F493322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1359 | 854 | 881 | 622 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0001459|Ga0496117_0001459_9156_11306 |
| Length | 698 |
| Sequence | MLPTRLQGWIYTVSRDRAPANLPRRQAGAAIQASCFCPALENPPHHPYPLSQPPRRARHRPRSIVTVTEQTQKQTLGFQTEVKQLLQLMIHSLYSNKEIFLRELISNAADASDKLRFEALTQPALLENDGDLRIRVSFDADAHTLTIDDNGIGMSREDAIAHLGTIAKSGTGDFLRQLSGDQKKDSQLIGQFGVGFYSAFIVADQVDVYSRRAGLPATEGVHWSSRGEGEFDVEAIDKPERGTRIVLHLKDDQHDFADGWRLRGIIKKYSDHIGLPIQMVKEHHGDDAPAEVEWETVNRASALWTRPRTEISDAEYQEFYKHAAHDHQDALAWSHNKVEGKLEYTSLLYVPGHAPFDLYHRDAPKGLKLYVQRVFVMDQAEQFLPMYLRFIKGVVDSNDLSLNVSREILQSGPVIDSMKSALTKRSLDMLDKLATDKPEVYAGFWKQFGQVLKEGPAEDFNNREKIAGLLRFASTHDASGEQSVSLADYVGRMIEGQDKIYYLTGDSYTQVKDSPHLEVFRKKGIEVLLFTDRIDEWLMGYLTEFDGKSFVDVARGDLDLGALESAEDKQAQEEXXXXKQGLVDRIKAALGEDVADVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQKVPDSKPVFEFNPGHPLIGKLDQEADAARFDDLSRVLFEQAALAAGDTLKDPAAYVRRLNKLLLELSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 12 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 13 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 14 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 15 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 16 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 17 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 18 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 19 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 20 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 21 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 22 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 23 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 24 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 25 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 26 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 27 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 28 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 29 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 30 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 31 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 32 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 33 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 34 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 35 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 36 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 37 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 38 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 39 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 40 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 41 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 42 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 43 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 44 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 45 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 46 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 47 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 48 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 49 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 50 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 51 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 52 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 53 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 54 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 55 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 56 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 57 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 58 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 59 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 60 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 61 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 62 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 63 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 64 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 65 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 66 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 67 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 68 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 69 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 70 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 71 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 72 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 73 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 74 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 75 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 76 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 77 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 78 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 79 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 80 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 81 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 82 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 83 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 84 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 85 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 86 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 87 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 88 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 89 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 90 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 91 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 92 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 93 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 94 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 95 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 96 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 97 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 98 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 99 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 100 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 101 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 102 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 103 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 104 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 105 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 106 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 107 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 108 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 109 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 110 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 111 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 112 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 113 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 114 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 115 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 116 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 117 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 118 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 119 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 120 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 121 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 122 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 123 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 124 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 125 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 126 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 127 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 128 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 129 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 130 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 131 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 132 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 133 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 134 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 135 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 136 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 137 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 138 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 139 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 140 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 141 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 142 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 143 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 144 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 145 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 146 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 147 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 148 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 149 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 150 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 151 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 152 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 153 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 154 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 155 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 156 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 157 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 158 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 159 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 160 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 161 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 162 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 163 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 164 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 165 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 166 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 167 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 168 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 169 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 170 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 171 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 172 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 173 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 174 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 175 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 176 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 177 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 178 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 179 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 180 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 181 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 182 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 183 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 184 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 185 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 186 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 187 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 188 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 189 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 190 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 191 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 192 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 193 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 194 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 195 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 196 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 197 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 198 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 199 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 200 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 201 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 202 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 203 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 204 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 205 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 206 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 207 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 208 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 209 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 210 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 211 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 212 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 213 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 214 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 215 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 216 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 217 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 218 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 219 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 220 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 221 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 222 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 223 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 224 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 225 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 226 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 227 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 228 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 229 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 230 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 231 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 232 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 233 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 234 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 235 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 236 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 237 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 238 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 239 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 240 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 241 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 242 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 243 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 244 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 245 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 246 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 247 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 248 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 249 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 250 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 251 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 252 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 253 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 254 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 255 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 256 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 257 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 258 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 259 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 260 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 261 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 262 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 263 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 264 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 265 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 266 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 267 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 268 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 269 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 270 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 271 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 272 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 273 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 274 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 275 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 276 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 277 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 278 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 279 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 280 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 281 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 282 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 283 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 284 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 285 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 286 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 287 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 288 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 289 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 290 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 291 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 292 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 293 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 294 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 295 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 296 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 297 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 298 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 299 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 300 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 301 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 302 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 303 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 304 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 305 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 306 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 307 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 308 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 309 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 310 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 311 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 312 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 313 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 314 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 315 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 316 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 317 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 318 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 319 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 320 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 321 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 322 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 323 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 324 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 325 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 326 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 327 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 328 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 329 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 330 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 331 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 332 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 333 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 334 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 335 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 336 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 337 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 338 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 339 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 340 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 341 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 342 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 343 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 344 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 345 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 346 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 347 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 348 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 349 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 350 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 351 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 352 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 353 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 354 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 355 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 356 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 357 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 358 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 359 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 360 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 361 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 362 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 363 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 364 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 365 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 366 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 367 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 368 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 369 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 370 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 371 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 372 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 373 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 374 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 375 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 376 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 377 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 378 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 379 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 380 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 381 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 382 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 383 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 384 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 385 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 386 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 387 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 388 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 389 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 390 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 391 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 392 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 393 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 394 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 395 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 396 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 397 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 398 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 399 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 400 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 401 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 402 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 403 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 404 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 405 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 406 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 407 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 408 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 409 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 410 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 411 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 412 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 413 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 414 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 415 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 416 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 417 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 418 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 419 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 420 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 421 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 422 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 423 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 424 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 425 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 426 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 427 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 428 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 429 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 430 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 431 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 432 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 433 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 434 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 435 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 436 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 437 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 438 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 439 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 440 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 441 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 442 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 443 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 444 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 445 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 446 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 447 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 448 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 449 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 450 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 451 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 452 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 453 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 454 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 455 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 456 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 457 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 458 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 459 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 460 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 461 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 462 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 463 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 464 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 465 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 466 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 467 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 468 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 469 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 470 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 471 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 472 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 474 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 475 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 476 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 477 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 478 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 479 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 480 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 481 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 482 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 483 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 484 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 485 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 487 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 488 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 489 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 490 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 491 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 492 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 493 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 494 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 495 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 496 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 497 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 498 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 499 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 500 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 501 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 502 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 503 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 504 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 506 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 507 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 508 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 509 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 510 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 511 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 512 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 514 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 515 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 516 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 517 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 518 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 521 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 523 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 525 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 526 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 527 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 528 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 529 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 530 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 531 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 532 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 533 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 534 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 535 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 536 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 537 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 538 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 539 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 540 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 541 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 542 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 543 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 544 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 545 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 547 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 548 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 549 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 550 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 551 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 555 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 556 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 558 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 559 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 560 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 561 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 562 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 564 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 565 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 566 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 569 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 570 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 572 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 612 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 613 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 618 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 622 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 623 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 624 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 625 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 626 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 627 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 628 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 629 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 630 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 631 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 632 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 633 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 634 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 635 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 636 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 637 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 638 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 642 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 643 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 644 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 645 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 646 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 647 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 648 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 649 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 650 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 651 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 652 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 653 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 654 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 655 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 656 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 657 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 658 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 659 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 660 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 661 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 662 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 663 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 664 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 665 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 666 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 667 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 668 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 669 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 670 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 671 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 672 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 673 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 674 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 675 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 676 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 677 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 678 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 679 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 680 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 681 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 682 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 683 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 684 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 743 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 744 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 745 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 746 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 747 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 748 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 749 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 750 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 751 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 752 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 753 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 754 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 755 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 756 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 757 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 760 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 761 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 762 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 763 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 764 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 765 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 766 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 767 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 768 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 769 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 770 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 771 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 772 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 773 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 774 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 775 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 776 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 777 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 778 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 779 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 780 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 781 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 782 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 783 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 784 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 785 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 786 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 787 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 788 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 789 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 790 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 791 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 792 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 793 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 794 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 795 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 796 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 797 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 798 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 799 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 800 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 801 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 802 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 803 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 804 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 805 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 806 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 807 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 808 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 809 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 810 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 811 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 812 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 813 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 814 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 815 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 816 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 817 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 818 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 819 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 820 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 821 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 822 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 823 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 824 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 825 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 826 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 827 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 828 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 829 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 830 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 831 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 832 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 833 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 834 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 835 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 836 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 837 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 838 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 839 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 840 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 841 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 842 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 843 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 844 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 845 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 846 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 847 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 848 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 849 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 850 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 851 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 852 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 853 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 854 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.46 |
| Metatranscriptomes | 0.29 |
| Isolates | 35.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0.07 |
| Endosphere | 8.02 |
| Nodule | 3.24 |
| Rhizoplane | 9.79 |
| Rhizosphere | 56.81 |
| Stem | 0.07 |
| Stem Tuber | 0.44 |
| Unclassified | 21.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_22 | 2124908027 | Bacteria | 54424 |
| 2 | SwRhRL2b_contig_1225512 | 2162886007 | Bacteria | 8222 |
| 3 | SwRhRL2b_contig_2054245 | 2162886007 | Bacteria | 20432 |
| 4 | JGI24739J22299_10004581 | 3300001989 | Bacteria | 5285 |
| 5 | JGI24738J21930_10010282 | 3300002075 | Bacteria | 2084 |
| 6 | JGI24033J26618_1000010 | 3300002155 | Bacteria | 35433 |
| 7 | JGI25162J39368_1000003 | 3300002737 | Bacteria | 575218 |
| 8 | JGI25162J39368_1000364 | 3300002737 | Bacteria | 38678 |
| 9 | JGI25162J39368_1000384 | 3300002737 | Bacteria | 37541 |
| 10 | JGI25162J39368_1003369 | 3300002737 | Bacteria | 4730 |
| 11 | JGI25163J39215_1000015 | 3300002771 | Bacteria | 83621 |
| 12 | JGI25164J39214_1000009 | 3300002772 | Bacteria | 303437 |
| 13 | JGI25164J39214_1000268 | 3300002772 | Bacteria | 38678 |
| 14 | JGI25164J39214_1000481 | 3300002772 | Bacteria | 19689 |
| 15 | JGI25152J39213_1000407 | 3300002773 | Bacteria | 26106 |
| 16 | JGI25152J39213_1003100 | 3300002773 | Bacteria | 5813 |
| 17 | JGI25150J39212_1000372 | 3300002774 | Bacteria | 21629 |
| 18 | JGI25151J46595_10000558 | 3300003187 | Bacteria | 33861 |
| 19 | JGI25165J46597_1000483 | 3300003214 | Bacteria | 38678 |
| 20 | JGI25165J46597_1000497 | 3300003214 | Bacteria | 37887 |
| 21 | JGI25153J46596_10000334 | 3300003215 | Bacteria | 33861 |
| 22 | rootH2_10003079 | 3300003320 | Bacteria | 31816 |
| 23 | rootH2_10040819 | 3300003320 | Bacteria | 20206 |
| 24 | rootH2_10068438 | 3300003320 | Bacteria | 3674 |
| 25 | rootH1_10005050 | 3300003316 | Bacteria | 9926 |
| 26 | rootH1_10005050 | 3300003323 | Bacteria | 27642 |
| 27 | rootH1_10089918 | 3300003323 | Bacteria | 11370 |
| 28 | Ga0055538_1000005 | 3300003751 | Bacteria | 575218 |
| 29 | Ga0055538_1000058 | 3300003751 | Bacteria | 112867 |
| 30 | Ga0055539_1000007 | 3300003752 | Bacteria | 575218 |
| 31 | Ga0055539_1000087 | 3300003752 | Bacteria | 114745 |
| 32 | Ga0055533_1000009 | 3300003756 | Bacteria | 575218 |
| 33 | Ga0055533_1000097 | 3300003756 | Bacteria | 112844 |
| 34 | Ga0055532_1000156 | 3300003758 | Bacteria | 60124 |
| 35 | Ga0055525_1000010 | 3300003759 | Bacteria | 575218 |
| 36 | Ga0055525_1000426 | 3300003759 | Bacteria | 25067 |
| 37 | Ga0055526_1001264 | 3300003771 | Bacteria | 18153 |
| 38 | Ga0055537_1000338 | 3300003773 | Bacteria | 32024 |
| 39 | Ga0055536_1001498 | 3300003781 | Bacteria | 14042 |
| 40 | Ga0055536_1004488 | 3300003781 | Bacteria | 7118 |
| 41 | Ga0055534_1000039 | 3300003784 | Bacteria | 104863 |
| 42 | Ga0055528_1000212 | 3300003790 | Bacteria | 49305 |
| 43 | Ga0055530_10000544 | 3300003791 | Bacteria | 32692 |
| 44 | Ga0055530_10002926 | 3300003791 | Bacteria | 10340 |
| 45 | Ga0055530_10010525 | 3300003791 | Bacteria | 3410 |
| 46 | Ga0055540_1002281 | 3300003792 | Bacteria | 10340 |
| 47 | Ga0055531_10000989 | 3300003794 | Bacteria | 22593 |
| 48 | Ga0055541_1000005 | 3300003841 | Bacteria | 575218 |
| 49 | Ga0055541_1000060 | 3300003841 | Bacteria | 112630 |
| 50 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 51 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 52 | Ga0058692_1005261 | 3300003856 | Bacteria | 3715 |
| 53 | Ga0065703_1019229 | 3300005272 | Bacteria | 3468 |
| 54 | Ga0065714_10000033 | 3300005288 | Bacteria | 16088 |
| 55 | Ga0065714_10003895 | 3300005288 | Bacteria | 10504 |
| 56 | Ga0065704_10000433 | 3300005289 | Bacteria | 46686 |
| 57 | Ga0065704_10000446 | 3300005289 | Bacteria | 30371 |
| 58 | Ga0065704_10000891 | 3300005289 | Bacteria | 11438 |
| 59 | Ga0065704_10003677 | 3300005289 | Bacteria | 6383 |
| 60 | Ga0065704_10008060 | 3300005289 | Bacteria | 3994 |
| 61 | Ga0065704_10070423 | 3300005289 | Bacteria | 25546 |
| 62 | Ga0065704_10072175 | 3300005289 | Bacteria | 9007 |
| 63 | Ga0065704_10080471 | 3300005289 | Bacteria | 3941 |
| 64 | Ga0065704_10092388 | 3300005289 | Bacteria | 2657 |
| 65 | Ga0065712_10000132 | 3300005290 | Bacteria | 73390 |
| 66 | Ga0065712_10004516 | 3300005290 | Bacteria | 5341 |
| 67 | Ga0070658_10004873 | 3300005327 | Bacteria | 10932 |
| 68 | Ga0070658_10020102 | 3300005327 | Bacteria | 5348 |
| 69 | Ga0070690_100000289 | 3300005330 | Bacteria | 25771 |
| 70 | Ga0070690_100066841 | 3300005330 | Bacteria | 2328 |
| 71 | Ga0070670_100000018 | 3300005331 | Bacteria | 221691 |
| 72 | Ga0070670_100009488 | 3300005331 | Bacteria | 8310 |
| 73 | Ga0068869_100000299 | 3300005334 | Bacteria | 26389 |
| 74 | Ga0070666_10034651 | 3300005335 | Bacteria | 3345 |
| 75 | Ga0070682_100002601 | 3300005337 | Bacteria | 9964 |
| 76 | Ga0068868_100000531 | 3300005338 | Bacteria | 25572 |
| 77 | Ga0070689_100006066 | 3300005340 | Bacteria | 8327 |
| 78 | Ga0070687_100000355 | 3300005343 | Bacteria | 15578 |
| 79 | Ga0070687_100025698 | 3300005343 | Bacteria | 2828 |
| 80 | Ga0070661_100000029 | 3300005344 | Bacteria | 117682 |
| 81 | Ga0070661_100000397 | 3300005344 | Bacteria | 33690 |
| 82 | Ga0070692_10002606 | 3300005345 | Bacteria | 7035 |
| 83 | Ga0070671_100000028 | 3300005355 | Bacteria | 113877 |
| 84 | Ga0070659_100023292 | 3300005366 | Bacteria | 4738 |
| 85 | Ga0070659_100029597 | 3300005366 | Bacteria | 4233 |
| 86 | Ga0070667_100000021 | 3300005367 | Bacteria | 205662 |
| 87 | Ga0070701_10000387 | 3300005438 | Bacteria | 14831 |
| 88 | Ga0070705_100000472 | 3300005440 | Bacteria | 23179 |
| 89 | Ga0070700_100006031 | 3300005441 | Bacteria | 6449 |
| 90 | Ga0070694_100000249 | 3300005444 | Bacteria | 28513 |
| 91 | Ga0070678_100025488 | 3300005456 | Bacteria | 3979 |
| 92 | Ga0070662_100041876 | 3300005457 | Bacteria | 3269 |
| 93 | Ga0068867_100000430 | 3300005459 | Bacteria | 28048 |
| 94 | Ga0070685_10000003 | 3300005466 | Bacteria | 283138 |
| 95 | Ga0068853_100000005 | 3300005539 | Bacteria | 366404 |
| 96 | Ga0068853_100057280 | 3300005539 | Bacteria | 3363 |
| 97 | Ga0070686_100000392 | 3300005544 | Bacteria | 27736 |
| 98 | Ga0070695_100000185 | 3300005545 | Bacteria | 29879 |
| 99 | Ga0070696_100000519 | 3300005546 | Bacteria | 24408 |
| 100 | Ga0070696_100002012 | 3300005546 | Bacteria | 13331 |
| 101 | Ga0070693_100000135 | 3300005547 | Bacteria | 33350 |
| 102 | Ga0070693_100015123 | 3300005547 | Bacteria | 3968 |
| 103 | Ga0070665_100001125 | 3300005548 | Bacteria | 32880 |
| 104 | Ga0068855_100002231 | 3300005563 | Bacteria | 23944 |
| 105 | Ga0068855_100003289 | 3300005563 | Bacteria | 19782 |
| 106 | Ga0068857_100000003 | 3300005577 | Bacteria | 174630 |
| 107 | Ga0068854_100008537 | 3300005578 | Bacteria | 6591 |
| 108 | Ga0070702_100000557 | 3300005615 | Bacteria | 13590 |
| 109 | Ga0068852_100001192 | 3300005616 | Bacteria | 17243 |
| 110 | Ga0068859_100001399 | 3300005617 | Bacteria | 24477 |
| 111 | Ga0068859_100134273 | 3300005617 | Bacteria | 2546 |
| 112 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 113 | Ga0068866_10001440 | 3300005718 | Bacteria | 10174 |
| 114 | Ga0068861_100001038 | 3300005719 | Bacteria | 17033 |
| 115 | Ga0068851_10000079 | 3300005834 | Bacteria | 54347 |
| 116 | Ga0068851_10000587 | 3300005834 | Bacteria | 15782 |
| 117 | Ga0068858_100010152 | 3300005842 | Bacteria | 8938 |
| 118 | Ga0068860_100001060 | 3300005843 | Bacteria | 30341 |
| 119 | Ga0068860_100002413 | 3300005843 | Bacteria | 19606 |
| 120 | Ga0068860_100030311 | 3300005843 | Bacteria | 5203 |
| 121 | Ga0068862_100001204 | 3300005844 | Bacteria | 24408 |
| 122 | Ga0068862_100001883 | 3300005844 | Bacteria | 19024 |
| 123 | Ga0068862_100009858 | 3300005844 | Bacteria | 7889 |
| 124 | Ga0068862_100108037 | 3300005844 | Bacteria | 2440 |
| 125 | Ga0081455_10078333 | 3300005937 | Bacteria | 2716 |
| 126 | Ga0075364_10000229 | 3300006051 | Bacteria | 26587 |
| 127 | Ga0075364_10006248 | 3300006051 | Bacteria | 6985 |
| 128 | Ga0075364_10013114 | 3300006051 | Bacteria | 5086 |
| 129 | Ga0075366_10010412 | 3300006195 | Bacteria | 5223 |
| 130 | Ga0097621_100004130 | 3300006237 | Bacteria | 10069 |
| 131 | Ga0068871_100000370 | 3300006358 | Bacteria | 31403 |
| 132 | Ga0075428_100000993 | 3300006844 | Bacteria | 30002 |
| 133 | Ga0075433_10003117 | 3300006852 | Bacteria | 12769 |
| 134 | Ga0075434_100011855 | 3300006871 | Bacteria | 8238 |
| 135 | Ga0075429_100000215 | 3300006880 | Bacteria | 38905 |
| 136 | Ga0068865_100000283 | 3300006881 | Bacteria | 27881 |
| 137 | Ga0075436_100001687 | 3300006914 | Bacteria | 15098 |
| 138 | Ga0075436_100022120 | 3300006914 | Bacteria | 4367 |
| 139 | Ga0097620_100001399 | 3300006931 | Bacteria | 24477 |
| 140 | Ga0097620_100134269 | 3300006931 | Bacteria | 2546 |
| 141 | Ga0079104_1000111 | 3300006946 | Bacteria | 116796 |
| 142 | Ga0079104_1000220 | 3300006946 | Bacteria | 79382 |
| 143 | Ga0079104_1000248 | 3300006946 | Bacteria | 72191 |
| 144 | Ga0079104_1001748 | 3300006946 | Bacteria | 13745 |
| 145 | Ga0079104_1002022 | 3300006946 | Bacteria | 11841 |
| 146 | Ga0079104_1002085 | 3300006946 | Bacteria | 11476 |
| 147 | Ga0079104_1002095 | 3300006946 | Bacteria | 11436 |
| 148 | Ga0079104_1009896 | 3300006946 | Bacteria | 3187 |
| 149 | Ga0079104_1013362 | 3300006946 | Bacteria | 2533 |
| 150 | Ga0075435_100001908 | 3300007076 | Bacteria | 13571 |
| 151 | Ga0105251_10000018 | 3300009011 | Bacteria | 142493 |
| 152 | Ga0105251_10000812 | 3300009011 | Bacteria | 28139 |
| 153 | Ga0105251_10000983 | 3300009011 | Bacteria | 25136 |
| 154 | Ga0105251_10001816 | 3300009011 | Bacteria | 17651 |
| 155 | Ga0105251_10002616 | 3300009011 | Bacteria | 13924 |
| 156 | Ga0105251_10003157 | 3300009011 | Bacteria | 12212 |
| 157 | Ga0105251_10003178 | 3300009011 | Bacteria | 12154 |
| 158 | Ga0105251_10005507 | 3300009011 | Bacteria | 8249 |
| 159 | Ga0105251_10007555 | 3300009011 | Bacteria | 6674 |
| 160 | Ga0105251_10015617 | 3300009011 | Bacteria | 4141 |
| 161 | Ga0105244_10000048 | 3300009036 | Bacteria | 141340 |
| 162 | Ga0105244_10000087 | 3300009036 | Bacteria | 102130 |
| 163 | Ga0105244_10000298 | 3300009036 | Bacteria | 48389 |
| 164 | Ga0105244_10000362 | 3300009036 | Bacteria | 42056 |
| 165 | Ga0105244_10000414 | 3300009036 | Bacteria | 39718 |
| 166 | Ga0105244_10003937 | 3300009036 | Bacteria | 10425 |
| 167 | Ga0105244_10004360 | 3300009036 | Bacteria | 9758 |
| 168 | Ga0105244_10007727 | 3300009036 | Bacteria | 6808 |
| 169 | Ga0105244_10007928 | 3300009036 | Bacteria | 6691 |
| 170 | Ga0105244_10009517 | 3300009036 | Bacteria | 5968 |
| 171 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 172 | Ga0105250_10000025 | 3300009092 | Bacteria | 215424 |
| 173 | Ga0105250_10000044 | 3300009092 | Bacteria | 128269 |
| 174 | Ga0105250_10008301 | 3300009092 | Bacteria | 4421 |
| 175 | Ga0105250_10008680 | 3300009092 | Bacteria | 4305 |
| 176 | Ga0105250_10010099 | 3300009092 | Bacteria | 3942 |
| 177 | Ga0105250_10011116 | 3300009092 | Bacteria | 3739 |
| 178 | Ga0105240_10000056 | 3300009093 | Bacteria | 224822 |
| 179 | Ga0105240_10000218 | 3300009093 | Bacteria | 115562 |
| 180 | Ga0105240_10047158 | 3300009093 | Bacteria | 5454 |
| 181 | Ga0111539_10104260 | 3300009094 | Bacteria | 3328 |
| 182 | Ga0111539_10167108 | 3300009094 | Bacteria | 2571 |
| 183 | Ga0105245_10001066 | 3300009098 | Bacteria | 24858 |
| 184 | Ga0114129_10001138 | 3300009147 | Bacteria | 35164 |
| 185 | Ga0105243_10000708 | 3300009148 | Bacteria | 32162 |
| 186 | Ga0105243_10002042 | 3300009148 | Bacteria | 17120 |
| 187 | Ga0105243_10003465 | 3300009148 | Bacteria | 12738 |
| 188 | Ga0105243_10005617 | 3300009148 | Bacteria | 9768 |
| 189 | Ga0105243_10005820 | 3300009148 | Bacteria | 9563 |
| 190 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 191 | Ga0105242_10001614 | 3300009176 | Bacteria | 17755 |
| 192 | Ga0105242_10002334 | 3300009176 | Bacteria | 14972 |
| 193 | Ga0105237_10001936 | 3300009545 | Bacteria | 26387 |
| 194 | Ga0105237_10012539 | 3300009545 | Bacteria | 8928 |
| 195 | Ga0105249_10005638 | 3300009553 | Bacteria | 10832 |
| 196 | Ga0105246_10006097 | 3300011119 | Bacteria | 7356 |
| 197 | Ga0157373_10000201 | 3300013100 | Bacteria | 49344 |
| 198 | Ga0157373_10001576 | 3300013100 | Bacteria | 17399 |
| 199 | Ga0157373_10004039 | 3300013100 | Bacteria | 11063 |
| 200 | Ga0157371_10000007 | 3300013102 | Bacteria | 401847 |
| 201 | Ga0157371_10000352 | 3300013102 | Bacteria | 58713 |
| 202 | Ga0157371_10000487 | 3300013102 | Bacteria | 48309 |
| 203 | Ga0157371_10002311 | 3300013102 | Bacteria | 18345 |
| 204 | Ga0157371_10002463 | 3300013102 | Bacteria | 17634 |
| 205 | Ga0157371_10017214 | 3300013102 | Bacteria | 5374 |
| 206 | Ga0157370_10000557 | 3300013104 | Bacteria | 46529 |
| 207 | Ga0157370_10000797 | 3300013104 | Bacteria | 39664 |
| 208 | Ga0157370_10001697 | 3300013104 | Bacteria | 27110 |
| 209 | Ga0157370_10003461 | 3300013104 | Bacteria | 18516 |
| 210 | Ga0157370_10016285 | 3300013104 | Bacteria | 7533 |
| 211 | Ga0157369_10018126 | 3300013105 | Bacteria | 7898 |
| 212 | Ga0157369_10028650 | 3300013105 | Bacteria | 6162 |
| 213 | Ga0157369_10051728 | 3300013105 | Bacteria | 4445 |
| 214 | Ga0157369_10057725 | 3300013105 | Bacteria | 4186 |
| 215 | Ga0157369_10068008 | 3300013105 | Bacteria | 3828 |
| 216 | Ga0157369_10068696 | 3300013105 | Bacteria | 3807 |
| 217 | Ga0157374_10060607 | 3300013296 | Bacteria | 3542 |
| 218 | Ga0157378_10001153 | 3300013297 | Bacteria | 24026 |
| 219 | Ga0157378_10021057 | 3300013297 | Bacteria | 5736 |
| 220 | Ga0163162_10010409 | 3300013306 | Bacteria | 9039 |
| 221 | Ga0163162_10037377 | 3300013306 | Bacteria | 4845 |
| 222 | Ga0157372_10005890 | 3300013307 | Bacteria | 13050 |
| 223 | Ga0157372_10012829 | 3300013307 | Bacteria | 8931 |
| 224 | Ga0157372_10012955 | 3300013307 | Bacteria | 8892 |
| 225 | Ga0157372_10250120 | 3300013307 | Bacteria | 2057 |
| 226 | Ga0163163_10000634 | 3300014325 | Bacteria | 30253 |
| 227 | Ga0182008_10000143 | 3300014497 | Bacteria | 55118 |
| 228 | Ga0182006_1000020 | 3300015261 | Bacteria | 285318 |
| 229 | Ga0182006_1004233 | 3300015261 | Bacteria | 7109 |
| 230 | Ga0182007_10000043 | 3300015262 | Bacteria | 107693 |
| 231 | Ga0182005_1000225 | 3300015265 | Bacteria | 37383 |
| 232 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 233 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 234 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 235 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 236 | Ga0163161_10000004 | 3300017792 | Bacteria | 333149 |
| 237 | Ga0163161_10016090 | 3300017792 | Bacteria | 5221 |
| 238 | Ga0213872_10000933 | 3300021361 | Bacteria | 20581 |
| 239 | Ga0213876_10000025 | 3300021384 | Bacteria | 236747 |
| 240 | Ga0213875_10018256 | 3300021388 | Bacteria | 3382 |
| 241 | Ga0209435_100916 | 3300025206 | Bacteria | 4435 |
| 242 | Ga0209760_100011 | 3300025207 | Bacteria | 197221 |
| 243 | Ga0209760_100057 | 3300025207 | Bacteria | 99434 |
| 244 | Ga0209760_100174 | 3300025207 | Bacteria | 35273 |
| 245 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 246 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 247 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 248 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 249 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 250 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 251 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 252 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 253 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 254 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 255 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 256 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 257 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 258 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 259 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 260 | Ga0209437_100235 | 3300025233 | Bacteria | 92210 |
| 261 | Ga0207425_1000030 | 3300025245 | Bacteria | 268200 |
| 262 | Ga0209646_1000216 | 3300025246 | Bacteria | 62818 |
| 263 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 264 | Ga0209677_100063 | 3300025253 | Bacteria | 151440 |
| 265 | Ga0209129_1000015 | 3300025258 | Bacteria | 487967 |
| 266 | Ga0209129_1000597 | 3300025258 | Bacteria | 24626 |
| 267 | Ga0209129_1012473 | 3300025258 | Bacteria | 1946 |
| 268 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 269 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 270 | Ga0209233_1001387 | 3300025261 | Bacteria | 9600 |
| 271 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 272 | Ga0209565_1005883 | 3300025263 | Bacteria | 3515 |
| 273 | Ga0209673_1000171 | 3300025273 | Bacteria | 133493 |
| 274 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 275 | Ga0209675_1000639 | 3300025291 | Bacteria | 24900 |
| 276 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 277 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 278 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 279 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 280 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 281 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 282 | Ga0209676_1000474 | 3300025292 | Bacteria | 66391 |
| 283 | Ga0209676_1000970 | 3300025292 | Bacteria | 34527 |
| 284 | Ga0209676_1015643 | 3300025292 | Bacteria | 2782 |
| 285 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 286 | Ga0209564_1000221 | 3300025295 | Bacteria | 129537 |
| 287 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 288 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 289 | Ga0209050_1000329 | 3300025298 | Bacteria | 94932 |
| 290 | Ga0209050_1000415 | 3300025298 | Bacteria | 79058 |
| 291 | Ga0209050_1000477 | 3300025298 | Bacteria | 70798 |
| 292 | Ga0209050_1001705 | 3300025298 | Bacteria | 21965 |
| 293 | Ga0209050_1022831 | 3300025298 | Bacteria | 2227 |
| 294 | Ga0209256_1005108 | 3300025299 | Bacteria | 7780 |
| 295 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 296 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 297 | Ga0209051_1001937 | 3300025303 | Bacteria | 15970 |
| 298 | Ga0209051_1012278 | 3300025303 | Bacteria | 4153 |
| 299 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 300 | Ga0209257_1000150 | 3300025304 | Bacteria | 191487 |
| 301 | Ga0209257_1000604 | 3300025304 | Bacteria | 59301 |
| 302 | Ga0209257_1001953 | 3300025304 | Bacteria | 22258 |
| 303 | Ga0209257_1004574 | 3300025304 | Bacteria | 10578 |
| 304 | Ga0207656_10000093 | 3300025321 | Bacteria | 33347 |
| 305 | Ga0207656_10014464 | 3300025321 | Bacteria | 3040 |
| 306 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 307 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 308 | Ga0207696_1000007 | 3300025711 | Bacteria | 578417 |
| 309 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 310 | Ga0207696_1000081 | 3300025711 | Bacteria | 198887 |
| 311 | Ga0207696_1000152 | 3300025711 | Bacteria | 119512 |
| 312 | Ga0207696_1000192 | 3300025711 | Bacteria | 94285 |
| 313 | Ga0207696_1000247 | 3300025711 | Bacteria | 73166 |
| 314 | Ga0207696_1000472 | 3300025711 | Bacteria | 34389 |
| 315 | Ga0207696_1000517 | 3300025711 | Bacteria | 32018 |
| 316 | Ga0207696_1000546 | 3300025711 | Bacteria | 30331 |
| 317 | Ga0207696_1000655 | 3300025711 | Bacteria | 24794 |
| 318 | Ga0207696_1006510 | 3300025711 | Bacteria | 4700 |
| 319 | Ga0207696_1006511 | 3300025711 | Bacteria | 4700 |
| 320 | Ga0207696_1007690 | 3300025711 | Bacteria | 4194 |
| 321 | Ga0207696_1009429 | 3300025711 | Bacteria | 3641 |
| 322 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 323 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 324 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 325 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 326 | Ga0207655_1000029 | 3300025728 | Bacteria | 432187 |
| 327 | Ga0207655_1000042 | 3300025728 | Bacteria | 333039 |
| 328 | Ga0207655_1000087 | 3300025728 | Bacteria | 205876 |
| 329 | Ga0207655_1000206 | 3300025728 | Bacteria | 102975 |
| 330 | Ga0207655_1000448 | 3300025728 | Bacteria | 54335 |
| 331 | Ga0207655_1000496 | 3300025728 | Bacteria | 50648 |
| 332 | Ga0207655_1000530 | 3300025728 | Bacteria | 48477 |
| 333 | Ga0207655_1001462 | 3300025728 | Bacteria | 21825 |
| 334 | Ga0207655_1002985 | 3300025728 | Bacteria | 12973 |
| 335 | Ga0207655_1003562 | 3300025728 | Bacteria | 11531 |
| 336 | Ga0207655_1006225 | 3300025728 | Bacteria | 7942 |
| 337 | Ga0207655_1006427 | 3300025728 | Bacteria | 7791 |
| 338 | Ga0207655_1006562 | 3300025728 | Bacteria | 7684 |
| 339 | Ga0207655_1007706 | 3300025728 | Bacteria | 6948 |
| 340 | Ga0207655_1008247 | 3300025728 | Bacteria | 6639 |
| 341 | Ga0207655_1011623 | 3300025728 | Bacteria | 5222 |
| 342 | Ga0207655_1012449 | 3300025728 | Bacteria | 4970 |
| 343 | Ga0207655_1015599 | 3300025728 | Bacteria | 4209 |
| 344 | Ga0207655_1023472 | 3300025728 | Bacteria | 3058 |
| 345 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 346 | Ga0207713_1000005 | 3300025735 | Bacteria | 649958 |
| 347 | Ga0207713_1000006 | 3300025735 | Bacteria | 586163 |
| 348 | Ga0207713_1000009 | 3300025735 | Bacteria | 551314 |
| 349 | Ga0207713_1000021 | 3300025735 | Bacteria | 353108 |
| 350 | Ga0207713_1000101 | 3300025735 | Bacteria | 140693 |
| 351 | Ga0207713_1000133 | 3300025735 | Bacteria | 112797 |
| 352 | Ga0207713_1000519 | 3300025735 | Bacteria | 38934 |
| 353 | Ga0207713_1000618 | 3300025735 | Bacteria | 34875 |
| 354 | Ga0207713_1000956 | 3300025735 | Bacteria | 25753 |
| 355 | Ga0207713_1001549 | 3300025735 | Bacteria | 18078 |
| 356 | Ga0207713_1003433 | 3300025735 | Bacteria | 10812 |
| 357 | Ga0207713_1003436 | 3300025735 | Bacteria | 10798 |
| 358 | Ga0207713_1003886 | 3300025735 | Bacteria | 9953 |
| 359 | Ga0207713_1006626 | 3300025735 | Bacteria | 7020 |
| 360 | Ga0207713_1007860 | 3300025735 | Bacteria | 6217 |
| 361 | Ga0207713_1007978 | 3300025735 | Bacteria | 6159 |
| 362 | Ga0207713_1010212 | 3300025735 | Bacteria | 5213 |
| 363 | Ga0207713_1011492 | 3300025735 | Bacteria | 4807 |
| 364 | Ga0207713_1013546 | 3300025735 | Bacteria | 4288 |
| 365 | Ga0207713_1014764 | 3300025735 | Bacteria | 4035 |
| 366 | Ga0207642_10007346 | 3300025899 | Bacteria | 3717 |
| 367 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 368 | Ga0207647_10000006 | 3300025904 | Bacteria | 214791 |
| 369 | Ga0207705_10025061 | 3300025909 | Bacteria | 4258 |
| 370 | Ga0207705_10039053 | 3300025909 | Bacteria | 3401 |
| 371 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 372 | Ga0207695_10000103 | 3300025913 | Bacteria | 257354 |
| 373 | Ga0207695_10000395 | 3300025913 | Bacteria | 98285 |
| 374 | Ga0207671_10000287 | 3300025914 | Bacteria | 74587 |
| 375 | Ga0207671_10043184 | 3300025914 | Bacteria | 3333 |
| 376 | Ga0207662_10000191 | 3300025918 | Bacteria | 28718 |
| 377 | Ga0207649_10000113 | 3300025920 | Bacteria | 68458 |
| 378 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 379 | Ga0207650_10000255 | 3300025925 | Bacteria | 57979 |
| 380 | Ga0207659_10043063 | 3300025926 | Bacteria | 3168 |
| 381 | Ga0207687_10001813 | 3300025927 | Bacteria | 14697 |
| 382 | Ga0207690_10014624 | 3300025932 | Bacteria | 4742 |
| 383 | Ga0207686_10001418 | 3300025934 | Bacteria | 13594 |
| 384 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 385 | Ga0207709_10000536 | 3300025935 | Bacteria | 32696 |
| 386 | Ga0207709_10001098 | 3300025935 | Bacteria | 19845 |
| 387 | Ga0207709_10002036 | 3300025935 | Bacteria | 13099 |
| 388 | Ga0207709_10003606 | 3300025935 | Bacteria | 9145 |
| 389 | Ga0207709_10012063 | 3300025935 | Bacteria | 4764 |
| 390 | Ga0207709_10016817 | 3300025935 | Bacteria | 4075 |
| 391 | Ga0207670_10001920 | 3300025936 | Bacteria | 10877 |
| 392 | Ga0207704_10000409 | 3300025938 | Bacteria | 19434 |
| 393 | Ga0207711_10006103 | 3300025941 | Bacteria | 10175 |
| 394 | Ga0207689_10000921 | 3300025942 | Bacteria | 28235 |
| 395 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 396 | Ga0207667_10006477 | 3300025949 | Bacteria | 14168 |
| 397 | Ga0207667_10017372 | 3300025949 | Bacteria | 8098 |
| 398 | Ga0207712_10004731 | 3300025961 | Bacteria | 8603 |
| 399 | Ga0207712_10060237 | 3300025961 | Bacteria | 2690 |
| 400 | Ga0207668_10061226 | 3300025972 | Bacteria | 2646 |
| 401 | Ga0207640_10001592 | 3300025981 | Bacteria | 12198 |
| 402 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 403 | Ga0207677_10000592 | 3300026023 | Bacteria | 22464 |
| 404 | Ga0207703_10007345 | 3300026035 | Bacteria | 8758 |
| 405 | Ga0207639_10000010 | 3300026041 | Bacteria | 415264 |
| 406 | Ga0207708_10000451 | 3300026075 | Bacteria | 31936 |
| 407 | Ga0207648_10000245 | 3300026089 | Bacteria | 58564 |
| 408 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 409 | Ga0207674_10000043 | 3300026116 | Bacteria | 124448 |
| 410 | Ga0207675_100001447 | 3300026118 | Bacteria | 23783 |
| 411 | Ga0207675_100044530 | 3300026118 | Bacteria | 4147 |
| 412 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 413 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 414 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 415 | Ga0209281_1000021 | 3300027111 | Bacteria | 541033 |
| 416 | Ga0209281_1000041 | 3300027111 | Bacteria | 347825 |
| 417 | Ga0209281_1000075 | 3300027111 | Bacteria | 267114 |
| 418 | Ga0209281_1000079 | 3300027111 | Bacteria | 261444 |
| 419 | Ga0209281_1000331 | 3300027111 | Bacteria | 81645 |
| 420 | Ga0209281_1000335 | 3300027111 | Bacteria | 80336 |
| 421 | Ga0209281_1003727 | 3300027111 | Bacteria | 4871 |
| 422 | Ga0209281_1006267 | 3300027111 | Bacteria | 3133 |
| 423 | Ga0209281_1006480 | 3300027111 | Bacteria | 3050 |
| 424 | Ga0209389_1001707 | 3300027296 | Bacteria | 15879 |
| 425 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 426 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 427 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 428 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 429 | Ga0209371_1000026 | 3300027312 | Bacteria | 449205 |
| 430 | Ga0209371_1000146 | 3300027312 | Bacteria | 115378 |
| 431 | Ga0209371_1000220 | 3300027312 | Bacteria | 76323 |
| 432 | Ga0209371_1000303 | 3300027312 | Bacteria | 54750 |
| 433 | Ga0209371_1000557 | 3300027312 | Bacteria | 34359 |
| 434 | Ga0209371_1000615 | 3300027312 | Bacteria | 31768 |
| 435 | Ga0209371_1001062 | 3300027312 | Bacteria | 20562 |
| 436 | Ga0209371_1001253 | 3300027312 | Bacteria | 18076 |
| 437 | Ga0209371_1002424 | 3300027312 | Bacteria | 10461 |
| 438 | Ga0209371_1002751 | 3300027312 | Bacteria | 9434 |
| 439 | Ga0209371_1003505 | 3300027312 | Bacteria | 7576 |
| 440 | Ga0209371_1003799 | 3300027312 | Bacteria | 7016 |
| 441 | Ga0209371_1009424 | 3300027312 | Bacteria | 3107 |
| 442 | Ga0209371_1010515 | 3300027312 | Bacteria | 2837 |
| 443 | Ga0209996_1001214 | 3300027395 | Bacteria | 3114 |
| 444 | Ga0209995_1001793 | 3300027471 | Bacteria | 3345 |
| 445 | Ga0209983_1002193 | 3300027665 | Bacteria | 4298 |
| 446 | Ga0207428_10000954 | 3300027907 | Bacteria | 32134 |
| 447 | Ga0268266_10000084 | 3300028379 | Bacteria | 201874 |
| 448 | Ga0268266_10004969 | 3300028379 | Bacteria | 12579 |
| 449 | Ga0268265_10000627 | 3300028380 | Bacteria | 35202 |
| 450 | Ga0268265_10000783 | 3300028380 | Bacteria | 30441 |
| 451 | Ga0268265_10008164 | 3300028380 | Bacteria | 7072 |
| 452 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 453 | Ga0268264_10003335 | 3300028381 | Bacteria | 13874 |
| 454 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 455 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 456 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 457 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 458 | Ga0268256_1000017 | 3300030500 | Bacteria | 600718 |
| 459 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 460 | Ga0268256_1000117 | 3300030500 | Bacteria | 115176 |
| 461 | Ga0268256_1000359 | 3300030500 | Bacteria | 43686 |
| 462 | Ga0268256_1000528 | 3300030500 | Bacteria | 31946 |
| 463 | Ga0268256_1000677 | 3300030500 | Bacteria | 25775 |
| 464 | Ga0268256_1000824 | 3300030500 | Bacteria | 22179 |
| 465 | Ga0268256_1000894 | 3300030500 | Bacteria | 20562 |
| 466 | Ga0268256_1001063 | 3300030500 | Bacteria | 18270 |
| 467 | Ga0268256_1002457 | 3300030500 | Bacteria | 9434 |
| 468 | Ga0268256_1007719 | 3300030500 | Bacteria | 3792 |
| 469 | Ga0268256_1009255 | 3300030500 | Bacteria | 3294 |
| 470 | Ga0316176_1131399 | 3300030732 | Bacteria | 2648 |
| 471 | Ga0314311_1124074 | 3300030733 | Bacteria | 4695 |
| 472 | Ga0316178_1127053 | 3300030735 | Bacteria | 33158 |
| 473 | Ga0316183_1195675 | 3300030742 | Bacteria | 4464 |
| 474 | Ga0265328_10000106 | 3300031239 | Bacteria | 39805 |
| 475 | Ga0265328_10000501 | 3300031239 | Bacteria | 18180 |
| 476 | Ga0265331_10000121 | 3300031250 | Bacteria | 102519 |
| 477 | Ga0265331_10024460 | 3300031250 | Bacteria | 3055 |
| 478 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 479 | Ga0265327_10000241 | 3300031251 | Bacteria | 109225 |
| 480 | Ga0265327_10000269 | 3300031251 | Bacteria | 102772 |
| 481 | Ga0265327_10000333 | 3300031251 | Bacteria | 89521 |
| 482 | Ga0265327_10000463 | 3300031251 | Bacteria | 72345 |
| 483 | Ga0265327_10001895 | 3300031251 | Bacteria | 24187 |
| 484 | Ga0265327_10003075 | 3300031251 | Bacteria | 16479 |
| 485 | Ga0265327_10007016 | 3300031251 | Bacteria | 8832 |
| 486 | Ga0265327_10025252 | 3300031251 | Bacteria | 3469 |
| 487 | Ga0307408_100000057 | 3300031548 | Bacteria | 135228 |
| 488 | Ga0307408_100000411 | 3300031548 | Bacteria | 38447 |
| 489 | Ga0307408_100004612 | 3300031548 | Bacteria | 9317 |
| 490 | Ga0316575_10001442 | 3300031665 | Bacteria | 7662 |
| 491 | Ga0316576_10001557 | 3300031727 | Bacteria | 12440 |
| 492 | Ga0316576_10011765 | 3300031727 | Bacteria | 5753 |
| 493 | Ga0316576_10012548 | 3300031727 | Bacteria | 5602 |
| 494 | Ga0316578_10001181 | 3300031728 | Bacteria | 10330 |
| 495 | Ga0316578_10019319 | 3300031728 | Bacteria | 3748 |
| 496 | Ga0316577_10000094 | 3300031733 | Bacteria | 24143 |
| 497 | Ga0316577_10028740 | 3300031733 | Bacteria | 3103 |
| 498 | Ga0307406_10003868 | 3300031901 | Bacteria | 8154 |
| 499 | Ga0307414_10011831 | 3300032004 | Bacteria | 5137 |
| 500 | Ga0316583_10005959 | 3300032133 | Bacteria | 4379 |
| 501 | Ga0307507_10021263 | 3300033179 | Bacteria | 7230 |
| 502 | Ga0316586_1002942 | 3300033527 | Bacteria | 2184 |
| 503 | Ga0316587_1001710 | 3300033529 | Bacteria | 2780 |
| 504 | Ga0316596_1005926 | 3300033541 | Bacteria | 2817 |
| 505 | Ga0316596_1013538 | 3300033541 | Bacteria | 2016 |
| 506 | Ga0373934_0000411 | 3300035086 | Bacteria | 15024 |
| 507 | Ga0373952_0000960 | 3300035092 | Bacteria | 5236 |
| 508 | Ga0373932_0009006 | 3300035112 | Bacteria | 2393 |
| 509 | Ga0373956_0002404 | 3300035119 | Bacteria | 7637 |
| 510 | Ga0373943_0036176 | 3300035170 | Bacteria | 2363 |
| 511 | Ga0373946_0004603 | 3300035171 | Bacteria | 4944 |
| 512 | Ga0373955_0038223 | 3300035172 | Bacteria | 2556 |
| 513 | Ga0316574_0001118 | 3300035398 | Bacteria | 12273 |
| 514 | Ga0316574_0005934 | 3300035398 | Bacteria | 6554 |
| 515 | Ga0373924_0020416 | 3300035410 | Bacteria | 2575 |
| 516 | Ga0373931_0003470 | 3300035691 | Bacteria | 7081 |
| 517 | Ga0373931_0004014 | 3300035691 | Bacteria | 6665 |
| 518 | Ga0373935_0041524 | 3300035692 | Bacteria | 2889 |
| 519 | Ga0373927_0011878 | 3300035695 | Bacteria | 5801 |
| 520 | Ga0373927_0036936 | 3300035695 | Bacteria | 3175 |
| 521 | Ga0373933_0002175 | 3300035724 | Bacteria | 11222 |
| 522 | Ga0373937_0003720 | 3300036401 | Bacteria | 12888 |
| 523 | Ga0316582_0001994 | 3300036647 | Bacteria | 9354 |
| 524 | Ga0316582_0002211 | 3300036647 | Bacteria | 9030 |
| 525 | Ga0316582_0007751 | 3300036647 | Bacteria | 5734 |
| 526 | Ga0316584_0000428 | 3300036712 | Bacteria | 21955 |
| 527 | Ga0316584_0004523 | 3300036712 | Bacteria | 9203 |
| 528 | Ga0316584_0075252 | 3300036712 | Bacteria | 2531 |
| 529 | Ga0316584_0077175 | 3300036712 | Bacteria | 2496 |
| 530 | Ga0316581_0006025 | 3300037588 | Bacteria | 3192 |
| 531 | Ga0436364_0455618 | 3300037853 | Bacteria | 8305 |
| 532 | Ga0237819_00054 | 3300038705 | Bacteria | 40103 |
| 533 | Ga0237819_00849 | 3300038705 | Bacteria | 9629 |
| 534 | Ga0237819_04151 | 3300038705 | Bacteria | 2432 |
| 535 | Ga0400484_07955 | 3300038725 | Bacteria | 7254 |
| 536 | Ga0400490_04080 | 3300038726 | Bacteria | 3040 |
| 537 | Ga0400490_28529 | 3300038726 | Bacteria | 26677 |
| 538 | Ga0400490_31714 | 3300038726 | Bacteria | 3979 |
| 539 | Ga0400490_36858 | 3300038726 | Bacteria | 32496 |
| 540 | Ga0400485_19597 | 3300038735 | Bacteria | 3668 |
| 541 | Ga0400483_009065 | 3300039062 | Bacteria | 5156 |
| 542 | Ga0400483_013162 | 3300039062 | Bacteria | 8018 |
| 543 | Ga0400483_026308 | 3300039062 | Bacteria | 223136 |
| 544 | Ga0400483_076133 | 3300039062 | Bacteria | 9214 |
| 545 | Ga0400483_178744 | 3300039062 | Bacteria | 2218 |
| 546 | Ga0400483_195378 | 3300039062 | Bacteria | 81541 |
| 547 | Ga0400483_233356 | 3300039062 | Bacteria | 3624 |
| 548 | Ga0400483_234758 | 3300039062 | Bacteria | 16366 |
| 549 | Ga0400483_250036 | 3300039062 | Bacteria | 396353 |
| 550 | Ga0400483_259219 | 3300039062 | Bacteria | 8327 |
| 551 | Ga0400487_51348 | 3300039110 | Bacteria | 7047 |
| 552 | Ga0436365_1279401 | 3300039437 | Bacteria | 294819 |
| 553 | Ga0436365_1440570 | 3300039437 | Bacteria | 2412 |
| 554 | Ga0436361_0695291 | 3300039447 | Bacteria | 66094 |
| 555 | Ga0436361_1114325 | 3300039447 | Bacteria | 10568 |
| 556 | Ga0439436_0000430 | 3300041404 | Bacteria | 10608 |
| 557 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 558 | Ga0439438_000879 | 3300041405 | Bacteria | 13384 |
| 559 | Ga0439438_006601 | 3300041405 | Bacteria | 4070 |
| 560 | Ga0439447_003201 | 3300041407 | Bacteria | 5831 |
| 561 | Ga0439447_011386 | 3300041407 | Bacteria | 2598 |
| 562 | Ga0439466_0000012 | 3300041411 | Bacteria | 179902 |
| 563 | Ga0439466_0001695 | 3300041411 | Bacteria | 8603 |
| 564 | Ga0451795_1536678 | 3300041456 | Bacteria | 3025 |
| 565 | Ga0451800_0211862 | 3300041459 | Bacteria | 7857 |
| 566 | Ga0451806_617527 | 3300041462 | Bacteria | 7457 |
| 567 | Ga0451807_1185460 | 3300041486 | Bacteria | 3562 |
| 568 | Ga0451853_1183803 | 3300041512 | Bacteria | 4811 |
| 569 | Ga0439452_000003 | 3300042010 | Bacteria | 942815 |
| 570 | Ga0439452_000017 | 3300042010 | Bacteria | 324897 |
| 571 | Ga0439452_000027 | 3300042010 | Bacteria | 206086 |
| 572 | Ga0439452_000033 | 3300042010 | Bacteria | 178345 |
| 573 | Ga0439452_002344 | 3300042010 | Bacteria | 7059 |
| 574 | Ga0439452_002943 | 3300042010 | Bacteria | 6073 |
| 575 | Ga0439456_000278 | 3300042013 | Bacteria | 12304 |
| 576 | Ga0439456_008211 | 3300042013 | Bacteria | 2156 |
| 577 | Ga0450911_000013 | 3300042115 | Bacteria | 129019 |
| 578 | Ga0450911_001689 | 3300042115 | Bacteria | 4873 |
| 579 | Ga0439460_0001205 | 3300042461 | Bacteria | 6095 |
| 580 | Ga0451577_0072675 | 3300042876 | Bacteria | 3069 |
| 581 | Ga0466981_0000006 | 3300044669 | Bacteria | 157389 |
| 582 | Ga0453684_0001204 | 3300044712 | Bacteria | 79823 |
| 583 | Ga0453684_0002214 | 3300044712 | Bacteria | 48332 |
| 584 | Ga0451576_0027885 | 3300045051 | Bacteria | 6057 |
| 585 | Ga0451576_0098624 | 3300045051 | Unclassified | 3039 |
| 586 | Ga0495617_004198 | 3300046452 | Bacteria | 5269 |
| 587 | Ga0495627_000145 | 3300046453 | Bacteria | 84853 |
| 588 | Ga0495627_001983 | 3300046453 | Bacteria | 10568 |
| 589 | Ga0495627_002242 | 3300046453 | Bacteria | 9573 |
| 590 | Ga0495627_004653 | 3300046453 | Bacteria | 5687 |
| 591 | Ga0495592_0004990 | 3300046454 | Bacteria | 9769 |
| 592 | Ga0495603_0000212 | 3300046455 | Bacteria | 30148 |
| 593 | Ga0495590_0001910 | 3300046457 | Bacteria | 8831 |
| 594 | Ga0495591_000011 | 3300046458 | Bacteria | 309685 |
| 595 | Ga0495591_000137 | 3300046458 | Bacteria | 79532 |
| 596 | Ga0495591_000301 | 3300046458 | Bacteria | 45136 |
| 597 | Ga0495591_001205 | 3300046458 | Bacteria | 16842 |
| 598 | Ga0495591_002420 | 3300046458 | Bacteria | 10404 |
| 599 | Ga0495591_002938 | 3300046458 | Bacteria | 9108 |
| 600 | Ga0495591_007890 | 3300046458 | Bacteria | 4439 |
| 601 | Ga0495638_0002776 | 3300046460 | Bacteria | 14066 |
| 602 | Ga0495638_0021129 | 3300046460 | Bacteria | 4294 |
| 603 | Ga0495651_0001303 | 3300046462 | Bacteria | 19301 |
| 604 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 605 | Ga0495650_0000033 | 3300046471 | Bacteria | 412188 |
| 606 | Ga0495650_0000175 | 3300046471 | Bacteria | 140965 |
| 607 | Ga0495580_0000358 | 3300046472 | Bacteria | 37269 |
| 608 | Ga0495605_0000026 | 3300046474 | Bacteria | 221832 |
| 609 | Ga0495605_0000414 | 3300046474 | Bacteria | 38982 |
| 610 | Ga0495605_0003439 | 3300046474 | Bacteria | 9411 |
| 611 | Ga0495605_0015583 | 3300046474 | Bacteria | 4129 |
| 612 | Ga0495584_0004701 | 3300046491 | Bacteria | 7312 |
| 613 | Ga0495585_0000394 | 3300046492 | Bacteria | 42296 |
| 614 | Ga0495585_0003927 | 3300046492 | Bacteria | 9835 |
| 615 | Ga0495596_0001337 | 3300046500 | Bacteria | 14179 |
| 616 | Ga0495607_0004502 | 3300046501 | Bacteria | 10226 |
| 617 | Ga0495607_0005073 | 3300046501 | Bacteria | 9530 |
| 618 | Ga0495583_0000043 | 3300046506 | Bacteria | 230804 |
| 619 | Ga0495583_0004703 | 3300046506 | Bacteria | 9605 |
| 620 | Ga0495606_0000627 | 3300046507 | Bacteria | 55643 |
| 621 | Ga0495606_0000861 | 3300046507 | Bacteria | 45459 |
| 622 | Ga0495606_0002635 | 3300046507 | Bacteria | 20465 |
| 623 | Ga0495606_0008136 | 3300046507 | Bacteria | 9187 |
| 624 | Ga0495606_0009605 | 3300046507 | Bacteria | 8152 |
| 625 | Ga0495610_0014992 | 3300046512 | Bacteria | 4524 |
| 626 | Ga0495610_0018057 | 3300046512 | Bacteria | 3996 |
| 627 | Ga0495616_0004615 | 3300046513 | Bacteria | 8648 |
| 628 | Ga0495616_0040906 | 3300046513 | Bacteria | 2366 |
| 629 | Ga0495620_0000083 | 3300046515 | Bacteria | 78909 |
| 630 | Ga0495620_0000263 | 3300046515 | Bacteria | 38924 |
| 631 | Ga0495620_0003570 | 3300046515 | Bacteria | 8893 |
| 632 | Ga0495620_0019386 | 3300046515 | Bacteria | 3346 |
| 633 | Ga0495628_0005053 | 3300046516 | Bacteria | 11596 |
| 634 | Ga0495631_0000558 | 3300046518 | Bacteria | 24972 |
| 635 | Ga0495631_0004234 | 3300046518 | Bacteria | 7675 |
| 636 | Ga0495632_0010833 | 3300046519 | Bacteria | 5363 |
| 637 | Ga0495632_0048002 | 3300046519 | Bacteria | 2115 |
| 638 | Ga0495637_0000174 | 3300046520 | Bacteria | 49455 |
| 639 | Ga0495637_0014466 | 3300046520 | Bacteria | 3723 |
| 640 | Ga0495643_0000062 | 3300046522 | Bacteria | 183602 |
| 641 | Ga0495643_0002111 | 3300046522 | Bacteria | 16411 |
| 642 | Ga0495643_0004357 | 3300046522 | Bacteria | 9926 |
| 643 | Ga0495643_0007246 | 3300046522 | Bacteria | 7185 |
| 644 | Ga0495644_0000325 | 3300046523 | Bacteria | 21805 |
| 645 | Ga0495648_0002784 | 3300046524 | Bacteria | 15767 |
| 646 | Ga0495654_0000020 | 3300046530 | Bacteria | 284814 |
| 647 | Ga0495654_0000032 | 3300046530 | Bacteria | 205780 |
| 648 | Ga0495654_0002005 | 3300046530 | Bacteria | 13413 |
| 649 | Ga0495654_0006490 | 3300046530 | Bacteria | 6641 |
| 650 | Ga0495654_0022838 | 3300046530 | Bacteria | 3243 |
| 651 | Ga0495586_0003782 | 3300046535 | Bacteria | 8110 |
| 652 | Ga0495609_0000036 | 3300046538 | Bacteria | 186358 |
| 653 | Ga0495609_0000125 | 3300046538 | Bacteria | 83190 |
| 654 | Ga0495597_0000129 | 3300046542 | Bacteria | 68183 |
| 655 | Ga0495597_0004114 | 3300046542 | Bacteria | 8103 |
| 656 | Ga0495645_0000552 | 3300046543 | Bacteria | 25668 |
| 657 | Ga0495633_0000143 | 3300046558 | Bacteria | 95292 |
| 658 | Ga0495611_0001051 | 3300046648 | Bacteria | 14598 |
| 659 | Ga0495625_0007427 | 3300046660 | Bacteria | 9537 |
| 660 | Ga0495635_0004064 | 3300046663 | Bacteria | 10155 |
| 661 | Ga0495661_0000092 | 3300046665 | Bacteria | 109902 |
| 662 | Ga0495661_0000121 | 3300046665 | Bacteria | 93554 |
| 663 | Ga0495661_0002800 | 3300046665 | Bacteria | 13209 |
| 664 | Ga0495661_0008826 | 3300046665 | Bacteria | 6953 |
| 665 | Ga0495588_0003773 | 3300046674 | Bacteria | 6635 |
| 666 | Ga0495646_0014122 | 3300046680 | Bacteria | 5078 |
| 667 | Ga0495647_0000273 | 3300046681 | Bacteria | 14274 |
| 668 | Ga0495658_0000620 | 3300046683 | Bacteria | 19327 |
| 669 | Ga0495613_0028561 | 3300046689 | Bacteria | 4149 |
| 670 | Ga0495671_0002439 | 3300046692 | Bacteria | 11743 |
| 671 | Ga0495671_0014193 | 3300046692 | Bacteria | 4293 |
| 672 | Ga0495649_0001266 | 3300046694 | Bacteria | 19465 |
| 673 | Ga0495649_0003138 | 3300046694 | Bacteria | 11324 |
| 674 | Ga0495649_0005413 | 3300046694 | Bacteria | 8124 |
| 675 | Ga0495649_0008704 | 3300046694 | Bacteria | 6088 |
| 676 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 677 | Ga0495589_0002626 | 3300046794 | Bacteria | 9950 |
| 678 | Ga0495589_0009905 | 3300046794 | Bacteria | 4951 |
| 679 | Ga0495600_0030133 | 3300046809 | Bacteria | 3513 |
| 680 | Ga0495660_0000007 | 3300046810 | Bacteria | 485295 |
| 681 | Ga0495660_0000011 | 3300046810 | Bacteria | 361397 |
| 682 | Ga0495636_0007887 | 3300047318 | Bacteria | 4191 |
| 683 | Ga0495672_0000004 | 3300047320 | Bacteria | 631810 |
| 684 | Ga0495672_0000027 | 3300047320 | Bacteria | 325651 |
| 685 | Ga0495672_0000061 | 3300047320 | Bacteria | 212024 |
| 686 | Ga0495672_0033100 | 3300047320 | Bacteria | 3205 |
| 687 | Ga0495676_0000019 | 3300047321 | Bacteria | 167261 |
| 688 | Ga0495676_0008018 | 3300047321 | Bacteria | 9681 |
| 689 | Ga0495680_0014781 | 3300047322 | Bacteria | 6747 |
| 690 | Ga0495680_0039620 | 3300047322 | Bacteria | 3756 |
| 691 | Ga0495683_0000003 | 3300047323 | Bacteria | 383992 |
| 692 | Ga0495683_0000175 | 3300047323 | Bacteria | 62928 |
| 693 | Ga0495683_0002550 | 3300047323 | Bacteria | 10948 |
| 694 | Ga0495683_0025572 | 3300047323 | Bacteria | 3025 |
| 695 | Ga0495675_0008743 | 3300047444 | Bacteria | 6285 |
| 696 | Ga0495675_0051538 | 3300047444 | Bacteria | 2613 |
| 697 | Ga0495679_000019 | 3300047446 | Bacteria | 231072 |
| 698 | Ga0495679_000119 | 3300047446 | Bacteria | 69255 |
| 699 | Ga0495673_0000023 | 3300047469 | Bacteria | 539904 |
| 700 | Ga0495673_0000529 | 3300047469 | Bacteria | 39664 |
| 701 | Ga0495673_0004149 | 3300047469 | Bacteria | 9167 |
| 702 | Ga0495673_0012478 | 3300047469 | Bacteria | 4502 |
| 703 | Ga0495681_0014386 | 3300047470 | Bacteria | 4538 |
| 704 | Ga0495681_0054310 | 3300047470 | Bacteria | 1872 |
| 705 | Ga0495686_0005011 | 3300047472 | Bacteria | 10633 |
| 706 | Ga0495626_0000659 | 3300048091 | Bacteria | 33166 |
| 707 | Ga0495626_0005573 | 3300048091 | Bacteria | 7305 |
| 708 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 709 | Ga0496102_0003967 | 3300048905 | Bacteria | 12540 |
| 710 | Ga0496102_0009820 | 3300048905 | Bacteria | 8228 |
| 711 | Ga0496104_0000592 | 3300048907 | Bacteria | 30952 |
| 712 | Ga0496105_0069602 | 3300048908 | Bacteria | 2908 |
| 713 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 714 | Ga0496116_0000054 | 3300048919 | Bacteria | 289010 |
| 715 | Ga0496116_0000505 | 3300048919 | Bacteria | 53281 |
| 716 | Ga0496116_0002239 | 3300048919 | Bacteria | 20578 |
| 717 | Ga0496116_0004675 | 3300048919 | Bacteria | 12957 |
| 718 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 719 | Ga0496117_0000212 | 3300048920 | Bacteria | 112241 |
| 720 | Ga0496117_0000853 | 3300048920 | Bacteria | 47190 |
| 721 | Ga0496117_0001196 | 3300048920 | Bacteria | 39067 |
| 722 | Ga0496117_0001459 | 3300048920 | Bacteria | 34088 |
| 723 | Ga0496117_0002296 | 3300048920 | Bacteria | 24627 |
| 724 | Ga0496117_0004075 | 3300048920 | Bacteria | 16412 |
| 725 | Ga0496117_0008161 | 3300048920 | Bacteria | 10000 |
| 726 | Ga0496117_0011702 | 3300048920 | Bacteria | 7826 |
| 727 | Ga0496117_0011783 | 3300048920 | Bacteria | 7790 |
| 728 | Ga0496117_0012041 | 3300048920 | Bacteria | 7678 |
| 729 | Ga0496117_0019385 | 3300048920 | Bacteria | 5588 |
| 730 | Ga0496118_0000024 | 3300048921 | Bacteria | 385236 |
| 731 | Ga0496118_0000528 | 3300048921 | Bacteria | 62711 |
| 732 | Ga0496118_0001266 | 3300048921 | Bacteria | 38767 |
| 733 | Ga0496118_0001268 | 3300048921 | Bacteria | 38749 |
| 734 | Ga0496118_0001321 | 3300048921 | Bacteria | 37625 |
| 735 | Ga0496118_0002368 | 3300048921 | Bacteria | 25530 |
| 736 | Ga0496118_0002663 | 3300048921 | Bacteria | 23602 |
| 737 | Ga0496118_0006001 | 3300048921 | Bacteria | 13546 |
| 738 | Ga0496118_0006959 | 3300048921 | Bacteria | 12214 |
| 739 | Ga0496118_0028333 | 3300048921 | Bacteria | 4719 |
| 740 | Ga0496119_0000043 | 3300048922 | Bacteria | 192373 |
| 741 | Ga0496119_0000062 | 3300048922 | Bacteria | 171150 |
| 742 | Ga0496119_0000659 | 3300048922 | Bacteria | 46235 |
| 743 | Ga0496119_0000910 | 3300048922 | Bacteria | 38340 |
| 744 | Ga0496119_0000951 | 3300048922 | Bacteria | 37280 |
| 745 | Ga0496119_0001545 | 3300048922 | Bacteria | 27501 |
| 746 | Ga0496119_0002495 | 3300048922 | Bacteria | 20119 |
| 747 | Ga0496119_0002997 | 3300048922 | Bacteria | 17911 |
| 748 | Ga0496120_0000009 | 3300048923 | Bacteria | 386727 |
| 749 | Ga0496120_0000217 | 3300048923 | Bacteria | 99402 |
| 750 | Ga0496120_0000276 | 3300048923 | Bacteria | 86130 |
| 751 | Ga0496120_0000429 | 3300048923 | Bacteria | 66724 |
| 752 | Ga0496120_0000522 | 3300048923 | Bacteria | 59462 |
| 753 | Ga0496120_0000703 | 3300048923 | Bacteria | 49030 |
| 754 | Ga0496120_0000985 | 3300048923 | Bacteria | 38684 |
| 755 | Ga0496120_0005573 | 3300048923 | Bacteria | 10003 |
| 756 | Ga0496120_0008451 | 3300048923 | Bacteria | 7470 |
| 757 | Ga0496121_0000129 | 3300048924 | Bacteria | 168148 |
| 758 | Ga0496121_0000131 | 3300048924 | Bacteria | 167955 |
| 759 | Ga0496121_0002191 | 3300048924 | Bacteria | 30572 |
| 760 | Ga0496121_0007699 | 3300048924 | Bacteria | 12930 |
| 761 | Ga0496121_0049366 | 3300048924 | Bacteria | 3568 |
| 762 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 763 | Ga0496122_0000026 | 3300048925 | Bacteria | 360871 |
| 764 | Ga0496122_0000372 | 3300048925 | Bacteria | 96314 |
| 765 | Ga0496122_0000520 | 3300048925 | Bacteria | 79579 |
| 766 | Ga0496122_0003581 | 3300048925 | Bacteria | 20271 |
| 767 | Ga0496122_0004029 | 3300048925 | Bacteria | 18674 |
| 768 | Ga0496122_0004100 | 3300048925 | Bacteria | 18458 |
| 769 | Ga0496122_0009940 | 3300048925 | Bacteria | 9909 |
| 770 | Ga0496122_0012371 | 3300048925 | Bacteria | 8510 |
| 771 | Ga0496122_0012404 | 3300048925 | Bacteria | 8488 |
| 772 | Ga0496122_0014998 | 3300048925 | Bacteria | 7445 |
| 773 | Ga0496122_0026581 | 3300048925 | Bacteria | 4981 |
| 774 | Ga0496122_0029135 | 3300048925 | Bacteria | 4664 |
| 775 | Ga0496122_0033596 | 3300048925 | Bacteria | 4215 |
| 776 | Ga0496122_0035824 | 3300048925 | Bacteria | 4028 |
| 777 | Ga0496122_0049165 | 3300048925 | Bacteria | 3233 |
| 778 | Ga0496123_0000005 | 3300048926 | Bacteria | 658131 |
| 779 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 780 | Ga0496123_0000152 | 3300048926 | Bacteria | 140376 |
| 781 | Ga0496123_0000651 | 3300048926 | Bacteria | 57756 |
| 782 | Ga0496123_0000759 | 3300048926 | Bacteria | 52224 |
| 783 | Ga0496123_0000801 | 3300048926 | Bacteria | 50851 |
| 784 | Ga0496123_0001489 | 3300048926 | Bacteria | 32524 |
| 785 | Ga0496123_0002672 | 3300048926 | Bacteria | 21476 |
| 786 | Ga0496123_0003248 | 3300048926 | Bacteria | 18471 |
| 787 | Ga0496123_0003662 | 3300048926 | Bacteria | 16955 |
| 788 | Ga0496123_0009515 | 3300048926 | Bacteria | 8742 |
| 789 | Ga0496123_0009535 | 3300048926 | Bacteria | 8728 |
| 790 | Ga0496123_0009924 | 3300048926 | Bacteria | 8494 |
| 791 | Ga0496124_0000010 | 3300048927 | Bacteria | 595157 |
| 792 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 793 | Ga0496124_0000039 | 3300048927 | Bacteria | 307831 |
| 794 | Ga0496124_0000156 | 3300048927 | Bacteria | 137990 |
| 795 | Ga0496124_0000288 | 3300048927 | Bacteria | 95203 |
| 796 | Ga0496124_0000734 | 3300048927 | Bacteria | 53581 |
| 797 | Ga0496124_0000815 | 3300048927 | Bacteria | 50713 |
| 798 | Ga0496124_0001225 | 3300048927 | Bacteria | 39571 |
| 799 | Ga0496124_0002812 | 3300048927 | Bacteria | 22045 |
| 800 | Ga0496124_0009003 | 3300048927 | Bacteria | 10330 |
| 801 | Ga0496124_0013680 | 3300048927 | Bacteria | 7905 |
| 802 | Ga0496124_0020649 | 3300048927 | Bacteria | 6079 |
| 803 | Ga0496124_0027491 | 3300048927 | Bacteria | 5105 |
| 804 | Ga0496124_0042025 | 3300048927 | Bacteria | 3938 |
| 805 | Ga0496124_0074671 | 3300048927 | Bacteria | 2802 |
| 806 | Ga0496125_0000016 | 3300048928 | Bacteria | 512512 |
| 807 | Ga0496125_0000019 | 3300048928 | Bacteria | 474989 |
| 808 | Ga0496125_0014222 | 3300048928 | Bacteria | 7758 |
| 809 | Ga0496125_0014751 | 3300048928 | Bacteria | 7590 |
| 810 | Ga0496125_0016707 | 3300048928 | Bacteria | 7036 |
| 811 | Ga0496125_0063020 | 3300048928 | Bacteria | 2959 |
| 812 | Ga0496125_0063376 | 3300048928 | Bacteria | 2948 |
| 813 | Ga0496126_0000252 | 3300048929 | Bacteria | 115370 |
| 814 | Ga0496126_0001252 | 3300048929 | Bacteria | 41095 |
| 815 | Ga0496126_0013792 | 3300048929 | Bacteria | 8194 |
| 816 | Ga0496126_0018254 | 3300048929 | Bacteria | 6959 |
| 817 | Ga0496126_0023249 | 3300048929 | Bacteria | 6008 |
| 818 | Ga0496126_0057570 | 3300048929 | Bacteria | 3507 |
| 819 | Ga0495678_000388 | 3300049459 | Bacteria | 44393 |
| 820 | Ga0495678_004373 | 3300049459 | Bacteria | 8204 |
| 821 | Ga0495682_0000004 | 3300049460 | Bacteria | 378337 |
| 822 | Ga0495682_0000060 | 3300049460 | Bacteria | 102283 |
| 823 | Ga0495682_0002230 | 3300049460 | Bacteria | 9346 |
| 824 | Ga0501032_0000157 | 3300049569 | Bacteria | 55322 |
| 825 | Ga0501033_0000001 | 3300049570 | Bacteria | 795921 |
| 826 | Ga0501033_0008946 | 3300049570 | Bacteria | 7733 |
| 827 | Ga0501033_0009262 | 3300049570 | Bacteria | 7585 |
| 828 | Ga0501034_0000272 | 3300049571 | Bacteria | 93316 |
| 829 | Ga0501034_0002511 | 3300049571 | Bacteria | 22011 |
| 830 | Ga0501036_0003884 | 3300049572 | Bacteria | 11991 |
| 831 | Ga0501036_0019602 | 3300049572 | Bacteria | 5679 |
| 832 | Ga0501038_0003490 | 3300049574 | Bacteria | 14652 |
| 833 | Ga0501038_0004228 | 3300049574 | Bacteria | 13340 |
| 834 | Ga0501038_0051187 | 3300049574 | Bacteria | 3566 |
| 835 | Ga0501038_0057751 | 3300049574 | Bacteria | 3330 |
| 836 | Ga0501039_0005786 | 3300049575 | Bacteria | 9365 |
| 837 | Ga0501039_0008002 | 3300049575 | Bacteria | 8055 |
| 838 | Ga0501040_0000316 | 3300049576 | Bacteria | 28420 |
| 839 | Ga0501040_0002293 | 3300049576 | Bacteria | 12294 |
| 840 | Ga0501040_0056736 | 3300049576 | Bacteria | 2688 |
| 841 | Ga0501041_0000270 | 3300049577 | Bacteria | 24655 |
| 842 | Ga0501042_0003173 | 3300049578 | Bacteria | 10247 |
| 843 | Ga0501042_0064995 | 3300049578 | Bacteria | 2607 |
| 844 | Ga0501043_0009281 | 3300049579 | Bacteria | 7730 |
| 845 | Ga0501046_0000535 | 3300049580 | Bacteria | 37702 |
| 846 | Ga0501046_0029317 | 3300049580 | Bacteria | 4474 |
| 847 | Ga0501047_0032055 | 3300049581 | Bacteria | 5071 |
| 848 | Ga0501048_0000628 | 3300049582 | Bacteria | 25195 |
| 849 | Ga0501067_0009769 | 3300049583 | Bacteria | 5311 |
| 850 | Ga0501070_0036681 | 3300049586 | Bacteria | 4094 |
| 851 | Ga0501071_0009143 | 3300049587 | Bacteria | 6584 |
| 852 | Ga0501072_0054669 | 3300049588 | Bacteria | 3146 |
| 853 | Ga0501074_0007169 | 3300049590 | Bacteria | 8049 |
| 854 | Ga0501074_0008561 | 3300049590 | Bacteria | 7411 |
| 855 | Ga0501075_0000915 | 3300049591 | Bacteria | 18695 |
| 856 | Ga0501076_0001078 | 3300049592 | Bacteria | 17938 |
| 857 | Ga0501076_0004510 | 3300049592 | Bacteria | 9914 |
| 858 | Ga0501079_0001639 | 3300049741 | Bacteria | 15935 |
| 859 | Ga0501080_0013180 | 3300049742 | Bacteria | 7596 |
| 860 | Ga0501080_0052909 | 3300049742 | Bacteria | 3780 |
| 861 | Ga0501035_0066958 | 3300049822 | Bacteria | 3187 |
| 862 | Ga0501035_0115032 | 3300049822 | Bacteria | 2355 |
| 863 | Ga0501044_0000112 | 3300049823 | Bacteria | 98748 |
| 864 | Ga0501045_0014628 | 3300049824 | Bacteria | 5563 |
| 865 | Ga0501226_000015 | 3300049853 | Bacteria | 164151 |
| 866 | nmdc:mga05p37_5151_c1 | 3300050507 | Bacteria | 15316 |
| 867 | nmdc:mga09592_5031_c1 | 3300050508 | Bacteria | 10722 |
| 868 | nmdc:mga08y16_114963_c1 | 3300050511 | Bacteria | 2802 |
| 869 | nmdc:mga0n895_6315_c1 | 3300050512 | Bacteria | 10049 |
| 870 | nmdc:mga0rr50_381_c1 | 3300050513 | Bacteria | 24264 |
| 871 | nmdc:mga08x19_2762_c1 | 3300050514 | Bacteria | 10593 |
| 872 | nmdc:mga0a205_93_c2 | 3300050515 | Bacteria | 37118 |
| 873 | Ga0500650_0000015 | 3300053098 | Bacteria | 71164 |
| 874 | Ga0500556_0003696 | 3300053104 | Bacteria | 4445 |
| 875 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 876 | Ga0500616_0001434 | 3300053153 | Bacteria | 22892 |
| 877 | Ga0500622_0000023 | 3300053156 | Bacteria | 251170 |
| 878 | Ga0500634_0025602 | 3300053161 | Bacteria | 3211 |
| 879 | Ga0590071_005517 | 3300059421 | Bacteria | 3039 |
| 880 | Ga0501082_0002945 | 3300060353 | Bacteria | 14859 |
| 881 | Ga0530510_0000092 | 3300061734 | Bacteria | 48492 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042013 | Ga0439456_008211 | Ga0439456_008211_14_1594 | 491 |
| 2 | 3300038735 | Ga0400485_19597 | Ga0400485_19597_2088_3656 | 505 |
| 3 | 3300049574 | Ga0501038_0051187 | Ga0501038_0051187_16_1560 | 509 |
| 4 | iso_pu_bacteria | 2554235132 | 2554816125 | 516 |
| 5 | iso_pu_bacteria | 2909399089 | 2909401966 | 522 |
| 6 | iso_pu_bacteria | 2887630918 | 2887631509 | 564 |
| 7 | 3300046794 | Ga0495589_0009905 | Ga0495589_0009905_24_1835 | 574 |
| 8 | 3300045051 | Ga0451576_0098624 | Ga0451576_0098624_116_1954 | 577 |
| 9 | 3300049570 | Ga0501033_0009262 | Ga0501033_0009262_3474_5327 | 578 |
| 10 | 3300039062 | Ga0400483_178744 | Ga0400483_178744_19_1854 | 579 |
| 11 | 3300035398 | Ga0316574_0005934 | Ga0316574_0005934_4649_6508 | 581 |
| 12 | 3300041456 | Ga0451795_1536678 | Ga0451795_1536678_326_2227 | 583 |
| 13 | 3300047470 | Ga0495681_0054310 | Ga0495681_0054310_17_1828 | 583 |
| 14 | 3300003320 | rootH2_10003079 | rootH2_100030794 | 585 |
| 15 | 3300049574 | Ga0501038_0003490 | Ga0501038_0003490_8021_9865 | 585 |
| 16 | 3300049583 | Ga0501067_0009769 | Ga0501067_0009769_2140_3984 | 585 |
| 17 | 3300003323 | rootH1_10089918 | rootH1_1008991811 | 589 |
| 18 | 3300005547 | Ga0070693_100015123 | Ga0070693_1000151231 | 589 |
| 19 | 3300005344 | Ga0070661_100000397 | Ga0070661_10000039722 | 590 |
| 20 | 3300005366 | Ga0070659_100023292 | Ga0070659_1000232922 | 590 |
| 21 | 3300025920 | Ga0207649_10000113 | Ga0207649_1000011338 | 590 |
| 22 | 3300025932 | Ga0207690_10014624 | Ga0207690_100146244 | 590 |
| 23 | 3300002155 | JGI24033J26618_1000010 | JGI24033J26618_100001026 | 592 |
| 24 | 3300005456 | Ga0070678_100025488 | Ga0070678_1000254882 | 592 |
| 25 | 3300036712 | Ga0316584_0075252 | Ga0316584_0075252_531_2429 | 592 |
| 26 | 3300009093 | Ga0105240_10000056 | Ga0105240_1000005616 | 593 |
| 27 | 3300025913 | Ga0207695_10000103 | Ga0207695_1000010316 | 593 |
| 28 | 3300041405 | Ga0439438_000001 | Ga0439438_000001_15181_17055 | 593 |
| 29 | 3300041407 | Ga0439447_011386 | Ga0439447_011386_560_2434 | 593 |
| 30 | 3300046507 | Ga0495606_0009605 | Ga0495606_0009605_3122_4903 | 593 |
| 31 | 3300025728 | Ga0207655_1000023 | Ga0207655_1000023279 | 594 |
| 32 | 3300031548 | Ga0307408_100004612 | Ga0307408_1000046126 | 594 |
| 33 | 3300046458 | Ga0495591_002420 | Ga0495591_002420_5457_7331 | 594 |
| 34 | 3300046471 | Ga0495650_0000033 | Ga0495650_0000033_262340_264214 | 594 |
| 35 | 3300046474 | Ga0495605_0015583 | Ga0495605_0015583_2199_4073 | 594 |
| 36 | 3300046507 | Ga0495606_0000627 | Ga0495606_0000627_16437_18311 | 594 |
| 37 | 3300046523 | Ga0495644_0000325 | Ga0495644_0000325_12174_14048 | 594 |
| 38 | 3300046524 | Ga0495648_0002784 | Ga0495648_0002784_3850_5724 | 594 |
| 39 | 3300046530 | Ga0495654_0000020 | Ga0495654_0000020_142685_144559 | 594 |
| 40 | 3300046692 | Ga0495671_0002439 | Ga0495671_0002439_6925_8799 | 594 |
| 41 | 3300046692 | Ga0495671_0014193 | Ga0495671_0014193_2496_4283 | 594 |
| 42 | 3300046810 | Ga0495660_0000011 | Ga0495660_0000011_111921_113795 | 594 |
| 43 | 3300047320 | Ga0495672_0000004 | Ga0495672_0000004_422865_424739 | 594 |
| 44 | 3300047469 | Ga0495673_0000023 | Ga0495673_0000023_376040_377914 | 594 |
| 45 | 3300049459 | Ga0495678_000388 | Ga0495678_000388_9228_11102 | 594 |
| 46 | 3300049460 | Ga0495682_0000004 | Ga0495682_0000004_149000_150874 | 594 |
| 47 | 3300053126 | Ga0500621_000001 | Ga0500621_000001_207000_208874 | 594 |
| 48 | 3300009036 | Ga0105244_10000048 | Ga0105244_1000004840 | 596 |
| 49 | 3300013104 | Ga0157370_10003461 | Ga0157370_1000346118 | 596 |
| 50 | 3300048919 | Ga0496116_0002239 | Ga0496116_0002239_727_2601 | 596 |
| 51 | 3300048923 | Ga0496120_0000429 | Ga0496120_0000429_18795_20669 | 596 |
| 52 | 3300048927 | Ga0496124_0013680 | Ga0496124_0013680_671_2545 | 596 |
| 53 | 3300048927 | Ga0496124_0042025 | Ga0496124_0042025_1728_3656 | 596 |
| 54 | 3300005289 | Ga0065704_10000433 | Ga0065704_1000043317 | 597 |
| 55 | 3300005366 | Ga0070659_100029597 | Ga0070659_1000295973 | 597 |
| 56 | 3300005548 | Ga0070665_100001125 | Ga0070665_1000011252 | 597 |
| 57 | 3300006051 | Ga0075364_10006248 | Ga0075364_100062484 | 597 |
| 58 | 3300006195 | Ga0075366_10010412 | Ga0075366_100104123 | 597 |
| 59 | 3300006946 | Ga0079104_1013362 | Ga0079104_10133622 | 597 |
| 60 | 3300013104 | Ga0157370_10001697 | Ga0157370_100016972 | 597 |
| 61 | 3300027111 | Ga0209281_1006480 | Ga0209281_10064803 | 597 |
| 62 | 3300027312 | Ga0209371_1000001 | Ga0209371_1000001186 | 597 |
| 63 | 3300028379 | Ga0268266_10000084 | Ga0268266_10000084129 | 597 |
| 64 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000012455 | 597 |
| 65 | 3300041512 | Ga0451853_1183803 | Ga0451853_1183803_2540_4414 | 597 |
| 66 | 3300042010 | Ga0439452_000033 | Ga0439452_000033_83298_85172 | 597 |
| 67 | 3300046471 | Ga0495650_0000175 | Ga0495650_0000175_83651_85525 | 597 |
| 68 | 3300046515 | Ga0495620_0000263 | Ga0495620_0000263_30_1868 | 597 |
| 69 | 3300048920 | Ga0496117_0011702 | Ga0496117_0011702_12_1805 | 597 |
| 70 | 3300048920 | Ga0496117_0019385 | Ga0496117_0019385_39_1913 | 597 |
| 71 | 3300048921 | Ga0496118_0002663 | Ga0496118_0002663_1066_2940 | 597 |
| 72 | 3300048924 | Ga0496121_0002191 | Ga0496121_0002191_25606_27480 | 597 |
| 73 | 3300048925 | Ga0496122_0003581 | Ga0496122_0003581_12599_14473 | 597 |
| 74 | 3300048925 | Ga0496122_0029135 | Ga0496122_0029135_2860_4653 | 597 |
| 75 | 3300048926 | Ga0496123_0000759 | Ga0496123_0000759_3094_4968 | 597 |
| 76 | 3300001989 | JGI24739J22299_10004581 | JGI24739J22299_100045814 | 598 |
| 77 | 3300005289 | Ga0065704_10008060 | Ga0065704_100080601 | 598 |
| 78 | 3300005289 | Ga0065704_10092388 | Ga0065704_100923882 | 598 |
| 79 | 3300005335 | Ga0070666_10034651 | Ga0070666_100346512 | 598 |
| 80 | 3300005577 | Ga0068857_100000003 | Ga0068857_10000000385 | 598 |
| 81 | 3300005844 | Ga0068862_100001883 | Ga0068862_10000188313 | 598 |
| 82 | 3300006946 | Ga0079104_1000220 | Ga0079104_100022040 | 598 |
| 83 | 3300006946 | Ga0079104_1009896 | Ga0079104_10098962 | 598 |
| 84 | 3300009011 | Ga0105251_10002616 | Ga0105251_1000261611 | 598 |
| 85 | 3300009036 | Ga0105244_10000414 | Ga0105244_1000041438 | 598 |
| 86 | 3300013102 | Ga0157371_10002463 | Ga0157371_1000246313 | 598 |
| 87 | 3300013104 | Ga0157370_10000557 | Ga0157370_1000055730 | 598 |
| 88 | 3300015679 | Ga0183366_1001 | Ga0183366_1001229 | 598 |
| 89 | 3300015680 | Ga0183370_1001 | Ga0183370_1001229 | 598 |
| 90 | 3300015685 | Ga0183369_1001 | Ga0183369_1001229 | 598 |
| 91 | 3300015687 | Ga0183368_1001 | Ga0183368_1001229 | 598 |
| 92 | 3300025711 | Ga0207696_1009429 | Ga0207696_10094292 | 598 |
| 93 | 3300025728 | Ga0207655_1000029 | Ga0207655_1000029210 | 598 |
| 94 | 3300025728 | Ga0207655_1000087 | Ga0207655_1000087195 | 598 |
| 95 | 3300025728 | Ga0207655_1006562 | Ga0207655_10065624 | 598 |
| 96 | 3300025728 | Ga0207655_1023472 | Ga0207655_10234723 | 598 |
| 97 | 3300025735 | Ga0207713_1013546 | Ga0207713_10135461 | 598 |
| 98 | 3300025941 | Ga0207711_10006103 | Ga0207711_100061039 | 598 |
| 99 | 3300026116 | Ga0207674_10000043 | Ga0207674_1000004385 | 598 |
| 100 | 3300027111 | Ga0209281_1000001 | Ga0209281_10000011659 | 598 |
| 101 | 3300027111 | Ga0209281_1000075 | Ga0209281_100007567 | 598 |
| 102 | 3300027111 | Ga0209281_1000335 | Ga0209281_100033563 | 598 |
| 103 | 3300027312 | Ga0209371_1010515 | Ga0209371_10105152 | 598 |
| 104 | 3300028379 | Ga0268266_10004969 | Ga0268266_1000496911 | 598 |
| 105 | 3300028380 | Ga0268265_10000783 | Ga0268265_1000078320 | 598 |
| 106 | 3300030500 | Ga0268256_1000824 | Ga0268256_10008242 | 598 |
| 107 | 3300042010 | Ga0439452_000017 | Ga0439452_000017_207637_209511 | 598 |
| 108 | 3300048919 | Ga0496116_0000505 | Ga0496116_0000505_35426_37300 | 598 |
| 109 | 3300048920 | Ga0496117_0000212 | Ga0496117_0000212_51514_53388 | 598 |
| 110 | 3300048921 | Ga0496118_0006001 | Ga0496118_0006001_4186_6060 | 598 |
| 111 | 3300048922 | Ga0496119_0002495 | Ga0496119_0002495_10706_12580 | 598 |
| 112 | 3300048923 | Ga0496120_0000703 | Ga0496120_0000703_39503_41377 | 598 |
| 113 | 3300048927 | Ga0496124_0020649 | Ga0496124_0020649_720_2594 | 598 |
| 114 | 3300048927 | Ga0496124_0074671 | Ga0496124_0074671_583_2520 | 598 |
| 115 | 3300048929 | Ga0496126_0001252 | Ga0496126_0001252_37412_39286 | 598 |
| 116 | 3300005289 | Ga0065704_10000891 | Ga0065704_100008911 | 599 |
| 117 | 3300005331 | Ga0070670_100000018 | Ga0070670_10000001829 | 599 |
| 118 | 3300005367 | Ga0070667_100000021 | Ga0070667_100000021175 | 599 |
| 119 | 3300005466 | Ga0070685_10000003 | Ga0070685_10000003142 | 599 |
| 120 | 3300005618 | Ga0068864_100000002 | Ga0068864_100000002514 | 599 |
| 121 | 3300005843 | Ga0068860_100001060 | Ga0068860_1000010607 | 599 |
| 122 | 3300006051 | Ga0075364_10000229 | Ga0075364_100002294 | 599 |
| 123 | 3300006946 | Ga0079104_1002095 | Ga0079104_100209510 | 599 |
| 124 | 3300009011 | Ga0105251_10000983 | Ga0105251_100009834 | 599 |
| 125 | 3300009036 | Ga0105244_10000087 | Ga0105244_1000008736 | 599 |
| 126 | 3300014325 | Ga0163163_10000634 | Ga0163163_1000063426 | 599 |
| 127 | 3300025711 | Ga0207696_1007690 | Ga0207696_10076902 | 599 |
| 128 | 3300025728 | Ga0207655_1000001 | Ga0207655_1000001206 | 599 |
| 129 | 3300025728 | Ga0207655_1000206 | Ga0207655_100020662 | 599 |
| 130 | 3300025735 | Ga0207713_1000021 | Ga0207713_1000021264 | 599 |
| 131 | 3300025735 | Ga0207713_1006626 | Ga0207713_10066264 | 599 |
| 132 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002508 | 599 |
| 133 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001844 | 599 |
| 134 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001508 | 599 |
| 135 | 3300027111 | Ga0209281_1000021 | Ga0209281_1000021321 | 599 |
| 136 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004515 | 599 |
| 137 | 3300046458 | Ga0495591_000011 | Ga0495591_000011_32612_34486 | 599 |
| 138 | 3300047469 | Ga0495673_0000529 | Ga0495673_0000529_3456_5330 | 599 |
| 139 | 3300048925 | Ga0496122_0000026 | Ga0496122_0000026_302389_304263 | 599 |
| 140 | 3300048926 | Ga0496123_0000005 | Ga0496123_0000005_602704_604578 | 599 |
| 141 | 3300049574 | Ga0501038_0057751 | Ga0501038_0057751_1225_3183 | 599 |
| 142 | 3300049586 | Ga0501070_0036681 | Ga0501070_0036681_1213_3171 | 599 |
| 143 | 3300049590 | Ga0501074_0007169 | Ga0501074_0007169_3313_5271 | 599 |
| 144 | 3300049742 | Ga0501080_0013180 | Ga0501080_0013180_696_2654 | 599 |
| 145 | 3300003320 | rootH2_10040819 | rootH2_1004081920 | 600 |
| 146 | 3300005937 | Ga0081455_10078333 | Ga0081455_100783332 | 600 |
| 147 | 3300009036 | Ga0105244_10009517 | Ga0105244_100095172 | 600 |
| 148 | 3300009092 | Ga0105250_10000044 | Ga0105250_1000004441 | 600 |
| 149 | 3300021388 | Ga0213875_10018256 | Ga0213875_100182563 | 600 |
| 150 | 3300025711 | Ga0207696_1000003 | Ga0207696_1000003305 | 600 |
| 151 | 3300027312 | Ga0209371_1009424 | Ga0209371_10094242 | 600 |
| 152 | 3300030500 | Ga0268256_1009255 | Ga0268256_10092553 | 600 |
| 153 | 3300031251 | Ga0265327_10000333 | Ga0265327_1000033339 | 600 |
| 154 | 3300037853 | Ga0436364_0455618 | Ga0436364_0455618_5839_7662 | 600 |
| 155 | 3300044669 | Ga0466981_0000006 | Ga0466981_0000006_104577_106451 | 600 |
| 156 | 3300048926 | Ga0496123_0000801 | Ga0496123_0000801_5916_7790 | 600 |
| 157 | 3300048928 | Ga0496125_0000016 | Ga0496125_0000016_472333_474207 | 600 |
| 158 | 3300049570 | Ga0501033_0008946 | Ga0501033_0008946_4854_6683 | 600 |
| 159 | 3300053104 | Ga0500556_0003696 | Ga0500556_0003696_2237_4063 | 600 |
| 160 | 3300013306 | Ga0163162_10037377 | Ga0163162_100373772 | 601 |
| 161 | 3300042115 | Ga0450911_000013 | Ga0450911_000013_43282_45204 | 601 |
| 162 | 3300049853 | Ga0501226_000015 | Ga0501226_000015_104160_106082 | 601 |
| 163 | 3300003320 | rootH2_10068438 | rootH2_100684382 | 602 |
| 164 | 3300003323 | rootH1_10005050 | rootH1_1000505019 | 602 |
| 165 | 3300009011 | Ga0105251_10000812 | Ga0105251_1000081223 | 602 |
| 166 | 3300009148 | Ga0105243_10002042 | Ga0105243_100020427 | 602 |
| 167 | 3300013297 | Ga0157378_10021057 | Ga0157378_100210574 | 602 |
| 168 | 3300025728 | Ga0207655_1007706 | Ga0207655_10077064 | 602 |
| 169 | 3300025735 | Ga0207713_1000005 | Ga0207713_1000005453 | 602 |
| 170 | 3300025735 | Ga0207713_1000006 | Ga0207713_100000638 | 602 |
| 171 | 3300025935 | Ga0207709_10003606 | Ga0207709_100036063 | 602 |
| 172 | 3300027312 | Ga0209371_1001253 | Ga0209371_100125312 | 602 |
| 173 | 3300030500 | Ga0268256_1001063 | Ga0268256_10010636 | 602 |
| 174 | 3300032133 | Ga0316583_10005959 | Ga0316583_100059594 | 602 |
| 175 | 3300033529 | Ga0316587_1001710 | Ga0316587_10017103 | 602 |
| 176 | 3300033541 | Ga0316596_1005926 | Ga0316596_10059261 | 602 |
| 177 | 3300036647 | Ga0316582_0001994 | Ga0316582_0001994_2066_3964 | 602 |
| 178 | 3300036712 | Ga0316584_0000428 | Ga0316584_0000428_7182_9080 | 602 |
| 179 | 3300049569 | Ga0501032_0000157 | Ga0501032_0000157_602_2446 | 602 |
| 180 | 3300049570 | Ga0501033_0000001 | Ga0501033_0000001_232908_234752 | 602 |
| 181 | 2162886007 | SwRhRL2b_contig_1225512 | SwRhRL2b_0798.00005230 | 603 |
| 182 | 3300003856 | Ga0058692_1005261 | Ga0058692_10052611 | 603 |
| 183 | 3300005327 | Ga0070658_10004873 | Ga0070658_100048734 | 603 |
| 184 | 3300005355 | Ga0070671_100000028 | Ga0070671_10000002827 | 603 |
| 185 | 3300005563 | Ga0068855_100003289 | Ga0068855_1000032895 | 603 |
| 186 | 3300009036 | Ga0105244_10000298 | Ga0105244_1000029826 | 603 |
| 187 | 3300009036 | Ga0105244_10004360 | Ga0105244_100043606 | 603 |
| 188 | 3300009545 | Ga0105237_10012539 | Ga0105237_100125393 | 603 |
| 189 | 3300025728 | Ga0207655_1000042 | Ga0207655_100004216 | 603 |
| 190 | 3300025909 | Ga0207705_10039053 | Ga0207705_100390531 | 603 |
| 191 | 3300025914 | Ga0207671_10043184 | Ga0207671_100431842 | 603 |
| 192 | 3300025949 | Ga0207667_10006477 | Ga0207667_100064776 | 603 |
| 193 | 3300038726 | Ga0400490_04080 | Ga0400490_04080_37_1917 | 603 |
| 194 | 3300046471 | Ga0495650_0000016 | Ga0495650_0000016_405810_407675 | 603 |
| 195 | 3300046522 | Ga0495643_0000062 | Ga0495643_0000062_170457_172292 | 603 |
| 196 | 3300046810 | Ga0495660_0000007 | Ga0495660_0000007_336399_338264 | 603 |
| 197 | 3300048907 | Ga0496104_0000592 | Ga0496104_0000592_14975_16840 | 603 |
| 198 | 3300048919 | Ga0496116_0000054 | Ga0496116_0000054_109951_111816 | 603 |
| 199 | 3300048920 | Ga0496117_0011783 | Ga0496117_0011783_4773_6638 | 603 |
| 200 | 3300048921 | Ga0496118_0001321 | Ga0496118_0001321_24236_26101 | 603 |
| 201 | 3300048923 | Ga0496120_0008451 | Ga0496120_0008451_4906_6771 | 603 |
| 202 | 3300048925 | Ga0496122_0000013 | Ga0496122_0000013_384197_386062 | 603 |
| 203 | 3300048926 | Ga0496123_0000010 | Ga0496123_0000010_114978_116843 | 603 |
| 204 | 3300048927 | Ga0496124_0000010 | Ga0496124_0000010_167672_169537 | 603 |
| 205 | 3300048927 | Ga0496124_0000288 | Ga0496124_0000288_29643_31517 | 603 |
| 206 | 3300048928 | Ga0496125_0000019 | Ga0496125_0000019_326016_327881 | 603 |
| 207 | 3300048929 | Ga0496126_0000252 | Ga0496126_0000252_52621_54486 | 603 |
| 208 | 3300053153 | Ga0500616_0001434 | Ga0500616_0001434_17486_19339 | 603 |
| 209 | iso_pu_bacteria | 2829745981 | 2829748077 | 603 |
| 210 | iso_pu_bacteria | 643348555 | 643389984 | 603 |
| 211 | 3300005844 | Ga0068862_100108037 | Ga0068862_1001080372 | 604 |
| 212 | 3300006946 | Ga0079104_1000248 | Ga0079104_100024849 | 604 |
| 213 | 3300006946 | Ga0079104_1001748 | Ga0079104_100174811 | 604 |
| 214 | 3300027111 | Ga0209281_1000041 | Ga0209281_100004160 | 604 |
| 215 | 3300027312 | Ga0209371_1003799 | Ga0209371_10037996 | 604 |
| 216 | 3300030500 | Ga0268256_1007719 | Ga0268256_10077191 | 604 |
| 217 | 3300031548 | Ga0307408_100000411 | Ga0307408_1000004112 | 604 |
| 218 | 3300031665 | Ga0316575_10001442 | Ga0316575_100014427 | 604 |
| 219 | 3300031727 | Ga0316576_10001557 | Ga0316576_100015574 | 604 |
| 220 | 3300031728 | Ga0316578_10001181 | Ga0316578_100011814 | 604 |
| 221 | 3300031733 | Ga0316577_10000094 | Ga0316577_1000009416 | 604 |
| 222 | 3300031901 | Ga0307406_10003868 | Ga0307406_100038686 | 604 |
| 223 | 3300036712 | Ga0316584_0004523 | Ga0316584_0004523_6070_7989 | 604 |
| 224 | 3300046694 | Ga0495649_0001266 | Ga0495649_0001266_9721_11595 | 604 |
| 225 | 3300002737 | JGI25162J39368_1000003 | JGI25162J39368_1000003271 | 605 |
| 226 | 3300002771 | JGI25163J39215_1000015 | JGI25163J39215_100001558 | 605 |
| 227 | 3300002772 | JGI25164J39214_1000009 | JGI25164J39214_100000919 | 605 |
| 228 | 3300003751 | Ga0055538_1000005 | Ga0055538_1000005271 | 605 |
| 229 | 3300003752 | Ga0055539_1000007 | Ga0055539_1000007271 | 605 |
| 230 | 3300003756 | Ga0055533_1000009 | Ga0055533_1000009271 | 605 |
| 231 | 3300003759 | Ga0055525_1000010 | Ga0055525_1000010271 | 605 |
| 232 | 3300003841 | Ga0055541_1000005 | Ga0055541_1000005293 | 605 |
| 233 | 3300005289 | Ga0065704_10000446 | Ga0065704_100004467 | 605 |
| 234 | 3300005327 | Ga0070658_10020102 | Ga0070658_100201022 | 605 |
| 235 | 3300005539 | Ga0068853_100000005 | Ga0068853_10000000531 | 605 |
| 236 | 3300005616 | Ga0068852_100001192 | Ga0068852_1000011924 | 605 |
| 237 | 3300005834 | Ga0068851_10000587 | Ga0068851_100005874 | 605 |
| 238 | 3300006946 | Ga0079104_1000111 | Ga0079104_100011168 | 605 |
| 239 | 3300013296 | Ga0157374_10060607 | Ga0157374_100606073 | 605 |
| 240 | 3300025207 | Ga0209760_100057 | Ga0209760_10005732 | 605 |
| 241 | 3300025224 | Ga0209784_100001 | Ga0209784_100001814 | 605 |
| 242 | 3300025225 | Ga0209566_100001 | Ga0209566_100001814 | 605 |
| 243 | 3300025226 | Ga0209674_100002 | Ga0209674_100002814 | 605 |
| 244 | 3300025230 | Ga0209563_100008 | Ga0209563_100008817 | 605 |
| 245 | 3300025231 | Ga0207427_100002 | Ga0207427_100002461 | 605 |
| 246 | 3300025233 | Ga0209437_100007 | Ga0209437_100007269 | 605 |
| 247 | 3300025253 | Ga0209677_100004 | Ga0209677_100004817 | 605 |
| 248 | 3300025261 | Ga0209233_1001387 | Ga0209233_10013876 | 605 |
| 249 | 3300025321 | Ga0207656_10014464 | Ga0207656_100144644 | 605 |
| 250 | 3300025711 | Ga0207696_1000247 | Ga0207696_100024756 | 605 |
| 251 | 3300025728 | Ga0207655_1000496 | Ga0207655_100049626 | 605 |
| 252 | 3300025909 | Ga0207705_10025061 | Ga0207705_100250613 | 605 |
| 253 | 3300026041 | Ga0207639_10000010 | Ga0207639_10000010265 | 605 |
| 254 | 3300026118 | Ga0207675_100044530 | Ga0207675_1000445302 | 605 |
| 255 | 3300027111 | Ga0209281_1000079 | Ga0209281_100007968 | 605 |
| 256 | 3300041404 | Ga0439436_0000430 | Ga0439436_0000430_7863_9761 | 605 |
| 257 | 3300041411 | Ga0439466_0001695 | Ga0439466_0001695_6270_8168 | 605 |
| 258 | iso_pu_bacteria | 2861691609 | 2861694999 | 605 |
| 259 | 3300021384 | Ga0213876_10000025 | Ga0213876_10000025222 | 606 |
| 260 | 3300027312 | Ga0209371_1000303 | Ga0209371_10003032 | 606 |
| 261 | 3300030500 | Ga0268256_1000017 | Ga0268256_1000017330 | 606 |
| 262 | 3300039437 | Ga0436365_1279401 | Ga0436365_1279401_288335_290209 | 606 |
| 263 | 3300048925 | Ga0496122_0000520 | Ga0496122_0000520_24357_26231 | 606 |
| 264 | 3300048926 | Ga0496123_0000152 | Ga0496123_0000152_56812_58686 | 606 |
| 265 | 3300015261 | Ga0182006_1000020 | Ga0182006_1000020183 | 607 |
| 266 | 3300041405 | Ga0439438_006601 | Ga0439438_006601_396_2270 | 607 |
| 267 | 3300042010 | Ga0439452_000003 | Ga0439452_000003_755955_757829 | 607 |
| 268 | 3300049580 | Ga0501046_0029317 | Ga0501046_0029317_724_2622 | 607 |
| 269 | 3300002773 | JGI25152J39213_1000407 | JGI25152J39213_100040730 | 609 |
| 270 | 3300002774 | JGI25150J39212_1000372 | JGI25150J39212_100037225 | 609 |
| 271 | 3300003187 | JGI25151J46595_10000558 | JGI25151J46595_1000055827 | 609 |
| 272 | 3300003215 | JGI25153J46596_10000334 | JGI25153J46596_1000033427 | 609 |
| 273 | 3300005289 | Ga0065704_10080471 | Ga0065704_100804711 | 609 |
| 274 | 3300025245 | Ga0207425_1000030 | Ga0207425_10000301 | 609 |
| 275 | 3300025258 | Ga0209129_1000597 | Ga0209129_100059726 | 609 |
| 276 | 3300025294 | Ga0209025_1000054 | Ga0209025_1000054260 | 609 |
| 277 | 3300025297 | Ga0209758_1000062 | Ga0209758_1000062260 | 609 |
| 278 | 3300039062 | Ga0400483_009065 | Ga0400483_009065_3234_5135 | 609 |
| 279 | 3300039062 | Ga0400483_259219 | Ga0400483_259219_2801_4702 | 609 |
| 280 | 3300039437 | Ga0436365_1440570 | Ga0436365_1440570_60_1934 | 609 |
| 281 | 3300046492 | Ga0495585_0003927 | Ga0495585_0003927_3811_5718 | 609 |
| 282 | 3300046665 | Ga0495661_0000092 | Ga0495661_0000092_4878_6785 | 609 |
| 283 | 3300049578 | Ga0501042_0003173 | Ga0501042_0003173_4692_6566 | 609 |
| 284 | iso_pu_bacteria | 641228493 | 641336185 | 609 |
| 285 | 3300002773 | JGI25152J39213_1003100 | JGI25152J39213_10031002 | 610 |
| 286 | 3300003856 | Ga0058692_1000006 | Ga0058692_1000006305 | 610 |
| 287 | 3300005289 | Ga0065704_10070423 | Ga0065704_100704233 | 610 |
| 288 | 3300005330 | Ga0070690_100066841 | Ga0070690_1000668411 | 610 |
| 289 | 3300005331 | Ga0070670_100009488 | Ga0070670_1000094883 | 610 |
| 290 | 3300005546 | Ga0070696_100002012 | Ga0070696_10000201211 | 610 |
| 291 | 3300005617 | Ga0068859_100134273 | Ga0068859_1001342732 | 610 |
| 292 | 3300005843 | Ga0068860_100030311 | Ga0068860_1000303111 | 610 |
| 293 | 3300006852 | Ga0075433_10003117 | Ga0075433_100031173 | 610 |
| 294 | 3300006871 | Ga0075434_100011855 | Ga0075434_1000118558 | 610 |
| 295 | 3300006914 | Ga0075436_100001687 | Ga0075436_1000016877 | 610 |
| 296 | 3300006931 | Ga0097620_100134269 | Ga0097620_1001342692 | 610 |
| 297 | 3300007076 | Ga0075435_100001908 | Ga0075435_10000190810 | 610 |
| 298 | 3300009011 | Ga0105251_10015617 | Ga0105251_100156173 | 610 |
| 299 | 3300009094 | Ga0111539_10104260 | Ga0111539_101042603 | 610 |
| 300 | 3300025258 | Ga0209129_1000015 | Ga0209129_1000015209 | 610 |
| 301 | 3300025735 | Ga0207713_1007860 | Ga0207713_10078603 | 610 |
| 302 | 3300027312 | Ga0209371_1000010 | Ga0209371_1000010689 | 610 |
| 303 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016302 | 610 |
| 304 | 3300027312 | Ga0209371_1000026 | Ga0209371_1000026247 | 610 |
| 305 | 3300027312 | Ga0209371_1001062 | Ga0209371_10010629 | 610 |
| 306 | 3300027312 | Ga0209371_1002424 | Ga0209371_100242411 | 610 |
| 307 | 3300030500 | Ga0268256_1000003 | Ga0268256_1000003247 | 610 |
| 308 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015268 | 610 |
| 309 | 3300030500 | Ga0268256_1000022 | Ga0268256_1000022176 | 610 |
| 310 | 3300030500 | Ga0268256_1000894 | Ga0268256_10008949 | 610 |
| 311 | 3300035691 | Ga0373931_0003470 | Ga0373931_0003470_393_2255 | 610 |
| 312 | 3300042010 | Ga0439452_000027 | Ga0439452_000027_65903_67777 | 610 |
| 313 | 3300042876 | Ga0451577_0072675 | Ga0451577_0072675_473_2317 | 610 |
| 314 | 3300045051 | Ga0451576_0027885 | Ga0451576_0027885_3562_5406 | 610 |
| 315 | 3300046694 | Ga0495649_0005413 | Ga0495649_0005413_1901_3808 | 610 |
| 316 | 3300048922 | Ga0496119_0002997 | Ga0496119_0002997_7040_8914 | 610 |
| 317 | 3300048927 | Ga0496124_0001225 | Ga0496124_0001225_4899_6773 | 610 |
| 318 | 3300048929 | Ga0496126_0023249 | Ga0496126_0023249_1312_3186 | 610 |
| 319 | 3300050512 | nmdc:mga0n895_6315_c1 | nmdc:mga0n895_6315_c1_6575_8437 | 610 |
| 320 | 3300050513 | nmdc:mga0rr50_381_c1 | nmdc:mga0rr50_381_c1_11200_13062 | 610 |
| 321 | 3300050514 | nmdc:mga08x19_2762_c1 | nmdc:mga08x19_2762_c1_8436_10298 | 610 |
| 322 | 3300050515 | nmdc:mga0a205_93_c2 | nmdc:mga0a205_93_c2_10267_12129 | 610 |
| 323 | 2162886007 | SwRhRL2b_contig_2054245 | SwRhRL2b_0024.00006900 | 611 |
| 324 | 3300005330 | Ga0070690_100000289 | Ga0070690_10000028922 | 611 |
| 325 | 3300005334 | Ga0068869_100000299 | Ga0068869_1000002995 | 611 |
| 326 | 3300005337 | Ga0070682_100002601 | Ga0070682_1000026014 | 611 |
| 327 | 3300005338 | Ga0068868_100000531 | Ga0068868_10000053122 | 611 |
| 328 | 3300005340 | Ga0070689_100006066 | Ga0070689_1000060664 | 611 |
| 329 | 3300005343 | Ga0070687_100000355 | Ga0070687_1000003553 | 611 |
| 330 | 3300005345 | Ga0070692_10002606 | Ga0070692_100026061 | 611 |
| 331 | 3300005438 | Ga0070701_10000387 | Ga0070701_1000038710 | 611 |
| 332 | 3300005440 | Ga0070705_100000472 | Ga0070705_1000004727 | 611 |
| 333 | 3300005441 | Ga0070700_100006031 | Ga0070700_1000060313 | 611 |
| 334 | 3300005444 | Ga0070694_100000249 | Ga0070694_10000024920 | 611 |
| 335 | 3300005459 | Ga0068867_100000430 | Ga0068867_1000004306 | 611 |
| 336 | 3300005539 | Ga0068853_100057280 | Ga0068853_1000572803 | 611 |
| 337 | 3300005544 | Ga0070686_100000392 | Ga0070686_10000039225 | 611 |
| 338 | 3300005545 | Ga0070695_100000185 | Ga0070695_1000001858 | 611 |
| 339 | 3300005546 | Ga0070696_100000519 | Ga0070696_10000051920 | 611 |
| 340 | 3300005547 | Ga0070693_100000135 | Ga0070693_10000013530 | 611 |
| 341 | 3300005563 | Ga0068855_100002231 | Ga0068855_1000022315 | 611 |
| 342 | 3300005578 | Ga0068854_100008537 | Ga0068854_1000085374 | 611 |
| 343 | 3300005615 | Ga0070702_100000557 | Ga0070702_10000055711 | 611 |
| 344 | 3300005617 | Ga0068859_100001399 | Ga0068859_1000013997 | 611 |
| 345 | 3300005718 | Ga0068866_10001440 | Ga0068866_100014402 | 611 |
| 346 | 3300005719 | Ga0068861_100001038 | Ga0068861_1000010381 | 611 |
| 347 | 3300005842 | Ga0068858_100010152 | Ga0068858_1000101524 | 611 |
| 348 | 3300005843 | Ga0068860_100002413 | Ga0068860_1000024135 | 611 |
| 349 | 3300005844 | Ga0068862_100001204 | Ga0068862_10000120420 | 611 |
| 350 | 3300006237 | Ga0097621_100004130 | Ga0097621_1000041303 | 611 |
| 351 | 3300006358 | Ga0068871_100000370 | Ga0068871_1000003706 | 611 |
| 352 | 3300006844 | Ga0075428_100000993 | Ga0075428_10000099315 | 611 |
| 353 | 3300006880 | Ga0075429_100000215 | Ga0075429_10000021545 | 611 |
| 354 | 3300006881 | Ga0068865_100000283 | Ga0068865_10000028325 | 611 |
| 355 | 3300006931 | Ga0097620_100001399 | Ga0097620_1000013997 | 611 |
| 356 | 3300009094 | Ga0111539_10167108 | Ga0111539_101671082 | 611 |
| 357 | 3300009098 | Ga0105245_10001066 | Ga0105245_100010664 | 611 |
| 358 | 3300009147 | Ga0114129_10001138 | Ga0114129_1000113820 | 611 |
| 359 | 3300009148 | Ga0105243_10000708 | Ga0105243_1000070830 | 611 |
| 360 | 3300009176 | Ga0105242_10001614 | Ga0105242_100016146 | 611 |
| 361 | 3300009553 | Ga0105249_10005638 | Ga0105249_100056385 | 611 |
| 362 | 3300013297 | Ga0157378_10001153 | Ga0157378_1000115320 | 611 |
| 363 | 3300025899 | Ga0207642_10007346 | Ga0207642_100073463 | 611 |
| 364 | 3300025918 | Ga0207662_10000191 | Ga0207662_1000019125 | 611 |
| 365 | 3300025926 | Ga0207659_10043063 | Ga0207659_100430633 | 611 |
| 366 | 3300025927 | Ga0207687_10001813 | Ga0207687_1000181314 | 611 |
| 367 | 3300025934 | Ga0207686_10001418 | Ga0207686_100014182 | 611 |
| 368 | 3300025935 | Ga0207709_10001098 | Ga0207709_100010985 | 611 |
| 369 | 3300025936 | Ga0207670_10001920 | Ga0207670_100019204 | 611 |
| 370 | 3300025938 | Ga0207704_10000409 | Ga0207704_100004096 | 611 |
| 371 | 3300025942 | Ga0207689_10000921 | Ga0207689_100009216 | 611 |
| 372 | 3300025949 | Ga0207667_10017372 | Ga0207667_100173725 | 611 |
| 373 | 3300025961 | Ga0207712_10004731 | Ga0207712_100047318 | 611 |
| 374 | 3300025981 | Ga0207640_10001592 | Ga0207640_1000159211 | 611 |
| 375 | 3300026023 | Ga0207677_10000592 | Ga0207677_1000059220 | 611 |
| 376 | 3300026035 | Ga0207703_10007345 | Ga0207703_100073457 | 611 |
| 377 | 3300026075 | Ga0207708_10000451 | Ga0207708_1000045119 | 611 |
| 378 | 3300026089 | Ga0207648_10000245 | Ga0207648_1000024520 | 611 |
| 379 | 3300026118 | Ga0207675_100001447 | Ga0207675_10000144720 | 611 |
| 380 | 3300027907 | Ga0207428_10000954 | Ga0207428_100009542 | 611 |
| 381 | 3300028380 | Ga0268265_10000627 | Ga0268265_100006278 | 611 |
| 382 | 3300028381 | Ga0268264_10003335 | Ga0268264_1000333512 | 611 |
| 383 | 3300033179 | Ga0307507_10021263 | Ga0307507_100212635 | 611 |
| 384 | 3300035112 | Ga0373932_0009006 | Ga0373932_0009006_327_2192 | 611 |
| 385 | 3300035170 | Ga0373943_0036176 | Ga0373943_0036176_123_1988 | 611 |
| 386 | 3300035171 | Ga0373946_0004603 | Ga0373946_0004603_130_1995 | 611 |
| 387 | 3300035410 | Ga0373924_0020416 | Ga0373924_0020416_611_2476 | 611 |
| 388 | 3300035691 | Ga0373931_0004014 | Ga0373931_0004014_4748_6595 | 611 |
| 389 | 3300035692 | Ga0373935_0041524 | Ga0373935_0041524_261_2126 | 611 |
| 390 | 3300035695 | Ga0373927_0036936 | Ga0373927_0036936_518_2383 | 611 |
| 391 | 3300046455 | Ga0495603_0000212 | Ga0495603_0000212_24314_26179 | 611 |
| 392 | 3300046472 | Ga0495580_0000358 | Ga0495580_0000358_7778_9643 | 611 |
| 393 | 3300046535 | Ga0495586_0003782 | Ga0495586_0003782_3046_4911 | 611 |
| 394 | 3300046674 | Ga0495588_0003773 | Ga0495588_0003773_2908_4773 | 611 |
| 395 | 3300046681 | Ga0495647_0000273 | Ga0495647_0000273_3265_5130 | 611 |
| 396 | 3300046683 | Ga0495658_0000620 | Ga0495658_0000620_4845_6710 | 611 |
| 397 | 3300048920 | Ga0496117_0008161 | Ga0496117_0008161_7337_9256 | 611 |
| 398 | 3300048922 | Ga0496119_0000951 | Ga0496119_0000951_7338_9257 | 611 |
| 399 | 3300048923 | Ga0496120_0000276 | Ga0496120_0000276_76875_78794 | 611 |
| 400 | 3300048925 | Ga0496122_0004100 | Ga0496122_0004100_3621_5540 | 611 |
| 401 | 3300048926 | Ga0496123_0003248 | Ga0496123_0003248_12932_14851 | 611 |
| 402 | 3300048927 | Ga0496124_0000815 | Ga0496124_0000815_12995_14914 | 611 |
| 403 | 3300050507 | nmdc:mga05p37_5151_c1 | nmdc:mga05p37_5151_c1_5115_6962 | 611 |
| 404 | 3300050508 | nmdc:mga09592_5031_c1 | nmdc:mga09592_5031_c1_103_1950 | 611 |
| 405 | 3300050511 | nmdc:mga08y16_114963_c1 | nmdc:mga08y16_114963_c1_397_2244 | 611 |
| 406 | iso_pu_bacteria | 2919404418 | 2919404697 | 611 |
| 407 | iso_pu_bacteria | 2941471342 | 2941472405 | 611 |
| 408 | 3300002737 | JGI25162J39368_1003369 | JGI25162J39368_10033692 | 612 |
| 409 | 3300005290 | Ga0065712_10000132 | Ga0065712_1000013234 | 612 |
| 410 | 3300009092 | Ga0105250_10000025 | Ga0105250_1000002597 | 612 |
| 411 | 3300009092 | Ga0105250_10010099 | Ga0105250_100100993 | 612 |
| 412 | 3300013105 | Ga0157369_10057725 | Ga0157369_100577254 | 612 |
| 413 | 3300025233 | Ga0209437_100235 | Ga0209437_10023535 | 612 |
| 414 | 3300025711 | Ga0207696_1000007 | Ga0207696_1000007315 | 612 |
| 415 | 3300025735 | Ga0207713_1000001 | Ga0207713_1000001179 | 612 |
| 416 | 3300027312 | Ga0209371_1003505 | Ga0209371_10035055 | 612 |
| 417 | 3300046513 | Ga0495616_0004615 | Ga0495616_0004615_6791_8629 | 612 |
| 418 | 3300046513 | Ga0495616_0040906 | Ga0495616_0040906_21_1859 | 612 |
| 419 | 3300048905 | Ga0496102_0009820 | Ga0496102_0009820_2397_4271 | 612 |
| 420 | 3300048920 | Ga0496117_0000004 | Ga0496117_0000004_834157_836031 | 612 |
| 421 | 3300048921 | Ga0496118_0000024 | Ga0496118_0000024_342262_344136 | 612 |
| 422 | 3300048922 | Ga0496119_0001545 | Ga0496119_0001545_2002_3876 | 612 |
| 423 | 3300048925 | Ga0496122_0009940 | Ga0496122_0009940_1616_3490 | 612 |
| 424 | 3300048925 | Ga0496122_0033596 | Ga0496122_0033596_1624_3573 | 612 |
| 425 | 3300048926 | Ga0496123_0000651 | Ga0496123_0000651_31202_33076 | 612 |
| 426 | 3300049588 | Ga0501072_0054669 | Ga0501072_0054669_568_2439 | 612 |
| 427 | 3300059421 | Ga0590071_005517 | Ga0590071_005517_235_2088 | 612 |
| 428 | 3300013307 | Ga0157372_10250120 | Ga0157372_102501201 | 613 |
| 429 | 3300015261 | Ga0182006_1004233 | Ga0182006_10042332 | 613 |
| 430 | 3300017792 | Ga0163161_10016090 | Ga0163161_100160903 | 613 |
| 431 | 3300025711 | Ga0207696_1000655 | Ga0207696_100065523 | 613 |
| 432 | 3300025728 | Ga0207655_1008247 | Ga0207655_10082473 | 613 |
| 433 | 3300025735 | Ga0207713_1010212 | Ga0207713_10102123 | 613 |
| 434 | 3300027312 | Ga0209371_1000220 | Ga0209371_100022034 | 613 |
| 435 | 3300030500 | Ga0268256_1000359 | Ga0268256_10003594 | 613 |
| 436 | 3300031251 | Ga0265327_10000241 | Ga0265327_1000024181 | 613 |
| 437 | 3300031727 | Ga0316576_10011765 | Ga0316576_100117655 | 613 |
| 438 | 3300031733 | Ga0316577_10028740 | Ga0316577_100287402 | 613 |
| 439 | 3300033541 | Ga0316596_1013538 | Ga0316596_10135381 | 613 |
| 440 | 3300035398 | Ga0316574_0001118 | Ga0316574_0001118_7335_9197 | 613 |
| 441 | 3300036647 | Ga0316582_0002211 | Ga0316582_0002211_5966_7864 | 613 |
| 442 | 3300036712 | Ga0316584_0077175 | Ga0316584_0077175_502_2370 | 613 |
| 443 | 3300037588 | Ga0316581_0006025 | Ga0316581_0006025_1039_2937 | 613 |
| 444 | 3300041407 | Ga0439447_003201 | Ga0439447_003201_1432_3306 | 613 |
| 445 | 3300041411 | Ga0439466_0000012 | Ga0439466_0000012_11720_13594 | 613 |
| 446 | 3300047320 | Ga0495672_0000061 | Ga0495672_0000061_20202_22076 | 613 |
| 447 | 3300048920 | Ga0496117_0000853 | Ga0496117_0000853_40838_42712 | 613 |
| 448 | 3300048921 | Ga0496118_0001266 | Ga0496118_0001266_31205_33079 | 613 |
| 449 | 3300048924 | Ga0496121_0000131 | Ga0496121_0000131_1339_3213 | 613 |
| 450 | 3300048926 | Ga0496123_0009515 | Ga0496123_0009515_5269_7143 | 613 |
| 451 | 3300048927 | Ga0496124_0000156 | Ga0496124_0000156_84202_86076 | 613 |
| 452 | 3300048927 | Ga0496124_0000734 | Ga0496124_0000734_8032_9918 | 613 |
| 453 | 3300048929 | Ga0496126_0057570 | Ga0496126_0057570_132_2006 | 613 |
| 454 | 3300013307 | Ga0157372_10012829 | Ga0157372_100128291 | 614 |
| 455 | 3300027312 | Ga0209371_1000146 | Ga0209371_100014674 | 614 |
| 456 | 3300027312 | Ga0209371_1000557 | Ga0209371_10005575 | 614 |
| 457 | 3300030500 | Ga0268256_1000117 | Ga0268256_100011742 | 614 |
| 458 | 3300030500 | Ga0268256_1000677 | Ga0268256_10006775 | 614 |
| 459 | 3300031251 | Ga0265327_10025252 | Ga0265327_100252523 | 614 |
| 460 | 3300041405 | Ga0439438_000879 | Ga0439438_000879_10973_12847 | 614 |
| 461 | 3300002075 | JGI24738J21930_10010282 | JGI24738J21930_100102821 | 615 |
| 462 | 3300013104 | Ga0157370_10016285 | Ga0157370_100162852 | 615 |
| 463 | 3300013105 | Ga0157369_10068008 | Ga0157369_100680083 | 615 |
| 464 | 3300025258 | Ga0209129_1012473 | Ga0209129_10124731 | 615 |
| 465 | 3300025303 | Ga0209051_1012278 | Ga0209051_10122783 | 615 |
| 466 | 3300025711 | Ga0207696_1000152 | Ga0207696_1000152115 | 615 |
| 467 | 3300025735 | Ga0207713_1000009 | Ga0207713_1000009396 | 615 |
| 468 | 3300025904 | Ga0207647_10000006 | Ga0207647_100000067 | 615 |
| 469 | 3300027312 | Ga0209371_1000615 | Ga0209371_100061514 | 615 |
| 470 | 3300030500 | Ga0268256_1000528 | Ga0268256_100052813 | 615 |
| 471 | 3300035695 | Ga0373927_0011878 | Ga0373927_0011878_3433_5295 | 615 |
| 472 | 3300039062 | Ga0400483_026308 | Ga0400483_026308_45120_47054 | 615 |
| 473 | 3300039062 | Ga0400483_076133 | Ga0400483_076133_4720_6615 | 615 |
| 474 | 3300039062 | Ga0400483_250036 | Ga0400483_250036_251726_253660 | 615 |
| 475 | 3300039110 | Ga0400487_51348 | Ga0400487_51348_4193_6088 | 615 |
| 476 | 3300046453 | Ga0495627_002242 | Ga0495627_002242_3565_5475 | 615 |
| 477 | 3300046507 | Ga0495606_0008136 | Ga0495606_0008136_3238_5145 | 615 |
| 478 | 3300046542 | Ga0495597_0004114 | Ga0495597_0004114_3124_5034 | 615 |
| 479 | 3300047321 | Ga0495676_0008018 | Ga0495676_0008018_1440_3347 | 615 |
| 480 | 3300047323 | Ga0495683_0000175 | Ga0495683_0000175_4783_6687 | 615 |
| 481 | 3300047469 | Ga0495673_0004149 | Ga0495673_0004149_3436_5346 | 615 |
| 482 | 3300048921 | Ga0496118_0006959 | Ga0496118_0006959_5279_7147 | 615 |
| 483 | 3300048924 | Ga0496121_0000129 | Ga0496121_0000129_7751_9619 | 615 |
| 484 | 3300048928 | Ga0496125_0016707 | Ga0496125_0016707_1050_2918 | 615 |
| 485 | 3300053098 | Ga0500650_0000015 | Ga0500650_0000015_41814_43760 | 615 |
| 486 | 3300038726 | Ga0400490_31714 | Ga0400490_31714_1400_3301 | 616 |
| 487 | 3300039447 | Ga0436361_1114325 | Ga0436361_1114325_8630_10531 | 616 |
| 488 | 3300049459 | Ga0495678_004373 | Ga0495678_004373_2010_3920 | 616 |
| 489 | 3300049572 | Ga0501036_0003884 | Ga0501036_0003884_2329_4191 | 616 |
| 490 | 3300049574 | Ga0501038_0004228 | Ga0501038_0004228_1183_3045 | 616 |
| 491 | 3300049575 | Ga0501039_0008002 | Ga0501039_0008002_2746_4608 | 616 |
| 492 | 3300049576 | Ga0501040_0000316 | Ga0501040_0000316_24169_26031 | 616 |
| 493 | 3300049577 | Ga0501041_0000270 | Ga0501041_0000270_16393_18255 | 616 |
| 494 | 3300049579 | Ga0501043_0009281 | Ga0501043_0009281_5283_7145 | 616 |
| 495 | 3300049580 | Ga0501046_0000535 | Ga0501046_0000535_11565_13427 | 616 |
| 496 | 3300049582 | Ga0501048_0000628 | Ga0501048_0000628_6210_8072 | 616 |
| 497 | 3300049587 | Ga0501071_0009143 | Ga0501071_0009143_57_1919 | 616 |
| 498 | 3300049590 | Ga0501074_0008561 | Ga0501074_0008561_460_2322 | 616 |
| 499 | 3300049591 | Ga0501075_0000915 | Ga0501075_0000915_7209_9071 | 616 |
| 500 | 3300049592 | Ga0501076_0004510 | Ga0501076_0004510_5327_7189 | 616 |
| 501 | 3300049741 | Ga0501079_0001639 | Ga0501079_0001639_10875_12737 | 616 |
| 502 | 3300049742 | Ga0501080_0052909 | Ga0501080_0052909_1128_2990 | 616 |
| 503 | 3300049822 | Ga0501035_0066958 | Ga0501035_0066958_706_2568 | 616 |
| 504 | 3300049824 | Ga0501045_0014628 | Ga0501045_0014628_3328_5190 | 616 |
| 505 | 3300060353 | Ga0501082_0002945 | Ga0501082_0002945_7795_9657 | 616 |
| 506 | 3300061734 | Ga0530510_0000092 | Ga0530510_0000092_40236_42098 | 616 |
| 507 | iso_pu_bacteria | 2506520007 | 2506577112 | 616 |
| 508 | iso_pu_bacteria | 2506520008 | 2506582250 | 616 |
| 509 | iso_pu_bacteria | 2654587920 | 2656279481 | 616 |
| 510 | iso_pu_bacteria | 2687453601 | 2689443515 | 616 |
| 511 | iso_pu_bacteria | 2869551831 | 2869552932 | 616 |
| 512 | iso_pu_bacteria | 2888366609 | 2888367640 | 616 |
| 513 | iso_pu_bacteria | 2888373701 | 2888374655 | 616 |
| 514 | 3300009011 | Ga0105251_10000018 | Ga0105251_1000001819 | 617 |
| 515 | 3300009092 | Ga0105250_10008301 | Ga0105250_100083011 | 617 |
| 516 | 3300033527 | Ga0316586_1002942 | Ga0316586_10029421 | 617 |
| 517 | 3300036647 | Ga0316582_0007751 | Ga0316582_0007751_399_2318 | 617 |
| 518 | 3300046453 | Ga0495627_001983 | Ga0495627_001983_4570_6480 | 617 |
| 519 | 3300046519 | Ga0495632_0048002 | Ga0495632_0048002_135_2045 | 617 |
| 520 | iso_pu_bacteria | 2844528606 | 2844532028 | 617 |
| 521 | iso_pu_bacteria | 2847797336 | 2847800869 | 617 |
| 522 | iso_pu_bacteria | 2865014394 | 2865017595 | 617 |
| 523 | iso_pu_bacteria | 2876601092 | 2876601255 | 617 |
| 524 | iso_pu_bacteria | 2881609920 | 2881612233 | 617 |
| 525 | iso_pu_bacteria | 2908669403 | 2908671247 | 617 |
| 526 | iso_pu_bacteria | 8055693939 | 8055695175 | 617 |
| 527 | 3300038705 | Ga0237819_00054 | Ga0237819_00054_183_2081 | 618 |
| 528 | 3300046458 | Ga0495591_000137 | Ga0495591_000137_2863_4773 | 618 |
| 529 | 3300046501 | Ga0495607_0005073 | Ga0495607_0005073_3028_5007 | 618 |
| 530 | 3300048920 | Ga0496117_0001196 | Ga0496117_0001196_28691_30616 | 618 |
| 531 | 3300048921 | Ga0496118_0001268 | Ga0496118_0001268_28695_30620 | 618 |
| 532 | iso_pu_bacteria | 2508501071 | 2508851079 | 618 |
| 533 | iso_pu_bacteria | 2585427591 | 2585826772 | 618 |
| 534 | iso_pu_bacteria | 2585427592 | 2585831302 | 618 |
| 535 | iso_pu_bacteria | 2667528173 | 2671108395 | 618 |
| 536 | iso_pu_bacteria | 2772190666 | 2772437621 | 618 |
| 537 | iso_pu_bacteria | 2806310673 | 2807177228 | 618 |
| 538 | iso_pu_bacteria | 2904474040 | 2904474933 | 618 |
| 539 | iso_pu_bacteria | 2919150387 | 2919151279 | 618 |
| 540 | iso_pu_bacteria | 2927143783 | 2927146153 | 618 |
| 541 | iso_pu_bacteria | 2932406140 | 2932407351 | 618 |
| 542 | iso_pu_bacteria | 2937967321 | 2937972157 | 618 |
| 543 | iso_pu_bacteria | 2939577877 | 2939579261 | 618 |
| 544 | iso_pu_bacteria | 640753048 | 640936658 | 618 |
| 545 | iso_pu_bacteria | 8004592986 | 8004594344 | 618 |
| 546 | iso_pu_bacteria | 8015394850 | 8015398919 | 618 |
| 547 | 3300003791 | Ga0055530_10010525 | Ga0055530_100105252 | 619 |
| 548 | 3300009011 | Ga0105251_10003157 | Ga0105251_1000315711 | 619 |
| 549 | 3300009011 | Ga0105251_10003178 | Ga0105251_1000317811 | 619 |
| 550 | 3300009036 | Ga0105244_10000362 | Ga0105244_1000036213 | 619 |
| 551 | 3300009092 | Ga0105250_10008680 | Ga0105250_100086803 | 619 |
| 552 | 3300009093 | Ga0105240_10047158 | Ga0105240_100471582 | 619 |
| 553 | 3300009174 | Ga0105241_10000004 | Ga0105241_10000004238 | 619 |
| 554 | 3300013100 | Ga0157373_10001576 | Ga0157373_100015765 | 619 |
| 555 | 3300013102 | Ga0157371_10000007 | Ga0157371_10000007248 | 619 |
| 556 | 3300017792 | Ga0163161_10000004 | Ga0163161_10000004147 | 619 |
| 557 | 3300025298 | Ga0209050_1001705 | Ga0209050_10017052 | 619 |
| 558 | 3300025711 | Ga0207696_1000033 | Ga0207696_1000033100 | 619 |
| 559 | 3300025735 | Ga0207713_1000133 | Ga0207713_1000133100 | 619 |
| 560 | 3300025900 | Ga0207710_10000016 | Ga0207710_10000016250 | 619 |
| 561 | 3300046453 | Ga0495627_000145 | Ga0495627_000145_68835_70700 | 619 |
| 562 | 3300046530 | Ga0495654_0002005 | Ga0495654_0002005_11099_12964 | 619 |
| 563 | 3300046794 | Ga0495589_0000006 | Ga0495589_0000006_268948_270813 | 619 |
| 564 | 3300048919 | Ga0496116_0000031 | Ga0496116_0000031_247409_249274 | 619 |
| 565 | 3300048920 | Ga0496117_0002296 | Ga0496117_0002296_18564_20429 | 619 |
| 566 | 3300048921 | Ga0496118_0002368 | Ga0496118_0002368_16906_18771 | 619 |
| 567 | 3300048923 | Ga0496120_0000522 | Ga0496120_0000522_9904_11769 | 619 |
| 568 | 3300048927 | Ga0496124_0000039 | Ga0496124_0000039_268242_270107 | 619 |
| 569 | iso_pu_bacteria | 2511231025 | 2511379386 | 619 |
| 570 | iso_pu_bacteria | 2511231035 | 2511433841 | 619 |
| 571 | iso_pu_bacteria | 2547132181 | 2547698791 | 619 |
| 572 | iso_pu_bacteria | 2547132416 | 2548648866 | 619 |
| 573 | iso_pu_bacteria | 2554235234 | 2555259378 | 619 |
| 574 | iso_pu_bacteria | 2561511199 | 2562466317 | 619 |
| 575 | iso_pu_bacteria | 2599185169 | 2599411963 | 619 |
| 576 | iso_pu_bacteria | 2599185299 | 2599927114 | 619 |
| 577 | iso_pu_bacteria | 2600255254 | 2601525141 | 619 |
| 578 | iso_pu_bacteria | 2600255255 | 2601530328 | 619 |
| 579 | iso_pu_bacteria | 2600255256 | 2601531781 | 619 |
| 580 | iso_pu_bacteria | 2600255257 | 2601537153 | 619 |
| 581 | iso_pu_bacteria | 2600255280 | 2601617068 | 619 |
| 582 | iso_pu_bacteria | 2600255281 | 2601621585 | 619 |
| 583 | iso_pu_bacteria | 2600255287 | 2601645003 | 619 |
| 584 | iso_pu_bacteria | 2600255288 | 2601650691 | 619 |
| 585 | iso_pu_bacteria | 2600255289 | 2601654909 | 619 |
| 586 | iso_pu_bacteria | 2600255290 | 2601660424 | 619 |
| 587 | iso_pu_bacteria | 2600255291 | 2601665026 | 619 |
| 588 | iso_pu_bacteria | 2600255298 | 2601697642 | 619 |
| 589 | iso_pu_bacteria | 2600255299 | 2601703030 | 619 |
| 590 | iso_pu_bacteria | 2600255300 | 2601708272 | 619 |
| 591 | iso_pu_bacteria | 2600255301 | 2601713365 | 619 |
| 592 | iso_pu_bacteria | 2600255302 | 2601718468 | 619 |
| 593 | iso_pu_bacteria | 2600255303 | 2601723191 | 619 |
| 594 | iso_pu_bacteria | 2600255304 | 2601728299 | 619 |
| 595 | iso_pu_bacteria | 2600255305 | 2601733416 | 619 |
| 596 | iso_pu_bacteria | 2600255306 | 2601738283 | 619 |
| 597 | iso_pu_bacteria | 2600255307 | 2601742407 | 619 |
| 598 | iso_pu_bacteria | 2600255309 | 2601753621 | 619 |
| 599 | iso_pu_bacteria | 2600255310 | 2601755499 | 619 |
| 600 | iso_pu_bacteria | 2600255311 | 2601760866 | 619 |
| 601 | iso_pu_bacteria | 2600255392 | 2602019992 | 619 |
| 602 | iso_pu_bacteria | 2602042046 | 2603639090 | 619 |
| 603 | iso_pu_bacteria | 2602042047 | 2603643559 | 619 |
| 604 | iso_pu_bacteria | 2602042052 | 2603661822 | 619 |
| 605 | iso_pu_bacteria | 2602042053 | 2603666720 | 619 |
| 606 | iso_pu_bacteria | 2602042066 | 2603700142 | 619 |
| 607 | iso_pu_bacteria | 2602042067 | 2603704131 | 619 |
| 608 | iso_pu_bacteria | 2602042103 | 2603840527 | 619 |
| 609 | iso_pu_bacteria | 2602042104 | 2603845810 | 619 |
| 610 | iso_pu_bacteria | 2602042105 | 2603850883 | 619 |
| 611 | iso_pu_bacteria | 2602042106 | 2603855744 | 619 |
| 612 | iso_pu_bacteria | 2602042109 | 2603866278 | 619 |
| 613 | iso_pu_bacteria | 2602042110 | 2603873326 | 619 |
| 614 | iso_pu_bacteria | 2602042111 | 2603877625 | 619 |
| 615 | iso_pu_bacteria | 2603880178 | 2606050712 | 619 |
| 616 | iso_pu_bacteria | 2603880184 | 2606071152 | 619 |
| 617 | iso_pu_bacteria | 2603880202 | 2606148396 | 619 |
| 618 | iso_pu_bacteria | 2603880211 | 2606178395 | 619 |
| 619 | iso_pu_bacteria | 2608642108 | 2608668545 | 619 |
| 620 | iso_pu_bacteria | 2609459761 | 2609912450 | 619 |
| 621 | iso_pu_bacteria | 2636415599 | 2637226710 | 619 |
| 622 | iso_pu_bacteria | 2648501693 | 2650895540 | 619 |
| 623 | iso_pu_bacteria | 2667528172 | 2671102230 | 619 |
| 624 | iso_pu_bacteria | 2675903046 | 2676407138 | 619 |
| 625 | iso_pu_bacteria | 2681812866 | 2681995893 | 619 |
| 626 | iso_pu_bacteria | 2681812869 | 2682008911 | 619 |
| 627 | iso_pu_bacteria | 2684622997 | 2686355754 | 619 |
| 628 | iso_pu_bacteria | 2711768156 | 2712472752 | 619 |
| 629 | iso_pu_bacteria | 2751185917 | 2753854929 | 619 |
| 630 | iso_pu_bacteria | 2765235842 | 2765587795 | 619 |
| 631 | iso_pu_bacteria | 2775506706 | 2775541805 | 619 |
| 632 | iso_pu_bacteria | 2775507074 | 2777022435 | 619 |
| 633 | iso_pu_bacteria | 2791354903 | 2791924610 | 619 |
| 634 | iso_pu_bacteria | 2791355010 | 2792313741 | 619 |
| 635 | iso_pu_bacteria | 2791355275 | 2793406527 | 619 |
| 636 | iso_pu_bacteria | 2808606414 | 2809124663 | 619 |
| 637 | iso_pu_bacteria | 2811995292 | 2813730136 | 619 |
| 638 | iso_pu_bacteria | 2814123068 | 2814697715 | 619 |
| 639 | iso_pu_bacteria | 2821118458 | 2821118708 | 619 |
| 640 | iso_pu_bacteria | 2823373977 | 2823377089 | 619 |
| 641 | iso_pu_bacteria | 2844425489 | 2844426482 | 619 |
| 642 | iso_pu_bacteria | 2847085930 | 2847088709 | 619 |
| 643 | iso_pu_bacteria | 2852103415 | 2852103548 | 619 |
| 644 | iso_pu_bacteria | 2884086401 | 2884090018 | 619 |
| 645 | iso_pu_bacteria | 2891670763 | 2891674940 | 619 |
| 646 | iso_pu_bacteria | 2904504865 | 2904505632 | 619 |
| 647 | iso_pu_bacteria | 2904513164 | 2904514976 | 619 |
| 648 | iso_pu_bacteria | 2919108558 | 2919109801 | 619 |
| 649 | iso_pu_bacteria | 2923634449 | 2923638344 | 619 |
| 650 | iso_pu_bacteria | 2927833300 | 2927835212 | 619 |
| 651 | iso_pu_bacteria | 2935625433 | 2935629385 | 619 |
| 652 | iso_pu_bacteria | 2937539931 | 2937542908 | 619 |
| 653 | iso_pu_bacteria | 2939568625 | 2939570696 | 619 |
| 654 | iso_pu_bacteria | 2939573065 | 2939574871 | 619 |
| 655 | iso_pu_bacteria | 2939602548 | 2939603015 | 619 |
| 656 | iso_pu_bacteria | 2939607340 | 2939610771 | 619 |
| 657 | iso_pu_bacteria | 2939617950 | 2939621682 | 619 |
| 658 | iso_pu_bacteria | 2939642701 | 2939644802 | 619 |
| 659 | iso_pu_bacteria | 2945874760 | 2945879298 | 619 |
| 660 | iso_pu_bacteria | 2945951305 | 2945953954 | 619 |
| 661 | iso_pu_bacteria | 2969079654 | 2969083693 | 619 |
| 662 | iso_pu_bacteria | 2971820967 | 2971825159 | 619 |
| 663 | iso_pu_bacteria | 2974310843 | 2974313272 | 619 |
| 664 | iso_pu_bacteria | 2974435778 | 2974437401 | 619 |
| 665 | iso_pu_bacteria | 2978975091 | 2978976438 | 619 |
| 666 | iso_pu_bacteria | 2984494565 | 2984495632 | 619 |
| 667 | iso_pu_bacteria | 2984559226 | 2984560795 | 619 |
| 668 | iso_pu_bacteria | 2984595703 | 2984598870 | 619 |
| 669 | iso_pu_bacteria | 2990261002 | 2990264327 | 619 |
| 670 | iso_pu_bacteria | 3000376612 | 3000380134 | 619 |
| 671 | iso_pu_bacteria | 8016733728 | 8016736875 | 619 |
| 672 | iso_pu_bacteria | 8018221730 | 8018224239 | 619 |
| 673 | iso_pu_bacteria | 8018405270 | 8018405859 | 619 |
| 674 | iso_pu_bacteria | 8019499862 | 8019502084 | 619 |
| 675 | iso_pu_bacteria | 8019504834 | 8019508176 | 619 |
| 676 | iso_pu_bacteria | 8055087960 | 8055091212 | 619 |
| 677 | iso_pu_bacteria | 8055092621 | 8055096517 | 619 |
| 678 | iso_pu_bacteria | 8055097453 | 8055101327 | 619 |
| 679 | iso_pu_bacteria | 8057304971 | 8057306231 | 619 |
| 680 | 3300009092 | Ga0105250_10000003 | Ga0105250_10000003431 | 620 |
| 681 | 3300014497 | Ga0182008_10000143 | Ga0182008_1000014362 | 620 |
| 682 | 3300030732 | Ga0316176_1131399 | Ga0316176_11313991 | 620 |
| 683 | 3300038726 | Ga0400490_28529 | Ga0400490_28529_7823_9730 | 620 |
| 684 | 3300046474 | Ga0495605_0003439 | Ga0495605_0003439_2969_4867 | 620 |
| 685 | 3300048925 | Ga0496122_0012404 | Ga0496122_0012404_4083_5981 | 620 |
| 686 | 3300048926 | Ga0496123_0009535 | Ga0496123_0009535_2946_4844 | 620 |
| 687 | iso_pu_bacteria | 2952252522 | 2952253313 | 620 |
| 688 | 3300005272 | Ga0065703_1019229 | Ga0065703_10192291 | 621 |
| 689 | 3300025728 | Ga0207655_1000011 | Ga0207655_1000011168 | 621 |
| 690 | 3300025735 | Ga0207713_1000101 | Ga0207713_1000101102 | 621 |
| 691 | 3300025735 | Ga0207713_1000956 | Ga0207713_100095611 | 621 |
| 692 | 3300025911 | Ga0207654_10000006 | Ga0207654_10000006254 | 621 |
| 693 | 3300027111 | Ga0209281_1000008 | Ga0209281_1000008618 | 621 |
| 694 | 3300027111 | Ga0209281_1006267 | Ga0209281_10062671 | 621 |
| 695 | 3300046474 | Ga0495605_0000026 | Ga0495605_0000026_215774_217684 | 621 |
| 696 | 3300046474 | Ga0495605_0000414 | Ga0495605_0000414_2535_4445 | 621 |
| 697 | 3300046506 | Ga0495583_0000043 | Ga0495583_0000043_4053_5963 | 621 |
| 698 | 3300046512 | Ga0495610_0018057 | Ga0495610_0018057_390_2300 | 621 |
| 699 | 3300046538 | Ga0495609_0000036 | Ga0495609_0000036_4112_6022 | 621 |
| 700 | 3300046558 | Ga0495633_0000143 | Ga0495633_0000143_89296_91206 | 621 |
| 701 | 3300046665 | Ga0495661_0000121 | Ga0495661_0000121_4162_6072 | 621 |
| 702 | 3300047323 | Ga0495683_0000003 | Ga0495683_0000003_378027_379937 | 621 |
| 703 | 3300047469 | Ga0495673_0012478 | Ga0495673_0012478_2337_4247 | 621 |
| 704 | 3300048925 | Ga0496122_0026581 | Ga0496122_0026581_1577_3487 | 621 |
| 705 | iso_pu_bacteria | 2671180115 | 2671588084 | 621 |
| 706 | iso_pu_bacteria | 8054844752 | 8054847331 | 621 |
| 707 | iso_pu_bacteria | 8054849141 | 8054854186 | 621 |
| 708 | iso_pu_bacteria | 8057160832 | 8057161512 | 621 |
| 709 | 3300006051 | Ga0075364_10013114 | Ga0075364_100131144 | 622 |
| 710 | 3300009011 | Ga0105251_10001816 | Ga0105251_100018168 | 622 |
| 711 | 3300009092 | Ga0105250_10011116 | Ga0105250_100111162 | 622 |
| 712 | 3300013100 | Ga0157373_10000201 | Ga0157373_100002017 | 622 |
| 713 | 3300013102 | Ga0157371_10000352 | Ga0157371_1000035215 | 622 |
| 714 | 3300013102 | Ga0157371_10017214 | Ga0157371_100172144 | 622 |
| 715 | 3300013105 | Ga0157369_10028650 | Ga0157369_100286504 | 622 |
| 716 | 3300013307 | Ga0157372_10005890 | Ga0157372_100058904 | 622 |
| 717 | 3300025711 | Ga0207696_1000004 | Ga0207696_1000004202 | 622 |
| 718 | 3300025711 | Ga0207696_1000192 | Ga0207696_100019252 | 622 |
| 719 | 3300025728 | Ga0207655_1011623 | Ga0207655_10116233 | 622 |
| 720 | 3300025735 | Ga0207713_1001549 | Ga0207713_100154913 | 622 |
| 721 | 3300030742 | Ga0316183_1195675 | Ga0316183_11956756 | 622 |
| 722 | 3300046458 | Ga0495591_000301 | Ga0495591_000301_10648_12522 | 622 |
| 723 | 3300046530 | Ga0495654_0000032 | Ga0495654_0000032_32593_34467 | 622 |
| 724 | 3300046530 | Ga0495654_0022838 | Ga0495654_0022838_280_2154 | 622 |
| 725 | 3300047446 | Ga0495679_000019 | Ga0495679_000019_87749_89623 | 622 |
| 726 | 3300048904 | Ga0496101_0000029 | Ga0496101_0000029_35047_36921 | 622 |
| 727 | 3300048920 | Ga0496117_0004075 | Ga0496117_0004075_11931_13805 | 622 |
| 728 | 3300048921 | Ga0496118_0028333 | Ga0496118_0028333_676_2580 | 622 |
| 729 | 3300048922 | Ga0496119_0000043 | Ga0496119_0000043_37158_39032 | 622 |
| 730 | 3300048922 | Ga0496119_0000062 | Ga0496119_0000062_165708_167582 | 622 |
| 731 | 3300048923 | Ga0496120_0000009 | Ga0496120_0000009_179536_181410 | 622 |
| 732 | 3300048923 | Ga0496120_0000985 | Ga0496120_0000985_4321_6195 | 622 |
| 733 | 3300048925 | Ga0496122_0012371 | Ga0496122_0012371_666_2540 | 622 |
| 734 | 3300048925 | Ga0496122_0035824 | Ga0496122_0035824_59_1933 | 622 |
| 735 | 3300048926 | Ga0496123_0002672 | Ga0496123_0002672_18938_20812 | 622 |
| 736 | 3300048926 | Ga0496123_0009924 | Ga0496123_0009924_2986_4860 | 622 |
| 737 | iso_pu_bacteria | 2537561728 | 2538428339 | 622 |
| 738 | iso_pu_bacteria | 2706794495 | 2707099952 | 622 |
| 739 | iso_pu_bacteria | 2854601825 | 2854602665 | 622 |
| 740 | iso_pu_bacteria | 2855195626 | 2855199174 | 622 |
| 741 | iso_pu_bacteria | 2858466076 | 2858469942 | 622 |
| 742 | iso_pu_bacteria | 2871272651 | 2871276716 | 622 |
| 743 | iso_pu_bacteria | 2871282230 | 2871283914 | 622 |
| 744 | iso_pu_bacteria | 2900051742 | 2900054258 | 622 |
| 745 | 3300032004 | Ga0307414_10011831 | Ga0307414_100118314 | 623 |
| 746 | 3300049576 | Ga0501040_0002293 | Ga0501040_0002293_2901_4775 | 623 |
| 747 | 3300049576 | Ga0501040_0056736 | Ga0501040_0056736_651_2525 | 623 |
| 748 | 3300049578 | Ga0501042_0064995 | Ga0501042_0064995_317_2191 | 623 |
| 749 | iso_pu_bacteria | 2747842428 | 2747950776 | 623 |
| 750 | 3300003791 | Ga0055530_10000544 | Ga0055530_1000054425 | 624 |
| 751 | 3300009011 | Ga0105251_10007555 | Ga0105251_100075553 | 624 |
| 752 | 3300025298 | Ga0209050_1000415 | Ga0209050_100041532 | 624 |
| 753 | 3300025711 | Ga0207696_1000517 | Ga0207696_10005177 | 624 |
| 754 | 3300025728 | Ga0207655_1006225 | Ga0207655_10062254 | 624 |
| 755 | 3300025728 | Ga0207655_1015599 | Ga0207655_10155993 | 624 |
| 756 | 3300025735 | Ga0207713_1014764 | Ga0207713_10147642 | 624 |
| 757 | 3300046458 | Ga0495591_002938 | Ga0495591_002938_2569_4479 | 624 |
| 758 | 3300046491 | Ga0495584_0004701 | Ga0495584_0004701_2299_4209 | 624 |
| 759 | 3300046501 | Ga0495607_0004502 | Ga0495607_0004502_3864_5774 | 624 |
| 760 | 3300046506 | Ga0495583_0004703 | Ga0495583_0004703_4474_6384 | 624 |
| 761 | 3300046507 | Ga0495606_0002635 | Ga0495606_0002635_3257_5167 | 624 |
| 762 | 3300046515 | Ga0495620_0003570 | Ga0495620_0003570_4147_6057 | 624 |
| 763 | 3300046515 | Ga0495620_0019386 | Ga0495620_0019386_1425_3335 | 624 |
| 764 | 3300046518 | Ga0495631_0004234 | Ga0495631_0004234_3284_5194 | 624 |
| 765 | 3300046519 | Ga0495632_0010833 | Ga0495632_0010833_1804_3714 | 624 |
| 766 | 3300046520 | Ga0495637_0000174 | Ga0495637_0000174_44139_46049 | 624 |
| 767 | 3300046660 | Ga0495625_0007427 | Ga0495625_0007427_4463_6373 | 624 |
| 768 | 3300046665 | Ga0495661_0002800 | Ga0495661_0002800_6832_8742 | 624 |
| 769 | 3300046694 | Ga0495649_0008704 | Ga0495649_0008704_2495_4405 | 624 |
| 770 | 3300047320 | Ga0495672_0000027 | Ga0495672_0000027_143503_145383 | 624 |
| 771 | 3300047321 | Ga0495676_0000019 | Ga0495676_0000019_162197_164107 | 624 |
| 772 | 3300047446 | Ga0495679_000119 | Ga0495679_000119_17267_19177 | 624 |
| 773 | 3300048091 | Ga0495626_0000659 | Ga0495626_0000659_3168_5078 | 624 |
| 774 | 3300049460 | Ga0495682_0002230 | Ga0495682_0002230_2934_4844 | 624 |
| 775 | iso_pu_bacteria | 2547132103 | 2547375320 | 624 |
| 776 | iso_pu_bacteria | 2738541276 | 2738714946 | 624 |
| 777 | iso_pu_bacteria | 2765235840 | 2765578636 | 624 |
| 778 | iso_pu_bacteria | 2816332141 | 2816516712 | 624 |
| 779 | iso_pu_bacteria | 2843690924 | 2843694295 | 624 |
| 780 | 3300031239 | Ga0265328_10000106 | Ga0265328_1000010638 | 625 |
| 781 | 3300031250 | Ga0265331_10024460 | Ga0265331_100244603 | 625 |
| 782 | 3300031251 | Ga0265327_10001895 | Ga0265327_1000189524 | 625 |
| 783 | 3300039062 | Ga0400483_233356 | Ga0400483_233356_911_2797 | 625 |
| 784 | 3300053156 | Ga0500622_0000023 | Ga0500622_0000023_143018_144904 | 625 |
| 785 | iso_pu_bacteria | 2547132130 | 2547503068 | 625 |
| 786 | iso_pu_bacteria | 2842391507 | 2842394946 | 625 |
| 787 | iso_pu_bacteria | 2846540461 | 2846541485 | 625 |
| 788 | iso_pu_bacteria | 2874220319 | 2874221265 | 625 |
| 789 | iso_pu_bacteria | 2919089067 | 2919092649 | 625 |
| 790 | iso_pu_bacteria | 2919134579 | 2919136177 | 625 |
| 791 | iso_pu_bacteria | 2928496128 | 2928496234 | 625 |
| 792 | iso_pu_bacteria | 2931380184 | 2931381092 | 625 |
| 793 | iso_pu_bacteria | 2937610967 | 2937612086 | 625 |
| 794 | iso_pu_bacteria | 2939626828 | 2939630087 | 625 |
| 795 | iso_pu_bacteria | 2961047084 | 2961048031 | 625 |
| 796 | iso_pu_bacteria | 2961064222 | 2961065050 | 625 |
| 797 | iso_pu_bacteria | 2998344455 | 2998345957 | 625 |
| 798 | 3300039062 | Ga0400483_195378 | Ga0400483_195378_8848_10782 | 626 |
| 799 | 3300049581 | Ga0501047_0032055 | Ga0501047_0032055_1683_3593 | 626 |
| 800 | 3300049822 | Ga0501035_0115032 | Ga0501035_0115032_389_2299 | 626 |
| 801 | 3300049823 | Ga0501044_0000112 | Ga0501044_0000112_82193_84103 | 626 |
| 802 | iso_pu_bacteria | 2648501241 | 2649121698 | 626 |
| 803 | iso_pu_bacteria | 2651869818 | 2652975993 | 626 |
| 804 | iso_pu_bacteria | 2881714928 | 2881716528 | 626 |
| 805 | iso_pu_bacteria | 3007315729 | 3007318455 | 626 |
| 806 | iso_pu_bacteria | 8054357960 | 8054360684 | 626 |
| 807 | 3300003781 | Ga0055536_1004488 | Ga0055536_10044887 | 627 |
| 808 | 3300009093 | Ga0105240_10000218 | Ga0105240_1000021858 | 627 |
| 809 | 3300025263 | Ga0209565_1005883 | Ga0209565_10058832 | 627 |
| 810 | 3300025292 | Ga0209676_1000047 | Ga0209676_100004759 | 627 |
| 811 | 3300025304 | Ga0209257_1001953 | Ga0209257_100195321 | 627 |
| 812 | 3300025913 | Ga0207695_10000395 | Ga0207695_1000039544 | 627 |
| 813 | 3300038725 | Ga0400484_07955 | Ga0400484_07955_4976_6868 | 627 |
| 814 | iso_pu_bacteria | 2576861471 | 2578458760 | 627 |
| 815 | iso_pu_bacteria | 2600254954 | 2600444885 | 627 |
| 816 | iso_pu_bacteria | 2600255389 | 2602011811 | 627 |
| 817 | iso_pu_bacteria | 2606217733 | 2608382486 | 627 |
| 818 | iso_pu_bacteria | 2643221579 | 2643905585 | 627 |
| 819 | iso_pu_bacteria | 2643221581 | 2643913282 | 627 |
| 820 | iso_pu_bacteria | 2728369097 | 2729148805 | 627 |
| 821 | iso_pu_bacteria | 2738543020 | 2739288057 | 627 |
| 822 | iso_pu_bacteria | 2738543021 | 2739293614 | 627 |
| 823 | iso_pu_bacteria | 2747842501 | 2748016429 | 627 |
| 824 | iso_pu_bacteria | 2808606373 | 2808907861 | 627 |
| 825 | iso_pu_bacteria | 2808606379 | 2808943129 | 627 |
| 826 | iso_pu_bacteria | 2811994881 | 2812367610 | 627 |
| 827 | iso_pu_bacteria | 2818991457 | 2819659998 | 627 |
| 828 | iso_pu_bacteria | 2823421272 | 2823423897 | 627 |
| 829 | iso_pu_bacteria | 2842805378 | 2842806323 | 627 |
| 830 | iso_pu_bacteria | 2852649853 | 2852651115 | 627 |
| 831 | iso_pu_bacteria | 2852684882 | 2852685181 | 627 |
| 832 | iso_pu_bacteria | 2857442823 | 2857445264 | 627 |
| 833 | iso_pu_bacteria | 2916178963 | 2916182743 | 627 |
| 834 | iso_pu_bacteria | 2919130084 | 2919130724 | 627 |
| 835 | iso_pu_bacteria | 2919493220 | 2919493439 | 627 |
| 836 | iso_pu_bacteria | 2919497567 | 2919500443 | 627 |
| 837 | iso_pu_bacteria | 2919501602 | 2919503630 | 627 |
| 838 | iso_pu_bacteria | 2919543075 | 2919545163 | 627 |
| 839 | iso_pu_bacteria | 2923516293 | 2923517694 | 627 |
| 840 | iso_pu_bacteria | 2923519811 | 2923521660 | 627 |
| 841 | iso_pu_bacteria | 2923525760 | 2923528132 | 627 |
| 842 | iso_pu_bacteria | 2926063275 | 2926065798 | 627 |
| 843 | iso_pu_bacteria | 2929195423 | 2929198270 | 627 |
| 844 | iso_pu_bacteria | 2939589442 | 2939590715 | 627 |
| 845 | iso_pu_bacteria | 2939622612 | 2939622901 | 627 |
| 846 | iso_pu_bacteria | 2941475908 | 2941477941 | 627 |
| 847 | iso_pu_bacteria | 2974307012 | 2974309237 | 627 |
| 848 | iso_pu_bacteria | 2977247770 | 2977249958 | 627 |
| 849 | iso_pu_bacteria | 2984514374 | 2984515553 | 627 |
| 850 | iso_pu_bacteria | 2987605356 | 2987606295 | 627 |
| 851 | iso_pu_bacteria | 2990196909 | 2990199221 | 627 |
| 852 | iso_pu_bacteria | 3007252601 | 3007252873 | 627 |
| 853 | iso_pu_bacteria | 640427133 | 640487837 | 627 |
| 854 | iso_pu_bacteria | 651053060 | 651175781 | 627 |
| 855 | iso_pu_bacteria | 8011350971 | 8011354042 | 627 |
| 856 | iso_pu_bacteria | 8021622325 | 8021625311 | 627 |
| 857 | iso_pu_bacteria | 8021626552 | 8021630207 | 627 |
| 858 | iso_pu_bacteria | 8021648035 | 8021652132 | 627 |
| 859 | iso_pu_bacteria | 8034962539 | 8034964599 | 627 |
| 860 | 3300005343 | Ga0070687_100025698 | Ga0070687_1000256981 | 628 |
| 861 | 3300009036 | Ga0105244_10003937 | Ga0105244_100039375 | 628 |
| 862 | 3300009036 | Ga0105244_10007727 | Ga0105244_100077277 | 628 |
| 863 | 3300025728 | Ga0207655_1006427 | Ga0207655_10064275 | 628 |
| 864 | 3300035092 | Ga0373952_0000960 | Ga0373952_0000960_74_1969 | 628 |
| 865 | 3300038705 | Ga0237819_04151 | Ga0237819_04151_38_1927 | 628 |
| 866 | 3300038726 | Ga0400490_36858 | Ga0400490_36858_13389_15284 | 628 |
| 867 | 3300044712 | Ga0453684_0002214 | Ga0453684_0002214_39965_41857 | 628 |
| 868 | 3300046542 | Ga0495597_0000129 | Ga0495597_0000129_62256_64235 | 628 |
| 869 | iso_pu_bacteria | 2510065053 | 2510283613 | 628 |
| 870 | iso_pu_bacteria | 2510065055 | 2510292559 | 628 |
| 871 | iso_pu_bacteria | 2510065058 | 2510311651 | 628 |
| 872 | iso_pu_bacteria | 2773857672 | 2774128615 | 628 |
| 873 | iso_pu_bacteria | 2917832318 | 2917837224 | 628 |
| 874 | iso_pu_bacteria | 2919125081 | 2919126774 | 628 |
| 875 | iso_pu_bacteria | 2974298342 | 2974299259 | 628 |
| 876 | iso_pu_bacteria | 2984499530 | 2984501576 | 628 |
| 877 | iso_pu_bacteria | 2984504281 | 2984505027 | 628 |
| 878 | iso_pu_bacteria | 8002745576 | 8002748204 | 628 |
| 879 | 3300003856 | Ga0058692_1000002 | Ga0058692_100000292 | 629 |
| 880 | 3300005844 | Ga0068862_100009858 | Ga0068862_1000098583 | 629 |
| 881 | 3300006914 | Ga0075436_100022120 | Ga0075436_1000221202 | 629 |
| 882 | 3300021361 | Ga0213872_10000933 | Ga0213872_1000093310 | 629 |
| 883 | 3300025935 | Ga0207709_10000536 | Ga0207709_100005361 | 629 |
| 884 | 3300025961 | Ga0207712_10060237 | Ga0207712_100602372 | 629 |
| 885 | 3300025972 | Ga0207668_10061226 | Ga0207668_100612262 | 629 |
| 886 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004301 | 629 |
| 887 | 3300028380 | Ga0268265_10008164 | Ga0268265_100081644 | 629 |
| 888 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005744 | 629 |
| 889 | 3300031251 | Ga0265327_10003075 | Ga0265327_100030752 | 629 |
| 890 | 3300031251 | Ga0265327_10007016 | Ga0265327_100070163 | 629 |
| 891 | 3300035086 | Ga0373934_0000411 | Ga0373934_0000411_435_2366 | 629 |
| 892 | 3300035119 | Ga0373956_0002404 | Ga0373956_0002404_5649_7580 | 629 |
| 893 | 3300035172 | Ga0373955_0038223 | Ga0373955_0038223_434_2365 | 629 |
| 894 | 3300035724 | Ga0373933_0002175 | Ga0373933_0002175_2884_4815 | 629 |
| 895 | 3300036401 | Ga0373937_0003720 | Ga0373937_0003720_4942_6873 | 629 |
| 896 | 3300039447 | Ga0436361_0695291 | Ga0436361_0695291_58179_60080 | 629 |
| 897 | 3300044712 | Ga0453684_0001204 | Ga0453684_0001204_913_2817 | 629 |
| 898 | 3300046454 | Ga0495592_0004990 | Ga0495592_0004990_3176_5107 | 629 |
| 899 | 3300046462 | Ga0495651_0001303 | Ga0495651_0001303_15845_17776 | 629 |
| 900 | 3300046516 | Ga0495628_0005053 | Ga0495628_0005053_5886_7817 | 629 |
| 901 | 3300046543 | Ga0495645_0000552 | Ga0495645_0000552_5411_7342 | 629 |
| 902 | 3300046665 | Ga0495661_0008826 | Ga0495661_0008826_2562_4472 | 629 |
| 903 | 3300046689 | Ga0495613_0028561 | Ga0495613_0028561_828_2759 | 629 |
| 904 | 3300048908 | Ga0496105_0069602 | Ga0496105_0069602_874_2766 | 629 |
| 905 | 3300048928 | Ga0496125_0014222 | Ga0496125_0014222_1082_2974 | 629 |
| 906 | 3300048929 | Ga0496126_0013792 | Ga0496126_0013792_1341_3233 | 629 |
| 907 | 3300049572 | Ga0501036_0019602 | Ga0501036_0019602_2027_3955 | 629 |
| 908 | 3300049575 | Ga0501039_0005786 | Ga0501039_0005786_5377_7305 | 629 |
| 909 | 3300049592 | Ga0501076_0001078 | Ga0501076_0001078_15706_17634 | 629 |
| 910 | iso_pu_bacteria | 2842757796 | 2842758447 | 629 |
| 911 | iso_pu_bacteria | 2919688452 | 2919692603 | 629 |
| 912 | iso_pu_bacteria | 8056172158 | 8056175522 | 629 |
| 913 | 3300009036 | Ga0105244_10007928 | Ga0105244_100079283 | 630 |
| 914 | 3300013105 | Ga0157369_10068696 | Ga0157369_100686961 | 630 |
| 915 | 3300031239 | Ga0265328_10000501 | Ga0265328_100005012 | 630 |
| 916 | 3300031250 | Ga0265331_10000121 | Ga0265331_1000012117 | 630 |
| 917 | 3300031251 | Ga0265327_10000008 | Ga0265327_10000008358 | 630 |
| 918 | 3300031251 | Ga0265327_10000269 | Ga0265327_1000026917 | 630 |
| 919 | 3300039062 | Ga0400483_013162 | Ga0400483_013162_4691_6601 | 630 |
| 920 | 3300048927 | Ga0496124_0002812 | Ga0496124_0002812_17583_19493 | 630 |
| 921 | iso_pu_bacteria | 2511231004 | 2511254635 | 630 |
| 922 | iso_pu_bacteria | 2511231006 | 2511268487 | 630 |
| 923 | iso_pu_bacteria | 2511231007 | 2511270698 | 630 |
| 924 | iso_pu_bacteria | 2511231008 | 2511277278 | 630 |
| 925 | iso_pu_bacteria | 2511231010 | 2511292418 | 630 |
| 926 | iso_pu_bacteria | 2511231011 | 2511294716 | 630 |
| 927 | iso_pu_bacteria | 2511231012 | 2511303388 | 630 |
| 928 | iso_pu_bacteria | 2511231014 | 2511312807 | 630 |
| 929 | iso_pu_bacteria | 2511231015 | 2511320260 | 630 |
| 930 | iso_pu_bacteria | 2511231016 | 2511328757 | 630 |
| 931 | iso_pu_bacteria | 2511231017 | 2511331707 | 630 |
| 932 | iso_pu_bacteria | 2511231018 | 2511340209 | 630 |
| 933 | iso_pu_bacteria | 2511231019 | 2511343880 | 630 |
| 934 | iso_pu_bacteria | 2511231020 | 2511350207 | 630 |
| 935 | iso_pu_bacteria | 2511231021 | 2511358534 | 630 |
| 936 | iso_pu_bacteria | 2511231022 | 2511362844 | 630 |
| 937 | iso_pu_bacteria | 2511231023 | 2511369834 | 630 |
| 938 | iso_pu_bacteria | 2511231024 | 2511374050 | 630 |
| 939 | iso_pu_bacteria | 2511231031 | 2511416250 | 630 |
| 940 | iso_pu_bacteria | 2512047018 | 2512324840 | 630 |
| 941 | iso_pu_bacteria | 2554235231 | 2555247184 | 630 |
| 942 | iso_pu_bacteria | 2582580891 | 2583790964 | 630 |
| 943 | iso_pu_bacteria | 2597489887 | 2597856891 | 630 |
| 944 | iso_pu_bacteria | 2597489888 | 2597863092 | 630 |
| 945 | iso_pu_bacteria | 2597489889 | 2597868884 | 630 |
| 946 | iso_pu_bacteria | 2599185155 | 2599326658 | 630 |
| 947 | iso_pu_bacteria | 2599185160 | 2599357082 | 630 |
| 948 | iso_pu_bacteria | 2599185161 | 2599362131 | 630 |
| 949 | iso_pu_bacteria | 2599185162 | 2599368451 | 630 |
| 950 | iso_pu_bacteria | 2599185163 | 2599375240 | 630 |
| 951 | iso_pu_bacteria | 2599185164 | 2599382187 | 630 |
| 952 | iso_pu_bacteria | 2599185165 | 2599388634 | 630 |
| 953 | iso_pu_bacteria | 2599185166 | 2599394098 | 630 |
| 954 | iso_pu_bacteria | 2599185167 | 2599401674 | 630 |
| 955 | iso_pu_bacteria | 2599185168 | 2599405863 | 630 |
| 956 | iso_pu_bacteria | 2599185179 | 2599451783 | 630 |
| 957 | iso_pu_bacteria | 2599185181 | 2599464413 | 630 |
| 958 | iso_pu_bacteria | 2599185182 | 2599468737 | 630 |
| 959 | iso_pu_bacteria | 2599185185 | 2599483918 | 630 |
| 960 | iso_pu_bacteria | 2599185186 | 2599493436 | 630 |
| 961 | iso_pu_bacteria | 2599185188 | 2599504235 | 630 |
| 962 | iso_pu_bacteria | 2599185189 | 2599509559 | 630 |
| 963 | iso_pu_bacteria | 2599185190 | 2599514920 | 630 |
| 964 | iso_pu_bacteria | 2599185191 | 2599521017 | 630 |
| 965 | iso_pu_bacteria | 2599185212 | 2599613518 | 630 |
| 966 | iso_pu_bacteria | 2599185248 | 2599772430 | 630 |
| 967 | iso_pu_bacteria | 2599185257 | 2599801564 | 630 |
| 968 | iso_pu_bacteria | 2599185288 | 2599882265 | 630 |
| 969 | iso_pu_bacteria | 2599185289 | 2599888848 | 630 |
| 970 | iso_pu_bacteria | 2599185290 | 2599894283 | 630 |
| 971 | iso_pu_bacteria | 2599185291 | 2599900477 | 630 |
| 972 | iso_pu_bacteria | 2599185300 | 2599933504 | 630 |
| 973 | iso_pu_bacteria | 2599185302 | 2599944044 | 630 |
| 974 | iso_pu_bacteria | 2599185303 | 2599952369 | 630 |
| 975 | iso_pu_bacteria | 2599185304 | 2599955744 | 630 |
| 976 | iso_pu_bacteria | 2599185305 | 2599961373 | 630 |
| 977 | iso_pu_bacteria | 2599185306 | 2599967304 | 630 |
| 978 | iso_pu_bacteria | 2599185307 | 2599970474 | 630 |
| 979 | iso_pu_bacteria | 2599185308 | 2599979301 | 630 |
| 980 | iso_pu_bacteria | 2599185309 | 2599985545 | 630 |
| 981 | iso_pu_bacteria | 2599185310 | 2599989418 | 630 |
| 982 | iso_pu_bacteria | 2599185311 | 2599994341 | 630 |
| 983 | iso_pu_bacteria | 2599185312 | 2600000186 | 630 |
| 984 | iso_pu_bacteria | 2599185313 | 2600008365 | 630 |
| 985 | iso_pu_bacteria | 2599185314 | 2600013186 | 630 |
| 986 | iso_pu_bacteria | 2599185315 | 2600019685 | 630 |
| 987 | iso_pu_bacteria | 2599185316 | 2600023634 | 630 |
| 988 | iso_pu_bacteria | 2599185317 | 2600032515 | 630 |
| 989 | iso_pu_bacteria | 2599185318 | 2600038986 | 630 |
| 990 | iso_pu_bacteria | 2599185319 | 2600044853 | 630 |
| 991 | iso_pu_bacteria | 2599185320 | 2600048493 | 630 |
| 992 | iso_pu_bacteria | 2599185321 | 2600054195 | 630 |
| 993 | iso_pu_bacteria | 2599185322 | 2600060407 | 630 |
| 994 | iso_pu_bacteria | 2599185323 | 2600066499 | 630 |
| 995 | iso_pu_bacteria | 2599185324 | 2600073438 | 630 |
| 996 | iso_pu_bacteria | 2599185325 | 2600078191 | 630 |
| 997 | iso_pu_bacteria | 2599185356 | 2600216690 | 630 |
| 998 | iso_pu_bacteria | 2600254930 | 2600361756 | 630 |
| 999 | iso_pu_bacteria | 2600254931 | 2600365861 | 630 |
| 1000 | iso_pu_bacteria | 2600255283 | 2601624878 | 630 |
| 1001 | iso_pu_bacteria | 2600255296 | 2601694197 | 630 |
| 1002 | iso_pu_bacteria | 2600255313 | 2601776713 | 630 |
| 1003 | iso_pu_bacteria | 2600255318 | 2601795536 | 630 |
| 1004 | iso_pu_bacteria | 2603880185 | 2606075606 | 630 |
| 1005 | iso_pu_bacteria | 2603880199 | 2606128483 | 630 |
| 1006 | iso_pu_bacteria | 2619619299 | 2621300832 | 630 |
| 1007 | iso_pu_bacteria | 2623620443 | 2624479473 | 630 |
| 1008 | iso_pu_bacteria | 2623620446 | 2624493529 | 630 |
| 1009 | iso_pu_bacteria | 2643221565 | 2643841718 | 630 |
| 1010 | iso_pu_bacteria | 2643221571 | 2643870627 | 630 |
| 1011 | iso_pu_bacteria | 2643221589 | 2643952608 | 630 |
| 1012 | iso_pu_bacteria | 2643221602 | 2644022370 | 630 |
| 1013 | iso_pu_bacteria | 2643221633 | 2644188573 | 630 |
| 1014 | iso_pu_bacteria | 2643221650 | 2644286142 | 630 |
| 1015 | iso_pu_bacteria | 2643221713 | 2644623085 | 630 |
| 1016 | iso_pu_bacteria | 2651869719 | 2652547885 | 630 |
| 1017 | iso_pu_bacteria | 2667528170 | 2671093138 | 630 |
| 1018 | iso_pu_bacteria | 2667528171 | 2671098770 | 630 |
| 1019 | iso_pu_bacteria | 2667528176 | 2671128991 | 630 |
| 1020 | iso_pu_bacteria | 2671180172 | 2671768513 | 630 |
| 1021 | iso_pu_bacteria | 2675903420 | 2677898200 | 630 |
| 1022 | iso_pu_bacteria | 2675903515 | 2678264560 | 630 |
| 1023 | iso_pu_bacteria | 2713897148 | 2715753866 | 630 |
| 1024 | iso_pu_bacteria | 2713897149 | 2715757739 | 630 |
| 1025 | iso_pu_bacteria | 2718217725 | 2718633321 | 630 |
| 1026 | iso_pu_bacteria | 2721755607 | 2723247911 | 630 |
| 1027 | iso_pu_bacteria | 2738541265 | 2738670549 | 630 |
| 1028 | iso_pu_bacteria | 2738541271 | 2738688528 | 630 |
| 1029 | iso_pu_bacteria | 2738541282 | 2738748942 | 630 |
| 1030 | iso_pu_bacteria | 2738541294 | 2738810918 | 630 |
| 1031 | iso_pu_bacteria | 2738541303 | 2738857984 | 630 |
| 1032 | iso_pu_bacteria | 2738541309 | 2738898278 | 630 |
| 1033 | iso_pu_bacteria | 2738543004 | 2739201290 | 630 |
| 1034 | iso_pu_bacteria | 2738543015 | 2739261146 | 630 |
| 1035 | iso_pu_bacteria | 2738543016 | 2739264260 | 630 |
| 1036 | iso_pu_bacteria | 2738543025 | 2739315983 | 630 |
| 1037 | iso_pu_bacteria | 2740892503 | 2743736319 | 630 |
| 1038 | iso_pu_bacteria | 2744054620 | 2745005014 | 630 |
| 1039 | iso_pu_bacteria | 2765235841 | 2765582965 | 630 |
| 1040 | iso_pu_bacteria | 2773857670 | 2774121306 | 630 |
| 1041 | iso_pu_bacteria | 2773857673 | 2774137630 | 630 |
| 1042 | iso_pu_bacteria | 2784132063 | 2784265618 | 630 |
| 1043 | iso_pu_bacteria | 2784132072 | 2784317400 | 630 |
| 1044 | iso_pu_bacteria | 2791355520 | 2794595859 | 630 |
| 1045 | iso_pu_bacteria | 2806310737 | 2807407476 | 630 |
| 1046 | iso_pu_bacteria | 2806310745 | 2807455813 | 630 |
| 1047 | iso_pu_bacteria | 2808606361 | 2808857011 | 630 |
| 1048 | iso_pu_bacteria | 2808606376 | 2808926956 | 630 |
| 1049 | iso_pu_bacteria | 2808606377 | 2808927401 | 630 |
| 1050 | iso_pu_bacteria | 2808606378 | 2808937083 | 630 |
| 1051 | iso_pu_bacteria | 2808606380 | 2808949110 | 630 |
| 1052 | iso_pu_bacteria | 2808606381 | 2808950060 | 630 |
| 1053 | iso_pu_bacteria | 2808606382 | 2808961555 | 630 |
| 1054 | iso_pu_bacteria | 2808606383 | 2808965399 | 630 |
| 1055 | iso_pu_bacteria | 2808606385 | 2808979368 | 630 |
| 1056 | iso_pu_bacteria | 2808606388 | 2808995292 | 630 |
| 1057 | iso_pu_bacteria | 2808606389 | 2809000360 | 630 |
| 1058 | iso_pu_bacteria | 2808606445 | 2809216409 | 630 |
| 1059 | iso_pu_bacteria | 2816332298 | 2817489868 | 630 |
| 1060 | iso_pu_bacteria | 2818991456 | 2819654759 | 630 |
| 1061 | iso_pu_bacteria | 2818991464 | 2819703891 | 630 |
| 1062 | iso_pu_bacteria | 2825651385 | 2825656498 | 630 |
| 1063 | iso_pu_bacteria | 2826581358 | 2826583038 | 630 |
| 1064 | iso_pu_bacteria | 2834028612 | 2834029741 | 630 |
| 1065 | iso_pu_bacteria | 2842815866 | 2842817556 | 630 |
| 1066 | iso_pu_bacteria | 2842826826 | 2842831012 | 630 |
| 1067 | iso_pu_bacteria | 2842832357 | 2842832656 | 630 |
| 1068 | iso_pu_bacteria | 2842837860 | 2842841485 | 630 |
| 1069 | iso_pu_bacteria | 2842843487 | 2842848258 | 630 |
| 1070 | iso_pu_bacteria | 2842849001 | 2842850707 | 630 |
| 1071 | iso_pu_bacteria | 2842854478 | 2842856883 | 630 |
| 1072 | iso_pu_bacteria | 2844665904 | 2844669211 | 630 |
| 1073 | iso_pu_bacteria | 2852612431 | 2852618375 | 630 |
| 1074 | iso_pu_bacteria | 2852657418 | 2852658956 | 630 |
| 1075 | iso_pu_bacteria | 2852667396 | 2852673489 | 630 |
| 1076 | iso_pu_bacteria | 2860339153 | 2860339983 | 630 |
| 1077 | iso_pu_bacteria | 2860867994 | 2860869736 | 630 |
| 1078 | iso_pu_bacteria | 2878029506 | 2878031476 | 630 |
| 1079 | iso_pu_bacteria | 2880230671 | 2880232346 | 630 |
| 1080 | iso_pu_bacteria | 2904518522 | 2904521763 | 630 |
| 1081 | iso_pu_bacteria | 2904550169 | 2904553159 | 630 |
| 1082 | iso_pu_bacteria | 2908446538 | 2908448678 | 630 |
| 1083 | iso_pu_bacteria | 2912963787 | 2912965499 | 630 |
| 1084 | iso_pu_bacteria | 2913036834 | 2913041037 | 630 |
| 1085 | iso_pu_bacteria | 2917070673 | 2917072483 | 630 |
| 1086 | iso_pu_bacteria | 2919063839 | 2919064053 | 630 |
| 1087 | iso_pu_bacteria | 2919155634 | 2919159762 | 630 |
| 1088 | iso_pu_bacteria | 2919385768 | 2919386440 | 630 |
| 1089 | iso_pu_bacteria | 2919456309 | 2919457077 | 630 |
| 1090 | iso_pu_bacteria | 2919481497 | 2919486207 | 630 |
| 1091 | iso_pu_bacteria | 2919487758 | 2919491278 | 630 |
| 1092 | iso_pu_bacteria | 2919697872 | 2919702831 | 630 |
| 1093 | iso_pu_bacteria | 2923153595 | 2923155333 | 630 |
| 1094 | iso_pu_bacteria | 2923586266 | 2923590072 | 630 |
| 1095 | iso_pu_bacteria | 2929144301 | 2929148537 | 630 |
| 1096 | iso_pu_bacteria | 2929189879 | 2929191708 | 630 |
| 1097 | iso_pu_bacteria | 2931369376 | 2931374021 | 630 |
| 1098 | iso_pu_bacteria | 2931390751 | 2931392811 | 630 |
| 1099 | iso_pu_bacteria | 2931396565 | 2931400125 | 630 |
| 1100 | iso_pu_bacteria | 2935353572 | 2935354647 | 630 |
| 1101 | iso_pu_bacteria | 2939636861 | 2939639702 | 630 |
| 1102 | iso_pu_bacteria | 2939651529 | 2939655481 | 630 |
| 1103 | iso_pu_bacteria | 2945928738 | 2945928859 | 630 |
| 1104 | iso_pu_bacteria | 2945961074 | 2945965119 | 630 |
| 1105 | iso_pu_bacteria | 2946006987 | 2946011061 | 630 |
| 1106 | iso_pu_bacteria | 2946027586 | 2946029991 | 630 |
| 1107 | iso_pu_bacteria | 2947233263 | 2947236565 | 630 |
| 1108 | iso_pu_bacteria | 2969304461 | 2969306259 | 630 |
| 1109 | iso_pu_bacteria | 2974289157 | 2974292087 | 630 |
| 1110 | iso_pu_bacteria | 2984286254 | 2984290705 | 630 |
| 1111 | iso_pu_bacteria | 2988728565 | 2988730130 | 630 |
| 1112 | iso_pu_bacteria | 2998139840 | 2998141654 | 630 |
| 1113 | iso_pu_bacteria | 3007395558 | 3007400873 | 630 |
| 1114 | iso_pu_bacteria | 3007419365 | 3007424521 | 630 |
| 1115 | iso_pu_bacteria | 3007511990 | 3007513052 | 630 |
| 1116 | iso_pu_bacteria | 3007614139 | 3007615890 | 630 |
| 1117 | iso_pu_bacteria | 3007619802 | 3007619920 | 630 |
| 1118 | iso_pu_bacteria | 3007718800 | 3007722477 | 630 |
| 1119 | iso_pu_bacteria | 3007803356 | 3007808500 | 630 |
| 1120 | iso_pu_bacteria | 3007855910 | 3007856245 | 630 |
| 1121 | iso_pu_bacteria | 3007861166 | 3007863107 | 630 |
| 1122 | iso_pu_bacteria | 3007866637 | 3007868053 | 630 |
| 1123 | iso_pu_bacteria | 3007872151 | 3007874756 | 630 |
| 1124 | iso_pu_bacteria | 637000220 | 637319068 | 630 |
| 1125 | iso_pu_bacteria | 8015687852 | 8015689551 | 630 |
| 1126 | iso_pu_bacteria | 8019769354 | 8019774051 | 630 |
| 1127 | iso_pu_bacteria | 8019775933 | 8019780288 | 630 |
| 1128 | iso_pu_bacteria | 8029995093 | 8029999102 | 630 |
| 1129 | iso_pu_bacteria | 8052494512 | 8052498300 | 630 |
| 1130 | iso_pu_bacteria | 8054285046 | 8054287214 | 630 |
| 1131 | iso_pu_bacteria | 8054347763 | 8054352167 | 630 |
| 1132 | iso_pu_bacteria | 8054503363 | 8054505312 | 630 |
| 1133 | iso_pu_bacteria | 8054929484 | 8054931447 | 630 |
| 1134 | iso_pu_bacteria | 8055770955 | 8055772688 | 630 |
| 1135 | iso_pu_bacteria | 8055817908 | 8055819869 | 630 |
| 1136 | iso_pu_bacteria | 8055878733 | 8055880445 | 630 |
| 1137 | iso_pu_bacteria | 8056115690 | 8056119664 | 630 |
| 1138 | iso_pu_bacteria | 8056120720 | 8056122522 | 630 |
| 1139 | iso_pu_bacteria | 8056125926 | 8056130148 | 630 |
| 1140 | iso_pu_bacteria | 8056131705 | 8056133636 | 630 |
| 1141 | iso_pu_bacteria | 8056137416 | 8056141214 | 630 |
| 1142 | iso_pu_bacteria | 8056143049 | 8056144840 | 630 |
| 1143 | iso_pu_bacteria | 8056148874 | 8056150545 | 630 |
| 1144 | iso_pu_bacteria | 8056155041 | 8056156193 | 630 |
| 1145 | iso_pu_bacteria | 8056161164 | 8056165059 | 630 |
| 1146 | iso_pu_bacteria | 8056166840 | 8056169337 | 630 |
| 1147 | iso_pu_bacteria | 8056177738 | 8056181182 | 630 |
| 1148 | iso_pu_bacteria | 8056569372 | 8056573190 | 630 |
| 1149 | iso_pu_bacteria | 8057798959 | 8057799109 | 630 |
| 1150 | 3300003771 | Ga0055526_1001264 | Ga0055526_10012642 | 631 |
| 1151 | 3300003773 | Ga0055537_1000338 | Ga0055537_10003382 | 631 |
| 1152 | 3300003781 | Ga0055536_1001498 | Ga0055536_10014986 | 631 |
| 1153 | 3300003784 | Ga0055534_1000039 | Ga0055534_100003970 | 631 |
| 1154 | 3300003790 | Ga0055528_1000212 | Ga0055528_100021217 | 631 |
| 1155 | 3300013102 | Ga0157371_10000487 | Ga0157371_1000048744 | 631 |
| 1156 | 3300013104 | Ga0157370_10000797 | Ga0157370_1000079733 | 631 |
| 1157 | 3300015262 | Ga0182007_10000043 | Ga0182007_1000004349 | 631 |
| 1158 | 3300015265 | Ga0182005_1000225 | Ga0182005_10002258 | 631 |
| 1159 | 3300025263 | Ga0209565_1000014 | Ga0209565_1000014145 | 631 |
| 1160 | 3300025273 | Ga0209673_1000171 | Ga0209673_100017180 | 631 |
| 1161 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011425 | 631 |
| 1162 | 3300025292 | Ga0209676_1000027 | Ga0209676_100002758 | 631 |
| 1163 | 3300025292 | Ga0209676_1000079 | Ga0209676_1000079210 | 631 |
| 1164 | 3300025292 | Ga0209676_1000970 | Ga0209676_100097024 | 631 |
| 1165 | 3300025295 | Ga0209564_1000221 | Ga0209564_100022146 | 631 |
| 1166 | 3300025298 | Ga0209050_1000329 | Ga0209050_100032944 | 631 |
| 1167 | 3300025299 | Ga0209256_1005108 | Ga0209256_10051082 | 631 |
| 1168 | 3300025304 | Ga0209257_1000081 | Ga0209257_1000081220 | 631 |
| 1169 | 3300025304 | Ga0209257_1004574 | Ga0209257_100457410 | 631 |
| 1170 | 3300025935 | Ga0207709_10012063 | Ga0207709_100120632 | 631 |
| 1171 | 3300027312 | Ga0209371_1002751 | Ga0209371_10027518 | 631 |
| 1172 | 3300027395 | Ga0209996_1001214 | Ga0209996_10012141 | 631 |
| 1173 | 3300027471 | Ga0209995_1001793 | Ga0209995_10017932 | 631 |
| 1174 | 3300027665 | Ga0209983_1002193 | Ga0209983_10021933 | 631 |
| 1175 | 3300030500 | Ga0268256_1002457 | Ga0268256_10024572 | 631 |
| 1176 | 3300031251 | Ga0265327_10000463 | Ga0265327_1000046329 | 631 |
| 1177 | 3300031548 | Ga0307408_100000057 | Ga0307408_10000005761 | 631 |
| 1178 | 3300039062 | Ga0400483_234758 | Ga0400483_234758_1041_2948 | 631 |
| 1179 | 3300041459 | Ga0451800_0211862 | Ga0451800_0211862_357_2261 | 631 |
| 1180 | 3300041462 | Ga0451806_617527 | Ga0451806_617527_322_2226 | 631 |
| 1181 | 3300041486 | Ga0451807_1185460 | Ga0451807_1185460_579_2483 | 631 |
| 1182 | 3300046460 | Ga0495638_0021129 | Ga0495638_0021129_2148_4076 | 631 |
| 1183 | 3300046507 | Ga0495606_0000861 | Ga0495606_0000861_38953_40851 | 631 |
| 1184 | 3300046512 | Ga0495610_0014992 | Ga0495610_0014992_958_2856 | 631 |
| 1185 | 3300046518 | Ga0495631_0000558 | Ga0495631_0000558_19309_21207 | 631 |
| 1186 | 3300046522 | Ga0495643_0002111 | Ga0495643_0002111_8710_10608 | 631 |
| 1187 | 3300048922 | Ga0496119_0000659 | Ga0496119_0000659_37299_39197 | 631 |
| 1188 | 3300048923 | Ga0496120_0000217 | Ga0496120_0000217_57312_59210 | 631 |
| 1189 | 3300048925 | Ga0496122_0000372 | Ga0496122_0000372_32478_34382 | 631 |
| 1190 | 3300048926 | Ga0496123_0003662 | Ga0496123_0003662_8316_10220 | 631 |
| 1191 | 3300049571 | Ga0501034_0000272 | Ga0501034_0000272_71735_73633 | 631 |
| 1192 | 3300053161 | Ga0500634_0025602 | Ga0500634_0025602_835_2733 | 631 |
| 1193 | iso_pu_bacteria | 2842780639 | 2842781256 | 631 |
| 1194 | 3300009148 | Ga0105243_10005617 | Ga0105243_100056178 | 632 |
| 1195 | 3300013105 | Ga0157369_10051728 | Ga0157369_100517284 | 632 |
| 1196 | 3300031727 | Ga0316576_10012548 | Ga0316576_100125483 | 632 |
| 1197 | 3300031728 | Ga0316578_10019319 | Ga0316578_100193191 | 632 |
| 1198 | 3300046460 | Ga0495638_0002776 | Ga0495638_0002776_6209_8158 | 632 |
| 1199 | 3300046530 | Ga0495654_0006490 | Ga0495654_0006490_1265_3163 | 632 |
| 1200 | 3300047323 | Ga0495683_0002550 | Ga0495683_0002550_2920_4818 | 632 |
| 1201 | 3300048920 | Ga0496117_0001459 | Ga0496117_0001459_9156_11306 | 632 |
| 1202 | 3300048920 | Ga0496117_0012041 | Ga0496117_0012041_822_2720 | 632 |
| 1203 | 3300048921 | Ga0496118_0000528 | Ga0496118_0000528_52752_54902 | 632 |
| 1204 | 3300048922 | Ga0496119_0000910 | Ga0496119_0000910_15764_17662 | 632 |
| 1205 | 3300048924 | Ga0496121_0049366 | Ga0496121_0049366_1342_3480 | 632 |
| 1206 | 3300048925 | Ga0496122_0004029 | Ga0496122_0004029_12068_13966 | 632 |
| 1207 | 3300048925 | Ga0496122_0049165 | Ga0496122_0049165_577_2526 | 632 |
| 1208 | 3300048926 | Ga0496123_0001489 | Ga0496123_0001489_14642_16540 | 632 |
| 1209 | 3300048928 | Ga0496125_0063020 | Ga0496125_0063020_686_2842 | 632 |
| 1210 | iso_pu_bacteria | 2511231156 | 2511826221 | 632 |
| 1211 | iso_pu_bacteria | 2554235341 | 2555668709 | 632 |
| 1212 | 3300025298 | Ga0209050_1022831 | Ga0209050_10228312 | 633 |
| 1213 | 3300025304 | Ga0209257_1000150 | Ga0209257_100015029 | 633 |
| 1214 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_557_2473 | 633 |
| 1215 | iso_pu_bacteria | 2690315857 | 2691330897 | 633 |
| 1216 | iso_pu_bacteria | 2919534386 | 2919534450 | 633 |
| 1217 | 3300002737 | JGI25162J39368_1000364 | JGI25162J39368_10003649 | 634 |
| 1218 | 3300002737 | JGI25162J39368_1000384 | JGI25162J39368_100038433 | 634 |
| 1219 | 3300002772 | JGI25164J39214_1000268 | JGI25164J39214_10002689 | 634 |
| 1220 | 3300002772 | JGI25164J39214_1000481 | JGI25164J39214_100048110 | 634 |
| 1221 | 3300003214 | JGI25165J46597_1000483 | JGI25165J46597_10004839 | 634 |
| 1222 | 3300003214 | JGI25165J46597_1000497 | JGI25165J46597_100049733 | 634 |
| 1223 | 3300003751 | Ga0055538_1000058 | Ga0055538_100005839 | 634 |
| 1224 | 3300003752 | Ga0055539_1000087 | Ga0055539_100008770 | 634 |
| 1225 | 3300003756 | Ga0055533_1000097 | Ga0055533_100009770 | 634 |
| 1226 | 3300003758 | Ga0055532_1000156 | Ga0055532_100015616 | 634 |
| 1227 | 3300003759 | Ga0055525_1000426 | Ga0055525_10004268 | 634 |
| 1228 | 3300003791 | Ga0055530_10002926 | Ga0055530_100029267 | 634 |
| 1229 | 3300003792 | Ga0055540_1002281 | Ga0055540_10022817 | 634 |
| 1230 | 3300003794 | Ga0055531_10000989 | Ga0055531_100009896 | 634 |
| 1231 | 3300003841 | Ga0055541_1000060 | Ga0055541_100006040 | 634 |
| 1232 | 3300005288 | Ga0065714_10000033 | Ga0065714_100000338 | 634 |
| 1233 | 3300005288 | Ga0065714_10003895 | Ga0065714_100038954 | 634 |
| 1234 | 3300005289 | Ga0065704_10003677 | Ga0065704_100036774 | 634 |
| 1235 | 3300005289 | Ga0065704_10072175 | Ga0065704_100721756 | 634 |
| 1236 | 3300005290 | Ga0065712_10004516 | Ga0065712_100045167 | 634 |
| 1237 | 3300005344 | Ga0070661_100000029 | Ga0070661_10000002987 | 634 |
| 1238 | 3300005457 | Ga0070662_100041876 | Ga0070662_1000418762 | 634 |
| 1239 | 3300005834 | Ga0068851_10000079 | Ga0068851_1000007932 | 634 |
| 1240 | 3300006946 | Ga0079104_1002022 | Ga0079104_10020228 | 634 |
| 1241 | 3300006946 | Ga0079104_1002085 | Ga0079104_10020859 | 634 |
| 1242 | 3300025206 | Ga0209435_100916 | Ga0209435_1009162 | 634 |
| 1243 | 3300025207 | Ga0209760_100011 | Ga0209760_100011157 | 634 |
| 1244 | 3300025224 | Ga0209784_100040 | Ga0209784_100040110 | 634 |
| 1245 | 3300025225 | Ga0209566_100051 | Ga0209566_100051110 | 634 |
| 1246 | 3300025226 | Ga0209674_100072 | Ga0209674_100072110 | 634 |
| 1247 | 3300025229 | Ga0209147_100067 | Ga0209147_100067110 | 634 |
| 1248 | 3300025230 | Ga0209563_100073 | Ga0209563_100073110 | 634 |
| 1249 | 3300025231 | Ga0207427_100008 | Ga0207427_100008338 | 634 |
| 1250 | 3300025233 | Ga0209437_100014 | Ga0209437_100014373 | 634 |
| 1251 | 3300025246 | Ga0209646_1000216 | Ga0209646_10002166 | 634 |
| 1252 | 3300025253 | Ga0209677_100063 | Ga0209677_100063110 | 634 |
| 1253 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008373 | 634 |
| 1254 | 3300025291 | Ga0209675_1000639 | Ga0209675_10006392 | 634 |
| 1255 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016573 | 634 |
| 1256 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021280 | 634 |
| 1257 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033391 | 634 |
| 1258 | 3300025292 | Ga0209676_1000474 | Ga0209676_100047411 | 634 |
| 1259 | 3300025292 | Ga0209676_1015643 | Ga0209676_10156432 | 634 |
| 1260 | 3300025298 | Ga0209050_1000235 | Ga0209050_100023528 | 634 |
| 1261 | 3300025298 | Ga0209050_1000477 | Ga0209050_100047716 | 634 |
| 1262 | 3300025303 | Ga0209051_1000043 | Ga0209051_100004357 | 634 |
| 1263 | 3300025303 | Ga0209051_1000123 | Ga0209051_100012388 | 634 |
| 1264 | 3300025303 | Ga0209051_1001937 | Ga0209051_100193710 | 634 |
| 1265 | 3300025304 | Ga0209257_1000604 | Ga0209257_100060457 | 634 |
| 1266 | 3300025321 | Ga0207656_10000093 | Ga0207656_100000936 | 634 |
| 1267 | 3300025711 | Ga0207696_1000081 | Ga0207696_1000081145 | 634 |
| 1268 | 3300025711 | Ga0207696_1000472 | Ga0207696_100047231 | 634 |
| 1269 | 3300025711 | Ga0207696_1000546 | Ga0207696_10005469 | 634 |
| 1270 | 3300025711 | Ga0207696_1006510 | Ga0207696_10065103 | 634 |
| 1271 | 3300025711 | Ga0207696_1006511 | Ga0207696_10065113 | 634 |
| 1272 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005687 | 634 |
| 1273 | 3300025728 | Ga0207655_1000448 | Ga0207655_10004481 | 634 |
| 1274 | 3300025728 | Ga0207655_1000530 | Ga0207655_10005306 | 634 |
| 1275 | 3300025728 | Ga0207655_1001462 | Ga0207655_100146211 | 634 |
| 1276 | 3300025728 | Ga0207655_1002985 | Ga0207655_10029856 | 634 |
| 1277 | 3300025728 | Ga0207655_1003562 | Ga0207655_10035627 | 634 |
| 1278 | 3300025728 | Ga0207655_1012449 | Ga0207655_10124492 | 634 |
| 1279 | 3300025735 | Ga0207713_1000519 | Ga0207713_100051912 | 634 |
| 1280 | 3300025735 | Ga0207713_1000618 | Ga0207713_100061832 | 634 |
| 1281 | 3300025735 | Ga0207713_1003433 | Ga0207713_10034336 | 634 |
| 1282 | 3300025735 | Ga0207713_1003436 | Ga0207713_10034367 | 634 |
| 1283 | 3300025735 | Ga0207713_1003886 | Ga0207713_10038864 | 634 |
| 1284 | 3300025735 | Ga0207713_1007978 | Ga0207713_10079785 | 634 |
| 1285 | 3300025735 | Ga0207713_1011492 | Ga0207713_10114926 | 634 |
| 1286 | 3300025914 | Ga0207671_10000287 | Ga0207671_1000028715 | 634 |
| 1287 | 3300025925 | Ga0207650_10000255 | Ga0207650_1000025550 | 634 |
| 1288 | 3300025935 | Ga0207709_10000053 | Ga0207709_10000053169 | 634 |
| 1289 | 3300025935 | Ga0207709_10002036 | Ga0207709_100020368 | 634 |
| 1290 | 3300025935 | Ga0207709_10016817 | Ga0207709_100168173 | 634 |
| 1291 | 3300025945 | Ga0207679_10000018 | Ga0207679_10000018126 | 634 |
| 1292 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010640 | 634 |
| 1293 | 3300027111 | Ga0209281_1000331 | Ga0209281_10003319 | 634 |
| 1294 | 3300027111 | Ga0209281_1003727 | Ga0209281_10037272 | 634 |
| 1295 | 3300027296 | Ga0209389_1001707 | Ga0209389_10017074 | 634 |
| 1296 | 3300030733 | Ga0314311_1124074 | Ga0314311_11240742 | 634 |
| 1297 | 3300030735 | Ga0316178_1127053 | Ga0316178_112705319 | 634 |
| 1298 | 3300042013 | Ga0439456_000278 | Ga0439456_000278_4454_6358 | 634 |
| 1299 | 3300046515 | Ga0495620_0000083 | Ga0495620_0000083_62544_64448 | 634 |
| 1300 | 3300046522 | Ga0495643_0004357 | Ga0495643_0004357_3465_5369 | 634 |
| 1301 | 3300046522 | Ga0495643_0007246 | Ga0495643_0007246_3203_5107 | 634 |
| 1302 | 3300046663 | Ga0495635_0004064 | Ga0495635_0004064_5694_7598 | 634 |
| 1303 | 3300046680 | Ga0495646_0014122 | Ga0495646_0014122_2655_4559 | 634 |
| 1304 | 3300046809 | Ga0495600_0030133 | Ga0495600_0030133_578_2482 | 634 |
| 1305 | 3300047322 | Ga0495680_0014781 | Ga0495680_0014781_4310_6214 | 634 |
| 1306 | 3300047444 | Ga0495675_0008743 | Ga0495675_0008743_2341_4245 | 634 |
| 1307 | 3300048923 | Ga0496120_0005573 | Ga0496120_0005573_4054_5958 | 634 |
| 1308 | 3300048927 | Ga0496124_0027491 | Ga0496124_0027491_2030_3934 | 634 |
| 1309 | 3300048928 | Ga0496125_0014751 | Ga0496125_0014751_1110_3014 | 634 |
| 1310 | 3300048928 | Ga0496125_0063376 | Ga0496125_0063376_35_1942 | 634 |
| 1311 | 3300049571 | Ga0501034_0002511 | Ga0501034_0002511_16521_18425 | 634 |
| 1312 | 2124908027 | MRS2a_Contig_22 | MRS2a_00121960 | 636 |
| 1313 | 3300009011 | Ga0105251_10005507 | Ga0105251_100055076 | 636 |
| 1314 | 3300009148 | Ga0105243_10003465 | Ga0105243_100034658 | 636 |
| 1315 | 3300009148 | Ga0105243_10005820 | Ga0105243_100058209 | 636 |
| 1316 | 3300009176 | Ga0105242_10002334 | Ga0105242_100023347 | 636 |
| 1317 | 3300009545 | Ga0105237_10001936 | Ga0105237_1000193611 | 636 |
| 1318 | 3300011119 | Ga0105246_10006097 | Ga0105246_100060977 | 636 |
| 1319 | 3300013100 | Ga0157373_10004039 | Ga0157373_100040397 | 636 |
| 1320 | 3300013102 | Ga0157371_10002311 | Ga0157371_1000231115 | 636 |
| 1321 | 3300013105 | Ga0157369_10018126 | Ga0157369_100181267 | 636 |
| 1322 | 3300013306 | Ga0163162_10010409 | Ga0163162_100104099 | 636 |
| 1323 | 3300013307 | Ga0157372_10012955 | Ga0157372_100129556 | 636 |
| 1324 | 3300025207 | Ga0209760_100174 | Ga0209760_10017433 | 636 |
| 1325 | 3300025231 | Ga0207427_100001 | Ga0207427_100001970 | 636 |
| 1326 | 3300025233 | Ga0209437_100003 | Ga0209437_100003402 | 636 |
| 1327 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007970 | 636 |
| 1328 | 3300038705 | Ga0237819_00849 | Ga0237819_00849_89_1999 | 636 |
| 1329 | 3300042010 | Ga0439452_002344 | Ga0439452_002344_3517_5427 | 636 |
| 1330 | 3300042010 | Ga0439452_002943 | Ga0439452_002943_1236_3146 | 636 |
| 1331 | 3300042115 | Ga0450911_001689 | Ga0450911_001689_367_2277 | 636 |
| 1332 | 3300042461 | Ga0439460_0001205 | Ga0439460_0001205_545_2455 | 636 |
| 1333 | 3300046452 | Ga0495617_004198 | Ga0495617_004198_3244_5154 | 636 |
| 1334 | 3300046453 | Ga0495627_004653 | Ga0495627_004653_1703_3613 | 636 |
| 1335 | 3300046457 | Ga0495590_0001910 | Ga0495590_0001910_4489_6399 | 636 |
| 1336 | 3300046458 | Ga0495591_001205 | Ga0495591_001205_10273_12183 | 636 |
| 1337 | 3300046458 | Ga0495591_007890 | Ga0495591_007890_74_1984 | 636 |
| 1338 | 3300046492 | Ga0495585_0000394 | Ga0495585_0000394_3638_5548 | 636 |
| 1339 | 3300046500 | Ga0495596_0001337 | Ga0495596_0001337_7612_9522 | 636 |
| 1340 | 3300046520 | Ga0495637_0014466 | Ga0495637_0014466_316_2226 | 636 |
| 1341 | 3300046538 | Ga0495609_0000125 | Ga0495609_0000125_3996_5906 | 636 |
| 1342 | 3300046648 | Ga0495611_0001051 | Ga0495611_0001051_6664_8574 | 636 |
| 1343 | 3300046694 | Ga0495649_0003138 | Ga0495649_0003138_4928_6838 | 636 |
| 1344 | 3300046794 | Ga0495589_0002626 | Ga0495589_0002626_4759_6669 | 636 |
| 1345 | 3300047318 | Ga0495636_0007887 | Ga0495636_0007887_262_2172 | 636 |
| 1346 | 3300047320 | Ga0495672_0033100 | Ga0495672_0033100_184_2094 | 636 |
| 1347 | 3300047322 | Ga0495680_0039620 | Ga0495680_0039620_1318_3228 | 636 |
| 1348 | 3300047323 | Ga0495683_0025572 | Ga0495683_0025572_746_2656 | 636 |
| 1349 | 3300047444 | Ga0495675_0051538 | Ga0495675_0051538_407_2317 | 636 |
| 1350 | 3300047470 | Ga0495681_0014386 | Ga0495681_0014386_1364_3274 | 636 |
| 1351 | 3300047472 | Ga0495686_0005011 | Ga0495686_0005011_5437_7347 | 636 |
| 1352 | 3300048091 | Ga0495626_0005573 | Ga0495626_0005573_4201_6111 | 636 |
| 1353 | 3300048905 | Ga0496102_0003967 | Ga0496102_0003967_5931_7841 | 636 |
| 1354 | 3300048919 | Ga0496116_0004675 | Ga0496116_0004675_4715_6625 | 636 |
| 1355 | 3300048924 | Ga0496121_0007699 | Ga0496121_0007699_4709_6619 | 636 |
| 1356 | 3300048925 | Ga0496122_0014998 | Ga0496122_0014998_1195_3171 | 636 |
| 1357 | 3300048927 | Ga0496124_0009003 | Ga0496124_0009003_3514_5469 | 636 |
| 1358 | 3300048929 | Ga0496126_0018254 | Ga0496126_0018254_2964_4919 | 636 |
| 1359 | 3300049460 | Ga0495682_0000060 | Ga0495682_0000060_3410_5320 | 636 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gq0-assembly1.cif.gz_A | crystal structure of the middle domain of htpg, the e. coli hsp90 | 0.989 | 240 | 491 |
| 2gq0-assembly1.cif.gz_A | crystal structure of the middle domain of htpg, the e. coli hsp90 | 0.9699 | 240 | 491 |
| 1y4s-assembly1.cif.gz_B | conformation rearrangement of heat shock protein 90 upon adp binding | 0.9593 | 7 | 490 |
| 1y4s-assembly1.cif.gz_B | conformation rearrangement of heat shock protein 90 upon adp binding | 0.9534 | 7 | 490 |
| 1usv-assembly1.cif.gz_A | the structure of the complex between aha1 and hsp90 | 0.9531 | 239 | 491 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2iopD02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9738 | 250 | 408 | 3.30.230.80 |
| af_Q9VAY2_505_592_3.40.50.11260 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9681 | 406 | 494 | 3.40.50.11260 |
| af_K7V364_511_598_3.40.50.11260 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.968 | 406 | 494 | 3.40.50.11260 |
| 2iopD02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9678 | 250 | 408 | 3.30.230.80 |
| af_Q4DW89_459_546_3.40.50.11260 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9633 | 406 | 494 | 3.40.50.11260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1NUH8-F1-model_v4 | deleted | 0.9973 | 379 | 486 |
|
| AF-A0A5C8BQR5-F1-model_v4 | deleted | 0.9958 | 361 | 636 |
|
| AF-A0A5C8BQR5-F1-model_v4 | deleted | 0.9922 | 361 | 636 |
|
| AF-A0A351DPJ8-F1-model_v4 | Molecular chaperone HtpG | 0.9916 | 308 | 472 |
GO:0005524
GO:0016887 GO:0051082 GO:0140662 |
| AF-A0A3C1NUH8-F1-model_v4 | deleted | 0.9881 | 379 | 486 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar