025931 Ga0207644_10113953 Ga0207644_101139532 178
846 3300025931 Ga0207644_10331354 Ga0207644_103313542 178
847 3300025931 Ga0207644_10398609 Ga0207644_103986092 178
848 3300025931 Ga0207644_10815338 Ga0207644_108153381 178
849 3300025932 Ga0207690_10100295 Ga0207690_101002953 178
850 3300025932 Ga0207690_10206454 Ga0207690_102064542 178
851 3300025933 Ga0207706_10000108 Ga0207706_1000010816 178
852 3300025933 Ga0207706_10001714 Ga0207706_1000171413 178
853 3300025933 Ga0207706_10026004 Ga0207706_100260045 178
854 3300025934 Ga0207686_10070065 Ga0207686_100700652 178
855 3300025934 Ga0207686_10709915 Ga0207686_107099152 178
856 3300025936 Ga0207670_10067098 Ga0207670_100670982 178
857 3300025938 Ga0207704_10017600 Ga0207704_100176007 178
858 3300025938 Ga0207704_10034342 Ga0207704_100343423 178
859 3300025938 Ga0207704_10056520 Ga0207704_100565202 178
860 3300025938 Ga0207704_10115328 Ga0207704_101153282 178
861 3300025939 Ga0207665_10010945 Ga0207665_100109456 178
862 3300025939 Ga0207665_10018667 Ga0207665_100186672 178
863 3300025939 Ga0207665_10028046 Ga0207665_100280463 178
864 3300025939 Ga0207665_10041938 Ga0207665_100419385 178
865 3300025939 Ga0207665_10138615 Ga0207665_101386152 178
866 3300025939 Ga0207665_10165911 Ga0207665_101659112 178
867 3300025939 Ga0207665_10173745 Ga0207665_101737452 178
868 3300025939 Ga0207665_10476214 Ga0207665_104762142 178
869 3300025940 Ga0207691_10000280 Ga0207691_1000028022 178
870 3300025940 Ga0207691_10012006 Ga0207691_100120064 178
871 3300025940 Ga0207691_10206089 Ga0207691_102060893 178
872 3300025941 Ga0207711_10004791 Ga0207711_100047915 178
873 3300025941 Ga0207711_10005368 Ga0207711_100053685 178
874 3300025941 Ga0207711_10006809 Ga0207711_1000680911 178
875 3300025941 Ga0207711_10014595 Ga0207711_100145955 178
876 3300025941 Ga0207711_10016426 Ga0207711_100164266 178
877 3300025941 Ga0207711_10028247 Ga0207711_100282475 178
878 3300025941 Ga0207711_10355279 Ga0207711_103552792 178
879 3300025942 Ga0207689_10000068 Ga0207689_1000006826 178
880 3300025942 Ga0207689_10000279 Ga0207689_1000027911 178
881 3300025942 Ga0207689_10008300 Ga0207689_100083006 178
882 3300025942 Ga0207689_10061528 Ga0207689_100615285 178
883 3300025942 Ga0207689_10166388 Ga0207689_101663882 178
884 3300025944 Ga0207661_10000619 Ga0207661_100006196 178
885 3300025944 Ga0207661_10055561 Ga0207661_100555612 178
886 3300025944 Ga0207661_10063983 Ga0207661_100639832 178
887 3300025944 Ga0207661_10083177 Ga0207661_100831772 178
888 3300025944 Ga0207661_10096335 Ga0207661_100963351 178
889 3300025944 Ga0207661_10227303 Ga0207661_102273032 178
890 3300025944 Ga0207661_10333233 Ga0207661_103332332 178
891 3300025944 Ga0207661_10553410 Ga0207661_105534102 178
892 3300025944 Ga0207661_10703975 Ga0207661_107039752 178
893 3300025945 Ga0207679_10000089 Ga0207679_1000008949 178
894 3300025945 Ga0207679_10009023 Ga0207679_100090235 178
895 3300025945 Ga0207679_10075049 Ga0207679_100750494 178
896 3300025945 Ga0207679_10399445 Ga0207679_103994452 178
897 3300025945 Ga0207679_10581799 Ga0207679_105817992 178
898 3300025949 Ga0207667_10000894 Ga0207667_1000089426 178
899 3300025949 Ga0207667_10002624 Ga0207667_100026242 178
900 3300025949 Ga0207667_10002983 Ga0207667_100029836 178
901 3300025949 Ga0207667_10004094 Ga0207667_1000409413 178
902 3300025949 Ga0207667_10051959 Ga0207667_100519592 178
903 3300025949 Ga0207667_10171266 Ga0207667_101712663 178
904 3300025949 Ga0207667_10465859 Ga0207667_104658592 178
905 3300025949 Ga0207667_10514484 Ga0207667_105144843 178
906 3300025949 Ga0207667_10544634 Ga0207667_105446342 178
907 3300025949 Ga0207667_10843700 Ga0207667_108437002 178
908 3300025960 Ga0207651_10006120 Ga0207651_100061209 178
909 3300025972 Ga0207668_10000933 Ga0207668_1000093316 178
910 3300025972 Ga0207668_10052050 Ga0207668_100520502 178
911 3300025972 Ga0207668_10174903 Ga0207668_101749032 178
912 3300025981 Ga0207640_10009050 Ga0207640_100090503 178
913 3300025981 Ga0207640_10017647 Ga0207640_100176476 178
914 3300025981 Ga0207640_10019761 Ga0207640_100197612 178
915 3300025981 Ga0207640_10049822 Ga0207640_100498223 178
916 3300025981 Ga0207640_10107918 Ga0207640_101079182 178
917 3300025981 Ga0207640_10218841 Ga0207640_102188411 178
918 3300025986 Ga0207658_10019740 Ga0207658_100197403 178
919 3300025986 Ga0207658_10024102 Ga0207658_100241021 178
920 3300025986 Ga0207658_10369217 Ga0207658_103692172 178
921 3300026023 Ga0207677_10002414 Ga0207677_100024142 178
922 3300026023 Ga0207677_10007316 Ga0207677_100073163 178
923 3300026023 Ga0207677_10013672 Ga0207677_100136723 178
924 3300026023 Ga0207677_10051738 Ga0207677_100517383 178
925 3300026023 Ga0207677_10107489 Ga0207677_101074892 178
926 3300026023 Ga0207677_10210196 Ga0207677_102101961 178
927 3300026023 Ga0207677_10614709 Ga0207677_106147092 178
928 3300026035 Ga0207703_10002566 Ga0207703_100025668 178
929 3300026035 Ga0207703_10011107 Ga0207703_100111075 178
930 3300026035 Ga0207703_10017594 Ga0207703_100175943 178
931 3300026035 Ga0207703_10060587 Ga0207703_100605872 178
932 3300026035 Ga0207703_10065203 Ga0207703_100652032 178
933 3300026035 Ga0207703_10342696 Ga0207703_103426962 178
934 3300026035 Ga0207703_11875832 Ga0207703_118758321 178
935 3300026041 Ga0207639_10000039 Ga0207639_10000039101 178
936 3300026041 Ga0207639_10005601 Ga0207639_100056014 178
937 3300026041 Ga0207639_10027239 Ga0207639_100272392 178
938 3300026041 Ga0207639_10049320 Ga0207639_100493203 178
939 3300026041 Ga0207639_10055770 Ga0207639_100557702 178
940 3300026041 Ga0207639_10142493 Ga0207639_101424933 178
941 3300026041 Ga0207639_10175077 Ga0207639_101750772 178
942 3300026041 Ga0207639_10222753 Ga0207639_102227533 178
943 3300026041 Ga0207639_10497389 Ga0207639_104973892 178
944 3300026041 Ga0207639_10501812 Ga0207639_105018122 178
945 3300026041 Ga0207639_11201703 Ga0207639_112017031 178
946 3300026067 Ga0207678_10001258 Ga0207678_100012586 178
947 3300026067 Ga0207678_10024576 Ga0207678_100245762 178
948 3300026067 Ga0207678_10035637 Ga0207678_100356375 178
949 3300026067 Ga0207678_10067605 Ga0207678_100676053 178
950 3300026078 Ga0207702_10001337 Ga0207702_100013377 178
951 3300026078 Ga0207702_10002152 Ga0207702_1000215214 178
952 3300026078 Ga0207702_10033840 Ga0207702_100338403 178
953 3300026078 Ga0207702_10039228 Ga0207702_100392283 178
954 3300026078 Ga0207702_10056098 Ga0207702_100560982 178
955 3300026078 Ga0207702_10066241 Ga0207702_100662413 178
956 3300026078 Ga0207702_10157188 Ga0207702_101571882 178
957 3300026078 Ga0207702_10314314 Ga0207702_103143141 178
958 3300026078 Ga0207702_10374815 Ga0207702_103748152 178
959 3300026078 Ga0207702_10538589 Ga0207702_105385892 178
960 3300026078 Ga0207702_11736992 Ga0207702_117369921 178
961 3300026088 Ga0207641_10000020 Ga0207641_1000002067 178
962 3300026088 Ga0207641_10026781 Ga0207641_100267818 178
963 3300026088 Ga0207641_10030451 Ga0207641_100304513 178
964 3300026088 Ga0207641_10037094 Ga0207641_100370944 178
965 3300026089 Ga0207648_10001305 Ga0207648_1000130524 178
966 3300026089 Ga0207648_10113152 Ga0207648_101131523 178
967 3300026089 Ga0207648_10719560 Ga0207648_107195601 178
968 3300026095 Ga0207676_10000108 Ga0207676_1000010828 178
969 3300026095 Ga0207676_10008595 Ga0207676_100085952 178
970 3300026116 Ga0207674_10000512 Ga0207674_1000051222 178
971 3300026116 Ga0207674_10000514 Ga0207674_1000051422 178
972 3300026116 Ga0207674_10001113 Ga0207674_1000111317 178
973 3300026116 Ga0207674_10002979 Ga0207674_100029793 178
974 3300026116 Ga0207674_10613780 Ga0207674_106137801 178
975 3300026116 Ga0207674_11016191 Ga0207674_110161911 178
976 3300026118 Ga0207675_100006587 Ga0207675_1000065876 178
977 3300026118 Ga0207675_100115129 Ga0207675_1001151293 178
978 3300026118 Ga0207675_100314635 Ga0207675_1003146352 178
979 3300026121 Ga0207683_10000338 Ga0207683_1000033828 178
980 3300026121 Ga0207683_10000901 Ga0207683_100009015 178
981 3300026121 Ga0207683_10169373 Ga0207683_101693732 178
982 3300026142 Ga0207698_10007174 Ga0207698_100071748 178
983 3300026142 Ga0207698_10022358 Ga0207698_100223583 178
984 3300026142 Ga0207698_10046373 Ga0207698_100463732 178
985 3300026142 Ga0207698_10086674 Ga0207698_100866742 178
986 3300026142 Ga0207698_10091660 Ga0207698_100916603 178
987 3300026142 Ga0207698_10093540 Ga0207698_100935403 178
988 3300026142 Ga0207698_10186809 Ga0207698_101868092 178
989 3300026142 Ga0207698_11914477 Ga0207698_119144771 178
990 3300028017 Ga0265356_1000089 Ga0265356_10000896 178
991 3300028017 Ga0265356_1004243 Ga0265356_10042432 178
992 3300028379 Ga0268266_10002727 Ga0268266_1000272717 178
993 3300028379 Ga0268266_10025372 Ga0268266_100253723 178
994 3300028379 Ga0268266_10037812 Ga0268266_100378123 178
995 3300028379 Ga0268266_10163314 Ga0268266_101633142 178
996 3300028379 Ga0268266_10291347 Ga0268266_102913472 178
997 3300028379 Ga0268266_10597968 Ga0268266_105979682 178
998 3300028380 Ga0268265_10020295 Ga0268265_100202956 178
999 3300028380 Ga0268265_10051133 Ga0268265_100511336 178
1000 3300028380 Ga0268265_10093200 Ga0268265_100932003 178
1001 3300028381 Ga0268264_10049593 Ga0268264_100495937 178
1002 3300028381 Ga0268264_10052779 Ga0268264_100527795 178
1003 3300028381 Ga0268264_10211321 Ga0268264_102113213 178
1004 3300028381 Ga0268264_10211423 Ga0268264_102114232 178
1005 3300028381 Ga0268264_10302087 Ga0268264_103020872 178
1006 3300028577 Ga0265318_10083111 Ga0265318_100831112 178
1007 3300028653 Ga0265323_10044904 Ga0265323_100449042 178
1008 3300028666 Ga0265336_10000690 Ga0265336_1000069012 178
1009 3300028666 Ga0265336_10020963 Ga0265336_100209631 178
1010 3300028800 Ga0265338_10003155 Ga0265338_1000315516 178
1011 3300028800 Ga0265338_10004667 Ga0265338_100046676 178
1012 3300028800 Ga0265338_10013138 Ga0265338_100131383 178
1013 3300028800 Ga0265338_10100909 Ga0265338_101009093 178
1014 3300028800 Ga0265338_10109205 Ga0265338_101092053 178
1015 3300029957 Ga0265324_10056549 Ga0265324_100565492 178
1016 3300030760 Ga0265762_1000444 Ga0265762_10004447 178
1017 3300030878 Ga0265770_1047723 Ga0265770_10477232 178
1018 3300030889 Ga0265761_107395 Ga0265761_1073951 178
1019 3300031090 Ga0265760_10000657 Ga0265760_100006571 178
1020 3300031090 Ga0265760_10001080 Ga0265760_100010804 178
1021 3300031090 Ga0265760_10001419 Ga0265760_100014193 178
1022 3300031090 Ga0265760_10050308 Ga0265760_100503081 178
1023 3300031090 Ga0265760_10064283 Ga0265760_100642832 178
1024 3300031235 Ga0265330_10000773 Ga0265330_100007733 178
1025 3300031235 Ga0265330_10051884 Ga0265330_100518841 178
1026 3300031235 Ga0265330_10156639 Ga0265330_101566391 178
1027 3300031238 Ga0265332_10003390 Ga0265332_100033904 178
1028 3300031239 Ga0265328_10001179 Ga0265328_100011792 178
1029 3300031240 Ga0265320_10037975 Ga0265320_100379753 178
1030 3300031240 Ga0265320_10163779 Ga0265320_101637792 178
1031 3300031241 Ga0265325_10002440 Ga0265325_100024403 178
1032 3300031241 Ga0265325_10003695 Ga0265325_100036956 178
1033 3300031241 Ga0265325_10007159 Ga0265325_100071592 178
1034 3300031241 Ga0265325_10024769 Ga0265325_100247693 178
1035 3300031241 Ga0265325_10057159 Ga0265325_100571591 178
1036 3300031241 Ga0265325_10095920 Ga0265325_100959202 178
1037 3300031242 Ga0265329_10007984 Ga0265329_100079843 178
1038 3300031247 Ga0265340_10003620 Ga0265340_100036205 178
1039 3300031247 Ga0265340_10009673 Ga0265340_100096732 178
1040 3300031247 Ga0265340_10019157 Ga0265340_100191572 178
1041 3300031247 Ga0265340_10097734 Ga0265340_100977342 178
1042 3300031249 Ga0265339_10000023 Ga0265339_1000002398 178
1043 3300031249 Ga0265339_10000956 Ga0265339_1000095613 178
1044 3300031249 Ga0265339_10032065 Ga0265339_100320653 178
1045 3300031249 Ga0265339_10048759 Ga0265339_100487592 178
1046 3300031249 Ga0265339_10059479 Ga0265339_100594794 178
1047 3300031250 Ga0265331_10023716 Ga0265331_100237163 178
1048 3300031250 Ga0265331_10250095 Ga0265331_102500951 178
1049 3300031344 Ga0265316_10003318 Ga0265316_1000331811 178
1050 3300031344 Ga0265316_10005538 Ga0265316_1000553811 178
1051 3300031344 Ga0265316_10031564 Ga0265316_100315641 178
1052 3300031344 Ga0265316_10045139 Ga0265316_100451392 178
1053 3300031344 Ga0265316_10055070 Ga0265316_100550702 178
1054 3300031344 Ga0265316_10109174 Ga0265316_101091742 178
1055 3300031344 Ga0265316_10152502 Ga0265316_101525022 178
1056 3300031344 Ga0265316_10367435 Ga0265316_103674352 178
1057 3300031344 Ga0265316_10925666 Ga0265316_109256661 178
1058 3300031595 Ga0265313_10003395 Ga0265313_100033954 178
1059 3300031595 Ga0265313_10009123 Ga0265313_100091235 178
1060 3300031595 Ga0265313_10055262 Ga0265313_100552622 178
1061 3300031595 Ga0265313_10110711 Ga0265313_101107111 178
1062 3300031595 Ga0265313_10181797 Ga0265313_101817972 178
1063 3300031711 Ga0265314_10000920 Ga0265314_1000092023 178
1064 3300031711 Ga0265314_10023696 Ga0265314_100236965 178
1065 3300031711 Ga0265314_10045585 Ga0265314_100455853 178
1066 3300031711 Ga0265314_10096051 Ga0265314_100960513 178
1067 3300031712 Ga0265342_10000246 Ga0265342_1000024640 178
1068 3300031712 Ga0265342_10010606 Ga0265342_100106062 178
1069 3300031712 Ga0265342_10075291 Ga0265342_100752913 178
1070 3300031712 Ga0265342_10120238 Ga0265342_101202382 178
1071 3300031712 Ga0265342_10267784 Ga0265342_102677841 178
1072 3300033547 Ga0316212_1011107 Ga0316212_10111072 178
1073 3300034820 Ga0373959_0084181 Ga0373959_0084181_186_722 178
1074 3300034957 Ga0373938_0030968 Ga0373938_0030968_182_718 178
1075 3300035083 Ga0373926_0002357 Ga0373926_0002357_2506_3042 178
1076 3300035086 Ga0373934_0001891 Ga0373934_0001891_33_569 178
1077 3300035086 Ga0373934_0074375 Ga0373934_0074375_424_960 178
1078 3300035088 Ga0373940_0055364 Ga0373940_0055364_180_716 178
1079 3300035089 Ga0373944_0012527 Ga0373944_0012527_532_1068 178
1080 3300035111 Ga0373923_0003850 Ga0373923_0003850_3151_3687 178
1081 3300035111 Ga0373923_0097680 Ga0373923_0097680_309_845 178
1082 3300035111 Ga0373923_0194678 Ga0373923_0194678_113_664 178
1083 3300035112 Ga0373932_0071521 Ga0373932_0071521_499_1035 178
1084 3300035113 Ga0373936_0003211 Ga0373936_0003211_782_1318 178
1085 3300035113 Ga0373936_0008529 Ga0373936_0008529_3291_3827 178
1086 3300035113 Ga0373936_0047563 Ga0373936_0047563_856_1392 178
1087 3300035115 Ga0373941_0022768 Ga0373941_0022768_185_721 178
1088 3300035116 Ga0373945_0001694 Ga0373945_0001694_4700_5236 178
1089 3300035116 Ga0373945_0127326 Ga0373945_0127326_82_618 178
1090 3300035117 Ga0373953_0092713 Ga0373953_0092713_612_1148 178
1091 3300035117 Ga0373953_0165104 Ga0373953_0165104_196_732 178
1092 3300035118 Ga0373954_0066770 Ga0373954_0066770_532_1068 178
1093 3300035118 Ga0373954_0137140 Ga0373954_0137140_356_892 178
1094 3300035118 Ga0373954_0413441 Ga0373954_0413441_34_570 178
1095 3300035119 Ga0373956_0026184 Ga0373956_0026184_848_1384 178
1096 3300035119 Ga0373956_0041996 Ga0373956_0041996_1226_1762 178
1097 3300035120 Ga0373957_0046084 Ga0373957_0046084_37_573 178
1098 3300035170 Ga0373943_0016509 Ga0373943_0016509_124_660 178
1099 3300035170 Ga0373943_0225106 Ga0373943_0225106_221_757 178
1100 3300035171 Ga0373946_0026579 Ga0373946_0026579_1493_2050 178
1101 3300035171 Ga0373946_0072128 Ga0373946_0072128_731_1267 178
1102 3300035171 Ga0373946_0319506 Ga0373946_0319506_141_677 178
1103 3300035172 Ga0373955_0014842 Ga0373955_0014842_2832_3368 178
1104 3300035172 Ga0373955_0294895 Ga0373955_0294895_294_830 178
1105 3300035172 Ga0373955_0402713 Ga0373955_0402713_60_596 178
1106 3300035207 Ga0373942_0174181 Ga0373942_0174181_64_600 178
1107 3300035241 Ga0373961_0118487 Ga0373961_0118487_153_689 178
1108 3300035242 Ga0373962_0234035 Ga0373962_0234035_17_553 178
1109 3300035410 Ga0373924_0038593 Ga0373924_0038593_1276_1812 178
1110 3300035410 Ga0373924_0057188 Ga0373924_0057188_248_784 178
1111 3300035410 Ga0373924_0105065 Ga0373924_0105065_668_1204 178
1112 3300035691 Ga0373931_0012837 Ga0373931_0012837_2217_2753 178
1113 3300035691 Ga0373931_0055596 Ga0373931_0055596_292_828 178
1114 3300035691 Ga0373931_0122980 Ga0373931_0122980_540_1076 178
1115 3300035691 Ga0373931_0402983 Ga0373931_0402983_10_546 178
1116 3300035692 Ga0373935_0000635 Ga0373935_0000635_14725_15261 178
1117 3300035692 Ga0373935_0068571 Ga0373935_0068571_750_1286 178
1118 3300035692 Ga0373935_0234625 Ga0373935_0234625_407_943 178
1119 3300035692 Ga0373935_0435370 Ga0373935_0435370_399_935 178
1120 3300035695 Ga0373927_0000129 Ga0373927_0000129_24637_25173 178
1121 3300035695 Ga0373927_0001713 Ga0373927_0001713_15558_16094 178
1122 3300035695 Ga0373927_0021495 Ga0373927_0021495_2303_2839 178
1123 3300035695 Ga0373927_0326999 Ga0373927_0326999_95_631 178
1124 3300035724 Ga0373933_0010474 Ga0373933_0010474_1285_1821 178
1125 3300035724 Ga0373933_0023540 Ga0373933_0023540_1955_2491 178
1126 3300035724 Ga0373933_0027412 Ga0373933_0027412_439_975 178
1127 3300035724 Ga0373933_0035020 Ga0373933_0035020_774_1310 178
1128 3300035725 Ga0373947_0001395 Ga0373947_0001395_12607_13143 178
1129 3300035725 Ga0373947_0029480 Ga0373947_0029480_1604_2140 178
1130 3300035725 Ga0373947_0034325 Ga0373947_0034325_856_1392 178
1131 3300035725 Ga0373947_0132243 Ga0373947_0132243_892_1428 178
1132 3300035725 Ga0373947_0177063 Ga0373947_0177063_142_678 178
1133 3300036401 Ga0373937_0000026 Ga0373937_0000026_51404_51961 178
1134 3300036401 Ga0373937_0006803 Ga0373937_0006803_2536_3072 178
1135 3300036401 Ga0373937_0042418 Ga0373937_0042418_1972_2508 178
1136 3300036401 Ga0373937_0048394 Ga0373937_0048394_1204_1740 178
1137 3300036401 Ga0373937_0181400 Ga0373937_0181400_379_915 178
1138 3300036401 Ga0373937_0398267 Ga0373937_0398267_559_1095 178
1139 3300036401 Ga0373937_0493545 Ga0373937_0493545_77_613 178
1140 3300036401 Ga0373937_0508147 Ga0373937_0508147_39_575 178
1141 3300036401 Ga0373937_1216903 Ga0373937_1216903_58_594 178
1142 3300037068 Ga0373925_0016669 Ga0373925_0016669_4325_4861 178
1143 3300037068 Ga0373925_0042992 Ga0373925_0042992_2134_2670 178
1144 3300037068 Ga0373925_0120081 Ga0373925_0120081_1140_1676 178
1145 3300037466 Ga0395898_0556310 Ga0395898_0556310_109_645 178
1146 3300037471 Ga0395905_0183081 Ga0395905_0183081_501_1037 178
1147 3300039437 Ga0436365_0917558 Ga0436365_0917558_2098_2634 178
1148 3300039438 Ga0436360_0636776 Ga0436360_0636776_97_633 178
1149 3300039438 Ga0436360_1008501 Ga0436360_1008501_242_778 178
1150 3300039438 Ga0436360_1036143 Ga0436360_1036143_9911_10447 178
1151 3300039438 Ga0436360_1342551 Ga0436360_1342551_100_636 178
1152 3300039447 Ga0436361_0038755 Ga0436361_0038755_15250_15786 178
1153 3300039447 Ga0436361_0581985 Ga0436361_0581985_505_1041 178
1154 3300039447 Ga0436361_0937014 Ga0436361_0937014_188_724 178
1155 3300039450 Ga0436363_0438067 Ga0436363_0438067_182_718 178
1156 3300041496 Ga0451839_0203465 Ga0451839_0203465_170_706 178
1157 3300042876 Ga0451577_0000334 Ga0451577_0000334_60098_60634 178
1158 3300044656 Ga0466969_0030079 Ga0466969_0030079_158_694 178
1159 3300044673 Ga0453683_0027092 Ga0453683_0027092_2338_2874 178
1160 3300044673 Ga0453683_0034678 Ga0453683_0034678_1742_2278 178
1161 3300044693 Ga0466961_0052368 Ga0466961_0052368_886_1422 178
1162 3300044694 Ga0466963_0003711 Ga0466963_0003711_186_722 178
1163 3300044694 Ga0466963_0011178 Ga0466963_0011178_2911_3456 178
1164 3300044694 Ga0466963_0041850 Ga0466963_0041850_934_1470 178
1165 3300044712 Ga0453684_0000429 Ga0453684_0000429_15851_16387 178
1166 3300044712 Ga0453684_0231671 Ga0453684_0231671_1198_1734 178
1167 3300044735 Ga0466968_0519656 Ga0466968_0519656_34_570 178
1168 3300044842 Ga0466957_0092402 Ga0466957_0092402_28_564 178
1169 3300044842 Ga0466957_0803115 Ga0466957_0803115_112_657 178
1170 3300045049 Ga0466959_0091061 Ga0466959_0091061_1280_1816 178
1171 3300045049 Ga0466959_0279844 Ga0466959_0279844_531_1067 178
1172 3300045051 Ga0451576_0027033 Ga0451576_0027033_372_908 178
1173 3300045051 Ga0451576_0046090 Ga0451576_0046090_3860_4396 178
1174 3300045051 Ga0451576_0330742 Ga0451576_0330742_953_1489 178
1175 3300045051 Ga0451576_0735149 Ga0451576_0735149_91_627 178
1176 3300045836 Ga0466958_0568379 Ga0466958_0568379_120_656 178
1177 3300045976 Ga0466967_0005265 Ga0466967_0005265_5380_5916 178
1178 3300045976 Ga0466967_0014407 Ga0466967_0014407_4188_4733 178
1179 3300045976 Ga0466967_0014854 Ga0466967_0014854_891_1427 178
1180 3300045976 Ga0466967_0100642 Ga0466967_0100642_334_870 178
1181 3300045976 Ga0466967_0365244 Ga0466967_0365244_476_1012 178
1182 3300046457 Ga0495590_0055420 Ga0495590_0055420_357_893 178
1183 3300046459 Ga0495629_0253557 Ga0495629_0253557_288_824 178
1184 3300046462 Ga0495651_0271800 Ga0495651_0271800_557_1093 178
1185 3300046462 Ga0495651_0325550 Ga0495651_0325550_267_824 178
1186 3300046462 Ga0495651_0654993 Ga0495651_0654993_73_609 178
1187 3300046472 Ga0495580_0000205 Ga0495580_0000205_6554_7090 178
1188 3300046472 Ga0495580_0027377 Ga0495580_0027377_1094_1630 178
1189 3300046472 Ga0495580_0030976 Ga0495580_0030976_2441_2977 178
1190 3300046472 Ga0495580_0033882 Ga0495580_0033882_2959_3495 178
1191 3300046472 Ga0495580_0044870 Ga0495580_0044870_573_1109 178
1192 3300046472 Ga0495580_0047100 Ga0495580_0047100_951_1487 178
1193 3300046472 Ga0495580_0066793 Ga0495580_0066793_1569_2105 178
1194 3300046472 Ga0495580_0092557 Ga0495580_0092557_99_635 178
1195 3300046472 Ga0495580_0184812 Ga0495580_0184812_454_990 178
1196 3300046472 Ga0495580_0210050 Ga0495580_0210050_253_789 178
1197 3300046472 Ga0495580_0311994 Ga0495580_0311994_195_731 178
1198 3300046472 Ga0495580_0600732 Ga0495580_0600732_111_647 178
1199 3300046473 Ga0495582_0001193 Ga0495582_0001193_23_559 178
1200 3300046477 Ga0495664_0247664 Ga0495664_0247664_108_644 178
1201 3300046491 Ga0495584_0174954 Ga0495584_0174954_433_969 178
1202 3300046511 Ga0495608_0083196 Ga0495608_0083196_159_695 178
1203 3300046517 Ga0495630_0079346 Ga0495630_0079346_1689_2246 178
1204 3300046517 Ga0495630_0089158 Ga0495630_0089158_1105_1641 178
1205 3300046517 Ga0495630_0462374 Ga0495630_0462374_425_961 178
1206 3300046529 Ga0495652_0069992 Ga0495652_0069992_1574_2110 178
1207 3300046529 Ga0495652_0117031 Ga0495652_0117031_579_1115 178
1208 3300046529 Ga0495652_0230675 Ga0495652_0230675_373_909 178
1209 3300046531 Ga0495665_0038406 Ga0495665_0038406_591_1127 178
1210 3300046531 Ga0495665_0262145 Ga0495665_0262145_291_827 178
1211 3300046531 Ga0495665_0506843 Ga0495665_0506843_15_551 178
1212 3300046536 Ga0495587_0051708 Ga0495587_0051708_218_754 178
1213 3300046536 Ga0495587_0152561 Ga0495587_0152561_521_1057 178
1214 3300046536 Ga0495587_0367482 Ga0495587_0367482_167_703 178
1215 3300046536 Ga0495587_0535483 Ga0495587_0535483_53_589 178
1216 3300046543 Ga0495645_0364012 Ga0495645_0364012_49_585 178
1217 3300046663 Ga0495635_0276839 Ga0495635_0276839_333_869 178
1218 3300046663 Ga0495635_0305265 Ga0495635_0305265_234_770 178
1219 3300046674 Ga0495588_0275236 Ga0495588_0275236_207_743 178
1220 3300046679 Ga0495623_0075012 Ga0495623_0075012_152_688 178
1221 3300046679 Ga0495623_0198361 Ga0495623_0198361_580_1116 178
1222 3300046679 Ga0495623_0443095 Ga0495623_0443095_61_597 178
1223 3300046680 Ga0495646_0208705 Ga0495646_0208705_153_689 178
1224 3300046683 Ga0495658_0509085 Ga0495658_0509085_190_741 178
1225 3300046689 Ga0495613_0149539 Ga0495613_0149539_726_1262 178
1226 3300046690 Ga0495624_0335881 Ga0495624_0335881_41_577 178
1227 3300046690 Ga0495624_0501738 Ga0495624_0501738_136_672 178
1228 3300047315 Ga0495581_0092987 Ga0495581_0092987_308_844 178
1229 3300047315 Ga0495581_0102040 Ga0495581_0102040_79_615 178
1230 3300047319 Ga0495674_0056217 Ga0495674_0056217_265_801 178
1231 3300047319 Ga0495674_0088956 Ga0495674_0088956_1092_1628 178
1232 3300047321 Ga0495676_0153372 Ga0495676_0153372_1038_1574 178
1233 3300047444 Ga0495675_0095348 Ga0495675_0095348_238_774 178
1234 3300047444 Ga0495675_0129950 Ga0495675_0129950_494_1030 178
1235 3300047444 Ga0495675_0516537 Ga0495675_0516537_31_567 178
1236 3300047471 Ga0495684_0761296 Ga0495684_0761296_31_567 178
1237 3300047673 Ga0495593_0200586 Ga0495593_0200586_232_768 178
1238 3300048088 Ga0495602_0021528 Ga0495602_0021528_4754_5290 178
1239 3300048088 Ga0495602_0084417 Ga0495602_0084417_1786_2322 178
1240 3300048088 Ga0495602_0109196 Ga0495602_0109196_286_822 178
1241 3300048088 Ga0495602_0164898 Ga0495602_0164898_508_1044 178
1242 3300048088 Ga0495602_0187691 Ga0495602_0187691_434_970 178
1243 3300048903 Ga0496100_0049155 Ga0496100_0049155_685_1221 178
1244 3300048903 Ga0496100_0263859 Ga0496100_0263859_79_615 178
1245 3300048903 Ga0496100_0299268 Ga0496100_0299268_643_1179 178
1246 3300048903 Ga0496100_0362859 Ga0496100_0362859_221_757 178
1247 3300048903 Ga0496100_0778061 Ga0496100_0778061_51_587 178
1248 3300048904 Ga0496101_0330883 Ga0496101_0330883_525_1061 178
1249 3300048904 Ga0496101_0398031 Ga0496101_0398031_369_905 178
1250 3300048904 Ga0496101_0966658 Ga0496101_0966658_38_574 178
1251 3300048905 Ga0496102_0021508 Ga0496102_0021508_1215_1751 178
1252 3300048905 Ga0496102_0025853 Ga0496102_0025853_1756_2292 178
1253 3300048905 Ga0496102_0131874 Ga0496102_0131874_1168_1704 178
1254 3300048905 Ga0496102_0144522 Ga0496102_0144522_755_1291 178
1255 3300048905 Ga0496102_0332665 Ga0496102_0332665_66_602 178
1256 3300048905 Ga0496102_0473300 Ga0496102_0473300_169_705 178
1257 3300048906 Ga0496103_0014424 Ga0496103_0014424_3923_4459 178
1258 3300048906 Ga0496103_0019906 Ga0496103_0019906_948_1484 178
1259 3300048906 Ga0496103_0349340 Ga0496103_0349340_233_769 178
1260 3300048906 Ga0496103_0415392 Ga0496103_0415392_235_771 178
1261 3300048907 Ga0496104_0006973 Ga0496104_0006973_3716_4252 178
1262 3300048907 Ga0496104_0008836 Ga0496104_0008836_7737_8273 178
1263 3300048907 Ga0496104_0047108 Ga0496104_0047108_3381_3917 178
1264 3300048907 Ga0496104_0058232 Ga0496104_0058232_1503_2039 178
1265 3300048907 Ga0496104_0180160 Ga0496104_0180160_1470_2006 178
1266 3300048907 Ga0496104_0306233 Ga0496104_0306233_226_762 178
1267 3300048907 Ga0496104_0585365 Ga0496104_0585365_149_685 178
1268 3300048907 Ga0496104_0667363 Ga0496104_0667363_196_732 178
1269 3300048908 Ga0496105_0463964 Ga0496105_0463964_60_596 178
1270 3300048908 Ga0496105_0731221 Ga0496105_0731221_205_741 178
1271 3300048909 Ga0496106_0012270 Ga0496106_0012270_4041_4577 178
1272 3300048909 Ga0496106_0045170 Ga0496106_0045170_398_934 178
1273 3300048909 Ga0496106_0083956 Ga0496106_0083956_560_1096 178
1274 3300048909 Ga0496106_0090384 Ga0496106_0090384_1668_2204 178
1275 3300048909 Ga0496106_0408041 Ga0496106_0408041_160_696 178
1276 3300048909 Ga0496106_0830185 Ga0496106_0830185_56_592 178
1277 3300048910 Ga0496107_0107228 Ga0496107_0107228_1223_1759 178
1278 3300048910 Ga0496107_0818732 Ga0496107_0818732_32_568 178
1279 3300048911 Ga0496108_0000215 Ga0496108_0000215_41230_41766 178
1280 3300048912 Ga0496109_0000018 Ga0496109_0000018_67665_68201 178
1281 3300048912 Ga0496109_0021295 Ga0496109_0021295_4514_5050 178
1282 3300048912 Ga0496109_0075051 Ga0496109_0075051_1694_2230 178
1283 3300048913 Ga0496110_0001385 Ga0496110_0001385_11515_12051 178
1284 3300048913 Ga0496110_0013034 Ga0496110_0013034_2350_2886 178
1285 3300048913 Ga0496110_0296417 Ga0496110_0296417_397_933 178
1286 3300048914 Ga0496111_0008136 Ga0496111_0008136_3652_4188 178
1287 3300048914 Ga0496111_0047840 Ga0496111_0047840_922_1458 178
1288 3300048914 Ga0496111_0163931 Ga0496111_0163931_834_1370 178
1289 3300048914 Ga0496111_0384509 Ga0496111_0384509_397_933 178
1290 3300048915 Ga0496112_0000248 Ga0496112_0000248_30508_31044 178
1291 3300048915 Ga0496112_0004294 Ga0496112_0004294_11066_11602 178
1292 3300048915 Ga0496112_0008088 Ga0496112_0008088_3719_4255 178
1293 3300048915 Ga0496112_0013775 Ga0496112_0013775_195_731 178
1294 3300048915 Ga0496112_0025914 Ga0496112_0025914_751_1287 178
1295 3300048915 Ga0496112_0036283 Ga0496112_0036283_1649_2185 178
1296 3300048915 Ga0496112_0075002 Ga0496112_0075002_590_1126 178
1297 3300048915 Ga0496112_0107651 Ga0496112_0107651_1989_2525 178
1298 3300048915 Ga0496112_0162792 Ga0496112_0162792_1471_2007 178
1299 3300048915 Ga0496112_0168272 Ga0496112_0168272_78_614 178
1300 3300048915 Ga0496112_0559524 Ga0496112_0559524_521_1057 178
1301 3300048915 Ga0496112_0857752 Ga0496112_0857752_215_751 178
1302 3300048915 Ga0496112_1110656 Ga0496112_1110656_113_649 178
1303 3300048915 Ga0496112_1379769 Ga0496112_1379769_60_596 178
1304 3300048916 Ga0496113_0000297 Ga0496113_0000297_5977_6513 178
1305 3300048916 Ga0496113_0009290 Ga0496113_0009290_2778_3314 178
1306 3300048916 Ga0496113_0266319 Ga0496113_0266319_265_801 178
1307 3300048916 Ga0496113_0287917 Ga0496113_0287917_543_1079 178
1308 3300048916 Ga0496113_0411395 Ga0496113_0411395_271_807 178
1309 3300048916 Ga0496113_1195498 Ga0496113_1195498_44_580 178
1310 3300048917 Ga0496114_0034080 Ga0496114_0034080_1225_1761 178
1311 3300048917 Ga0496114_0653956 Ga0496114_0653956_129_665 178
1312 3300048918 Ga0496115_0021813 Ga0496115_0021813_3942_4478 178
1313 3300048918 Ga0496115_0039205 Ga0496115_0039205_925_1461 178
1314 3300048918 Ga0496115_0273053 Ga0496115_0273053_784_1320 178
1315 3300048918 Ga0496115_0471330 Ga0496115_0471330_116_652 178
1316 3300048923 Ga0496120_0298142 Ga0496120_0298142_113_649 178
1317 3300048929 Ga0496126_0000018 Ga0496126_0000018_77360_77899 178
1318 3300048929 Ga0496126_0005215 Ga0496126_0005215_3171_3710 178
1319 3300049460 Ga0495682_0106806 Ga0495682_0106806_368_919 178
1320 3300049460 Ga0495682_0157956 Ga0495682_0157956_238_786 178
1321 3300049583 Ga0501067_0050464 Ga0501067_0050464_1461_1997 178
1322 3300049583 Ga0501067_0096834 Ga0501067_0096834_645_1181 178
1323 3300049583 Ga0501067_0223044 Ga0501067_0223044_328_864 178
1324 3300049589 Ga0501073_0067240 Ga0501073_0067240_1693_2229 178
1325 3300049593 Ga0501077_0480392 Ga0501077_0480392_64_600 178
1326 3300050507 nmdc:mga05p37_291762_c1 nmdc:mga05p37_291762_c1_88_624 178
1327 3300050507 nmdc:mga05p37_45380_c1 nmdc:mga05p37_45380_c1_2327_2866 178
1328 3300050512 nmdc:mga0n895_102_c1 nmdc:mga0n895_102_c1_41671_42207 178
1329 3300050512 nmdc:mga0n895_220843_c1 nmdc:mga0n895_220843_c1_26_562 178
1330 3300050512 nmdc:mga0n895_5895_c1 nmdc:mga0n895_5895_c1_5769_6305 178
1331 3300050513 nmdc:mga0rr50_110_c1 nmdc:mga0rr50_110_c1_9516_10052 178
1332 3300050513 nmdc:mga0rr50_122804_c1 nmdc:mga0rr50_122804_c1_347_883 178
1333 3300050513 nmdc:mga0rr50_489156_c1 nmdc:mga0rr50_489156_c1_110_646 178
1334 3300050513 nmdc:mga0rr50_844412_c1 nmdc:mga0rr50_844412_c1_183_719 178
1335 3300050514 nmdc:mga08x19_136557_c1 nmdc:mga08x19_136557_c1_1014_1550 178
1336 3300050514 nmdc:mga08x19_2079_c1 nmdc:mga08x19_2079_c1_7179_7715 178
1337 3300050514 nmdc:mga08x19_51372_c1 nmdc:mga08x19_51372_c1_1331_1867 178
1338 3300050514 nmdc:mga08x19_51721_c1 nmdc:mga08x19_51721_c1_432_968 178
1339 3300050514 nmdc:mga08x19_53017_c1 nmdc:mga08x19_53017_c1_705_1241 178
1340 3300050514 nmdc:mga08x19_5766_c1 nmdc:mga08x19_5766_c1_4571_5107 178
1341 3300050514 nmdc:mga08x19_847256_c1 nmdc:mga08x19_847256_c1_46_582 178
1342 3300050514 nmdc:mga08x19_94853_c1 nmdc:mga08x19_94853_c1_443_979 178
1343 3300050515 nmdc:mga0a205_131_c1 nmdc:mga0a205_131_c1_36636_37172 178
1344 3300050515 nmdc:mga0a205_924037_c1 nmdc:mga0a205_924037_c1_114_650 178
1345 3300053077 Ga0495601_0124129 Ga0495601_0124129_943_1479 178
1346 3300053077 Ga0495601_0154737 Ga0495601_0154737_276_812 178
1347 3300053084 Ga0495595_0099139 Ga0495595_0099139_435_971 178
1348 3300053085 Ga0495619_0148361 Ga0495619_0148361_879_1415 178
1349 3300054114 Ga0501084_0061125 Ga0501084_0061125_154_690 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02572

CobA_CobO_BtuR

ATP:corrinoid adenosyltransferase BtuR/CobO/CobP

34

207

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.9154 6 164
1g64-assembly1.cif.gz_B the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex 0.8997 6 169
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.8989 6 164
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8604 6 178
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8557 6 178
ID Description Score Start End Superfamily
1g64B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8997 6 169 3.40.50.300
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8872 6 164 3.40.50.300
1g5rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8706 6 164 3.40.50.300
af_I6Y1V6_9_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8674 1 169 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8517 6 178 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9VU14-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.9593 1 164 GO:0005524
GO:0008817
GO:0009236
AF-A0A661K7H6-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase (EC 2.5.1.17) 0.9512 6 160 GO:0005524
GO:0008817
GO:0009236
AF-A0A2V9VU14-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.948 1 164 GO:0005524
GO:0008817
GO:0009236
AF-A0A7J3MBS0-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase (EC 2.5.1.17) 0.9452 5 167 GO:0005524
GO:0008817
GO:0009236
AF-A0A7X3Y6A6-F1-model_v4 corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9388 6 162 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
82.78 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map