F493322

General Info

Members Datasets Scaffolds Average Seq Length
1359 854 881 622

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0001459|Ga0496117_0001459_9156_11306
Length 698
Sequence MLPTRLQGWIYTVSRDRAPANLPRRQAGAAIQASCFCPALENPPHHPYPLSQPPRRARHRPRSIVTVTEQTQKQTLGFQTEVKQLLQLMIHSLYSNKEIFLRELISNAADASDKLRFEALTQPALLENDGDLRIRVSFDADAHTLTIDDNGIGMSREDAIAHLGTIAKSGTGDFLRQLSGDQKKDSQLIGQFGVGFYSAFIVADQVDVYSRRAGLPATEGVHWSSRGEGEFDVEAIDKPERGTRIVLHLKDDQHDFADGWRLRGIIKKYSDHIGLPIQMVKEHHGDDAPAEVEWETVNRASALWTRPRTEISDAEYQEFYKHAAHDHQDALAWSHNKVEGKLEYTSLLYVPGHAPFDLYHRDAPKGLKLYVQRVFVMDQAEQFLPMYLRFIKGVVDSNDLSLNVSREILQSGPVIDSMKSALTKRSLDMLDKLATDKPEVYAGFWKQFGQVLKEGPAEDFNNREKIAGLLRFASTHDASGEQSVSLADYVGRMIEGQDKIYYLTGDSYTQVKDSPHLEVFRKKGIEVLLFTDRIDEWLMGYLTEFDGKSFVDVARGDLDLGALESAEDKQAQEEXXXXKQGLVDRIKAALGEDVADVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQKVPDSKPVFEFNPGHPLIGKLDQEADAARFDDLSRVLFEQAALAAGDTLKDPAAYVRRLNKLLLELSA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231023 Pseudomonas sp. GM80 Isolate Nodule
26 2511231024 Pseudomonas sp. GM84 Isolate Nodule
27 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
28 2511231031 Pseudomonas sp. GM16 Isolate Nodule
29 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
33 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
34 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
35 2547132181 Kosakonia sacchari SP1 Isolate Stem
36 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
37 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
38 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
39 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
40 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
41 2561511199 Enterobacter sp. R4-368 Isolate Nodule
42 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
43 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
44 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
45 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
46 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
47 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
48 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
49 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
50 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
51 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
52 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
53 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
54 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
55 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
56 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
57 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
58 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
59 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
60 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
61 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
62 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
63 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
64 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
65 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
66 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
67 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
68 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
69 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
70 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
71 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
72 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
73 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
74 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
75 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
76 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
77 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
78 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
79 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
80 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
81 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
82 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
83 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
84 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
85 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
86 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
87 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
88 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
89 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
90 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
91 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
92 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
93 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
94 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
95 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
96 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
97 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
98 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
99 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
100 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
101 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
102 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
103 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
104 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
105 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
106 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
107 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
108 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
109 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
110 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
111 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
112 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
113 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
114 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
115 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
116 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
117 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
118 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
119 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
120 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
121 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
122 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
123 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
124 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
125 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
126 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
127 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
128 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
129 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
130 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
131 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
132 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
133 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
134 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
135 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
136 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
137 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
138 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
139 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
140 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
141 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
142 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
143 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
144 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
145 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
146 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
147 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
148 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
149 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
150 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
151 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
152 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
153 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
154 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
155 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
156 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
157 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
158 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
159 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
160 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
161 2636415599 Klebsiella variicola DX120E Isolate Unclassified
162 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
163 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
164 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
165 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
166 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
167 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
168 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
169 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
170 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
171 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
172 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
173 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
174 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
175 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
176 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
177 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
178 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
179 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
180 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
181 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
182 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
183 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
184 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
185 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
186 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
187 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
188 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
189 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
190 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
191 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
192 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
193 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
194 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
195 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
196 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
197 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
198 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
199 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
200 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
201 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
202 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
203 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
204 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
205 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
206 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
207 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
208 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
209 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
210 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
211 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
212 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
213 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
214 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
215 2751185917 Enterobacter sp. HK169 Isolate Unclassified
216 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
217 2765235841 Pseudomonas putida AA7 Isolate Unclassified
218 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
219 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
220 2773857670 Pseudomonas sp. 478 Isolate Unclassified
221 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
222 2773857673 Pseudomonas sp. 443 Isolate Unclassified
223 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
224 2775507074 Klebsiella sp. D5A Isolate Unclassified
225 2784132063 Pseudomonas sp. 424 Isolate Unclassified
226 2784132072 Pseudomonas sp. 460 Isolate Unclassified
227 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
228 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
229 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
230 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
231 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
232 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
233 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
234 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
235 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
236 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
237 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
238 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
239 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
240 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
241 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
242 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
243 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
244 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
245 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
246 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
247 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
248 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
249 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
250 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
251 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
252 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
253 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
254 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
255 2818991457 Xanthomonas translucens 569 Isolate Unclassified
256 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
257 2821118458 Enterobacter asburiae 609 Isolate Unclassified
258 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
259 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
260 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
261 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
262 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
263 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
264 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
265 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
266 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
267 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
268 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
269 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
270 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
271 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
272 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
273 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
274 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
275 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
276 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
277 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
278 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
279 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
280 2847085930 Erwinia persicina B64 Isolate Bulb
281 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
282 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
283 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
284 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
285 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
286 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
287 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
288 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
289 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
290 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
291 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
292 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
293 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
294 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
295 2865014394 Pantoea sp. R-71966 Isolate Unclassified
296 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
297 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
298 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
299 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
300 2876601092 Pantoea endophytica 596 Isolate Unclassified
301 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
302 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
303 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
304 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
305 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
306 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
307 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
308 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
309 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
310 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
311 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
312 2904504865 Serratia marcescens 1822 Isolate Unclassified
313 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
314 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
315 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
316 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
317 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
318 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
319 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
320 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
321 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
322 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
323 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
324 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
325 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
326 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
327 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
328 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
329 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
330 2919150387 Rahnella aceris 1817 Isolate Unclassified
331 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
332 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
333 2919404418 Luteibacter sp. 3190 Isolate Unclassified
334 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
335 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
336 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
337 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
338 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
339 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
340 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
341 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
342 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
343 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
344 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
345 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
346 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
347 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
348 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
349 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
350 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
351 2927143783 Rahnella sp. 2050 Isolate Unclassified
352 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
353 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
354 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
355 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
356 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
357 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
358 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
359 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
360 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
361 2932406140 Serratia sp. 2723 Isolate Rhizosphere
362 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
363 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
364 2937539931 Pantoea sp. LS15 Isolate Unclassified
365 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
366 2937967321 Serratia sp. YC16 Isolate Unclassified
367 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
368 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
369 2939577877 Serratia sp. 509 Isolate Rhizosphere
370 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
371 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
372 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
373 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
374 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
375 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
376 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
377 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
378 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
379 2941471342 Luteibacter sp. 621 Isolate Unclassified
380 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
381 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
382 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
383 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
384 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
385 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
386 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
387 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
388 2952252522 Salinicola sp. DM10 Isolate Unclassified
389 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
390 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
391 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
392 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
393 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
394 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
395 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
396 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
397 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
398 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
399 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
400 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
401 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
402 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
403 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
404 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
405 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
406 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
407 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
408 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
409 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
410 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
411 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
412 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
413 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
414 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
415 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
416 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
417 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
418 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
419 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
420 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
421 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
422 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
423 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
424 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
425 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
426 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
427 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
428 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
429 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
430 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
431 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
432 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
433 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
434 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
435 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
436 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
437 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
438 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
439 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
440 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
441 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
442 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
443 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
444 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
445 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
446 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
447 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
448 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
449 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
450 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
451 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
452 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
453 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
454 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
455 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
456 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
457 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
458 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
459 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
460 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
461 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
462 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
463 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
464 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
465 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
466 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
467 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
468 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
469 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
470 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
471 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
472 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
473 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
474 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
475 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
476 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
477 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
478 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
479 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
480 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
481 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
482 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
483 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
484 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
485 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
486 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
487 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
488 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
489 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
490 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
491 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
492 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
493 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
494 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
495 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
496 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
497 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
498 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
499 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
500 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
501 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
502 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
503 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
504 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
505 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
506 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
507 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
508 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
509 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
510 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
511 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
512 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
513 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
514 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
515 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
516 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
517 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
518 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
519 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
520 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
521 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
522 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
523 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
524 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
525 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
526 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
527 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
528 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
529 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
530 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
531 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
532 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
533 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
534 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
535 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
536 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
537 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
538 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
539 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
540 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
541 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
542 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
543 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
544 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
545 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
546 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
547 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
548 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
549 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
550 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
551 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
552 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
555 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
557 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
558 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
559 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
560 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
562 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
563 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
564 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
565 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
566 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
568 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
569 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
570 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
572 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
612 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
613 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
614 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
615 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
616 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
617 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
618 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
620 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
621 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
622 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
623 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
624 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
625 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
626 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
627 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
628 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
629 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
630 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
631 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
632 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
633 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
634 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
635 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
636 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
637 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
638 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
642 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
643 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
644 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
645 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
646 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
647 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
648 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
649 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
650 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
651 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
652 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
653 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
654 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
655 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
656 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
657 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
658 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
659 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
660 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
661 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
662 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
663 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
664 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
665 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
666 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
667 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
668 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
669 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
670 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
671 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
672 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
673 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
674 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
675 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
676 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
677 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
678 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
679 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
680 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
681 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
682 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
683 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
684 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
685 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
686 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
687 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
688 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
689 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
690 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
691 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
692 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
693 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
694 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
695 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
696 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
697 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
698 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
699 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
700 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
701 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
702 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
703 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
704 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
705 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
706 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
707 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
708 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
709 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
710 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
711 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
712 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
713 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
714 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
715 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
716 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
717 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
718 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
719 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
720 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
721 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
722 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
723 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
724 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
725 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
726 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
727 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
728 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
729 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
730 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
731 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
732 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
733 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
734 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
735 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
736 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
737 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
738 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
739 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
740 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
741 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
742 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
743 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
744 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
745 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
746 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
747 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
748 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
749 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
750 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
751 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
752 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
753 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
754 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
755 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
756 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
757 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
758 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
759 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
760 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
761 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
762 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
763 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
764 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
765 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
766 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
767 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
768 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
769 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
770 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
771 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
772 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
773 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
774 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
775 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
776 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
777 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
778 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
779 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
780 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
781 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
782 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
783 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
784 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
785 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
786 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
787 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
788 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
789 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
790 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
791 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
792 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
793 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
794 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
795 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
796 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
797 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
798 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
799 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
800 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
801 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
802 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
803 640753048 Serratia proteamaculans 568 Isolate Endosphere
804 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
805 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
806 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
807 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
808 8004592986 Serratia sp. S119 Isolate Unclassified
809 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
810 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
811 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
812 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
813 8018221730 Enterobacter sp. CM29 Isolate Unclassified
814 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
815 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
816 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
817 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
818 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
819 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
820 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
821 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
822 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
823 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
824 8052494512 Pseudomonas putida LD6 Isolate Unclassified
825 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
826 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
827 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
828 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
829 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
830 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
831 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
832 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
833 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
834 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
835 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
836 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
837 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
838 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
839 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
840 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
841 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
842 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
843 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
844 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
845 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
846 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
847 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
848 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
849 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
850 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
851 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
852 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
853 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
854 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.46
Metatranscriptomes 0.29
Isolates 35.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0.07
Endosphere 8.02
Nodule 3.24
Rhizoplane 9.79
Rhizosphere 56.81
Stem 0.07
Stem Tuber 0.44
Unclassified 21.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_22 2124908027 Bacteria 54424
2 SwRhRL2b_contig_1225512 2162886007 Bacteria 8222
3 SwRhRL2b_contig_2054245 2162886007 Bacteria 20432
4 JGI24739J22299_10004581 3300001989 Bacteria 5285
5 JGI24738J21930_10010282 3300002075 Bacteria 2084
6 JGI24033J26618_1000010 3300002155 Bacteria 35433
7 JGI25162J39368_1000003 3300002737 Bacteria 575218
8 JGI25162J39368_1000364 3300002737 Bacteria 38678
9 JGI25162J39368_1000384 3300002737 Bacteria 37541
10 JGI25162J39368_1003369 3300002737 Bacteria 4730
11 JGI25163J39215_1000015 3300002771 Bacteria 83621
12 JGI25164J39214_1000009 3300002772 Bacteria 303437
13 JGI25164J39214_1000268 3300002772 Bacteria 38678
14 JGI25164J39214_1000481 3300002772 Bacteria 19689
15 JGI25152J39213_1000407 3300002773 Bacteria 26106
16 JGI25152J39213_1003100 3300002773 Bacteria 5813
17 JGI25150J39212_1000372 3300002774 Bacteria 21629
18 JGI25151J46595_10000558 3300003187 Bacteria 33861
19 JGI25165J46597_1000483 3300003214 Bacteria 38678
20 JGI25165J46597_1000497 3300003214 Bacteria 37887
21 JGI25153J46596_10000334 3300003215 Bacteria 33861
22 rootH2_10003079 3300003320 Bacteria 31816
23 rootH2_10040819 3300003320 Bacteria 20206
24 rootH2_10068438 3300003320 Bacteria 3674
25 rootH1_10005050 3300003316 Bacteria 9926
26 rootH1_10005050 3300003323 Bacteria 27642
27 rootH1_10089918 3300003323 Bacteria 11370
28 Ga0055538_1000005 3300003751 Bacteria 575218
29 Ga0055538_1000058 3300003751 Bacteria 112867
30 Ga0055539_1000007 3300003752 Bacteria 575218
31 Ga0055539_1000087 3300003752 Bacteria 114745
32 Ga0055533_1000009 3300003756 Bacteria 575218
33 Ga0055533_1000097 3300003756 Bacteria 112844
34 Ga0055532_1000156 3300003758 Bacteria 60124
35 Ga0055525_1000010 3300003759 Bacteria 575218
36 Ga0055525_1000426 3300003759 Bacteria 25067
37 Ga0055526_1001264 3300003771 Bacteria 18153
38 Ga0055537_1000338 3300003773 Bacteria 32024
39 Ga0055536_1001498 3300003781 Bacteria 14042
40 Ga0055536_1004488 3300003781 Bacteria 7118
41 Ga0055534_1000039 3300003784 Bacteria 104863
42 Ga0055528_1000212 3300003790 Bacteria 49305
43 Ga0055530_10000544 3300003791 Bacteria 32692
44 Ga0055530_10002926 3300003791 Bacteria 10340
45 Ga0055530_10010525 3300003791 Bacteria 3410
46 Ga0055540_1002281 3300003792 Bacteria 10340
47 Ga0055531_10000989 3300003794 Bacteria 22593
48 Ga0055541_1000005 3300003841 Bacteria 575218
49 Ga0055541_1000060 3300003841 Bacteria 112630
50 Ga0058692_1000002 3300003856 Bacteria 508401
51 Ga0058692_1000006 3300003856 Bacteria 398109
52 Ga0058692_1005261 3300003856 Bacteria 3715
53 Ga0065703_1019229 3300005272 Bacteria 3468
54 Ga0065714_10000033 3300005288 Bacteria 16088
55 Ga0065714_10003895 3300005288 Bacteria 10504
56 Ga0065704_10000433 3300005289 Bacteria 46686
57 Ga0065704_10000446 3300005289 Bacteria 30371
58 Ga0065704_10000891 3300005289 Bacteria 11438
59 Ga0065704_10003677 3300005289 Bacteria 6383
60 Ga0065704_10008060 3300005289 Bacteria 3994
61 Ga0065704_10070423 3300005289 Bacteria 25546
62 Ga0065704_10072175 3300005289 Bacteria 9007
63 Ga0065704_10080471 3300005289 Bacteria 3941
64 Ga0065704_10092388 3300005289 Bacteria 2657
65 Ga0065712_10000132 3300005290 Bacteria 73390
66 Ga0065712_10004516 3300005290 Bacteria 5341
67 Ga0070658_10004873 3300005327 Bacteria 10932
68 Ga0070658_10020102 3300005327 Bacteria 5348
69 Ga0070690_100000289 3300005330 Bacteria 25771
70 Ga0070690_100066841 3300005330 Bacteria 2328
71 Ga0070670_100000018 3300005331 Bacteria 221691
72 Ga0070670_100009488 3300005331 Bacteria 8310
73 Ga0068869_100000299 3300005334 Bacteria 26389
74 Ga0070666_10034651 3300005335 Bacteria 3345
75 Ga0070682_100002601 3300005337 Bacteria 9964
76 Ga0068868_100000531 3300005338 Bacteria 25572
77 Ga0070689_100006066 3300005340 Bacteria 8327
78 Ga0070687_100000355 3300005343 Bacteria 15578
79 Ga0070687_100025698 3300005343 Bacteria 2828
80 Ga0070661_100000029 3300005344 Bacteria 117682
81 Ga0070661_100000397 3300005344 Bacteria 33690
82 Ga0070692_10002606 3300005345 Bacteria 7035
83 Ga0070671_100000028 3300005355 Bacteria 113877
84 Ga0070659_100023292 3300005366 Bacteria 4738
85 Ga0070659_100029597 3300005366 Bacteria 4233
86 Ga0070667_100000021 3300005367 Bacteria 205662
87 Ga0070701_10000387 3300005438 Bacteria 14831
88 Ga0070705_100000472 3300005440 Bacteria 23179
89 Ga0070700_100006031 3300005441 Bacteria 6449
90 Ga0070694_100000249 3300005444 Bacteria 28513
91 Ga0070678_100025488 3300005456 Bacteria 3979
92 Ga0070662_100041876 3300005457 Bacteria 3269
93 Ga0068867_100000430 3300005459 Bacteria 28048
94 Ga0070685_10000003 3300005466 Bacteria 283138
95 Ga0068853_100000005 3300005539 Bacteria 366404
96 Ga0068853_100057280 3300005539 Bacteria 3363
97 Ga0070686_100000392 3300005544 Bacteria 27736
98 Ga0070695_100000185 3300005545 Bacteria 29879
99 Ga0070696_100000519 3300005546 Bacteria 24408
100 Ga0070696_100002012 3300005546 Bacteria 13331
101 Ga0070693_100000135 3300005547 Bacteria 33350
102 Ga0070693_100015123 3300005547 Bacteria 3968
103 Ga0070665_100001125 3300005548 Bacteria 32880
104 Ga0068855_100002231 3300005563 Bacteria 23944
105 Ga0068855_100003289 3300005563 Bacteria 19782
106 Ga0068857_100000003 3300005577 Bacteria 174630
107 Ga0068854_100008537 3300005578 Bacteria 6591
108 Ga0070702_100000557 3300005615 Bacteria 13590
109 Ga0068852_100001192 3300005616 Bacteria 17243
110 Ga0068859_100001399 3300005617 Bacteria 24477
111 Ga0068859_100134273 3300005617 Bacteria 2546
112 Ga0068864_100000002 3300005618 Bacteria 658857
113 Ga0068866_10001440 3300005718 Bacteria 10174
114 Ga0068861_100001038 3300005719 Bacteria 17033
115 Ga0068851_10000079 3300005834 Bacteria 54347
116 Ga0068851_10000587 3300005834 Bacteria 15782
117 Ga0068858_100010152 3300005842 Bacteria 8938
118 Ga0068860_100001060 3300005843 Bacteria 30341
119 Ga0068860_100002413 3300005843 Bacteria 19606
120 Ga0068860_100030311 3300005843 Bacteria 5203
121 Ga0068862_100001204 3300005844 Bacteria 24408
122 Ga0068862_100001883 3300005844 Bacteria 19024
123 Ga0068862_100009858 3300005844 Bacteria 7889
124 Ga0068862_100108037 3300005844 Bacteria 2440
125 Ga0081455_10078333 3300005937 Bacteria 2716
126 Ga0075364_10000229 3300006051 Bacteria 26587
127 Ga0075364_10006248 3300006051 Bacteria 6985
128 Ga0075364_10013114 3300006051 Bacteria 5086
129 Ga0075366_10010412 3300006195 Bacteria 5223
130 Ga0097621_100004130 3300006237 Bacteria 10069
131 Ga0068871_100000370 3300006358 Bacteria 31403
132 Ga0075428_100000993 3300006844 Bacteria 30002
133 Ga0075433_10003117 3300006852 Bacteria 12769
134 Ga0075434_100011855 3300006871 Bacteria 8238
135 Ga0075429_100000215 3300006880 Bacteria 38905
136 Ga0068865_100000283 3300006881 Bacteria 27881
137 Ga0075436_100001687 3300006914 Bacteria 15098
138 Ga0075436_100022120 3300006914 Bacteria 4367
139 Ga0097620_100001399 3300006931 Bacteria 24477
140 Ga0097620_100134269 3300006931 Bacteria 2546
141 Ga0079104_1000111 3300006946 Bacteria 116796
142 Ga0079104_1000220 3300006946 Bacteria 79382
143 Ga0079104_1000248 3300006946 Bacteria 72191
144 Ga0079104_1001748 3300006946 Bacteria 13745
145 Ga0079104_1002022 3300006946 Bacteria 11841
146 Ga0079104_1002085 3300006946 Bacteria 11476
147 Ga0079104_1002095 3300006946 Bacteria 11436
148 Ga0079104_1009896 3300006946 Bacteria 3187
149 Ga0079104_1013362 3300006946 Bacteria 2533
150 Ga0075435_100001908 3300007076 Bacteria 13571
151 Ga0105251_10000018 3300009011 Bacteria 142493
152 Ga0105251_10000812 3300009011 Bacteria 28139
153 Ga0105251_10000983 3300009011 Bacteria 25136
154 Ga0105251_10001816 3300009011 Bacteria 17651
155 Ga0105251_10002616 3300009011 Bacteria 13924
156 Ga0105251_10003157 3300009011 Bacteria 12212
157 Ga0105251_10003178 3300009011 Bacteria 12154
158 Ga0105251_10005507 3300009011 Bacteria 8249
159 Ga0105251_10007555 3300009011 Bacteria 6674
160 Ga0105251_10015617 3300009011 Bacteria 4141
161 Ga0105244_10000048 3300009036 Bacteria 141340
162 Ga0105244_10000087 3300009036 Bacteria 102130
163 Ga0105244_10000298 3300009036 Bacteria 48389
164 Ga0105244_10000362 3300009036 Bacteria 42056
165 Ga0105244_10000414 3300009036 Bacteria 39718
166 Ga0105244_10003937 3300009036 Bacteria 10425
167 Ga0105244_10004360 3300009036 Bacteria 9758
168 Ga0105244_10007727 3300009036 Bacteria 6808
169 Ga0105244_10007928 3300009036 Bacteria 6691
170 Ga0105244_10009517 3300009036 Bacteria 5968
171 Ga0105250_10000003 3300009092 Bacteria 547770
172 Ga0105250_10000025 3300009092 Bacteria 215424
173 Ga0105250_10000044 3300009092 Bacteria 128269
174 Ga0105250_10008301 3300009092 Bacteria 4421
175 Ga0105250_10008680 3300009092 Bacteria 4305
176 Ga0105250_10010099 3300009092 Bacteria 3942
177 Ga0105250_10011116 3300009092 Bacteria 3739
178 Ga0105240_10000056 3300009093 Bacteria 224822
179 Ga0105240_10000218 3300009093 Bacteria 115562
180 Ga0105240_10047158 3300009093 Bacteria 5454
181 Ga0111539_10104260 3300009094 Bacteria 3328
182 Ga0111539_10167108 3300009094 Bacteria 2571
183 Ga0105245_10001066 3300009098 Bacteria 24858
184 Ga0114129_10001138 3300009147 Bacteria 35164
185 Ga0105243_10000708 3300009148 Bacteria 32162
186 Ga0105243_10002042 3300009148 Bacteria 17120
187 Ga0105243_10003465 3300009148 Bacteria 12738
188 Ga0105243_10005617 3300009148 Bacteria 9768
189 Ga0105243_10005820 3300009148 Bacteria 9563
190 Ga0105241_10000004 3300009174 Bacteria 803007
191 Ga0105242_10001614 3300009176 Bacteria 17755
192 Ga0105242_10002334 3300009176 Bacteria 14972
193 Ga0105237_10001936 3300009545 Bacteria 26387
194 Ga0105237_10012539 3300009545 Bacteria 8928
195 Ga0105249_10005638 3300009553 Bacteria 10832
196 Ga0105246_10006097 3300011119 Bacteria 7356
197 Ga0157373_10000201 3300013100 Bacteria 49344
198 Ga0157373_10001576 3300013100 Bacteria 17399
199 Ga0157373_10004039 3300013100 Bacteria 11063
200 Ga0157371_10000007 3300013102 Bacteria 401847
201 Ga0157371_10000352 3300013102 Bacteria 58713
202 Ga0157371_10000487 3300013102 Bacteria 48309
203 Ga0157371_10002311 3300013102 Bacteria 18345
204 Ga0157371_10002463 3300013102 Bacteria 17634
205 Ga0157371_10017214 3300013102 Bacteria 5374
206 Ga0157370_10000557 3300013104 Bacteria 46529
207 Ga0157370_10000797 3300013104 Bacteria 39664
208 Ga0157370_10001697 3300013104 Bacteria 27110
209 Ga0157370_10003461 3300013104 Bacteria 18516
210 Ga0157370_10016285 3300013104 Bacteria 7533
211 Ga0157369_10018126 3300013105 Bacteria 7898
212 Ga0157369_10028650 3300013105 Bacteria 6162
213 Ga0157369_10051728 3300013105 Bacteria 4445
214 Ga0157369_10057725 3300013105 Bacteria 4186
215 Ga0157369_10068008 3300013105 Bacteria 3828
216 Ga0157369_10068696 3300013105 Bacteria 3807
217 Ga0157374_10060607 3300013296 Bacteria 3542
218 Ga0157378_10001153 3300013297 Bacteria 24026
219 Ga0157378_10021057 3300013297 Bacteria 5736
220 Ga0163162_10010409 3300013306 Bacteria 9039
221 Ga0163162_10037377 3300013306 Bacteria 4845
222 Ga0157372_10005890 3300013307 Bacteria 13050
223 Ga0157372_10012829 3300013307 Bacteria 8931
224 Ga0157372_10012955 3300013307 Bacteria 8892
225 Ga0157372_10250120 3300013307 Bacteria 2057
226 Ga0163163_10000634 3300014325 Bacteria 30253
227 Ga0182008_10000143 3300014497 Bacteria 55118
228 Ga0182006_1000020 3300015261 Bacteria 285318
229 Ga0182006_1004233 3300015261 Bacteria 7109
230 Ga0182007_10000043 3300015262 Bacteria 107693
231 Ga0182005_1000225 3300015265 Bacteria 37383
232 Ga0183366_1001 3300015679 Bacteria 2743932
233 Ga0183370_1001 3300015680 Bacteria 2743932
234 Ga0183369_1001 3300015685 Bacteria 2743932
235 Ga0183368_1001 3300015687 Bacteria 2743932
236 Ga0163161_10000004 3300017792 Bacteria 333149
237 Ga0163161_10016090 3300017792 Bacteria 5221
238 Ga0213872_10000933 3300021361 Bacteria 20581
239 Ga0213876_10000025 3300021384 Bacteria 236747
240 Ga0213875_10018256 3300021388 Bacteria 3382
241 Ga0209435_100916 3300025206 Bacteria 4435
242 Ga0209760_100011 3300025207 Bacteria 197221
243 Ga0209760_100057 3300025207 Bacteria 99434
244 Ga0209760_100174 3300025207 Bacteria 35273
245 Ga0209784_100001 3300025224 Bacteria 3600592
246 Ga0209784_100040 3300025224 Bacteria 231812
247 Ga0209566_100001 3300025225 Bacteria 3600765
248 Ga0209566_100051 3300025225 Bacteria 231920
249 Ga0209674_100002 3300025226 Bacteria 3600592
250 Ga0209674_100072 3300025226 Bacteria 231812
251 Ga0209147_100067 3300025229 Bacteria 231812
252 Ga0209563_100008 3300025230 Bacteria 1554545
253 Ga0209563_100073 3300025230 Bacteria 231920
254 Ga0207427_100001 3300025231 Bacteria 1410763
255 Ga0207427_100002 3300025231 Bacteria 1355321
256 Ga0207427_100008 3300025231 Bacteria 740731
257 Ga0209437_100003 3300025233 Bacteria 1517827
258 Ga0209437_100007 3300025233 Bacteria 938377
259 Ga0209437_100014 3300025233 Bacteria 740714
260 Ga0209437_100235 3300025233 Bacteria 92210
261 Ga0207425_1000030 3300025245 Bacteria 268200
262 Ga0209646_1000216 3300025246 Bacteria 62818
263 Ga0209677_100004 3300025253 Bacteria 1554545
264 Ga0209677_100063 3300025253 Bacteria 151440
265 Ga0209129_1000015 3300025258 Bacteria 487967
266 Ga0209129_1000597 3300025258 Bacteria 24626
267 Ga0209129_1012473 3300025258 Bacteria 1946
268 Ga0209233_1000007 3300025261 Bacteria 1411234
269 Ga0209233_1000008 3300025261 Bacteria 1356712
270 Ga0209233_1001387 3300025261 Bacteria 9600
271 Ga0209565_1000014 3300025263 Bacteria 530302
272 Ga0209565_1005883 3300025263 Bacteria 3515
273 Ga0209673_1000171 3300025273 Bacteria 133493
274 Ga0209675_1000011 3300025291 Bacteria 520597
275 Ga0209675_1000639 3300025291 Bacteria 24900
276 Ga0209676_1000016 3300025292 Bacteria 655561
277 Ga0209676_1000021 3300025292 Bacteria 609534
278 Ga0209676_1000027 3300025292 Bacteria 560222
279 Ga0209676_1000033 3300025292 Bacteria 463236
280 Ga0209676_1000047 3300025292 Bacteria 408645
281 Ga0209676_1000079 3300025292 Bacteria 290447
282 Ga0209676_1000474 3300025292 Bacteria 66391
283 Ga0209676_1000970 3300025292 Bacteria 34527
284 Ga0209676_1015643 3300025292 Bacteria 2782
285 Ga0209025_1000054 3300025294 Bacteria 317002
286 Ga0209564_1000221 3300025295 Bacteria 129537
287 Ga0209758_1000062 3300025297 Bacteria 317002
288 Ga0209050_1000235 3300025298 Bacteria 121420
289 Ga0209050_1000329 3300025298 Bacteria 94932
290 Ga0209050_1000415 3300025298 Bacteria 79058
291 Ga0209050_1000477 3300025298 Bacteria 70798
292 Ga0209050_1001705 3300025298 Bacteria 21965
293 Ga0209050_1022831 3300025298 Bacteria 2227
294 Ga0209256_1005108 3300025299 Bacteria 7780
295 Ga0209051_1000043 3300025303 Bacteria 305473
296 Ga0209051_1000123 3300025303 Bacteria 144298
297 Ga0209051_1001937 3300025303 Bacteria 15970
298 Ga0209051_1012278 3300025303 Bacteria 4153
299 Ga0209257_1000081 3300025304 Bacteria 306577
300 Ga0209257_1000150 3300025304 Bacteria 191487
301 Ga0209257_1000604 3300025304 Bacteria 59301
302 Ga0209257_1001953 3300025304 Bacteria 22258
303 Ga0209257_1004574 3300025304 Bacteria 10578
304 Ga0207656_10000093 3300025321 Bacteria 33347
305 Ga0207656_10014464 3300025321 Bacteria 3040
306 Ga0207696_1000003 3300025711 Bacteria 860639
307 Ga0207696_1000004 3300025711 Bacteria 671626
308 Ga0207696_1000007 3300025711 Bacteria 578417
309 Ga0207696_1000033 3300025711 Bacteria 360689
310 Ga0207696_1000081 3300025711 Bacteria 198887
311 Ga0207696_1000152 3300025711 Bacteria 119512
312 Ga0207696_1000192 3300025711 Bacteria 94285
313 Ga0207696_1000247 3300025711 Bacteria 73166
314 Ga0207696_1000472 3300025711 Bacteria 34389
315 Ga0207696_1000517 3300025711 Bacteria 32018
316 Ga0207696_1000546 3300025711 Bacteria 30331
317 Ga0207696_1000655 3300025711 Bacteria 24794
318 Ga0207696_1006510 3300025711 Bacteria 4700
319 Ga0207696_1006511 3300025711 Bacteria 4700
320 Ga0207696_1007690 3300025711 Bacteria 4194
321 Ga0207696_1009429 3300025711 Bacteria 3641
322 Ga0207655_1000001 3300025728 Bacteria 1866413
323 Ga0207655_1000005 3300025728 Bacteria 917277
324 Ga0207655_1000011 3300025728 Bacteria 643321
325 Ga0207655_1000023 3300025728 Bacteria 467070
326 Ga0207655_1000029 3300025728 Bacteria 432187
327 Ga0207655_1000042 3300025728 Bacteria 333039
328 Ga0207655_1000087 3300025728 Bacteria 205876
329 Ga0207655_1000206 3300025728 Bacteria 102975
330 Ga0207655_1000448 3300025728 Bacteria 54335
331 Ga0207655_1000496 3300025728 Bacteria 50648
332 Ga0207655_1000530 3300025728 Bacteria 48477
333 Ga0207655_1001462 3300025728 Bacteria 21825
334 Ga0207655_1002985 3300025728 Bacteria 12973
335 Ga0207655_1003562 3300025728 Bacteria 11531
336 Ga0207655_1006225 3300025728 Bacteria 7942
337 Ga0207655_1006427 3300025728 Bacteria 7791
338 Ga0207655_1006562 3300025728 Bacteria 7684
339 Ga0207655_1007706 3300025728 Bacteria 6948
340 Ga0207655_1008247 3300025728 Bacteria 6639
341 Ga0207655_1011623 3300025728 Bacteria 5222
342 Ga0207655_1012449 3300025728 Bacteria 4970
343 Ga0207655_1015599 3300025728 Bacteria 4209
344 Ga0207655_1023472 3300025728 Bacteria 3058
345 Ga0207713_1000001 3300025735 Bacteria 2295391
346 Ga0207713_1000005 3300025735 Bacteria 649958
347 Ga0207713_1000006 3300025735 Bacteria 586163
348 Ga0207713_1000009 3300025735 Bacteria 551314
349 Ga0207713_1000021 3300025735 Bacteria 353108
350 Ga0207713_1000101 3300025735 Bacteria 140693
351 Ga0207713_1000133 3300025735 Bacteria 112797
352 Ga0207713_1000519 3300025735 Bacteria 38934
353 Ga0207713_1000618 3300025735 Bacteria 34875
354 Ga0207713_1000956 3300025735 Bacteria 25753
355 Ga0207713_1001549 3300025735 Bacteria 18078
356 Ga0207713_1003433 3300025735 Bacteria 10812
357 Ga0207713_1003436 3300025735 Bacteria 10798
358 Ga0207713_1003886 3300025735 Bacteria 9953
359 Ga0207713_1006626 3300025735 Bacteria 7020
360 Ga0207713_1007860 3300025735 Bacteria 6217
361 Ga0207713_1007978 3300025735 Bacteria 6159
362 Ga0207713_1010212 3300025735 Bacteria 5213
363 Ga0207713_1011492 3300025735 Bacteria 4807
364 Ga0207713_1013546 3300025735 Bacteria 4288
365 Ga0207713_1014764 3300025735 Bacteria 4035
366 Ga0207642_10007346 3300025899 Bacteria 3717
367 Ga0207710_10000016 3300025900 Bacteria 388568
368 Ga0207647_10000006 3300025904 Bacteria 214791
369 Ga0207705_10025061 3300025909 Bacteria 4258
370 Ga0207705_10039053 3300025909 Bacteria 3401
371 Ga0207654_10000006 3300025911 Bacteria 815027
372 Ga0207695_10000103 3300025913 Bacteria 257354
373 Ga0207695_10000395 3300025913 Bacteria 98285
374 Ga0207671_10000287 3300025914 Bacteria 74587
375 Ga0207671_10043184 3300025914 Bacteria 3333
376 Ga0207662_10000191 3300025918 Bacteria 28718
377 Ga0207649_10000113 3300025920 Bacteria 68458
378 Ga0207650_10000002 3300025925 Bacteria 1439222
379 Ga0207650_10000255 3300025925 Bacteria 57979
380 Ga0207659_10043063 3300025926 Bacteria 3168
381 Ga0207687_10001813 3300025927 Bacteria 14697
382 Ga0207690_10014624 3300025932 Bacteria 4742
383 Ga0207686_10001418 3300025934 Bacteria 13594
384 Ga0207709_10000053 3300025935 Bacteria 225514
385 Ga0207709_10000536 3300025935 Bacteria 32696
386 Ga0207709_10001098 3300025935 Bacteria 19845
387 Ga0207709_10002036 3300025935 Bacteria 13099
388 Ga0207709_10003606 3300025935 Bacteria 9145
389 Ga0207709_10012063 3300025935 Bacteria 4764
390 Ga0207709_10016817 3300025935 Bacteria 4075
391 Ga0207670_10001920 3300025936 Bacteria 10877
392 Ga0207704_10000409 3300025938 Bacteria 19434
393 Ga0207711_10006103 3300025941 Bacteria 10175
394 Ga0207689_10000921 3300025942 Bacteria 28235
395 Ga0207679_10000018 3300025945 Bacteria 238375
396 Ga0207667_10006477 3300025949 Bacteria 14168
397 Ga0207667_10017372 3300025949 Bacteria 8098
398 Ga0207712_10004731 3300025961 Bacteria 8603
399 Ga0207712_10060237 3300025961 Bacteria 2690
400 Ga0207668_10061226 3300025972 Bacteria 2646
401 Ga0207640_10001592 3300025981 Bacteria 12198
402 Ga0207658_10000001 3300025986 Bacteria 1439333
403 Ga0207677_10000592 3300026023 Bacteria 22464
404 Ga0207703_10007345 3300026035 Bacteria 8758
405 Ga0207639_10000010 3300026041 Bacteria 415264
406 Ga0207708_10000451 3300026075 Bacteria 31936
407 Ga0207648_10000245 3300026089 Bacteria 58564
408 Ga0207676_10000001 3300026095 Bacteria 1439222
409 Ga0207674_10000043 3300026116 Bacteria 124448
410 Ga0207675_100001447 3300026118 Bacteria 23783
411 Ga0207675_100044530 3300026118 Bacteria 4147
412 Ga0209281_1000001 3300027111 Bacteria 1933496
413 Ga0209281_1000008 3300027111 Bacteria 867470
414 Ga0209281_1000010 3300027111 Bacteria 726106
415 Ga0209281_1000021 3300027111 Bacteria 541033
416 Ga0209281_1000041 3300027111 Bacteria 347825
417 Ga0209281_1000075 3300027111 Bacteria 267114
418 Ga0209281_1000079 3300027111 Bacteria 261444
419 Ga0209281_1000331 3300027111 Bacteria 81645
420 Ga0209281_1000335 3300027111 Bacteria 80336
421 Ga0209281_1003727 3300027111 Bacteria 4871
422 Ga0209281_1006267 3300027111 Bacteria 3133
423 Ga0209281_1006480 3300027111 Bacteria 3050
424 Ga0209389_1001707 3300027296 Bacteria 15879
425 Ga0209371_1000001 3300027312 Bacteria 2771503
426 Ga0209371_1000004 3300027312 Bacteria 1098197
427 Ga0209371_1000010 3300027312 Bacteria 922021
428 Ga0209371_1000016 3300027312 Bacteria 646301
429 Ga0209371_1000026 3300027312 Bacteria 449205
430 Ga0209371_1000146 3300027312 Bacteria 115378
431 Ga0209371_1000220 3300027312 Bacteria 76323
432 Ga0209371_1000303 3300027312 Bacteria 54750
433 Ga0209371_1000557 3300027312 Bacteria 34359
434 Ga0209371_1000615 3300027312 Bacteria 31768
435 Ga0209371_1001062 3300027312 Bacteria 20562
436 Ga0209371_1001253 3300027312 Bacteria 18076
437 Ga0209371_1002424 3300027312 Bacteria 10461
438 Ga0209371_1002751 3300027312 Bacteria 9434
439 Ga0209371_1003505 3300027312 Bacteria 7576
440 Ga0209371_1003799 3300027312 Bacteria 7016
441 Ga0209371_1009424 3300027312 Bacteria 3107
442 Ga0209371_1010515 3300027312 Bacteria 2837
443 Ga0209996_1001214 3300027395 Bacteria 3114
444 Ga0209995_1001793 3300027471 Bacteria 3345
445 Ga0209983_1002193 3300027665 Bacteria 4298
446 Ga0207428_10000954 3300027907 Bacteria 32134
447 Ga0268266_10000084 3300028379 Bacteria 201874
448 Ga0268266_10004969 3300028379 Bacteria 12579
449 Ga0268265_10000627 3300028380 Bacteria 35202
450 Ga0268265_10000783 3300028380 Bacteria 30441
451 Ga0268265_10008164 3300028380 Bacteria 7072
452 Ga0268264_10000004 3300028381 Bacteria 1116842
453 Ga0268264_10003335 3300028381 Bacteria 13874
454 Ga0268256_1000001 3300030500 Bacteria 2771065
455 Ga0268256_1000003 3300030500 Bacteria 1289401
456 Ga0268256_1000005 3300030500 Bacteria 1082342
457 Ga0268256_1000015 3300030500 Bacteria 646300
458 Ga0268256_1000017 3300030500 Bacteria 600718
459 Ga0268256_1000022 3300030500 Bacteria 531115
460 Ga0268256_1000117 3300030500 Bacteria 115176
461 Ga0268256_1000359 3300030500 Bacteria 43686
462 Ga0268256_1000528 3300030500 Bacteria 31946
463 Ga0268256_1000677 3300030500 Bacteria 25775
464 Ga0268256_1000824 3300030500 Bacteria 22179
465 Ga0268256_1000894 3300030500 Bacteria 20562
466 Ga0268256_1001063 3300030500 Bacteria 18270
467 Ga0268256_1002457 3300030500 Bacteria 9434
468 Ga0268256_1007719 3300030500 Bacteria 3792
469 Ga0268256_1009255 3300030500 Bacteria 3294
470 Ga0316176_1131399 3300030732 Bacteria 2648
471 Ga0314311_1124074 3300030733 Bacteria 4695
472 Ga0316178_1127053 3300030735 Bacteria 33158
473 Ga0316183_1195675 3300030742 Bacteria 4464
474 Ga0265328_10000106 3300031239 Bacteria 39805
475 Ga0265328_10000501 3300031239 Bacteria 18180
476 Ga0265331_10000121 3300031250 Bacteria 102519
477 Ga0265331_10024460 3300031250 Bacteria 3055
478 Ga0265327_10000008 3300031251 Bacteria 658870
479 Ga0265327_10000241 3300031251 Bacteria 109225
480 Ga0265327_10000269 3300031251 Bacteria 102772
481 Ga0265327_10000333 3300031251 Bacteria 89521
482 Ga0265327_10000463 3300031251 Bacteria 72345
483 Ga0265327_10001895 3300031251 Bacteria 24187
484 Ga0265327_10003075 3300031251 Bacteria 16479
485 Ga0265327_10007016 3300031251 Bacteria 8832
486 Ga0265327_10025252 3300031251 Bacteria 3469
487 Ga0307408_100000057 3300031548 Bacteria 135228
488 Ga0307408_100000411 3300031548 Bacteria 38447
489 Ga0307408_100004612 3300031548 Bacteria 9317
490 Ga0316575_10001442 3300031665 Bacteria 7662
491 Ga0316576_10001557 3300031727 Bacteria 12440
492 Ga0316576_10011765 3300031727 Bacteria 5753
493 Ga0316576_10012548 3300031727 Bacteria 5602
494 Ga0316578_10001181 3300031728 Bacteria 10330
495 Ga0316578_10019319 3300031728 Bacteria 3748
496 Ga0316577_10000094 3300031733 Bacteria 24143
497 Ga0316577_10028740 3300031733 Bacteria 3103
498 Ga0307406_10003868 3300031901 Bacteria 8154
499 Ga0307414_10011831 3300032004 Bacteria 5137
500 Ga0316583_10005959 3300032133 Bacteria 4379
501 Ga0307507_10021263 3300033179 Bacteria 7230
502 Ga0316586_1002942 3300033527 Bacteria 2184
503 Ga0316587_1001710 3300033529 Bacteria 2780
504 Ga0316596_1005926 3300033541 Bacteria 2817
505 Ga0316596_1013538 3300033541 Bacteria 2016
506 Ga0373934_0000411 3300035086 Bacteria 15024
507 Ga0373952_0000960 3300035092 Bacteria 5236
508 Ga0373932_0009006 3300035112 Bacteria 2393
509 Ga0373956_0002404 3300035119 Bacteria 7637
510 Ga0373943_0036176 3300035170 Bacteria 2363
511 Ga0373946_0004603 3300035171 Bacteria 4944
512 Ga0373955_0038223 3300035172 Bacteria 2556
513 Ga0316574_0001118 3300035398 Bacteria 12273
514 Ga0316574_0005934 3300035398 Bacteria 6554
515 Ga0373924_0020416 3300035410 Bacteria 2575
516 Ga0373931_0003470 3300035691 Bacteria 7081
517 Ga0373931_0004014 3300035691 Bacteria 6665
518 Ga0373935_0041524 3300035692 Bacteria 2889
519 Ga0373927_0011878 3300035695 Bacteria 5801
520 Ga0373927_0036936 3300035695 Bacteria 3175
521 Ga0373933_0002175 3300035724 Bacteria 11222
522 Ga0373937_0003720 3300036401 Bacteria 12888
523 Ga0316582_0001994 3300036647 Bacteria 9354
524 Ga0316582_0002211 3300036647 Bacteria 9030
525 Ga0316582_0007751 3300036647 Bacteria 5734
526 Ga0316584_0000428 3300036712 Bacteria 21955
527 Ga0316584_0004523 3300036712 Bacteria 9203
528 Ga0316584_0075252 3300036712 Bacteria 2531
529 Ga0316584_0077175 3300036712 Bacteria 2496
530 Ga0316581_0006025 3300037588 Bacteria 3192
531 Ga0436364_0455618 3300037853 Bacteria 8305
532 Ga0237819_00054 3300038705 Bacteria 40103
533 Ga0237819_00849 3300038705 Bacteria 9629
534 Ga0237819_04151 3300038705 Bacteria 2432
535 Ga0400484_07955 3300038725 Bacteria 7254
536 Ga0400490_04080 3300038726 Bacteria 3040
537 Ga0400490_28529 3300038726 Bacteria 26677
538 Ga0400490_31714 3300038726 Bacteria 3979
539 Ga0400490_36858 3300038726 Bacteria 32496
540 Ga0400485_19597 3300038735 Bacteria 3668
541 Ga0400483_009065 3300039062 Bacteria 5156
542 Ga0400483_013162 3300039062 Bacteria 8018
543 Ga0400483_026308 3300039062 Bacteria 223136
544 Ga0400483_076133 3300039062 Bacteria 9214
545 Ga0400483_178744 3300039062 Bacteria 2218
546 Ga0400483_195378 3300039062 Bacteria 81541
547 Ga0400483_233356 3300039062 Bacteria 3624
548 Ga0400483_234758 3300039062 Bacteria 16366
549 Ga0400483_250036 3300039062 Bacteria 396353
550 Ga0400483_259219 3300039062 Bacteria 8327
551 Ga0400487_51348 3300039110 Bacteria 7047
552 Ga0436365_1279401 3300039437 Bacteria 294819
553 Ga0436365_1440570 3300039437 Bacteria 2412
554 Ga0436361_0695291 3300039447 Bacteria 66094
555 Ga0436361_1114325 3300039447 Bacteria 10568
556 Ga0439436_0000430 3300041404 Bacteria 10608
557 Ga0439438_000001 3300041405 Bacteria 1263568
558 Ga0439438_000879 3300041405 Bacteria 13384
559 Ga0439438_006601 3300041405 Bacteria 4070
560 Ga0439447_003201 3300041407 Bacteria 5831
561 Ga0439447_011386 3300041407 Bacteria 2598
562 Ga0439466_0000012 3300041411 Bacteria 179902
563 Ga0439466_0001695 3300041411 Bacteria 8603
564 Ga0451795_1536678 3300041456 Bacteria 3025
565 Ga0451800_0211862 3300041459 Bacteria 7857
566 Ga0451806_617527 3300041462 Bacteria 7457
567 Ga0451807_1185460 3300041486 Bacteria 3562
568 Ga0451853_1183803 3300041512 Bacteria 4811
569 Ga0439452_000003 3300042010 Bacteria 942815
570 Ga0439452_000017 3300042010 Bacteria 324897
571 Ga0439452_000027 3300042010 Bacteria 206086
572 Ga0439452_000033 3300042010 Bacteria 178345
573 Ga0439452_002344 3300042010 Bacteria 7059
574 Ga0439452_002943 3300042010 Bacteria 6073
575 Ga0439456_000278 3300042013 Bacteria 12304
576 Ga0439456_008211 3300042013 Bacteria 2156
577 Ga0450911_000013 3300042115 Bacteria 129019
578 Ga0450911_001689 3300042115 Bacteria 4873
579 Ga0439460_0001205 3300042461 Bacteria 6095
580 Ga0451577_0072675 3300042876 Bacteria 3069
581 Ga0466981_0000006 3300044669 Bacteria 157389
582 Ga0453684_0001204 3300044712 Bacteria 79823
583 Ga0453684_0002214 3300044712 Bacteria 48332
584 Ga0451576_0027885 3300045051 Bacteria 6057
585 Ga0451576_0098624 3300045051 Unclassified 3039
586 Ga0495617_004198 3300046452 Bacteria 5269
587 Ga0495627_000145 3300046453 Bacteria 84853
588 Ga0495627_001983 3300046453 Bacteria 10568
589 Ga0495627_002242 3300046453 Bacteria 9573
590 Ga0495627_004653 3300046453 Bacteria 5687
591 Ga0495592_0004990 3300046454 Bacteria 9769
592 Ga0495603_0000212 3300046455 Bacteria 30148
593 Ga0495590_0001910 3300046457 Bacteria 8831
594 Ga0495591_000011 3300046458 Bacteria 309685
595 Ga0495591_000137 3300046458 Bacteria 79532
596 Ga0495591_000301 3300046458 Bacteria 45136
597 Ga0495591_001205 3300046458 Bacteria 16842
598 Ga0495591_002420 3300046458 Bacteria 10404
599 Ga0495591_002938 3300046458 Bacteria 9108
600 Ga0495591_007890 3300046458 Bacteria 4439
601 Ga0495638_0002776 3300046460 Bacteria 14066
602 Ga0495638_0021129 3300046460 Bacteria 4294
603 Ga0495651_0001303 3300046462 Bacteria 19301
604 Ga0495650_0000016 3300046471 Bacteria 554693
605 Ga0495650_0000033 3300046471 Bacteria 412188
606 Ga0495650_0000175 3300046471 Bacteria 140965
607 Ga0495580_0000358 3300046472 Bacteria 37269
608 Ga0495605_0000026 3300046474 Bacteria 221832
609 Ga0495605_0000414 3300046474 Bacteria 38982
610 Ga0495605_0003439 3300046474 Bacteria 9411
611 Ga0495605_0015583 3300046474 Bacteria 4129
612 Ga0495584_0004701 3300046491 Bacteria 7312
613 Ga0495585_0000394 3300046492 Bacteria 42296
614 Ga0495585_0003927 3300046492 Bacteria 9835
615 Ga0495596_0001337 3300046500 Bacteria 14179
616 Ga0495607_0004502 3300046501 Bacteria 10226
617 Ga0495607_0005073 3300046501 Bacteria 9530
618 Ga0495583_0000043 3300046506 Bacteria 230804
619 Ga0495583_0004703 3300046506 Bacteria 9605
620 Ga0495606_0000627 3300046507 Bacteria 55643
621 Ga0495606_0000861 3300046507 Bacteria 45459
622 Ga0495606_0002635 3300046507 Bacteria 20465
623 Ga0495606_0008136 3300046507 Bacteria 9187
624 Ga0495606_0009605 3300046507 Bacteria 8152
625 Ga0495610_0014992 3300046512 Bacteria 4524
626 Ga0495610_0018057 3300046512 Bacteria 3996
627 Ga0495616_0004615 3300046513 Bacteria 8648
628 Ga0495616_0040906 3300046513 Bacteria 2366
629 Ga0495620_0000083 3300046515 Bacteria 78909
630 Ga0495620_0000263 3300046515 Bacteria 38924
631 Ga0495620_0003570 3300046515 Bacteria 8893
632 Ga0495620_0019386 3300046515 Bacteria 3346
633 Ga0495628_0005053 3300046516 Bacteria 11596
634 Ga0495631_0000558 3300046518 Bacteria 24972
635 Ga0495631_0004234 3300046518 Bacteria 7675
636 Ga0495632_0010833 3300046519 Bacteria 5363
637 Ga0495632_0048002 3300046519 Bacteria 2115
638 Ga0495637_0000174 3300046520 Bacteria 49455
639 Ga0495637_0014466 3300046520 Bacteria 3723
640 Ga0495643_0000062 3300046522 Bacteria 183602
641 Ga0495643_0002111 3300046522 Bacteria 16411
642 Ga0495643_0004357 3300046522 Bacteria 9926
643 Ga0495643_0007246 3300046522 Bacteria 7185
644 Ga0495644_0000325 3300046523 Bacteria 21805
645 Ga0495648_0002784 3300046524 Bacteria 15767
646 Ga0495654_0000020 3300046530 Bacteria 284814
647 Ga0495654_0000032 3300046530 Bacteria 205780
648 Ga0495654_0002005 3300046530 Bacteria 13413
649 Ga0495654_0006490 3300046530 Bacteria 6641
650 Ga0495654_0022838 3300046530 Bacteria 3243
651 Ga0495586_0003782 3300046535 Bacteria 8110
652 Ga0495609_0000036 3300046538 Bacteria 186358
653 Ga0495609_0000125 3300046538 Bacteria 83190
654 Ga0495597_0000129 3300046542 Bacteria 68183
655 Ga0495597_0004114 3300046542 Bacteria 8103
656 Ga0495645_0000552 3300046543 Bacteria 25668
657 Ga0495633_0000143 3300046558 Bacteria 95292
658 Ga0495611_0001051 3300046648 Bacteria 14598
659 Ga0495625_0007427 3300046660 Bacteria 9537
660 Ga0495635_0004064 3300046663 Bacteria 10155
661 Ga0495661_0000092 3300046665 Bacteria 109902
662 Ga0495661_0000121 3300046665 Bacteria 93554
663 Ga0495661_0002800 3300046665 Bacteria 13209
664 Ga0495661_0008826 3300046665 Bacteria 6953
665 Ga0495588_0003773 3300046674 Bacteria 6635
666 Ga0495646_0014122 3300046680 Bacteria 5078
667 Ga0495647_0000273 3300046681 Bacteria 14274
668 Ga0495658_0000620 3300046683 Bacteria 19327
669 Ga0495613_0028561 3300046689 Bacteria 4149
670 Ga0495671_0002439 3300046692 Bacteria 11743
671 Ga0495671_0014193 3300046692 Bacteria 4293
672 Ga0495649_0001266 3300046694 Bacteria 19465
673 Ga0495649_0003138 3300046694 Bacteria 11324
674 Ga0495649_0005413 3300046694 Bacteria 8124
675 Ga0495649_0008704 3300046694 Bacteria 6088
676 Ga0495589_0000006 3300046794 Bacteria 303635
677 Ga0495589_0002626 3300046794 Bacteria 9950
678 Ga0495589_0009905 3300046794 Bacteria 4951
679 Ga0495600_0030133 3300046809 Bacteria 3513
680 Ga0495660_0000007 3300046810 Bacteria 485295
681 Ga0495660_0000011 3300046810 Bacteria 361397
682 Ga0495636_0007887 3300047318 Bacteria 4191
683 Ga0495672_0000004 3300047320 Bacteria 631810
684 Ga0495672_0000027 3300047320 Bacteria 325651
685 Ga0495672_0000061 3300047320 Bacteria 212024
686 Ga0495672_0033100 3300047320 Bacteria 3205
687 Ga0495676_0000019 3300047321 Bacteria 167261
688 Ga0495676_0008018 3300047321 Bacteria 9681
689 Ga0495680_0014781 3300047322 Bacteria 6747
690 Ga0495680_0039620 3300047322 Bacteria 3756
691 Ga0495683_0000003 3300047323 Bacteria 383992
692 Ga0495683_0000175 3300047323 Bacteria 62928
693 Ga0495683_0002550 3300047323 Bacteria 10948
694 Ga0495683_0025572 3300047323 Bacteria 3025
695 Ga0495675_0008743 3300047444 Bacteria 6285
696 Ga0495675_0051538 3300047444 Bacteria 2613
697 Ga0495679_000019 3300047446 Bacteria 231072
698 Ga0495679_000119 3300047446 Bacteria 69255
699 Ga0495673_0000023 3300047469 Bacteria 539904
700 Ga0495673_0000529 3300047469 Bacteria 39664
701 Ga0495673_0004149 3300047469 Bacteria 9167
702 Ga0495673_0012478 3300047469 Bacteria 4502
703 Ga0495681_0014386 3300047470 Bacteria 4538
704 Ga0495681_0054310 3300047470 Bacteria 1872
705 Ga0495686_0005011 3300047472 Bacteria 10633
706 Ga0495626_0000659 3300048091 Bacteria 33166
707 Ga0495626_0005573 3300048091 Bacteria 7305
708 Ga0496101_0000029 3300048904 Bacteria 198515
709 Ga0496102_0003967 3300048905 Bacteria 12540
710 Ga0496102_0009820 3300048905 Bacteria 8228
711 Ga0496104_0000592 3300048907 Bacteria 30952
712 Ga0496105_0069602 3300048908 Bacteria 2908
713 Ga0496116_0000031 3300048919 Bacteria 420043
714 Ga0496116_0000054 3300048919 Bacteria 289010
715 Ga0496116_0000505 3300048919 Bacteria 53281
716 Ga0496116_0002239 3300048919 Bacteria 20578
717 Ga0496116_0004675 3300048919 Bacteria 12957
718 Ga0496117_0000004 3300048920 Bacteria 877131
719 Ga0496117_0000212 3300048920 Bacteria 112241
720 Ga0496117_0000853 3300048920 Bacteria 47190
721 Ga0496117_0001196 3300048920 Bacteria 39067
722 Ga0496117_0001459 3300048920 Bacteria 34088
723 Ga0496117_0002296 3300048920 Bacteria 24627
724 Ga0496117_0004075 3300048920 Bacteria 16412
725 Ga0496117_0008161 3300048920 Bacteria 10000
726 Ga0496117_0011702 3300048920 Bacteria 7826
727 Ga0496117_0011783 3300048920 Bacteria 7790
728 Ga0496117_0012041 3300048920 Bacteria 7678
729 Ga0496117_0019385 3300048920 Bacteria 5588
730 Ga0496118_0000024 3300048921 Bacteria 385236
731 Ga0496118_0000528 3300048921 Bacteria 62711
732 Ga0496118_0001266 3300048921 Bacteria 38767
733 Ga0496118_0001268 3300048921 Bacteria 38749
734 Ga0496118_0001321 3300048921 Bacteria 37625
735 Ga0496118_0002368 3300048921 Bacteria 25530
736 Ga0496118_0002663 3300048921 Bacteria 23602
737 Ga0496118_0006001 3300048921 Bacteria 13546
738 Ga0496118_0006959 3300048921 Bacteria 12214
739 Ga0496118_0028333 3300048921 Bacteria 4719
740 Ga0496119_0000043 3300048922 Bacteria 192373
741 Ga0496119_0000062 3300048922 Bacteria 171150
742 Ga0496119_0000659 3300048922 Bacteria 46235
743 Ga0496119_0000910 3300048922 Bacteria 38340
744 Ga0496119_0000951 3300048922 Bacteria 37280
745 Ga0496119_0001545 3300048922 Bacteria 27501
746 Ga0496119_0002495 3300048922 Bacteria 20119
747 Ga0496119_0002997 3300048922 Bacteria 17911
748 Ga0496120_0000009 3300048923 Bacteria 386727
749 Ga0496120_0000217 3300048923 Bacteria 99402
750 Ga0496120_0000276 3300048923 Bacteria 86130
751 Ga0496120_0000429 3300048923 Bacteria 66724
752 Ga0496120_0000522 3300048923 Bacteria 59462
753 Ga0496120_0000703 3300048923 Bacteria 49030
754 Ga0496120_0000985 3300048923 Bacteria 38684
755 Ga0496120_0005573 3300048923 Bacteria 10003
756 Ga0496120_0008451 3300048923 Bacteria 7470
757 Ga0496121_0000129 3300048924 Bacteria 168148
758 Ga0496121_0000131 3300048924 Bacteria 167955
759 Ga0496121_0002191 3300048924 Bacteria 30572
760 Ga0496121_0007699 3300048924 Bacteria 12930
761 Ga0496121_0049366 3300048924 Bacteria 3568
762 Ga0496122_0000013 3300048925 Bacteria 501039
763 Ga0496122_0000026 3300048925 Bacteria 360871
764 Ga0496122_0000372 3300048925 Bacteria 96314
765 Ga0496122_0000520 3300048925 Bacteria 79579
766 Ga0496122_0003581 3300048925 Bacteria 20271
767 Ga0496122_0004029 3300048925 Bacteria 18674
768 Ga0496122_0004100 3300048925 Bacteria 18458
769 Ga0496122_0009940 3300048925 Bacteria 9909
770 Ga0496122_0012371 3300048925 Bacteria 8510
771 Ga0496122_0012404 3300048925 Bacteria 8488
772 Ga0496122_0014998 3300048925 Bacteria 7445
773 Ga0496122_0026581 3300048925 Bacteria 4981
774 Ga0496122_0029135 3300048925 Bacteria 4664
775 Ga0496122_0033596 3300048925 Bacteria 4215
776 Ga0496122_0035824 3300048925 Bacteria 4028
777 Ga0496122_0049165 3300048925 Bacteria 3233
778 Ga0496123_0000005 3300048926 Bacteria 658131
779 Ga0496123_0000010 3300048926 Bacteria 501039
780 Ga0496123_0000152 3300048926 Bacteria 140376
781 Ga0496123_0000651 3300048926 Bacteria 57756
782 Ga0496123_0000759 3300048926 Bacteria 52224
783 Ga0496123_0000801 3300048926 Bacteria 50851
784 Ga0496123_0001489 3300048926 Bacteria 32524
785 Ga0496123_0002672 3300048926 Bacteria 21476
786 Ga0496123_0003248 3300048926 Bacteria 18471
787 Ga0496123_0003662 3300048926 Bacteria 16955
788 Ga0496123_0009515 3300048926 Bacteria 8742
789 Ga0496123_0009535 3300048926 Bacteria 8728
790 Ga0496123_0009924 3300048926 Bacteria 8494
791 Ga0496124_0000010 3300048927 Bacteria 595157
792 Ga0496124_0000018 3300048927 Bacteria 442940
793 Ga0496124_0000039 3300048927 Bacteria 307831
794 Ga0496124_0000156 3300048927 Bacteria 137990
795 Ga0496124_0000288 3300048927 Bacteria 95203
796 Ga0496124_0000734 3300048927 Bacteria 53581
797 Ga0496124_0000815 3300048927 Bacteria 50713
798 Ga0496124_0001225 3300048927 Bacteria 39571
799 Ga0496124_0002812 3300048927 Bacteria 22045
800 Ga0496124_0009003 3300048927 Bacteria 10330
801 Ga0496124_0013680 3300048927 Bacteria 7905
802 Ga0496124_0020649 3300048927 Bacteria 6079
803 Ga0496124_0027491 3300048927 Bacteria 5105
804 Ga0496124_0042025 3300048927 Bacteria 3938
805 Ga0496124_0074671 3300048927 Bacteria 2802
806 Ga0496125_0000016 3300048928 Bacteria 512512
807 Ga0496125_0000019 3300048928 Bacteria 474989
808 Ga0496125_0014222 3300048928 Bacteria 7758
809 Ga0496125_0014751 3300048928 Bacteria 7590
810 Ga0496125_0016707 3300048928 Bacteria 7036
811 Ga0496125_0063020 3300048928 Bacteria 2959
812 Ga0496125_0063376 3300048928 Bacteria 2948
813 Ga0496126_0000252 3300048929 Bacteria 115370
814 Ga0496126_0001252 3300048929 Bacteria 41095
815 Ga0496126_0013792 3300048929 Bacteria 8194
816 Ga0496126_0018254 3300048929 Bacteria 6959
817 Ga0496126_0023249 3300048929 Bacteria 6008
818 Ga0496126_0057570 3300048929 Bacteria 3507
819 Ga0495678_000388 3300049459 Bacteria 44393
820 Ga0495678_004373 3300049459 Bacteria 8204
821 Ga0495682_0000004 3300049460 Bacteria 378337
822 Ga0495682_0000060 3300049460 Bacteria 102283
823 Ga0495682_0002230 3300049460 Bacteria 9346
824 Ga0501032_0000157 3300049569 Bacteria 55322
825 Ga0501033_0000001 3300049570 Bacteria 795921
826 Ga0501033_0008946 3300049570 Bacteria 7733
827 Ga0501033_0009262 3300049570 Bacteria 7585
828 Ga0501034_0000272 3300049571 Bacteria 93316
829 Ga0501034_0002511 3300049571 Bacteria 22011
830 Ga0501036_0003884 3300049572 Bacteria 11991
831 Ga0501036_0019602 3300049572 Bacteria 5679
832 Ga0501038_0003490 3300049574 Bacteria 14652
833 Ga0501038_0004228 3300049574 Bacteria 13340
834 Ga0501038_0051187 3300049574 Bacteria 3566
835 Ga0501038_0057751 3300049574 Bacteria 3330
836 Ga0501039_0005786 3300049575 Bacteria 9365
837 Ga0501039_0008002 3300049575 Bacteria 8055
838 Ga0501040_0000316 3300049576 Bacteria 28420
839 Ga0501040_0002293 3300049576 Bacteria 12294
840 Ga0501040_0056736 3300049576 Bacteria 2688
841 Ga0501041_0000270 3300049577 Bacteria 24655
842 Ga0501042_0003173 3300049578 Bacteria 10247
843 Ga0501042_0064995 3300049578 Bacteria 2607
844 Ga0501043_0009281 3300049579 Bacteria 7730
845 Ga0501046_0000535 3300049580 Bacteria 37702
846 Ga0501046_0029317 3300049580 Bacteria 4474
847 Ga0501047_0032055 3300049581 Bacteria 5071
848 Ga0501048_0000628 3300049582 Bacteria 25195
849 Ga0501067_0009769 3300049583 Bacteria 5311
850 Ga0501070_0036681 3300049586 Bacteria 4094
851 Ga0501071_0009143 3300049587 Bacteria 6584
852 Ga0501072_0054669 3300049588 Bacteria 3146
853 Ga0501074_0007169 3300049590 Bacteria 8049
854 Ga0501074_0008561 3300049590 Bacteria 7411
855 Ga0501075_0000915 3300049591 Bacteria 18695
856 Ga0501076_0001078 3300049592 Bacteria 17938
857 Ga0501076_0004510 3300049592 Bacteria 9914
858 Ga0501079_0001639 3300049741 Bacteria 15935
859 Ga0501080_0013180 3300049742 Bacteria 7596
860 Ga0501080_0052909 3300049742 Bacteria 3780
861 Ga0501035_0066958 3300049822 Bacteria 3187
862 Ga0501035_0115032 3300049822 Bacteria 2355
863 Ga0501044_0000112 3300049823 Bacteria 98748
864 Ga0501045_0014628 3300049824 Bacteria 5563
865 Ga0501226_000015 3300049853 Bacteria 164151
866 nmdc:mga05p37_5151_c1 3300050507 Bacteria 15316
867 nmdc:mga09592_5031_c1 3300050508 Bacteria 10722
868 nmdc:mga08y16_114963_c1 3300050511 Bacteria 2802
869 nmdc:mga0n895_6315_c1 3300050512 Bacteria 10049
870 nmdc:mga0rr50_381_c1 3300050513 Bacteria 24264
871 nmdc:mga08x19_2762_c1 3300050514 Bacteria 10593
872 nmdc:mga0a205_93_c2 3300050515 Bacteria 37118
873 Ga0500650_0000015 3300053098 Bacteria 71164
874 Ga0500556_0003696 3300053104 Bacteria 4445
875 Ga0500621_000001 3300053126 Bacteria 1049698
876 Ga0500616_0001434 3300053153 Bacteria 22892
877 Ga0500622_0000023 3300053156 Bacteria 251170
878 Ga0500634_0025602 3300053161 Bacteria 3211
879 Ga0590071_005517 3300059421 Bacteria 3039
880 Ga0501082_0002945 3300060353 Bacteria 14859
881 Ga0530510_0000092 3300061734 Bacteria 48492

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042013 Ga0439456_008211 Ga0439456_008211_14_1594 491
2 3300038735 Ga0400485_19597 Ga0400485_19597_2088_3656 505
3 3300049574 Ga0501038_0051187 Ga0501038_0051187_16_1560 509
4 iso_pu_bacteria 2554235132 2554816125 516
5 iso_pu_bacteria 2909399089 2909401966 522
6 iso_pu_bacteria 2887630918 2887631509 564
7 3300046794 Ga0495589_0009905 Ga0495589_0009905_24_1835 574
8 3300045051 Ga0451576_0098624 Ga0451576_0098624_116_1954 577
9 3300049570 Ga0501033_0009262 Ga0501033_0009262_3474_5327 578
10 3300039062 Ga0400483_178744 Ga0400483_178744_19_1854 579
11 3300035398 Ga0316574_0005934 Ga0316574_0005934_4649_6508 581
12 3300041456 Ga0451795_1536678 Ga0451795_1536678_326_2227 583
13 3300047470 Ga0495681_0054310 Ga0495681_0054310_17_1828 583
14 3300003320 rootH2_10003079 rootH2_100030794 585
15 3300049574 Ga0501038_0003490 Ga0501038_0003490_8021_9865 585
16 3300049583 Ga0501067_0009769 Ga0501067_0009769_2140_3984 585
17 3300003323 rootH1_10089918 rootH1_1008991811 589
18 3300005547 Ga0070693_100015123 Ga0070693_1000151231 589
19 3300005344 Ga0070661_100000397 Ga0070661_10000039722 590
20 3300005366 Ga0070659_100023292 Ga0070659_1000232922 590
21 3300025920 Ga0207649_10000113 Ga0207649_1000011338 590
22 3300025932 Ga0207690_10014624 Ga0207690_100146244 590
23 3300002155 JGI24033J26618_1000010 JGI24033J26618_100001026 592
24 3300005456 Ga0070678_100025488 Ga0070678_1000254882 592
25 3300036712 Ga0316584_0075252 Ga0316584_0075252_531_2429 592
26 3300009093 Ga0105240_10000056 Ga0105240_1000005616 593
27 3300025913 Ga0207695_10000103 Ga0207695_1000010316 593
28 3300041405 Ga0439438_000001 Ga0439438_000001_15181_17055 593
29 3300041407 Ga0439447_011386 Ga0439447_011386_560_2434 593
30 3300046507 Ga0495606_0009605 Ga0495606_0009605_3122_4903 593
31 3300025728 Ga0207655_1000023 Ga0207655_1000023279 594
32 3300031548 Ga0307408_100004612 Ga0307408_1000046126 594
33 3300046458 Ga0495591_002420 Ga0495591_002420_5457_7331 594
34 3300046471 Ga0495650_0000033 Ga0495650_0000033_262340_264214 594
35 3300046474 Ga0495605_0015583 Ga0495605_0015583_2199_4073 594
36 3300046507 Ga0495606_0000627 Ga0495606_0000627_16437_18311 594
37 3300046523 Ga0495644_0000325 Ga0495644_0000325_12174_14048 594
38 3300046524 Ga0495648_0002784 Ga0495648_0002784_3850_5724 594
39 3300046530 Ga0495654_0000020 Ga0495654_0000020_142685_144559 594
40 3300046692 Ga0495671_0002439 Ga0495671_0002439_6925_8799 594
41 3300046692 Ga0495671_0014193 Ga0495671_0014193_2496_4283 594
42 3300046810 Ga0495660_0000011 Ga0495660_0000011_111921_113795 594
43 3300047320 Ga0495672_0000004 Ga0495672_0000004_422865_424739 594
44 3300047469 Ga0495673_0000023 Ga0495673_0000023_376040_377914 594
45 3300049459 Ga0495678_000388 Ga0495678_000388_9228_11102 594
46 3300049460 Ga0495682_0000004 Ga0495682_0000004_149000_150874 594
47 3300053126 Ga0500621_000001 Ga0500621_000001_207000_208874 594
48 3300009036 Ga0105244_10000048 Ga0105244_1000004840 596
49 3300013104 Ga0157370_10003461 Ga0157370_1000346118 596
50 3300048919 Ga0496116_0002239 Ga0496116_0002239_727_2601 596
51 3300048923 Ga0496120_0000429 Ga0496120_0000429_18795_20669 596
52 3300048927 Ga0496124_0013680 Ga0496124_0013680_671_2545 596
53 3300048927 Ga0496124_0042025 Ga0496124_0042025_1728_3656 596
54 3300005289 Ga0065704_10000433 Ga0065704_1000043317 597
55 3300005366 Ga0070659_100029597 Ga0070659_1000295973 597
56 3300005548 Ga0070665_100001125 Ga0070665_1000011252 597
57 3300006051 Ga0075364_10006248 Ga0075364_100062484 597
58 3300006195 Ga0075366_10010412 Ga0075366_100104123 597
59 3300006946 Ga0079104_1013362 Ga0079104_10133622 597
60 3300013104 Ga0157370_10001697 Ga0157370_100016972 597
61 3300027111 Ga0209281_1006480 Ga0209281_10064803 597
62 3300027312 Ga0209371_1000001 Ga0209371_1000001186 597
63 3300028379 Ga0268266_10000084 Ga0268266_10000084129 597
64 3300030500 Ga0268256_1000001 Ga0268256_10000012455 597
65 3300041512 Ga0451853_1183803 Ga0451853_1183803_2540_4414 597
66 3300042010 Ga0439452_000033 Ga0439452_000033_83298_85172 597
67 3300046471 Ga0495650_0000175 Ga0495650_0000175_83651_85525 597
68 3300046515 Ga0495620_0000263 Ga0495620_0000263_30_1868 597
69 3300048920 Ga0496117_0011702 Ga0496117_0011702_12_1805 597
70 3300048920 Ga0496117_0019385 Ga0496117_0019385_39_1913 597
71 3300048921 Ga0496118_0002663 Ga0496118_0002663_1066_2940 597
72 3300048924 Ga0496121_0002191 Ga0496121_0002191_25606_27480 597
73 3300048925 Ga0496122_0003581 Ga0496122_0003581_12599_14473 597
74 3300048925 Ga0496122_0029135 Ga0496122_0029135_2860_4653 597
75 3300048926 Ga0496123_0000759 Ga0496123_0000759_3094_4968 597
76 3300001989 JGI24739J22299_10004581 JGI24739J22299_100045814 598
77 3300005289 Ga0065704_10008060 Ga0065704_100080601 598
78 3300005289 Ga0065704_10092388 Ga0065704_100923882 598
79 3300005335 Ga0070666_10034651 Ga0070666_100346512 598
80 3300005577 Ga0068857_100000003 Ga0068857_10000000385 598
81 3300005844 Ga0068862_100001883 Ga0068862_10000188313 598
82 3300006946 Ga0079104_1000220 Ga0079104_100022040 598
83 3300006946 Ga0079104_1009896 Ga0079104_10098962 598
84 3300009011 Ga0105251_10002616 Ga0105251_1000261611 598
85 3300009036 Ga0105244_10000414 Ga0105244_1000041438 598
86 3300013102 Ga0157371_10002463 Ga0157371_1000246313 598
87 3300013104 Ga0157370_10000557 Ga0157370_1000055730 598
88 3300015679 Ga0183366_1001 Ga0183366_1001229 598
89 3300015680 Ga0183370_1001 Ga0183370_1001229 598
90 3300015685 Ga0183369_1001 Ga0183369_1001229 598
91 3300015687 Ga0183368_1001 Ga0183368_1001229 598
92 3300025711 Ga0207696_1009429 Ga0207696_10094292 598
93 3300025728 Ga0207655_1000029 Ga0207655_1000029210 598
94 3300025728 Ga0207655_1000087 Ga0207655_1000087195 598
95 3300025728 Ga0207655_1006562 Ga0207655_10065624 598
96 3300025728 Ga0207655_1023472 Ga0207655_10234723 598
97 3300025735 Ga0207713_1013546 Ga0207713_10135461 598
98 3300025941 Ga0207711_10006103 Ga0207711_100061039 598
99 3300026116 Ga0207674_10000043 Ga0207674_1000004385 598
100 3300027111 Ga0209281_1000001 Ga0209281_10000011659 598
101 3300027111 Ga0209281_1000075 Ga0209281_100007567 598
102 3300027111 Ga0209281_1000335 Ga0209281_100033563 598
103 3300027312 Ga0209371_1010515 Ga0209371_10105152 598
104 3300028379 Ga0268266_10004969 Ga0268266_1000496911 598
105 3300028380 Ga0268265_10000783 Ga0268265_1000078320 598
106 3300030500 Ga0268256_1000824 Ga0268256_10008242 598
107 3300042010 Ga0439452_000017 Ga0439452_000017_207637_209511 598
108 3300048919 Ga0496116_0000505 Ga0496116_0000505_35426_37300 598
109 3300048920 Ga0496117_0000212 Ga0496117_0000212_51514_53388 598
110 3300048921 Ga0496118_0006001 Ga0496118_0006001_4186_6060 598
111 3300048922 Ga0496119_0002495 Ga0496119_0002495_10706_12580 598
112 3300048923 Ga0496120_0000703 Ga0496120_0000703_39503_41377 598
113 3300048927 Ga0496124_0020649 Ga0496124_0020649_720_2594 598
114 3300048927 Ga0496124_0074671 Ga0496124_0074671_583_2520 598
115 3300048929 Ga0496126_0001252 Ga0496126_0001252_37412_39286 598
116 3300005289 Ga0065704_10000891 Ga0065704_100008911 599
117 3300005331 Ga0070670_100000018 Ga0070670_10000001829 599
118 3300005367 Ga0070667_100000021 Ga0070667_100000021175 599
119 3300005466 Ga0070685_10000003 Ga0070685_10000003142 599
120 3300005618 Ga0068864_100000002 Ga0068864_100000002514 599
121 3300005843 Ga0068860_100001060 Ga0068860_1000010607 599
122 3300006051 Ga0075364_10000229 Ga0075364_100002294 599
123 3300006946 Ga0079104_1002095 Ga0079104_100209510 599
124 3300009011 Ga0105251_10000983 Ga0105251_100009834 599
125 3300009036 Ga0105244_10000087 Ga0105244_1000008736 599
126 3300014325 Ga0163163_10000634 Ga0163163_1000063426 599
127 3300025711 Ga0207696_1007690 Ga0207696_10076902 599
128 3300025728 Ga0207655_1000001 Ga0207655_1000001206 599
129 3300025728 Ga0207655_1000206 Ga0207655_100020662 599
130 3300025735 Ga0207713_1000021 Ga0207713_1000021264 599
131 3300025735 Ga0207713_1006626 Ga0207713_10066264 599
132 3300025925 Ga0207650_10000002 Ga0207650_10000002508 599
133 3300025986 Ga0207658_10000001 Ga0207658_10000001844 599
134 3300026095 Ga0207676_10000001 Ga0207676_10000001508 599
135 3300027111 Ga0209281_1000021 Ga0209281_1000021321 599
136 3300028381 Ga0268264_10000004 Ga0268264_10000004515 599
137 3300046458 Ga0495591_000011 Ga0495591_000011_32612_34486 599
138 3300047469 Ga0495673_0000529 Ga0495673_0000529_3456_5330 599
139 3300048925 Ga0496122_0000026 Ga0496122_0000026_302389_304263 599
140 3300048926 Ga0496123_0000005 Ga0496123_0000005_602704_604578 599
141 3300049574 Ga0501038_0057751 Ga0501038_0057751_1225_3183 599
142 3300049586 Ga0501070_0036681 Ga0501070_0036681_1213_3171 599
143 3300049590 Ga0501074_0007169 Ga0501074_0007169_3313_5271 599
144 3300049742 Ga0501080_0013180 Ga0501080_0013180_696_2654 599
145 3300003320 rootH2_10040819 rootH2_1004081920 600
146 3300005937 Ga0081455_10078333 Ga0081455_100783332 600
147 3300009036 Ga0105244_10009517 Ga0105244_100095172 600
148 3300009092 Ga0105250_10000044 Ga0105250_1000004441 600
149 3300021388 Ga0213875_10018256 Ga0213875_100182563 600
150 3300025711 Ga0207696_1000003 Ga0207696_1000003305 600
151 3300027312 Ga0209371_1009424 Ga0209371_10094242 600
152 3300030500 Ga0268256_1009255 Ga0268256_10092553 600
153 3300031251 Ga0265327_10000333 Ga0265327_1000033339 600
154 3300037853 Ga0436364_0455618 Ga0436364_0455618_5839_7662 600
155 3300044669 Ga0466981_0000006 Ga0466981_0000006_104577_106451 600
156 3300048926 Ga0496123_0000801 Ga0496123_0000801_5916_7790 600
157 3300048928 Ga0496125_0000016 Ga0496125_0000016_472333_474207 600
158 3300049570 Ga0501033_0008946 Ga0501033_0008946_4854_6683 600
159 3300053104 Ga0500556_0003696 Ga0500556_0003696_2237_4063 600
160 3300013306 Ga0163162_10037377 Ga0163162_100373772 601
161 3300042115 Ga0450911_000013 Ga0450911_000013_43282_45204 601
162 3300049853 Ga0501226_000015 Ga0501226_000015_104160_106082 601
163 3300003320 rootH2_10068438 rootH2_100684382 602
164 3300003323 rootH1_10005050 rootH1_1000505019 602
165 3300009011 Ga0105251_10000812 Ga0105251_1000081223 602
166 3300009148 Ga0105243_10002042 Ga0105243_100020427 602
167 3300013297 Ga0157378_10021057 Ga0157378_100210574 602
168 3300025728 Ga0207655_1007706 Ga0207655_10077064 602
169 3300025735 Ga0207713_1000005 Ga0207713_1000005453 602
170 3300025735 Ga0207713_1000006 Ga0207713_100000638 602
171 3300025935 Ga0207709_10003606 Ga0207709_100036063 602
172 3300027312 Ga0209371_1001253 Ga0209371_100125312 602
173 3300030500 Ga0268256_1001063 Ga0268256_10010636 602
174 3300032133 Ga0316583_10005959 Ga0316583_100059594 602
175 3300033529 Ga0316587_1001710 Ga0316587_10017103 602
176 3300033541 Ga0316596_1005926 Ga0316596_10059261 602
177 3300036647 Ga0316582_0001994 Ga0316582_0001994_2066_3964 602
178 3300036712 Ga0316584_0000428 Ga0316584_0000428_7182_9080 602
179 3300049569 Ga0501032_0000157 Ga0501032_0000157_602_2446 602
180 3300049570 Ga0501033_0000001 Ga0501033_0000001_232908_234752 602
181 2162886007 SwRhRL2b_contig_1225512 SwRhRL2b_0798.00005230 603
182 3300003856 Ga0058692_1005261 Ga0058692_10052611 603
183 3300005327 Ga0070658_10004873 Ga0070658_100048734 603
184 3300005355 Ga0070671_100000028 Ga0070671_10000002827 603
185 3300005563 Ga0068855_100003289 Ga0068855_1000032895 603
186 3300009036 Ga0105244_10000298 Ga0105244_1000029826 603
187 3300009036 Ga0105244_10004360 Ga0105244_100043606 603
188 3300009545 Ga0105237_10012539 Ga0105237_100125393 603
189 3300025728 Ga0207655_1000042 Ga0207655_100004216 603
190 3300025909 Ga0207705_10039053 Ga0207705_100390531 603
191 3300025914 Ga0207671_10043184 Ga0207671_100431842 603
192 3300025949 Ga0207667_10006477 Ga0207667_100064776 603
193 3300038726 Ga0400490_04080 Ga0400490_04080_37_1917 603
194 3300046471 Ga0495650_0000016 Ga0495650_0000016_405810_407675 603
195 3300046522 Ga0495643_0000062 Ga0495643_0000062_170457_172292 603
196 3300046810 Ga0495660_0000007 Ga0495660_0000007_336399_338264 603
197 3300048907 Ga0496104_0000592 Ga0496104_0000592_14975_16840 603
198 3300048919 Ga0496116_0000054 Ga0496116_0000054_109951_111816 603
199 3300048920 Ga0496117_0011783 Ga0496117_0011783_4773_6638 603
200 3300048921 Ga0496118_0001321 Ga0496118_0001321_24236_26101 603
201 3300048923 Ga0496120_0008451 Ga0496120_0008451_4906_6771 603
202 3300048925 Ga0496122_0000013 Ga0496122_0000013_384197_386062 603
203 3300048926 Ga0496123_0000010 Ga0496123_0000010_114978_116843 603
204 3300048927 Ga0496124_0000010 Ga0496124_0000010_167672_169537 603
205 3300048927 Ga0496124_0000288 Ga0496124_0000288_29643_31517 603
206 3300048928 Ga0496125_0000019 Ga0496125_0000019_326016_327881 603
207 3300048929 Ga0496126_0000252 Ga0496126_0000252_52621_54486 603
208 3300053153 Ga0500616_0001434 Ga0500616_0001434_17486_19339 603
209 iso_pu_bacteria 2829745981 2829748077 603
210 iso_pu_bacteria 643348555 643389984 603
211 3300005844 Ga0068862_100108037 Ga0068862_1001080372 604
212 3300006946 Ga0079104_1000248 Ga0079104_100024849 604
213 3300006946 Ga0079104_1001748 Ga0079104_100174811 604
214 3300027111 Ga0209281_1000041 Ga0209281_100004160 604
215 3300027312 Ga0209371_1003799 Ga0209371_10037996 604
216 3300030500 Ga0268256_1007719 Ga0268256_10077191 604
217 3300031548 Ga0307408_100000411 Ga0307408_1000004112 604
218 3300031665 Ga0316575_10001442 Ga0316575_100014427 604
219 3300031727 Ga0316576_10001557 Ga0316576_100015574 604
220 3300031728 Ga0316578_10001181 Ga0316578_100011814 604
221 3300031733 Ga0316577_10000094 Ga0316577_1000009416 604
222 3300031901 Ga0307406_10003868 Ga0307406_100038686 604
223 3300036712 Ga0316584_0004523 Ga0316584_0004523_6070_7989 604
224 3300046694 Ga0495649_0001266 Ga0495649_0001266_9721_11595 604
225 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003271 605
226 3300002771 JGI25163J39215_1000015 JGI25163J39215_100001558 605
227 3300002772 JGI25164J39214_1000009 JGI25164J39214_100000919 605
228 3300003751 Ga0055538_1000005 Ga0055538_1000005271 605
229 3300003752 Ga0055539_1000007 Ga0055539_1000007271 605
230 3300003756 Ga0055533_1000009 Ga0055533_1000009271 605
231 3300003759 Ga0055525_1000010 Ga0055525_1000010271 605
232 3300003841 Ga0055541_1000005 Ga0055541_1000005293 605
233 3300005289 Ga0065704_10000446 Ga0065704_100004467 605
234 3300005327 Ga0070658_10020102 Ga0070658_100201022 605
235 3300005539 Ga0068853_100000005 Ga0068853_10000000531 605
236 3300005616 Ga0068852_100001192 Ga0068852_1000011924 605
237 3300005834 Ga0068851_10000587 Ga0068851_100005874 605
238 3300006946 Ga0079104_1000111 Ga0079104_100011168 605
239 3300013296 Ga0157374_10060607 Ga0157374_100606073 605
240 3300025207 Ga0209760_100057 Ga0209760_10005732 605
241 3300025224 Ga0209784_100001 Ga0209784_100001814 605
242 3300025225 Ga0209566_100001 Ga0209566_100001814 605
243 3300025226 Ga0209674_100002 Ga0209674_100002814 605
244 3300025230 Ga0209563_100008 Ga0209563_100008817 605
245 3300025231 Ga0207427_100002 Ga0207427_100002461 605
246 3300025233 Ga0209437_100007 Ga0209437_100007269 605
247 3300025253 Ga0209677_100004 Ga0209677_100004817 605
248 3300025261 Ga0209233_1001387 Ga0209233_10013876 605
249 3300025321 Ga0207656_10014464 Ga0207656_100144644 605
250 3300025711 Ga0207696_1000247 Ga0207696_100024756 605
251 3300025728 Ga0207655_1000496 Ga0207655_100049626 605
252 3300025909 Ga0207705_10025061 Ga0207705_100250613 605
253 3300026041 Ga0207639_10000010 Ga0207639_10000010265 605
254 3300026118 Ga0207675_100044530 Ga0207675_1000445302 605
255 3300027111 Ga0209281_1000079 Ga0209281_100007968 605
256 3300041404 Ga0439436_0000430 Ga0439436_0000430_7863_9761 605
257 3300041411 Ga0439466_0001695 Ga0439466_0001695_6270_8168 605
258 iso_pu_bacteria 2861691609 2861694999 605
259 3300021384 Ga0213876_10000025 Ga0213876_10000025222 606
260 3300027312 Ga0209371_1000303 Ga0209371_10003032 606
261 3300030500 Ga0268256_1000017 Ga0268256_1000017330 606
262 3300039437 Ga0436365_1279401 Ga0436365_1279401_288335_290209 606
263 3300048925 Ga0496122_0000520 Ga0496122_0000520_24357_26231 606
264 3300048926 Ga0496123_0000152 Ga0496123_0000152_56812_58686 606
265 3300015261 Ga0182006_1000020 Ga0182006_1000020183 607
266 3300041405 Ga0439438_006601 Ga0439438_006601_396_2270 607
267 3300042010 Ga0439452_000003 Ga0439452_000003_755955_757829 607
268 3300049580 Ga0501046_0029317 Ga0501046_0029317_724_2622 607
269 3300002773 JGI25152J39213_1000407 JGI25152J39213_100040730 609
270 3300002774 JGI25150J39212_1000372 JGI25150J39212_100037225 609
271 3300003187 JGI25151J46595_10000558 JGI25151J46595_1000055827 609
272 3300003215 JGI25153J46596_10000334 JGI25153J46596_1000033427 609
273 3300005289 Ga0065704_10080471 Ga0065704_100804711 609
274 3300025245 Ga0207425_1000030 Ga0207425_10000301 609
275 3300025258 Ga0209129_1000597 Ga0209129_100059726 609
276 3300025294 Ga0209025_1000054 Ga0209025_1000054260 609
277 3300025297 Ga0209758_1000062 Ga0209758_1000062260 609
278 3300039062 Ga0400483_009065 Ga0400483_009065_3234_5135 609
279 3300039062 Ga0400483_259219 Ga0400483_259219_2801_4702 609
280 3300039437 Ga0436365_1440570 Ga0436365_1440570_60_1934 609
281 3300046492 Ga0495585_0003927 Ga0495585_0003927_3811_5718 609
282 3300046665 Ga0495661_0000092 Ga0495661_0000092_4878_6785 609
283 3300049578 Ga0501042_0003173 Ga0501042_0003173_4692_6566 609
284 iso_pu_bacteria 641228493 641336185 609
285 3300002773 JGI25152J39213_1003100 JGI25152J39213_10031002 610
286 3300003856 Ga0058692_1000006 Ga0058692_1000006305 610
287 3300005289 Ga0065704_10070423 Ga0065704_100704233 610
288 3300005330 Ga0070690_100066841 Ga0070690_1000668411 610
289 3300005331 Ga0070670_100009488 Ga0070670_1000094883 610
290 3300005546 Ga0070696_100002012 Ga0070696_10000201211 610
291 3300005617 Ga0068859_100134273 Ga0068859_1001342732 610
292 3300005843 Ga0068860_100030311 Ga0068860_1000303111 610
293 3300006852 Ga0075433_10003117 Ga0075433_100031173 610
294 3300006871 Ga0075434_100011855 Ga0075434_1000118558 610
295 3300006914 Ga0075436_100001687 Ga0075436_1000016877 610
296 3300006931 Ga0097620_100134269 Ga0097620_1001342692 610
297 3300007076 Ga0075435_100001908 Ga0075435_10000190810 610
298 3300009011 Ga0105251_10015617 Ga0105251_100156173 610
299 3300009094 Ga0111539_10104260 Ga0111539_101042603 610
300 3300025258 Ga0209129_1000015 Ga0209129_1000015209 610
301 3300025735 Ga0207713_1007860 Ga0207713_10078603 610
302 3300027312 Ga0209371_1000010 Ga0209371_1000010689 610
303 3300027312 Ga0209371_1000016 Ga0209371_1000016302 610
304 3300027312 Ga0209371_1000026 Ga0209371_1000026247 610
305 3300027312 Ga0209371_1001062 Ga0209371_10010629 610
306 3300027312 Ga0209371_1002424 Ga0209371_100242411 610
307 3300030500 Ga0268256_1000003 Ga0268256_1000003247 610
308 3300030500 Ga0268256_1000015 Ga0268256_1000015268 610
309 3300030500 Ga0268256_1000022 Ga0268256_1000022176 610
310 3300030500 Ga0268256_1000894 Ga0268256_10008949 610
311 3300035691 Ga0373931_0003470 Ga0373931_0003470_393_2255 610
312 3300042010 Ga0439452_000027 Ga0439452_000027_65903_67777 610
313 3300042876 Ga0451577_0072675 Ga0451577_0072675_473_2317 610
314 3300045051 Ga0451576_0027885 Ga0451576_0027885_3562_5406 610
315 3300046694 Ga0495649_0005413 Ga0495649_0005413_1901_3808 610
316 3300048922 Ga0496119_0002997 Ga0496119_0002997_7040_8914 610
317 3300048927 Ga0496124_0001225 Ga0496124_0001225_4899_6773 610
318 3300048929 Ga0496126_0023249 Ga0496126_0023249_1312_3186 610
319 3300050512 nmdc:mga0n895_6315_c1 nmdc:mga0n895_6315_c1_6575_8437 610
320 3300050513 nmdc:mga0rr50_381_c1 nmdc:mga0rr50_381_c1_11200_13062 610
321 3300050514 nmdc:mga08x19_2762_c1 nmdc:mga08x19_2762_c1_8436_10298 610
322 3300050515 nmdc:mga0a205_93_c2 nmdc:mga0a205_93_c2_10267_12129 610
323 2162886007 SwRhRL2b_contig_2054245 SwRhRL2b_0024.00006900 611
324 3300005330 Ga0070690_100000289 Ga0070690_10000028922 611
325 3300005334 Ga0068869_100000299 Ga0068869_1000002995 611
326 3300005337 Ga0070682_100002601 Ga0070682_1000026014 611
327 3300005338 Ga0068868_100000531 Ga0068868_10000053122 611
328 3300005340 Ga0070689_100006066 Ga0070689_1000060664 611
329 3300005343 Ga0070687_100000355 Ga0070687_1000003553 611
330 3300005345 Ga0070692_10002606 Ga0070692_100026061 611
331 3300005438 Ga0070701_10000387 Ga0070701_1000038710 611
332 3300005440 Ga0070705_100000472 Ga0070705_1000004727 611
333 3300005441 Ga0070700_100006031 Ga0070700_1000060313 611
334 3300005444 Ga0070694_100000249 Ga0070694_10000024920 611
335 3300005459 Ga0068867_100000430 Ga0068867_1000004306 611
336 3300005539 Ga0068853_100057280 Ga0068853_1000572803 611
337 3300005544 Ga0070686_100000392 Ga0070686_10000039225 611
338 3300005545 Ga0070695_100000185 Ga0070695_1000001858 611
339 3300005546 Ga0070696_100000519 Ga0070696_10000051920 611
340 3300005547 Ga0070693_100000135 Ga0070693_10000013530 611
341 3300005563 Ga0068855_100002231 Ga0068855_1000022315 611
342 3300005578 Ga0068854_100008537 Ga0068854_1000085374 611
343 3300005615 Ga0070702_100000557 Ga0070702_10000055711 611
344 3300005617 Ga0068859_100001399 Ga0068859_1000013997 611
345 3300005718 Ga0068866_10001440 Ga0068866_100014402 611
346 3300005719 Ga0068861_100001038 Ga0068861_1000010381 611
347 3300005842 Ga0068858_100010152 Ga0068858_1000101524 611
348 3300005843 Ga0068860_100002413 Ga0068860_1000024135 611
349 3300005844 Ga0068862_100001204 Ga0068862_10000120420 611
350 3300006237 Ga0097621_100004130 Ga0097621_1000041303 611
351 3300006358 Ga0068871_100000370 Ga0068871_1000003706 611
352 3300006844 Ga0075428_100000993 Ga0075428_10000099315 611
353 3300006880 Ga0075429_100000215 Ga0075429_10000021545 611
354 3300006881 Ga0068865_100000283 Ga0068865_10000028325 611
355 3300006931 Ga0097620_100001399 Ga0097620_1000013997 611
356 3300009094 Ga0111539_10167108 Ga0111539_101671082 611
357 3300009098 Ga0105245_10001066 Ga0105245_100010664 611
358 3300009147 Ga0114129_10001138 Ga0114129_1000113820 611
359 3300009148 Ga0105243_10000708 Ga0105243_1000070830 611
360 3300009176 Ga0105242_10001614 Ga0105242_100016146 611
361 3300009553 Ga0105249_10005638 Ga0105249_100056385 611
362 3300013297 Ga0157378_10001153 Ga0157378_1000115320 611
363 3300025899 Ga0207642_10007346 Ga0207642_100073463 611
364 3300025918 Ga0207662_10000191 Ga0207662_1000019125 611
365 3300025926 Ga0207659_10043063 Ga0207659_100430633 611
366 3300025927 Ga0207687_10001813 Ga0207687_1000181314 611
367 3300025934 Ga0207686_10001418 Ga0207686_100014182 611
368 3300025935 Ga0207709_10001098 Ga0207709_100010985 611
369 3300025936 Ga0207670_10001920 Ga0207670_100019204 611
370 3300025938 Ga0207704_10000409 Ga0207704_100004096 611
371 3300025942 Ga0207689_10000921 Ga0207689_100009216 611
372 3300025949 Ga0207667_10017372 Ga0207667_100173725 611
373 3300025961 Ga0207712_10004731 Ga0207712_100047318 611
374 3300025981 Ga0207640_10001592 Ga0207640_1000159211 611
375 3300026023 Ga0207677_10000592 Ga0207677_1000059220 611
376 3300026035 Ga0207703_10007345 Ga0207703_100073457 611
377 3300026075 Ga0207708_10000451 Ga0207708_1000045119 611
378 3300026089 Ga0207648_10000245 Ga0207648_1000024520 611
379 3300026118 Ga0207675_100001447 Ga0207675_10000144720 611
380 3300027907 Ga0207428_10000954 Ga0207428_100009542 611
381 3300028380 Ga0268265_10000627 Ga0268265_100006278 611
382 3300028381 Ga0268264_10003335 Ga0268264_1000333512 611
383 3300033179 Ga0307507_10021263 Ga0307507_100212635 611
384 3300035112 Ga0373932_0009006 Ga0373932_0009006_327_2192 611
385 3300035170 Ga0373943_0036176 Ga0373943_0036176_123_1988 611
386 3300035171 Ga0373946_0004603 Ga0373946_0004603_130_1995 611
387 3300035410 Ga0373924_0020416 Ga0373924_0020416_611_2476 611
388 3300035691 Ga0373931_0004014 Ga0373931_0004014_4748_6595 611
389 3300035692 Ga0373935_0041524 Ga0373935_0041524_261_2126 611
390 3300035695 Ga0373927_0036936 Ga0373927_0036936_518_2383 611
391 3300046455 Ga0495603_0000212 Ga0495603_0000212_24314_26179 611
392 3300046472 Ga0495580_0000358 Ga0495580_0000358_7778_9643 611
393 3300046535 Ga0495586_0003782 Ga0495586_0003782_3046_4911 611
394 3300046674 Ga0495588_0003773 Ga0495588_0003773_2908_4773 611
395 3300046681 Ga0495647_0000273 Ga0495647_0000273_3265_5130 611
396 3300046683 Ga0495658_0000620 Ga0495658_0000620_4845_6710 611
397 3300048920 Ga0496117_0008161 Ga0496117_0008161_7337_9256 611
398 3300048922 Ga0496119_0000951 Ga0496119_0000951_7338_9257 611
399 3300048923 Ga0496120_0000276 Ga0496120_0000276_76875_78794 611
400 3300048925 Ga0496122_0004100 Ga0496122_0004100_3621_5540 611
401 3300048926 Ga0496123_0003248 Ga0496123_0003248_12932_14851 611
402 3300048927 Ga0496124_0000815 Ga0496124_0000815_12995_14914 611
403 3300050507 nmdc:mga05p37_5151_c1 nmdc:mga05p37_5151_c1_5115_6962 611
404 3300050508 nmdc:mga09592_5031_c1 nmdc:mga09592_5031_c1_103_1950 611
405 3300050511 nmdc:mga08y16_114963_c1 nmdc:mga08y16_114963_c1_397_2244 611
406 iso_pu_bacteria 2919404418 2919404697 611
407 iso_pu_bacteria 2941471342 2941472405 611
408 3300002737 JGI25162J39368_1003369 JGI25162J39368_10033692 612
409 3300005290 Ga0065712_10000132 Ga0065712_1000013234 612
410 3300009092 Ga0105250_10000025 Ga0105250_1000002597 612
411 3300009092 Ga0105250_10010099 Ga0105250_100100993 612
412 3300013105 Ga0157369_10057725 Ga0157369_100577254 612
413 3300025233 Ga0209437_100235 Ga0209437_10023535 612
414 3300025711 Ga0207696_1000007 Ga0207696_1000007315 612
415 3300025735 Ga0207713_1000001 Ga0207713_1000001179 612
416 3300027312 Ga0209371_1003505 Ga0209371_10035055 612
417 3300046513 Ga0495616_0004615 Ga0495616_0004615_6791_8629 612
418 3300046513 Ga0495616_0040906 Ga0495616_0040906_21_1859 612
419 3300048905 Ga0496102_0009820 Ga0496102_0009820_2397_4271 612
420 3300048920 Ga0496117_0000004 Ga0496117_0000004_834157_836031 612
421 3300048921 Ga0496118_0000024 Ga0496118_0000024_342262_344136 612
422 3300048922 Ga0496119_0001545 Ga0496119_0001545_2002_3876 612
423 3300048925 Ga0496122_0009940 Ga0496122_0009940_1616_3490 612
424 3300048925 Ga0496122_0033596 Ga0496122_0033596_1624_3573 612
425 3300048926 Ga0496123_0000651 Ga0496123_0000651_31202_33076 612
426 3300049588 Ga0501072_0054669 Ga0501072_0054669_568_2439 612
427 3300059421 Ga0590071_005517 Ga0590071_005517_235_2088 612
428 3300013307 Ga0157372_10250120 Ga0157372_102501201 613
429 3300015261 Ga0182006_1004233 Ga0182006_10042332 613
430 3300017792 Ga0163161_10016090 Ga0163161_100160903 613
431 3300025711 Ga0207696_1000655 Ga0207696_100065523 613
432 3300025728 Ga0207655_1008247 Ga0207655_10082473 613
433 3300025735 Ga0207713_1010212 Ga0207713_10102123 613
434 3300027312 Ga0209371_1000220 Ga0209371_100022034 613
435 3300030500 Ga0268256_1000359 Ga0268256_10003594 613
436 3300031251 Ga0265327_10000241 Ga0265327_1000024181 613
437 3300031727 Ga0316576_10011765 Ga0316576_100117655 613
438 3300031733 Ga0316577_10028740 Ga0316577_100287402 613
439 3300033541 Ga0316596_1013538 Ga0316596_10135381 613
440 3300035398 Ga0316574_0001118 Ga0316574_0001118_7335_9197 613
441 3300036647 Ga0316582_0002211 Ga0316582_0002211_5966_7864 613
442 3300036712 Ga0316584_0077175 Ga0316584_0077175_502_2370 613
443 3300037588 Ga0316581_0006025 Ga0316581_0006025_1039_2937 613
444 3300041407 Ga0439447_003201 Ga0439447_003201_1432_3306 613
445 3300041411 Ga0439466_0000012 Ga0439466_0000012_11720_13594 613
446 3300047320 Ga0495672_0000061 Ga0495672_0000061_20202_22076 613
447 3300048920 Ga0496117_0000853 Ga0496117_0000853_40838_42712 613
448 3300048921 Ga0496118_0001266 Ga0496118_0001266_31205_33079 613
449 3300048924 Ga0496121_0000131 Ga0496121_0000131_1339_3213 613
450 3300048926 Ga0496123_0009515 Ga0496123_0009515_5269_7143 613
451 3300048927 Ga0496124_0000156 Ga0496124_0000156_84202_86076 613
452 3300048927 Ga0496124_0000734 Ga0496124_0000734_8032_9918 613
453 3300048929 Ga0496126_0057570 Ga0496126_0057570_132_2006 613
454 3300013307 Ga0157372_10012829 Ga0157372_100128291 614
455 3300027312 Ga0209371_1000146 Ga0209371_100014674 614
456 3300027312 Ga0209371_1000557 Ga0209371_10005575 614
457 3300030500 Ga0268256_1000117 Ga0268256_100011742 614
458 3300030500 Ga0268256_1000677 Ga0268256_10006775 614
459 3300031251 Ga0265327_10025252 Ga0265327_100252523 614
460 3300041405 Ga0439438_000879 Ga0439438_000879_10973_12847 614
461 3300002075 JGI24738J21930_10010282 JGI24738J21930_100102821 615
462 3300013104 Ga0157370_10016285 Ga0157370_100162852 615
463 3300013105 Ga0157369_10068008 Ga0157369_100680083 615
464 3300025258 Ga0209129_1012473 Ga0209129_10124731 615
465 3300025303 Ga0209051_1012278 Ga0209051_10122783 615
466 3300025711 Ga0207696_1000152 Ga0207696_1000152115 615
467 3300025735 Ga0207713_1000009 Ga0207713_1000009396 615
468 3300025904 Ga0207647_10000006 Ga0207647_100000067 615
469 3300027312 Ga0209371_1000615 Ga0209371_100061514 615
470 3300030500 Ga0268256_1000528 Ga0268256_100052813 615
471 3300035695 Ga0373927_0011878 Ga0373927_0011878_3433_5295 615
472 3300039062 Ga0400483_026308 Ga0400483_026308_45120_47054 615
473 3300039062 Ga0400483_076133 Ga0400483_076133_4720_6615 615
474 3300039062 Ga0400483_250036 Ga0400483_250036_251726_253660 615
475 3300039110 Ga0400487_51348 Ga0400487_51348_4193_6088 615
476 3300046453 Ga0495627_002242 Ga0495627_002242_3565_5475 615
477 3300046507 Ga0495606_0008136 Ga0495606_0008136_3238_5145 615
478 3300046542 Ga0495597_0004114 Ga0495597_0004114_3124_5034 615
479 3300047321 Ga0495676_0008018 Ga0495676_0008018_1440_3347 615
480 3300047323 Ga0495683_0000175 Ga0495683_0000175_4783_6687 615
481 3300047469 Ga0495673_0004149 Ga0495673_0004149_3436_5346 615
482 3300048921 Ga0496118_0006959 Ga0496118_0006959_5279_7147 615
483 3300048924 Ga0496121_0000129 Ga0496121_0000129_7751_9619 615
484 3300048928 Ga0496125_0016707 Ga0496125_0016707_1050_2918 615
485 3300053098 Ga0500650_0000015 Ga0500650_0000015_41814_43760 615
486 3300038726 Ga0400490_31714 Ga0400490_31714_1400_3301 616
487 3300039447 Ga0436361_1114325 Ga0436361_1114325_8630_10531 616
488 3300049459 Ga0495678_004373 Ga0495678_004373_2010_3920 616
489 3300049572 Ga0501036_0003884 Ga0501036_0003884_2329_4191 616
490 3300049574 Ga0501038_0004228 Ga0501038_0004228_1183_3045 616
491 3300049575 Ga0501039_0008002 Ga0501039_0008002_2746_4608 616
492 3300049576 Ga0501040_0000316 Ga0501040_0000316_24169_26031 616
493 3300049577 Ga0501041_0000270 Ga0501041_0000270_16393_18255 616
494 3300049579 Ga0501043_0009281 Ga0501043_0009281_5283_7145 616
495 3300049580 Ga0501046_0000535 Ga0501046_0000535_11565_13427 616
496 3300049582 Ga0501048_0000628 Ga0501048_0000628_6210_8072 616
497 3300049587 Ga0501071_0009143 Ga0501071_0009143_57_1919 616
498 3300049590 Ga0501074_0008561 Ga0501074_0008561_460_2322 616
499 3300049591 Ga0501075_0000915 Ga0501075_0000915_7209_9071 616
500 3300049592 Ga0501076_0004510 Ga0501076_0004510_5327_7189 616
501 3300049741 Ga0501079_0001639 Ga0501079_0001639_10875_12737 616
502 3300049742 Ga0501080_0052909 Ga0501080_0052909_1128_2990 616
503 3300049822 Ga0501035_0066958 Ga0501035_0066958_706_2568 616
504 3300049824 Ga0501045_0014628 Ga0501045_0014628_3328_5190 616
505 3300060353 Ga0501082_0002945 Ga0501082_0002945_7795_9657 616
506 3300061734 Ga0530510_0000092 Ga0530510_0000092_40236_42098 616
507 iso_pu_bacteria 2506520007 2506577112 616
508 iso_pu_bacteria 2506520008 2506582250 616
509 iso_pu_bacteria 2654587920 2656279481 616
510 iso_pu_bacteria 2687453601 2689443515 616
511 iso_pu_bacteria 2869551831 2869552932 616
512 iso_pu_bacteria 2888366609 2888367640 616
513 iso_pu_bacteria 2888373701 2888374655 616
514 3300009011 Ga0105251_10000018 Ga0105251_1000001819 617
515 3300009092 Ga0105250_10008301 Ga0105250_100083011 617
516 3300033527 Ga0316586_1002942 Ga0316586_10029421 617
517 3300036647 Ga0316582_0007751 Ga0316582_0007751_399_2318 617
518 3300046453 Ga0495627_001983 Ga0495627_001983_4570_6480 617
519 3300046519 Ga0495632_0048002 Ga0495632_0048002_135_2045 617
520 iso_pu_bacteria 2844528606 2844532028 617
521 iso_pu_bacteria 2847797336 2847800869 617
522 iso_pu_bacteria 2865014394 2865017595 617
523 iso_pu_bacteria 2876601092 2876601255 617
524 iso_pu_bacteria 2881609920 2881612233 617
525 iso_pu_bacteria 2908669403 2908671247 617
526 iso_pu_bacteria 8055693939 8055695175 617
527 3300038705 Ga0237819_00054 Ga0237819_00054_183_2081 618
528 3300046458 Ga0495591_000137 Ga0495591_000137_2863_4773 618
529 3300046501 Ga0495607_0005073 Ga0495607_0005073_3028_5007 618
530 3300048920 Ga0496117_0001196 Ga0496117_0001196_28691_30616 618
531 3300048921 Ga0496118_0001268 Ga0496118_0001268_28695_30620 618
532 iso_pu_bacteria 2508501071 2508851079 618
533 iso_pu_bacteria 2585427591 2585826772 618
534 iso_pu_bacteria 2585427592 2585831302 618
535 iso_pu_bacteria 2667528173 2671108395 618
536 iso_pu_bacteria 2772190666 2772437621 618
537 iso_pu_bacteria 2806310673 2807177228 618
538 iso_pu_bacteria 2904474040 2904474933 618
539 iso_pu_bacteria 2919150387 2919151279 618
540 iso_pu_bacteria 2927143783 2927146153 618
541 iso_pu_bacteria 2932406140 2932407351 618
542 iso_pu_bacteria 2937967321 2937972157 618
543 iso_pu_bacteria 2939577877 2939579261 618
544 iso_pu_bacteria 640753048 640936658 618
545 iso_pu_bacteria 8004592986 8004594344 618
546 iso_pu_bacteria 8015394850 8015398919 618
547 3300003791 Ga0055530_10010525 Ga0055530_100105252 619
548 3300009011 Ga0105251_10003157 Ga0105251_1000315711 619
549 3300009011 Ga0105251_10003178 Ga0105251_1000317811 619
550 3300009036 Ga0105244_10000362 Ga0105244_1000036213 619
551 3300009092 Ga0105250_10008680 Ga0105250_100086803 619
552 3300009093 Ga0105240_10047158 Ga0105240_100471582 619
553 3300009174 Ga0105241_10000004 Ga0105241_10000004238 619
554 3300013100 Ga0157373_10001576 Ga0157373_100015765 619
555 3300013102 Ga0157371_10000007 Ga0157371_10000007248 619
556 3300017792 Ga0163161_10000004 Ga0163161_10000004147 619
557 3300025298 Ga0209050_1001705 Ga0209050_10017052 619
558 3300025711 Ga0207696_1000033 Ga0207696_1000033100 619
559 3300025735 Ga0207713_1000133 Ga0207713_1000133100 619
560 3300025900 Ga0207710_10000016 Ga0207710_10000016250 619
561 3300046453 Ga0495627_000145 Ga0495627_000145_68835_70700 619
562 3300046530 Ga0495654_0002005 Ga0495654_0002005_11099_12964 619
563 3300046794 Ga0495589_0000006 Ga0495589_0000006_268948_270813 619
564 3300048919 Ga0496116_0000031 Ga0496116_0000031_247409_249274 619
565 3300048920 Ga0496117_0002296 Ga0496117_0002296_18564_20429 619
566 3300048921 Ga0496118_0002368 Ga0496118_0002368_16906_18771 619
567 3300048923 Ga0496120_0000522 Ga0496120_0000522_9904_11769 619
568 3300048927 Ga0496124_0000039 Ga0496124_0000039_268242_270107 619
569 iso_pu_bacteria 2511231025 2511379386 619
570 iso_pu_bacteria 2511231035 2511433841 619
571 iso_pu_bacteria 2547132181 2547698791 619
572 iso_pu_bacteria 2547132416 2548648866 619
573 iso_pu_bacteria 2554235234 2555259378 619
574 iso_pu_bacteria 2561511199 2562466317 619
575 iso_pu_bacteria 2599185169 2599411963 619
576 iso_pu_bacteria 2599185299 2599927114 619
577 iso_pu_bacteria 2600255254 2601525141 619
578 iso_pu_bacteria 2600255255 2601530328 619
579 iso_pu_bacteria 2600255256 2601531781 619
580 iso_pu_bacteria 2600255257 2601537153 619
581 iso_pu_bacteria 2600255280 2601617068 619
582 iso_pu_bacteria 2600255281 2601621585 619
583 iso_pu_bacteria 2600255287 2601645003 619
584 iso_pu_bacteria 2600255288 2601650691 619
585 iso_pu_bacteria 2600255289 2601654909 619
586 iso_pu_bacteria 2600255290 2601660424 619
587 iso_pu_bacteria 2600255291 2601665026 619
588 iso_pu_bacteria 2600255298 2601697642 619
589 iso_pu_bacteria 2600255299 2601703030 619
590 iso_pu_bacteria 2600255300 2601708272 619
591 iso_pu_bacteria 2600255301 2601713365 619
592 iso_pu_bacteria 2600255302 2601718468 619
593 iso_pu_bacteria 2600255303 2601723191 619
594 iso_pu_bacteria 2600255304 2601728299 619
595 iso_pu_bacteria 2600255305 2601733416 619
596 iso_pu_bacteria 2600255306 2601738283 619
597 iso_pu_bacteria 2600255307 2601742407 619
598 iso_pu_bacteria 2600255309 2601753621 619
599 iso_pu_bacteria 2600255310 2601755499 619
600 iso_pu_bacteria 2600255311 2601760866 619
601 iso_pu_bacteria 2600255392 2602019992 619
602 iso_pu_bacteria 2602042046 2603639090 619
603 iso_pu_bacteria 2602042047 2603643559 619
604 iso_pu_bacteria 2602042052 2603661822 619
605 iso_pu_bacteria 2602042053 2603666720 619
606 iso_pu_bacteria 2602042066 2603700142 619
607 iso_pu_bacteria 2602042067 2603704131 619
608 iso_pu_bacteria 2602042103 2603840527 619
609 iso_pu_bacteria 2602042104 2603845810 619
610 iso_pu_bacteria 2602042105 2603850883 619
611 iso_pu_bacteria 2602042106 2603855744 619
612 iso_pu_bacteria 2602042109 2603866278 619
613 iso_pu_bacteria 2602042110 2603873326 619
614 iso_pu_bacteria 2602042111 2603877625 619
615 iso_pu_bacteria 2603880178 2606050712 619
616 iso_pu_bacteria 2603880184 2606071152 619
617 iso_pu_bacteria 2603880202 2606148396 619
618 iso_pu_bacteria 2603880211 2606178395 619
619 iso_pu_bacteria 2608642108 2608668545 619
620 iso_pu_bacteria 2609459761 2609912450 619
621 iso_pu_bacteria 2636415599 2637226710 619
622 iso_pu_bacteria 2648501693 2650895540 619
623 iso_pu_bacteria 2667528172 2671102230 619
624 iso_pu_bacteria 2675903046 2676407138 619
625 iso_pu_bacteria 2681812866 2681995893 619
626 iso_pu_bacteria 2681812869 2682008911 619
627 iso_pu_bacteria 2684622997 2686355754 619
628 iso_pu_bacteria 2711768156 2712472752 619
629 iso_pu_bacteria 2751185917 2753854929 619
630 iso_pu_bacteria 2765235842 2765587795 619
631 iso_pu_bacteria 2775506706 2775541805 619
632 iso_pu_bacteria 2775507074 2777022435 619
633 iso_pu_bacteria 2791354903 2791924610 619
634 iso_pu_bacteria 2791355010 2792313741 619
635 iso_pu_bacteria 2791355275 2793406527 619
636 iso_pu_bacteria 2808606414 2809124663 619
637 iso_pu_bacteria 2811995292 2813730136 619
638 iso_pu_bacteria 2814123068 2814697715 619
639 iso_pu_bacteria 2821118458 2821118708 619
640 iso_pu_bacteria 2823373977 2823377089 619
641 iso_pu_bacteria 2844425489 2844426482 619
642 iso_pu_bacteria 2847085930 2847088709 619
643 iso_pu_bacteria 2852103415 2852103548 619
644 iso_pu_bacteria 2884086401 2884090018 619
645 iso_pu_bacteria 2891670763 2891674940 619
646 iso_pu_bacteria 2904504865 2904505632 619
647 iso_pu_bacteria 2904513164 2904514976 619
648 iso_pu_bacteria 2919108558 2919109801 619
649 iso_pu_bacteria 2923634449 2923638344 619
650 iso_pu_bacteria 2927833300 2927835212 619
651 iso_pu_bacteria 2935625433 2935629385 619
652 iso_pu_bacteria 2937539931 2937542908 619
653 iso_pu_bacteria 2939568625 2939570696 619
654 iso_pu_bacteria 2939573065 2939574871 619
655 iso_pu_bacteria 2939602548 2939603015 619
656 iso_pu_bacteria 2939607340 2939610771 619
657 iso_pu_bacteria 2939617950 2939621682 619
658 iso_pu_bacteria 2939642701 2939644802 619
659 iso_pu_bacteria 2945874760 2945879298 619
660 iso_pu_bacteria 2945951305 2945953954 619
661 iso_pu_bacteria 2969079654 2969083693 619
662 iso_pu_bacteria 2971820967 2971825159 619
663 iso_pu_bacteria 2974310843 2974313272 619
664 iso_pu_bacteria 2974435778 2974437401 619
665 iso_pu_bacteria 2978975091 2978976438 619
666 iso_pu_bacteria 2984494565 2984495632 619
667 iso_pu_bacteria 2984559226 2984560795 619
668 iso_pu_bacteria 2984595703 2984598870 619
669 iso_pu_bacteria 2990261002 2990264327 619
670 iso_pu_bacteria 3000376612 3000380134 619
671 iso_pu_bacteria 8016733728 8016736875 619
672 iso_pu_bacteria 8018221730 8018224239 619
673 iso_pu_bacteria 8018405270 8018405859 619
674 iso_pu_bacteria 8019499862 8019502084 619
675 iso_pu_bacteria 8019504834 8019508176 619
676 iso_pu_bacteria 8055087960 8055091212 619
677 iso_pu_bacteria 8055092621 8055096517 619
678 iso_pu_bacteria 8055097453 8055101327 619
679 iso_pu_bacteria 8057304971 8057306231 619
680 3300009092 Ga0105250_10000003 Ga0105250_10000003431 620
681 3300014497 Ga0182008_10000143 Ga0182008_1000014362 620
682 3300030732 Ga0316176_1131399 Ga0316176_11313991 620
683 3300038726 Ga0400490_28529 Ga0400490_28529_7823_9730 620
684 3300046474 Ga0495605_0003439 Ga0495605_0003439_2969_4867 620
685 3300048925 Ga0496122_0012404 Ga0496122_0012404_4083_5981 620
686 3300048926 Ga0496123_0009535 Ga0496123_0009535_2946_4844 620
687 iso_pu_bacteria 2952252522 2952253313 620
688 3300005272 Ga0065703_1019229 Ga0065703_10192291 621
689 3300025728 Ga0207655_1000011 Ga0207655_1000011168 621
690 3300025735 Ga0207713_1000101 Ga0207713_1000101102 621
691 3300025735 Ga0207713_1000956 Ga0207713_100095611 621
692 3300025911 Ga0207654_10000006 Ga0207654_10000006254 621
693 3300027111 Ga0209281_1000008 Ga0209281_1000008618 621
694 3300027111 Ga0209281_1006267 Ga0209281_10062671 621
695 3300046474 Ga0495605_0000026 Ga0495605_0000026_215774_217684 621
696 3300046474 Ga0495605_0000414 Ga0495605_0000414_2535_4445 621
697 3300046506 Ga0495583_0000043 Ga0495583_0000043_4053_5963 621
698 3300046512 Ga0495610_0018057 Ga0495610_0018057_390_2300 621
699 3300046538 Ga0495609_0000036 Ga0495609_0000036_4112_6022 621
700 3300046558 Ga0495633_0000143 Ga0495633_0000143_89296_91206 621
701 3300046665 Ga0495661_0000121 Ga0495661_0000121_4162_6072 621
702 3300047323 Ga0495683_0000003 Ga0495683_0000003_378027_379937 621
703 3300047469 Ga0495673_0012478 Ga0495673_0012478_2337_4247 621
704 3300048925 Ga0496122_0026581 Ga0496122_0026581_1577_3487 621
705 iso_pu_bacteria 2671180115 2671588084 621
706 iso_pu_bacteria 8054844752 8054847331 621
707 iso_pu_bacteria 8054849141 8054854186 621
708 iso_pu_bacteria 8057160832 8057161512 621
709 3300006051 Ga0075364_10013114 Ga0075364_100131144 622
710 3300009011 Ga0105251_10001816 Ga0105251_100018168 622
711 3300009092 Ga0105250_10011116 Ga0105250_100111162 622
712 3300013100 Ga0157373_10000201 Ga0157373_100002017 622
713 3300013102 Ga0157371_10000352 Ga0157371_1000035215 622
714 3300013102 Ga0157371_10017214 Ga0157371_100172144 622
715 3300013105 Ga0157369_10028650 Ga0157369_100286504 622
716 3300013307 Ga0157372_10005890 Ga0157372_100058904 622
717 3300025711 Ga0207696_1000004 Ga0207696_1000004202 622
718 3300025711 Ga0207696_1000192 Ga0207696_100019252 622
719 3300025728 Ga0207655_1011623 Ga0207655_10116233 622
720 3300025735 Ga0207713_1001549 Ga0207713_100154913 622
721 3300030742 Ga0316183_1195675 Ga0316183_11956756 622
722 3300046458 Ga0495591_000301 Ga0495591_000301_10648_12522 622
723 3300046530 Ga0495654_0000032 Ga0495654_0000032_32593_34467 622
724 3300046530 Ga0495654_0022838 Ga0495654_0022838_280_2154 622
725 3300047446 Ga0495679_000019 Ga0495679_000019_87749_89623 622
726 3300048904 Ga0496101_0000029 Ga0496101_0000029_35047_36921 622
727 3300048920 Ga0496117_0004075 Ga0496117_0004075_11931_13805 622
728 3300048921 Ga0496118_0028333 Ga0496118_0028333_676_2580 622
729 3300048922 Ga0496119_0000043 Ga0496119_0000043_37158_39032 622
730 3300048922 Ga0496119_0000062 Ga0496119_0000062_165708_167582 622
731 3300048923 Ga0496120_0000009 Ga0496120_0000009_179536_181410 622
732 3300048923 Ga0496120_0000985 Ga0496120_0000985_4321_6195 622
733 3300048925 Ga0496122_0012371 Ga0496122_0012371_666_2540 622
734 3300048925 Ga0496122_0035824 Ga0496122_0035824_59_1933 622
735 3300048926 Ga0496123_0002672 Ga0496123_0002672_18938_20812 622
736 3300048926 Ga0496123_0009924 Ga0496123_0009924_2986_4860 622
737 iso_pu_bacteria 2537561728 2538428339 622
738 iso_pu_bacteria 2706794495 2707099952 622
739 iso_pu_bacteria 2854601825 2854602665 622
740 iso_pu_bacteria 2855195626 2855199174 622
741 iso_pu_bacteria 2858466076 2858469942 622
742 iso_pu_bacteria 2871272651 2871276716 622
743 iso_pu_bacteria 2871282230 2871283914 622
744 iso_pu_bacteria 2900051742 2900054258 622
745 3300032004 Ga0307414_10011831 Ga0307414_100118314 623
746 3300049576 Ga0501040_0002293 Ga0501040_0002293_2901_4775 623
747 3300049576 Ga0501040_0056736 Ga0501040_0056736_651_2525 623
748 3300049578 Ga0501042_0064995 Ga0501042_0064995_317_2191 623
749 iso_pu_bacteria 2747842428 2747950776 623
750 3300003791 Ga0055530_10000544 Ga0055530_1000054425 624
751 3300009011 Ga0105251_10007555 Ga0105251_100075553 624
752 3300025298 Ga0209050_1000415 Ga0209050_100041532 624
753 3300025711 Ga0207696_1000517 Ga0207696_10005177 624
754 3300025728 Ga0207655_1006225 Ga0207655_10062254 624
755 3300025728 Ga0207655_1015599 Ga0207655_10155993 624
756 3300025735 Ga0207713_1014764 Ga0207713_10147642 624
757 3300046458 Ga0495591_002938 Ga0495591_002938_2569_4479 624
758 3300046491 Ga0495584_0004701 Ga0495584_0004701_2299_4209 624
759 3300046501 Ga0495607_0004502 Ga0495607_0004502_3864_5774 624
760 3300046506 Ga0495583_0004703 Ga0495583_0004703_4474_6384 624
761 3300046507 Ga0495606_0002635 Ga0495606_0002635_3257_5167 624
762 3300046515 Ga0495620_0003570 Ga0495620_0003570_4147_6057 624
763 3300046515 Ga0495620_0019386 Ga0495620_0019386_1425_3335 624
764 3300046518 Ga0495631_0004234 Ga0495631_0004234_3284_5194 624
765 3300046519 Ga0495632_0010833 Ga0495632_0010833_1804_3714 624
766 3300046520 Ga0495637_0000174 Ga0495637_0000174_44139_46049 624
767 3300046660 Ga0495625_0007427 Ga0495625_0007427_4463_6373 624
768 3300046665 Ga0495661_0002800 Ga0495661_0002800_6832_8742 624
769 3300046694 Ga0495649_0008704 Ga0495649_0008704_2495_4405 624
770 3300047320 Ga0495672_0000027 Ga0495672_0000027_143503_145383 624
771 3300047321 Ga0495676_0000019 Ga0495676_0000019_162197_164107 624
772 3300047446 Ga0495679_000119 Ga0495679_000119_17267_19177 624
773 3300048091 Ga0495626_0000659 Ga0495626_0000659_3168_5078 624
774 3300049460 Ga0495682_0002230 Ga0495682_0002230_2934_4844 624
775 iso_pu_bacteria 2547132103 2547375320 624
776 iso_pu_bacteria 2738541276 2738714946 624
777 iso_pu_bacteria 2765235840 2765578636 624
778 iso_pu_bacteria 2816332141 2816516712 624
779 iso_pu_bacteria 2843690924 2843694295 624
780 3300031239 Ga0265328_10000106 Ga0265328_1000010638 625
781 3300031250 Ga0265331_10024460 Ga0265331_100244603 625
782 3300031251 Ga0265327_10001895 Ga0265327_1000189524 625
783 3300039062 Ga0400483_233356 Ga0400483_233356_911_2797 625
784 3300053156 Ga0500622_0000023 Ga0500622_0000023_143018_144904 625
785 iso_pu_bacteria 2547132130 2547503068 625
786 iso_pu_bacteria 2842391507 2842394946 625
787 iso_pu_bacteria 2846540461 2846541485 625
788 iso_pu_bacteria 2874220319 2874221265 625
789 iso_pu_bacteria 2919089067 2919092649 625
790 iso_pu_bacteria 2919134579 2919136177 625
791 iso_pu_bacteria 2928496128 2928496234 625
792 iso_pu_bacteria 2931380184 2931381092 625
793 iso_pu_bacteria 2937610967 2937612086 625
794 iso_pu_bacteria 2939626828 2939630087 625
795 iso_pu_bacteria 2961047084 2961048031 625
796 iso_pu_bacteria 2961064222 2961065050 625
797 iso_pu_bacteria 2998344455 2998345957 625
798 3300039062 Ga0400483_195378 Ga0400483_195378_8848_10782 626
799 3300049581 Ga0501047_0032055 Ga0501047_0032055_1683_3593 626
800 3300049822 Ga0501035_0115032 Ga0501035_0115032_389_2299 626
801 3300049823 Ga0501044_0000112 Ga0501044_0000112_82193_84103 626
802 iso_pu_bacteria 2648501241 2649121698 626
803 iso_pu_bacteria 2651869818 2652975993 626
804 iso_pu_bacteria 2881714928 2881716528 626
805 iso_pu_bacteria 3007315729 3007318455 626
806 iso_pu_bacteria 8054357960 8054360684 626
807 3300003781 Ga0055536_1004488 Ga0055536_10044887 627
808 3300009093 Ga0105240_10000218 Ga0105240_1000021858 627
809 3300025263 Ga0209565_1005883 Ga0209565_10058832 627
810 3300025292 Ga0209676_1000047 Ga0209676_100004759 627
811 3300025304 Ga0209257_1001953 Ga0209257_100195321 627
812 3300025913 Ga0207695_10000395 Ga0207695_1000039544 627
813 3300038725 Ga0400484_07955 Ga0400484_07955_4976_6868 627
814 iso_pu_bacteria 2576861471 2578458760 627
815 iso_pu_bacteria 2600254954 2600444885 627
816 iso_pu_bacteria 2600255389 2602011811 627
817 iso_pu_bacteria 2606217733 2608382486 627
818 iso_pu_bacteria 2643221579 2643905585 627
819 iso_pu_bacteria 2643221581 2643913282 627
820 iso_pu_bacteria 2728369097 2729148805 627
821 iso_pu_bacteria 2738543020 2739288057 627
822 iso_pu_bacteria 2738543021 2739293614 627
823 iso_pu_bacteria 2747842501 2748016429 627
824 iso_pu_bacteria 2808606373 2808907861 627
825 iso_pu_bacteria 2808606379 2808943129 627
826 iso_pu_bacteria 2811994881 2812367610 627
827 iso_pu_bacteria 2818991457 2819659998 627
828 iso_pu_bacteria 2823421272 2823423897 627
829 iso_pu_bacteria 2842805378 2842806323 627
830 iso_pu_bacteria 2852649853 2852651115 627
831 iso_pu_bacteria 2852684882 2852685181 627
832 iso_pu_bacteria 2857442823 2857445264 627
833 iso_pu_bacteria 2916178963 2916182743 627
834 iso_pu_bacteria 2919130084 2919130724 627
835 iso_pu_bacteria 2919493220 2919493439 627
836 iso_pu_bacteria 2919497567 2919500443 627
837 iso_pu_bacteria 2919501602 2919503630 627
838 iso_pu_bacteria 2919543075 2919545163 627
839 iso_pu_bacteria 2923516293 2923517694 627
840 iso_pu_bacteria 2923519811 2923521660 627
841 iso_pu_bacteria 2923525760 2923528132 627
842 iso_pu_bacteria 2926063275 2926065798 627
843 iso_pu_bacteria 2929195423 2929198270 627
844 iso_pu_bacteria 2939589442 2939590715 627
845 iso_pu_bacteria 2939622612 2939622901 627
846 iso_pu_bacteria 2941475908 2941477941 627
847 iso_pu_bacteria 2974307012 2974309237 627
848 iso_pu_bacteria 2977247770 2977249958 627
849 iso_pu_bacteria 2984514374 2984515553 627
850 iso_pu_bacteria 2987605356 2987606295 627
851 iso_pu_bacteria 2990196909 2990199221 627
852 iso_pu_bacteria 3007252601 3007252873 627
853 iso_pu_bacteria 640427133 640487837 627
854 iso_pu_bacteria 651053060 651175781 627
855 iso_pu_bacteria 8011350971 8011354042 627
856 iso_pu_bacteria 8021622325 8021625311 627
857 iso_pu_bacteria 8021626552 8021630207 627
858 iso_pu_bacteria 8021648035 8021652132 627
859 iso_pu_bacteria 8034962539 8034964599 627
860 3300005343 Ga0070687_100025698 Ga0070687_1000256981 628
861 3300009036 Ga0105244_10003937 Ga0105244_100039375 628
862 3300009036 Ga0105244_10007727 Ga0105244_100077277 628
863 3300025728 Ga0207655_1006427 Ga0207655_10064275 628
864 3300035092 Ga0373952_0000960 Ga0373952_0000960_74_1969 628
865 3300038705 Ga0237819_04151 Ga0237819_04151_38_1927 628
866 3300038726 Ga0400490_36858 Ga0400490_36858_13389_15284 628
867 3300044712 Ga0453684_0002214 Ga0453684_0002214_39965_41857 628
868 3300046542 Ga0495597_0000129 Ga0495597_0000129_62256_64235 628
869 iso_pu_bacteria 2510065053 2510283613 628
870 iso_pu_bacteria 2510065055 2510292559 628
871 iso_pu_bacteria 2510065058 2510311651 628
872 iso_pu_bacteria 2773857672 2774128615 628
873 iso_pu_bacteria 2917832318 2917837224 628
874 iso_pu_bacteria 2919125081 2919126774 628
875 iso_pu_bacteria 2974298342 2974299259 628
876 iso_pu_bacteria 2984499530 2984501576 628
877 iso_pu_bacteria 2984504281 2984505027 628
878 iso_pu_bacteria 8002745576 8002748204 628
879 3300003856 Ga0058692_1000002 Ga0058692_100000292 629
880 3300005844 Ga0068862_100009858 Ga0068862_1000098583 629
881 3300006914 Ga0075436_100022120 Ga0075436_1000221202 629
882 3300021361 Ga0213872_10000933 Ga0213872_1000093310 629
883 3300025935 Ga0207709_10000536 Ga0207709_100005361 629
884 3300025961 Ga0207712_10060237 Ga0207712_100602372 629
885 3300025972 Ga0207668_10061226 Ga0207668_100612262 629
886 3300027312 Ga0209371_1000004 Ga0209371_1000004301 629
887 3300028380 Ga0268265_10008164 Ga0268265_100081644 629
888 3300030500 Ga0268256_1000005 Ga0268256_1000005744 629
889 3300031251 Ga0265327_10003075 Ga0265327_100030752 629
890 3300031251 Ga0265327_10007016 Ga0265327_100070163 629
891 3300035086 Ga0373934_0000411 Ga0373934_0000411_435_2366 629
892 3300035119 Ga0373956_0002404 Ga0373956_0002404_5649_7580 629
893 3300035172 Ga0373955_0038223 Ga0373955_0038223_434_2365 629
894 3300035724 Ga0373933_0002175 Ga0373933_0002175_2884_4815 629
895 3300036401 Ga0373937_0003720 Ga0373937_0003720_4942_6873 629
896 3300039447 Ga0436361_0695291 Ga0436361_0695291_58179_60080 629
897 3300044712 Ga0453684_0001204 Ga0453684_0001204_913_2817 629
898 3300046454 Ga0495592_0004990 Ga0495592_0004990_3176_5107 629
899 3300046462 Ga0495651_0001303 Ga0495651_0001303_15845_17776 629
900 3300046516 Ga0495628_0005053 Ga0495628_0005053_5886_7817 629
901 3300046543 Ga0495645_0000552 Ga0495645_0000552_5411_7342 629
902 3300046665 Ga0495661_0008826 Ga0495661_0008826_2562_4472 629
903 3300046689 Ga0495613_0028561 Ga0495613_0028561_828_2759 629
904 3300048908 Ga0496105_0069602 Ga0496105_0069602_874_2766 629
905 3300048928 Ga0496125_0014222 Ga0496125_0014222_1082_2974 629
906 3300048929 Ga0496126_0013792 Ga0496126_0013792_1341_3233 629
907 3300049572 Ga0501036_0019602 Ga0501036_0019602_2027_3955 629
908 3300049575 Ga0501039_0005786 Ga0501039_0005786_5377_7305 629
909 3300049592 Ga0501076_0001078 Ga0501076_0001078_15706_17634 629
910 iso_pu_bacteria 2842757796 2842758447 629
911 iso_pu_bacteria 2919688452 2919692603 629
912 iso_pu_bacteria 8056172158 8056175522 629
913 3300009036 Ga0105244_10007928 Ga0105244_100079283 630
914 3300013105 Ga0157369_10068696 Ga0157369_100686961 630
915 3300031239 Ga0265328_10000501 Ga0265328_100005012 630
916 3300031250 Ga0265331_10000121 Ga0265331_1000012117 630
917 3300031251 Ga0265327_10000008 Ga0265327_10000008358 630
918 3300031251 Ga0265327_10000269 Ga0265327_1000026917 630
919 3300039062 Ga0400483_013162 Ga0400483_013162_4691_6601 630
920 3300048927 Ga0496124_0002812 Ga0496124_0002812_17583_19493 630
921 iso_pu_bacteria 2511231004 2511254635 630
922 iso_pu_bacteria 2511231006 2511268487 630
923 iso_pu_bacteria 2511231007 2511270698 630
924 iso_pu_bacteria 2511231008 2511277278 630
925 iso_pu_bacteria 2511231010 2511292418 630
926 iso_pu_bacteria 2511231011 2511294716 630
927 iso_pu_bacteria 2511231012 2511303388 630
928 iso_pu_bacteria 2511231014 2511312807 630
929 iso_pu_bacteria 2511231015 2511320260 630
930 iso_pu_bacteria 2511231016 2511328757 630
931 iso_pu_bacteria 2511231017 2511331707 630
932 iso_pu_bacteria 2511231018 2511340209 630
933 iso_pu_bacteria 2511231019 2511343880 630
934 iso_pu_bacteria 2511231020 2511350207 630
935 iso_pu_bacteria 2511231021 2511358534 630
936 iso_pu_bacteria 2511231022 2511362844 630
937 iso_pu_bacteria 2511231023 2511369834 630
938 iso_pu_bacteria 2511231024 2511374050 630
939 iso_pu_bacteria 2511231031 2511416250 630
940 iso_pu_bacteria 2512047018 2512324840 630
941 iso_pu_bacteria 2554235231 2555247184 630
942 iso_pu_bacteria 2582580891 2583790964 630
943 iso_pu_bacteria 2597489887 2597856891 630
944 iso_pu_bacteria 2597489888 2597863092 630
945 iso_pu_bacteria 2597489889 2597868884 630
946 iso_pu_bacteria 2599185155 2599326658 630
947 iso_pu_bacteria 2599185160 2599357082 630
948 iso_pu_bacteria 2599185161 2599362131 630
949 iso_pu_bacteria 2599185162 2599368451 630
950 iso_pu_bacteria 2599185163 2599375240 630
951 iso_pu_bacteria 2599185164 2599382187 630
952 iso_pu_bacteria 2599185165 2599388634 630
953 iso_pu_bacteria 2599185166 2599394098 630
954 iso_pu_bacteria 2599185167 2599401674 630
955 iso_pu_bacteria 2599185168 2599405863 630
956 iso_pu_bacteria 2599185179 2599451783 630
957 iso_pu_bacteria 2599185181 2599464413 630
958 iso_pu_bacteria 2599185182 2599468737 630
959 iso_pu_bacteria 2599185185 2599483918 630
960 iso_pu_bacteria 2599185186 2599493436 630
961 iso_pu_bacteria 2599185188 2599504235 630
962 iso_pu_bacteria 2599185189 2599509559 630
963 iso_pu_bacteria 2599185190 2599514920 630
964 iso_pu_bacteria 2599185191 2599521017 630
965 iso_pu_bacteria 2599185212 2599613518 630
966 iso_pu_bacteria 2599185248 2599772430 630
967 iso_pu_bacteria 2599185257 2599801564 630
968 iso_pu_bacteria 2599185288 2599882265 630
969 iso_pu_bacteria 2599185289 2599888848 630
970 iso_pu_bacteria 2599185290 2599894283 630
971 iso_pu_bacteria 2599185291 2599900477 630
972 iso_pu_bacteria 2599185300 2599933504 630
973 iso_pu_bacteria 2599185302 2599944044 630
974 iso_pu_bacteria 2599185303 2599952369 630
975 iso_pu_bacteria 2599185304 2599955744 630
976 iso_pu_bacteria 2599185305 2599961373 630
977 iso_pu_bacteria 2599185306 2599967304 630
978 iso_pu_bacteria 2599185307 2599970474 630
979 iso_pu_bacteria 2599185308 2599979301 630
980 iso_pu_bacteria 2599185309 2599985545 630
981 iso_pu_bacteria 2599185310 2599989418 630
982 iso_pu_bacteria 2599185311 2599994341 630
983 iso_pu_bacteria 2599185312 2600000186 630
984 iso_pu_bacteria 2599185313 2600008365 630
985 iso_pu_bacteria 2599185314 2600013186 630
986 iso_pu_bacteria 2599185315 2600019685 630
987 iso_pu_bacteria 2599185316 2600023634 630
988 iso_pu_bacteria 2599185317 2600032515 630
989 iso_pu_bacteria 2599185318 2600038986 630
990 iso_pu_bacteria 2599185319 2600044853 630
991 iso_pu_bacteria 2599185320 2600048493 630
992 iso_pu_bacteria 2599185321 2600054195 630
993 iso_pu_bacteria 2599185322 2600060407 630
994 iso_pu_bacteria 2599185323 2600066499 630
995 iso_pu_bacteria 2599185324 2600073438 630
996 iso_pu_bacteria 2599185325 2600078191 630
997 iso_pu_bacteria 2599185356 2600216690 630
998 iso_pu_bacteria 2600254930 2600361756 630
999 iso_pu_bacteria 2600254931 2600365861 630
1000 iso_pu_bacteria 2600255283 2601624878 630
1001 iso_pu_bacteria 2600255296 2601694197 630
1002 iso_pu_bacteria 2600255313 2601776713 630
1003 iso_pu_bacteria 2600255318 2601795536 630
1004 iso_pu_bacteria 2603880185 2606075606 630
1005 iso_pu_bacteria 2603880199 2606128483 630
1006 iso_pu_bacteria 2619619299 2621300832 630
1007 iso_pu_bacteria 2623620443 2624479473 630
1008 iso_pu_bacteria 2623620446 2624493529 630
1009 iso_pu_bacteria 2643221565 2643841718 630
1010 iso_pu_bacteria 2643221571 2643870627 630
1011 iso_pu_bacteria 2643221589 2643952608 630
1012 iso_pu_bacteria 2643221602 2644022370 630
1013 iso_pu_bacteria 2643221633 2644188573 630
1014 iso_pu_bacteria 2643221650 2644286142 630
1015 iso_pu_bacteria 2643221713 2644623085 630
1016 iso_pu_bacteria 2651869719 2652547885 630
1017 iso_pu_bacteria 2667528170 2671093138 630
1018 iso_pu_bacteria 2667528171 2671098770 630
1019 iso_pu_bacteria 2667528176 2671128991 630
1020 iso_pu_bacteria 2671180172 2671768513 630
1021 iso_pu_bacteria 2675903420 2677898200 630
1022 iso_pu_bacteria 2675903515 2678264560 630
1023 iso_pu_bacteria 2713897148 2715753866 630
1024 iso_pu_bacteria 2713897149 2715757739 630
1025 iso_pu_bacteria 2718217725 2718633321 630
1026 iso_pu_bacteria 2721755607 2723247911 630
1027 iso_pu_bacteria 2738541265 2738670549 630
1028 iso_pu_bacteria 2738541271 2738688528 630
1029 iso_pu_bacteria 2738541282 2738748942 630
1030 iso_pu_bacteria 2738541294 2738810918 630
1031 iso_pu_bacteria 2738541303 2738857984 630
1032 iso_pu_bacteria 2738541309 2738898278 630
1033 iso_pu_bacteria 2738543004 2739201290 630
1034 iso_pu_bacteria 2738543015 2739261146 630
1035 iso_pu_bacteria 2738543016 2739264260 630
1036 iso_pu_bacteria 2738543025 2739315983 630
1037 iso_pu_bacteria 2740892503 2743736319 630
1038 iso_pu_bacteria 2744054620 2745005014 630
1039 iso_pu_bacteria 2765235841 2765582965 630
1040 iso_pu_bacteria 2773857670 2774121306 630
1041 iso_pu_bacteria 2773857673 2774137630 630
1042 iso_pu_bacteria 2784132063 2784265618 630
1043 iso_pu_bacteria 2784132072 2784317400 630
1044 iso_pu_bacteria 2791355520 2794595859 630
1045 iso_pu_bacteria 2806310737 2807407476 630
1046 iso_pu_bacteria 2806310745 2807455813 630
1047 iso_pu_bacteria 2808606361 2808857011 630
1048 iso_pu_bacteria 2808606376 2808926956 630
1049 iso_pu_bacteria 2808606377 2808927401 630
1050 iso_pu_bacteria 2808606378 2808937083 630
1051 iso_pu_bacteria 2808606380 2808949110 630
1052 iso_pu_bacteria 2808606381 2808950060 630
1053 iso_pu_bacteria 2808606382 2808961555 630
1054 iso_pu_bacteria 2808606383 2808965399 630
1055 iso_pu_bacteria 2808606385 2808979368 630
1056 iso_pu_bacteria 2808606388 2808995292 630
1057 iso_pu_bacteria 2808606389 2809000360 630
1058 iso_pu_bacteria 2808606445 2809216409 630
1059 iso_pu_bacteria 2816332298 2817489868 630
1060 iso_pu_bacteria 2818991456 2819654759 630
1061 iso_pu_bacteria 2818991464 2819703891 630
1062 iso_pu_bacteria 2825651385 2825656498 630
1063 iso_pu_bacteria 2826581358 2826583038 630
1064 iso_pu_bacteria 2834028612 2834029741 630
1065 iso_pu_bacteria 2842815866 2842817556 630
1066 iso_pu_bacteria 2842826826 2842831012 630
1067 iso_pu_bacteria 2842832357 2842832656 630
1068 iso_pu_bacteria 2842837860 2842841485 630
1069 iso_pu_bacteria 2842843487 2842848258 630
1070 iso_pu_bacteria 2842849001 2842850707 630
1071 iso_pu_bacteria 2842854478 2842856883 630
1072 iso_pu_bacteria 2844665904 2844669211 630
1073 iso_pu_bacteria 2852612431 2852618375 630
1074 iso_pu_bacteria 2852657418 2852658956 630
1075 iso_pu_bacteria 2852667396 2852673489 630
1076 iso_pu_bacteria 2860339153 2860339983 630
1077 iso_pu_bacteria 2860867994 2860869736 630
1078 iso_pu_bacteria 2878029506 2878031476 630
1079 iso_pu_bacteria 2880230671 2880232346 630
1080 iso_pu_bacteria 2904518522 2904521763 630
1081 iso_pu_bacteria 2904550169 2904553159 630
1082 iso_pu_bacteria 2908446538 2908448678 630
1083 iso_pu_bacteria 2912963787 2912965499 630
1084 iso_pu_bacteria 2913036834 2913041037 630
1085 iso_pu_bacteria 2917070673 2917072483 630
1086 iso_pu_bacteria 2919063839 2919064053 630
1087 iso_pu_bacteria 2919155634 2919159762 630
1088 iso_pu_bacteria 2919385768 2919386440 630
1089 iso_pu_bacteria 2919456309 2919457077 630
1090 iso_pu_bacteria 2919481497 2919486207 630
1091 iso_pu_bacteria 2919487758 2919491278 630
1092 iso_pu_bacteria 2919697872 2919702831 630
1093 iso_pu_bacteria 2923153595 2923155333 630
1094 iso_pu_bacteria 2923586266 2923590072 630
1095 iso_pu_bacteria 2929144301 2929148537 630
1096 iso_pu_bacteria 2929189879 2929191708 630
1097 iso_pu_bacteria 2931369376 2931374021 630
1098 iso_pu_bacteria 2931390751 2931392811 630
1099 iso_pu_bacteria 2931396565 2931400125 630
1100 iso_pu_bacteria 2935353572 2935354647 630
1101 iso_pu_bacteria 2939636861 2939639702 630
1102 iso_pu_bacteria 2939651529 2939655481 630
1103 iso_pu_bacteria 2945928738 2945928859 630
1104 iso_pu_bacteria 2945961074 2945965119 630
1105 iso_pu_bacteria 2946006987 2946011061 630
1106 iso_pu_bacteria 2946027586 2946029991 630
1107 iso_pu_bacteria 2947233263 2947236565 630
1108 iso_pu_bacteria 2969304461 2969306259 630
1109 iso_pu_bacteria 2974289157 2974292087 630
1110 iso_pu_bacteria 2984286254 2984290705 630
1111 iso_pu_bacteria 2988728565 2988730130 630
1112 iso_pu_bacteria 2998139840 2998141654 630
1113 iso_pu_bacteria 3007395558 3007400873 630
1114 iso_pu_bacteria 3007419365 3007424521 630
1115 iso_pu_bacteria 3007511990 3007513052 630
1116 iso_pu_bacteria 3007614139 3007615890 630
1117 iso_pu_bacteria 3007619802 3007619920 630
1118 iso_pu_bacteria 3007718800 3007722477 630
1119 iso_pu_bacteria 3007803356 3007808500 630
1120 iso_pu_bacteria 3007855910 3007856245 630
1121 iso_pu_bacteria 3007861166 3007863107 630
1122 iso_pu_bacteria 3007866637 3007868053 630
1123 iso_pu_bacteria 3007872151 3007874756 630
1124 iso_pu_bacteria 637000220 637319068 630
1125 iso_pu_bacteria 8015687852 8015689551 630
1126 iso_pu_bacteria 8019769354 8019774051 630
1127 iso_pu_bacteria 8019775933 8019780288 630
1128 iso_pu_bacteria 8029995093 8029999102 630
1129 iso_pu_bacteria 8052494512 8052498300 630
1130 iso_pu_bacteria 8054285046 8054287214 630
1131 iso_pu_bacteria 8054347763 8054352167 630
1132 iso_pu_bacteria 8054503363 8054505312 630
1133 iso_pu_bacteria 8054929484 8054931447 630
1134 iso_pu_bacteria 8055770955 8055772688 630
1135 iso_pu_bacteria 8055817908 8055819869 630
1136 iso_pu_bacteria 8055878733 8055880445 630
1137 iso_pu_bacteria 8056115690 8056119664 630
1138 iso_pu_bacteria 8056120720 8056122522 630
1139 iso_pu_bacteria 8056125926 8056130148 630
1140 iso_pu_bacteria 8056131705 8056133636 630
1141 iso_pu_bacteria 8056137416 8056141214 630
1142 iso_pu_bacteria 8056143049 8056144840 630
1143 iso_pu_bacteria 8056148874 8056150545 630
1144 iso_pu_bacteria 8056155041 8056156193 630
1145 iso_pu_bacteria 8056161164 8056165059 630
1146 iso_pu_bacteria 8056166840 8056169337 630
1147 iso_pu_bacteria 8056177738 8056181182 630
1148 iso_pu_bacteria 8056569372 8056573190 630
1149 iso_pu_bacteria 8057798959 8057799109 630
1150 3300003771 Ga0055526_1001264 Ga0055526_10012642 631
1151 3300003773 Ga0055537_1000338 Ga0055537_10003382 631
1152 3300003781 Ga0055536_1001498 Ga0055536_10014986 631
1153 3300003784 Ga0055534_1000039 Ga0055534_100003970 631
1154 3300003790 Ga0055528_1000212 Ga0055528_100021217 631
1155 3300013102 Ga0157371_10000487 Ga0157371_1000048744 631
1156 3300013104 Ga0157370_10000797 Ga0157370_1000079733 631
1157 3300015262 Ga0182007_10000043 Ga0182007_1000004349 631
1158 3300015265 Ga0182005_1000225 Ga0182005_10002258 631
1159 3300025263 Ga0209565_1000014 Ga0209565_1000014145 631
1160 3300025273 Ga0209673_1000171 Ga0209673_100017180 631
1161 3300025291 Ga0209675_1000011 Ga0209675_1000011425 631
1162 3300025292 Ga0209676_1000027 Ga0209676_100002758 631
1163 3300025292 Ga0209676_1000079 Ga0209676_1000079210 631
1164 3300025292 Ga0209676_1000970 Ga0209676_100097024 631
1165 3300025295 Ga0209564_1000221 Ga0209564_100022146 631
1166 3300025298 Ga0209050_1000329 Ga0209050_100032944 631
1167 3300025299 Ga0209256_1005108 Ga0209256_10051082 631
1168 3300025304 Ga0209257_1000081 Ga0209257_1000081220 631
1169 3300025304 Ga0209257_1004574 Ga0209257_100457410 631
1170 3300025935 Ga0207709_10012063 Ga0207709_100120632 631
1171 3300027312 Ga0209371_1002751 Ga0209371_10027518 631
1172 3300027395 Ga0209996_1001214 Ga0209996_10012141 631
1173 3300027471 Ga0209995_1001793 Ga0209995_10017932 631
1174 3300027665 Ga0209983_1002193 Ga0209983_10021933 631
1175 3300030500 Ga0268256_1002457 Ga0268256_10024572 631
1176 3300031251 Ga0265327_10000463 Ga0265327_1000046329 631
1177 3300031548 Ga0307408_100000057 Ga0307408_10000005761 631
1178 3300039062 Ga0400483_234758 Ga0400483_234758_1041_2948 631
1179 3300041459 Ga0451800_0211862 Ga0451800_0211862_357_2261 631
1180 3300041462 Ga0451806_617527 Ga0451806_617527_322_2226 631
1181 3300041486 Ga0451807_1185460 Ga0451807_1185460_579_2483 631
1182 3300046460 Ga0495638_0021129 Ga0495638_0021129_2148_4076 631
1183 3300046507 Ga0495606_0000861 Ga0495606_0000861_38953_40851 631
1184 3300046512 Ga0495610_0014992 Ga0495610_0014992_958_2856 631
1185 3300046518 Ga0495631_0000558 Ga0495631_0000558_19309_21207 631
1186 3300046522 Ga0495643_0002111 Ga0495643_0002111_8710_10608 631
1187 3300048922 Ga0496119_0000659 Ga0496119_0000659_37299_39197 631
1188 3300048923 Ga0496120_0000217 Ga0496120_0000217_57312_59210 631
1189 3300048925 Ga0496122_0000372 Ga0496122_0000372_32478_34382 631
1190 3300048926 Ga0496123_0003662 Ga0496123_0003662_8316_10220 631
1191 3300049571 Ga0501034_0000272 Ga0501034_0000272_71735_73633 631
1192 3300053161 Ga0500634_0025602 Ga0500634_0025602_835_2733 631
1193 iso_pu_bacteria 2842780639 2842781256 631
1194 3300009148 Ga0105243_10005617 Ga0105243_100056178 632
1195 3300013105 Ga0157369_10051728 Ga0157369_100517284 632
1196 3300031727 Ga0316576_10012548 Ga0316576_100125483 632
1197 3300031728 Ga0316578_10019319 Ga0316578_100193191 632
1198 3300046460 Ga0495638_0002776 Ga0495638_0002776_6209_8158 632
1199 3300046530 Ga0495654_0006490 Ga0495654_0006490_1265_3163 632
1200 3300047323 Ga0495683_0002550 Ga0495683_0002550_2920_4818 632
1201 3300048920 Ga0496117_0001459 Ga0496117_0001459_9156_11306 632
1202 3300048920 Ga0496117_0012041 Ga0496117_0012041_822_2720 632
1203 3300048921 Ga0496118_0000528 Ga0496118_0000528_52752_54902 632
1204 3300048922 Ga0496119_0000910 Ga0496119_0000910_15764_17662 632
1205 3300048924 Ga0496121_0049366 Ga0496121_0049366_1342_3480 632
1206 3300048925 Ga0496122_0004029 Ga0496122_0004029_12068_13966 632
1207 3300048925 Ga0496122_0049165 Ga0496122_0049165_577_2526 632
1208 3300048926 Ga0496123_0001489 Ga0496123_0001489_14642_16540 632
1209 3300048928 Ga0496125_0063020 Ga0496125_0063020_686_2842 632
1210 iso_pu_bacteria 2511231156 2511826221 632
1211 iso_pu_bacteria 2554235341 2555668709 632
1212 3300025298 Ga0209050_1022831 Ga0209050_10228312 633
1213 3300025304 Ga0209257_1000150 Ga0209257_100015029 633
1214 3300048927 Ga0496124_0000018 Ga0496124_0000018_557_2473 633
1215 iso_pu_bacteria 2690315857 2691330897 633
1216 iso_pu_bacteria 2919534386 2919534450 633
1217 3300002737 JGI25162J39368_1000364 JGI25162J39368_10003649 634
1218 3300002737 JGI25162J39368_1000384 JGI25162J39368_100038433 634
1219 3300002772 JGI25164J39214_1000268 JGI25164J39214_10002689 634
1220 3300002772 JGI25164J39214_1000481 JGI25164J39214_100048110 634
1221 3300003214 JGI25165J46597_1000483 JGI25165J46597_10004839 634
1222 3300003214 JGI25165J46597_1000497 JGI25165J46597_100049733 634
1223 3300003751 Ga0055538_1000058 Ga0055538_100005839 634
1224 3300003752 Ga0055539_1000087 Ga0055539_100008770 634
1225 3300003756 Ga0055533_1000097 Ga0055533_100009770 634
1226 3300003758 Ga0055532_1000156 Ga0055532_100015616 634
1227 3300003759 Ga0055525_1000426 Ga0055525_10004268 634
1228 3300003791 Ga0055530_10002926 Ga0055530_100029267 634
1229 3300003792 Ga0055540_1002281 Ga0055540_10022817 634
1230 3300003794 Ga0055531_10000989 Ga0055531_100009896 634
1231 3300003841 Ga0055541_1000060 Ga0055541_100006040 634
1232 3300005288 Ga0065714_10000033 Ga0065714_100000338 634
1233 3300005288 Ga0065714_10003895 Ga0065714_100038954 634
1234 3300005289 Ga0065704_10003677 Ga0065704_100036774 634
1235 3300005289 Ga0065704_10072175 Ga0065704_100721756 634
1236 3300005290 Ga0065712_10004516 Ga0065712_100045167 634
1237 3300005344 Ga0070661_100000029 Ga0070661_10000002987 634
1238 3300005457 Ga0070662_100041876 Ga0070662_1000418762 634
1239 3300005834 Ga0068851_10000079 Ga0068851_1000007932 634
1240 3300006946 Ga0079104_1002022 Ga0079104_10020228 634
1241 3300006946 Ga0079104_1002085 Ga0079104_10020859 634
1242 3300025206 Ga0209435_100916 Ga0209435_1009162 634
1243 3300025207 Ga0209760_100011 Ga0209760_100011157 634
1244 3300025224 Ga0209784_100040 Ga0209784_100040110 634
1245 3300025225 Ga0209566_100051 Ga0209566_100051110 634
1246 3300025226 Ga0209674_100072 Ga0209674_100072110 634
1247 3300025229 Ga0209147_100067 Ga0209147_100067110 634
1248 3300025230 Ga0209563_100073 Ga0209563_100073110 634
1249 3300025231 Ga0207427_100008 Ga0207427_100008338 634
1250 3300025233 Ga0209437_100014 Ga0209437_100014373 634
1251 3300025246 Ga0209646_1000216 Ga0209646_10002166 634
1252 3300025253 Ga0209677_100063 Ga0209677_100063110 634
1253 3300025261 Ga0209233_1000008 Ga0209233_1000008373 634
1254 3300025291 Ga0209675_1000639 Ga0209675_10006392 634
1255 3300025292 Ga0209676_1000016 Ga0209676_1000016573 634
1256 3300025292 Ga0209676_1000021 Ga0209676_1000021280 634
1257 3300025292 Ga0209676_1000033 Ga0209676_1000033391 634
1258 3300025292 Ga0209676_1000474 Ga0209676_100047411 634
1259 3300025292 Ga0209676_1015643 Ga0209676_10156432 634
1260 3300025298 Ga0209050_1000235 Ga0209050_100023528 634
1261 3300025298 Ga0209050_1000477 Ga0209050_100047716 634
1262 3300025303 Ga0209051_1000043 Ga0209051_100004357 634
1263 3300025303 Ga0209051_1000123 Ga0209051_100012388 634
1264 3300025303 Ga0209051_1001937 Ga0209051_100193710 634
1265 3300025304 Ga0209257_1000604 Ga0209257_100060457 634
1266 3300025321 Ga0207656_10000093 Ga0207656_100000936 634
1267 3300025711 Ga0207696_1000081 Ga0207696_1000081145 634
1268 3300025711 Ga0207696_1000472 Ga0207696_100047231 634
1269 3300025711 Ga0207696_1000546 Ga0207696_10005469 634
1270 3300025711 Ga0207696_1006510 Ga0207696_10065103 634
1271 3300025711 Ga0207696_1006511 Ga0207696_10065113 634
1272 3300025728 Ga0207655_1000005 Ga0207655_1000005687 634
1273 3300025728 Ga0207655_1000448 Ga0207655_10004481 634
1274 3300025728 Ga0207655_1000530 Ga0207655_10005306 634
1275 3300025728 Ga0207655_1001462 Ga0207655_100146211 634
1276 3300025728 Ga0207655_1002985 Ga0207655_10029856 634
1277 3300025728 Ga0207655_1003562 Ga0207655_10035627 634
1278 3300025728 Ga0207655_1012449 Ga0207655_10124492 634
1279 3300025735 Ga0207713_1000519 Ga0207713_100051912 634
1280 3300025735 Ga0207713_1000618 Ga0207713_100061832 634
1281 3300025735 Ga0207713_1003433 Ga0207713_10034336 634
1282 3300025735 Ga0207713_1003436 Ga0207713_10034367 634
1283 3300025735 Ga0207713_1003886 Ga0207713_10038864 634
1284 3300025735 Ga0207713_1007978 Ga0207713_10079785 634
1285 3300025735 Ga0207713_1011492 Ga0207713_10114926 634
1286 3300025914 Ga0207671_10000287 Ga0207671_1000028715 634
1287 3300025925 Ga0207650_10000255 Ga0207650_1000025550 634
1288 3300025935 Ga0207709_10000053 Ga0207709_10000053169 634
1289 3300025935 Ga0207709_10002036 Ga0207709_100020368 634
1290 3300025935 Ga0207709_10016817 Ga0207709_100168173 634
1291 3300025945 Ga0207679_10000018 Ga0207679_10000018126 634
1292 3300027111 Ga0209281_1000010 Ga0209281_1000010640 634
1293 3300027111 Ga0209281_1000331 Ga0209281_10003319 634
1294 3300027111 Ga0209281_1003727 Ga0209281_10037272 634
1295 3300027296 Ga0209389_1001707 Ga0209389_10017074 634
1296 3300030733 Ga0314311_1124074 Ga0314311_11240742 634
1297 3300030735 Ga0316178_1127053 Ga0316178_112705319 634
1298 3300042013 Ga0439456_000278 Ga0439456_000278_4454_6358 634
1299 3300046515 Ga0495620_0000083 Ga0495620_0000083_62544_64448 634
1300 3300046522 Ga0495643_0004357 Ga0495643_0004357_3465_5369 634
1301 3300046522 Ga0495643_0007246 Ga0495643_0007246_3203_5107 634
1302 3300046663 Ga0495635_0004064 Ga0495635_0004064_5694_7598 634
1303 3300046680 Ga0495646_0014122 Ga0495646_0014122_2655_4559 634
1304 3300046809 Ga0495600_0030133 Ga0495600_0030133_578_2482 634
1305 3300047322 Ga0495680_0014781 Ga0495680_0014781_4310_6214 634
1306 3300047444 Ga0495675_0008743 Ga0495675_0008743_2341_4245 634
1307 3300048923 Ga0496120_0005573 Ga0496120_0005573_4054_5958 634
1308 3300048927 Ga0496124_0027491 Ga0496124_0027491_2030_3934 634
1309 3300048928 Ga0496125_0014751 Ga0496125_0014751_1110_3014 634
1310 3300048928 Ga0496125_0063376 Ga0496125_0063376_35_1942 634
1311 3300049571 Ga0501034_0002511 Ga0501034_0002511_16521_18425 634
1312 2124908027 MRS2a_Contig_22 MRS2a_00121960 636
1313 3300009011 Ga0105251_10005507 Ga0105251_100055076 636
1314 3300009148 Ga0105243_10003465 Ga0105243_100034658 636
1315 3300009148 Ga0105243_10005820 Ga0105243_100058209 636
1316 3300009176 Ga0105242_10002334 Ga0105242_100023347 636
1317 3300009545 Ga0105237_10001936 Ga0105237_1000193611 636
1318 3300011119 Ga0105246_10006097 Ga0105246_100060977 636
1319 3300013100 Ga0157373_10004039 Ga0157373_100040397 636
1320 3300013102 Ga0157371_10002311 Ga0157371_1000231115 636
1321 3300013105 Ga0157369_10018126 Ga0157369_100181267 636
1322 3300013306 Ga0163162_10010409 Ga0163162_100104099 636
1323 3300013307 Ga0157372_10012955 Ga0157372_100129556 636
1324 3300025207 Ga0209760_100174 Ga0209760_10017433 636
1325 3300025231 Ga0207427_100001 Ga0207427_100001970 636
1326 3300025233 Ga0209437_100003 Ga0209437_100003402 636
1327 3300025261 Ga0209233_1000007 Ga0209233_1000007970 636
1328 3300038705 Ga0237819_00849 Ga0237819_00849_89_1999 636
1329 3300042010 Ga0439452_002344 Ga0439452_002344_3517_5427 636
1330 3300042010 Ga0439452_002943 Ga0439452_002943_1236_3146 636
1331 3300042115 Ga0450911_001689 Ga0450911_001689_367_2277 636
1332 3300042461 Ga0439460_0001205 Ga0439460_0001205_545_2455 636
1333 3300046452 Ga0495617_004198 Ga0495617_004198_3244_5154 636
1334 3300046453 Ga0495627_004653 Ga0495627_004653_1703_3613 636
1335 3300046457 Ga0495590_0001910 Ga0495590_0001910_4489_6399 636
1336 3300046458 Ga0495591_001205 Ga0495591_001205_10273_12183 636
1337 3300046458 Ga0495591_007890 Ga0495591_007890_74_1984 636
1338 3300046492 Ga0495585_0000394 Ga0495585_0000394_3638_5548 636
1339 3300046500 Ga0495596_0001337 Ga0495596_0001337_7612_9522 636
1340 3300046520 Ga0495637_0014466 Ga0495637_0014466_316_2226 636
1341 3300046538 Ga0495609_0000125 Ga0495609_0000125_3996_5906 636
1342 3300046648 Ga0495611_0001051 Ga0495611_0001051_6664_8574 636
1343 3300046694 Ga0495649_0003138 Ga0495649_0003138_4928_6838 636
1344 3300046794 Ga0495589_0002626 Ga0495589_0002626_4759_6669 636
1345 3300047318 Ga0495636_0007887 Ga0495636_0007887_262_2172 636
1346 3300047320 Ga0495672_0033100 Ga0495672_0033100_184_2094 636
1347 3300047322 Ga0495680_0039620 Ga0495680_0039620_1318_3228 636
1348 3300047323 Ga0495683_0025572 Ga0495683_0025572_746_2656 636
1349 3300047444 Ga0495675_0051538 Ga0495675_0051538_407_2317 636
1350 3300047470 Ga0495681_0014386 Ga0495681_0014386_1364_3274 636
1351 3300047472 Ga0495686_0005011 Ga0495686_0005011_5437_7347 636
1352 3300048091 Ga0495626_0005573 Ga0495626_0005573_4201_6111 636
1353 3300048905 Ga0496102_0003967 Ga0496102_0003967_5931_7841 636
1354 3300048919 Ga0496116_0004675 Ga0496116_0004675_4715_6625 636
1355 3300048924 Ga0496121_0007699 Ga0496121_0007699_4709_6619 636
1356 3300048925 Ga0496122_0014998 Ga0496122_0014998_1195_3171 636
1357 3300048927 Ga0496124_0009003 Ga0496124_0009003_3514_5469 636
1358 3300048929 Ga0496126_0018254 Ga0496126_0018254_2964_4919 636
1359 3300049460 Ga0495682_0000060 Ga0495682_0000060_3410_5320 636

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00183

HSP90

Hsp90 protein

287

697

0.96

PF13589

HATPase_c_3

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

94

254

0.78

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

96

253

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gq0-assembly1.cif.gz_A crystal structure of the middle domain of htpg, the e. coli hsp90 0.989 240 491
2gq0-assembly1.cif.gz_A crystal structure of the middle domain of htpg, the e. coli hsp90 0.9699 240 491
1y4s-assembly1.cif.gz_B conformation rearrangement of heat shock protein 90 upon adp binding 0.9593 7 490
1y4s-assembly1.cif.gz_B conformation rearrangement of heat shock protein 90 upon adp binding 0.9534 7 490
1usv-assembly1.cif.gz_A the structure of the complex between aha1 and hsp90 0.9531 239 491
ID Description Score Start End Superfamily
2iopD02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9738 250 408 3.30.230.80
af_Q9VAY2_505_592_3.40.50.11260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9681 406 494 3.40.50.11260
af_K7V364_511_598_3.40.50.11260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.968 406 494 3.40.50.11260
2iopD02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9678 250 408 3.30.230.80
af_Q4DW89_459_546_3.40.50.11260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9633 406 494 3.40.50.11260
ID Description Score Start End GO Terms
AF-A0A3C1NUH8-F1-model_v4 deleted 0.9973 379 486
AF-A0A5C8BQR5-F1-model_v4 deleted 0.9958 361 636
AF-A0A5C8BQR5-F1-model_v4 deleted 0.9922 361 636
AF-A0A351DPJ8-F1-model_v4 Molecular chaperone HtpG 0.9916 308 472 GO:0005524
GO:0016887
GO:0051082
GO:0140662
AF-A0A3C1NUH8-F1-model_v4 deleted 0.9881 379 486

Feature Viewer

pLDDT pTM Quality
86.71 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map