F493379

General Info

Members Datasets Scaffolds Average Seq Length
1366 723 2732 196

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0273333|Ga0496101_0273333_430_1134
Length 234
Sequence MRGGRLIHLNHLAVIDVALFGAGVLQRNNAKCAGGERKMAHKILVFYGSYRSDRMGIRLADFLVAGLRARGDDAELIDAKAVGLPMLDRMYKEYPSGSAPPAMEALASKIRGADAFVFVVGEYNWGVQPGLKNLTDHFLEEWFWRPAAIASYSAGRFSGVRSSFAWHNTLSEMGMVVISSALAVGPIAQTLDADGAPSGPTGKALELAFPRFADDLAWWTDAAKAQRAQRSPPY

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
119 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
120 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
160 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
161 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
162 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
165 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
241 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
242 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
243 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
244 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
245 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
255 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
256 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
257 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
258 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
259 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
260 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
261 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
262 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
263 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
267 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
274 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
278 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
279 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
280 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
291 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
292 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
295 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
296 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
297 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
300 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
301 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
306 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
307 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
308 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
317 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
324 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
325 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
326 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
327 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
328 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
329 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
330 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
331 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
332 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
338 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
339 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
340 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
352 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
361 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
370 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
371 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
372 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
373 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
374 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
379 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
380 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
381 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
398 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
399 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
400 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
401 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
402 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
403 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
404 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
405 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
409 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
410 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
411 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
414 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
415 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
416 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
419 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
420 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
421 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
422 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
423 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
424 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
425 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
426 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
427 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
434 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
435 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
436 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
439 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
443 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
444 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
459 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
460 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
461 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
462 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
465 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
478 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
479 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
480 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
481 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
482 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
483 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
484 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
485 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
486 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
487 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
488 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
489 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
490 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
491 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
492 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
493 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
494 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
495 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
496 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
497 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
498 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
499 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
500 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
501 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
502 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
503 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
504 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
505 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
506 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
507 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
508 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
509 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
510 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
511 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
512 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
513 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
514 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
515 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
516 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
517 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
518 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
519 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
520 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
521 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
522 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
523 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
524 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
527 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
528 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
529 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
530 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
531 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
532 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
533 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
534 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
535 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
536 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
537 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
538 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
539 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
540 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
541 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
542 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
543 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
544 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
545 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
546 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
547 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
548 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
549 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
550 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
551 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
552 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
553 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
554 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
555 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
556 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
557 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
558 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
559 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
560 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
561 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
562 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
563 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
564 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
565 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
566 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
567 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
568 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
569 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
570 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
571 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
572 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
573 2643221651 Afipia sp. Root123D2 Isolate Unclassified
574 2643221658 Variovorax sp. Root411 Isolate Unclassified
575 2643221672 Variovorax sp. Root434 Isolate Unclassified
576 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
577 2738541277 Variovorax sp. GV051 Isolate Unclassified
578 2738541307 Variovorax sp. GV008 Isolate Unclassified
579 2738543019 Variovorax sp. GV040 Isolate Unclassified
580 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
581 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
582 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
583 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
584 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
585 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
586 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
587 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
588 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
589 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
590 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
591 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
592 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
593 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
594 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
595 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
596 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
597 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
598 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
599 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
600 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
601 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
602 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
603 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
604 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
605 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
606 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
607 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
608 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
609 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
610 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
611 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
612 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
613 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
614 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
615 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
616 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
617 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
618 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
619 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
620 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
621 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
622 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
623 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
624 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
625 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
626 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
627 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
628 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
629 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
630 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
631 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
632 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
633 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
634 2885198086 Variovorax sp. 679 Isolate Unclassified
635 2885211737 Variovorax sp. 553 Isolate Unclassified
636 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
637 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
638 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
639 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
640 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
641 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
642 2904456579 Variovorax sp. 2002 Isolate Unclassified
643 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
644 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
645 2904699407
646 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
647 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
648 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
649 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
650 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
651 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
652 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
653 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
654 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
655 2919675420 Luteimonas terrae 4099 Isolate Unclassified
656 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
657 2922368715
658 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
659 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
660 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
661 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
662 2929520902 Variovorax beijingensis 502 Isolate Unclassified
663 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
664 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
665 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
666 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
667 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
668 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
669 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
670 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
671 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
672 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
673 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
674 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
675 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
676 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
677 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
678 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
679 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
680 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
681 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
682 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
683 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
684 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
685 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
686 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
687 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
688 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
689 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
690 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
691 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
692 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
693 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
694 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
695 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
696 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
697 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
698 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
699 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
700 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
701 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
702 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
703 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
704 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
705 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
706 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
707 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
708 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
709 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
710 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
711 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
712 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
713 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
714 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
715 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
716 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
717 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
718 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
719 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
720 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
721 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
722 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
723 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 0.22
Isolates 13.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.84
Nodule 9.15
Rhizoplane 6.08
Rhizosphere 57.39
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0273333 3300048904 Bacteria 1319
2 JGI24740J21852_10026939 3300001979 Bacteria 1919
3 JGI24739J22299_10030477 3300001989 Bacteria 1870
4 JGI25162J39368_1000577 3300002737 Bacteria 26905
5 JGI25162J39368_1001401 3300002737 Bacteria 13172
6 JGI25162J39368_1001515 3300002737 Bacteria 12058
7 JGI25158J39367_1006561 3300002739 Bacteria 1664
8 JGI25152J39213_1028894 3300002773 Bacteria 878
9 JGI25159J45721_1029267 3300002987 Bacteria 909
10 JGI25151J46595_10001814 3300003187 Bacteria 13785
11 JGI25151J46595_10003602 3300003187 Bacteria 8481
12 JGI25406J46586_10000104 3300003203 Bacteria 37774
13 JGI25165J46597_1000654 3300003214 Bacteria 28366
14 JGI25165J46597_1001229 3300003214 Bacteria 15248
15 JGI25165J46597_1005089 3300003214 Bacteria 2617
16 JGI25153J46596_10000022 3300003215 Bacteria 251919
17 JGI25153J46596_10000531 3300003215 Bacteria 23973
18 rootH1_10106416 3300003323 Bacteria 2809
19 JGI25160J50197_1004582 3300003354 Bacteria 5953
20 JGI25160J50197_1006303 3300003354 Bacteria 4817
21 JGI25161J50226_1008089 3300003374 Bacteria 1663
22 Ga0006562J51391_1096725 3300003578 Bacteria 5880
23 Ga0006562J51391_1096726 3300003578 Bacteria 8227
24 Ga0055526_1021043 3300003771 Bacteria 2288
25 Ga0055537_1000134 3300003773 Bacteria 56046
26 Ga0055524_1019623 3300003775 Bacteria 2304
27 Ga0055536_1003710 3300003781 Bacteria 8101
28 Ga0055536_1005818 3300003781 Bacteria 5927
29 Ga0055534_1000088 3300003784 Bacteria 72004
30 Ga0055534_1015173 3300003784 Bacteria 1419
31 Ga0055528_1000493 3300003790 Bacteria 31199
32 Ga0055530_10000495 3300003791 Bacteria 34154
33 Ga0055540_1001986 3300003792 Bacteria 11424
34 Ga0055540_1002205 3300003792 Bacteria 10582
35 Ga0055540_1004978 3300003792 Bacteria 5788
36 Ga0055540_1038840 3300003792 Bacteria 1041
37 Ga0055531_10002338 3300003794 Bacteria 12771
38 Ga0055531_10003743 3300003794 Bacteria 9554
39 Ga0055543_1005204 3300004625 Bacteria 3366
40 Ga0055543_1009121 3300004625 Bacteria 2154
41 Ga0065165_1000780 3300005262 Bacteria 42673
42 Ga0065165_1000826 3300005262 Bacteria 40863
43 Ga0065165_1018204 3300005262 Bacteria 2554
44 Ga0065165_1048388 3300005262 Bacteria 1221
45 Ga0070658_10790892 3300005327 Bacteria 824
46 Ga0070658_10995982 3300005327 Bacteria 729
47 Ga0070676_10754911 3300005328 Bacteria 714
48 Ga0070683_100060557 3300005329 Bacteria 3518
49 Ga0070670_100272808 3300005331 Bacteria 1476
50 Ga0070680_100043111 3300005336 Bacteria 3664
51 Ga0070680_100055517 3300005336 Bacteria 3237
52 Ga0070680_100506005 3300005336 Bacteria 1034
53 Ga0070682_100404603 3300005337 Bacteria 1033
54 Ga0070682_100537566 3300005337 Bacteria 912
55 Ga0068868_100631688 3300005338 Bacteria 952
56 Ga0068868_100890642 3300005338 Bacteria 808
57 Ga0070660_100088577 3300005339 Bacteria 2437
58 Ga0070691_10028452 3300005341 Bacteria 2611
59 Ga0070691_10132829 3300005341 Bacteria 1263
60 Ga0070687_100093724 3300005343 Bacteria 1666
61 Ga0070661_100043450 3300005344 Bacteria 3283
62 Ga0070661_100141174 3300005344 Bacteria 1815
63 Ga0070692_10254507 3300005345 Bacteria 1053
64 Ga0070668_100035983 3300005347 Bacteria 3778
65 Ga0070668_100050905 3300005347 Bacteria 3190
66 Ga0070668_100069611 3300005347 Bacteria 2738
67 Ga0070668_100214967 3300005347 Bacteria 1583
68 Ga0070668_100752685 3300005347 Bacteria 863
69 Ga0070669_100163351 3300005353 Bacteria 1732
70 Ga0070669_100453835 3300005353 Bacteria 1057
71 Ga0070669_100593283 3300005353 Bacteria 927
72 Ga0070675_100574806 3300005354 Bacteria 1021
73 Ga0070671_100011820 3300005355 Bacteria 7023
74 Ga0070671_100199501 3300005355 Bacteria 1696
75 Ga0070674_100301223 3300005356 Bacteria 1278
76 Ga0070673_100126972 3300005364 Bacteria 2135
77 Ga0070688_100256917 3300005365 Bacteria 1246
78 Ga0070659_100155671 3300005366 Bacteria 1866
79 Ga0070659_100194377 3300005366 Bacteria 1668
80 Ga0070667_100100625 3300005367 Bacteria 2496
81 Ga0070667_100209805 3300005367 Bacteria 1731
82 Ga0070667_100472534 3300005367 Bacteria 1147
83 Ga0070667_100619121 3300005367 Bacteria 998
84 Ga0070667_101034694 3300005367 Bacteria 767
85 Ga0070703_10013557 3300005406 Bacteria 2316
86 Ga0070703_10089962 3300005406 Bacteria 1062
87 Ga0070714_100140826 3300005435 Bacteria 2165
88 Ga0070713_100299529 3300005436 Bacteria 1480
89 Ga0070713_100319379 3300005436 Bacteria 1434
90 Ga0070710_10210652 3300005437 Bacteria 1232
91 Ga0070710_10490937 3300005437 Bacteria 839
92 Ga0070701_10138179 3300005438 Bacteria 1391
93 Ga0070701_10138929 3300005438 Bacteria 1387
94 Ga0070701_10339768 3300005438 Bacteria 935
95 Ga0070711_100567895 3300005439 Bacteria 943
96 Ga0070711_100874750 3300005439 Bacteria 766
97 Ga0070705_100000144 3300005440 Bacteria 42003
98 Ga0070705_100089856 3300005440 Bacteria 1910
99 Ga0070705_100122839 3300005440 Bacteria 1679
100 Ga0070705_100205007 3300005440 Bacteria 1355
101 Ga0070700_100006214 3300005441 Bacteria 6367
102 Ga0070694_100001328 3300005444 Bacteria 14406
103 Ga0070694_100086792 3300005444 Bacteria 2187
104 Ga0070694_100234679 3300005444 Bacteria 1381
105 Ga0070694_100643394 3300005444 Bacteria 858
106 Ga0070708_100004216 3300005445 Bacteria 11298
107 Ga0070663_100153516 3300005455 Bacteria 1767
108 Ga0070663_100157236 3300005455 Bacteria 1747
109 Ga0070663_100238111 3300005455 Bacteria 1436
110 Ga0070678_100015254 3300005456 Bacteria 4878
111 Ga0070678_100093738 3300005456 Bacteria 2310
112 Ga0070678_100322009 3300005456 Bacteria 1320
113 Ga0070678_100884574 3300005456 Bacteria 816
114 Ga0070662_100007222 3300005457 Bacteria 7197
115 Ga0070662_100176306 3300005457 Bacteria 1682
116 Ga0070662_100218509 3300005457 Bacteria 1520
117 Ga0070662_100639093 3300005457 Bacteria 897
118 Ga0070681_10036878 3300005458 Bacteria 4908
119 Ga0070681_10885766 3300005458 Bacteria 811
120 Ga0068867_100147402 3300005459 Bacteria 1846
121 Ga0068867_100902520 3300005459 Bacteria 795
122 Ga0070698_101134818 3300005471 Bacteria 730
123 Ga0070699_100006781 3300005518 Bacteria 9963
124 Ga0070679_100214536 3300005530 Bacteria 1887
125 Ga0070684_100032782 3300005535 Bacteria 4431
126 Ga0070684_100281542 3300005535 Bacteria 1523
127 Ga0070697_100009721 3300005536 Bacteria 7508
128 Ga0070697_100085543 3300005536 Bacteria 2601
129 Ga0070697_100321850 3300005536 Bacteria 1332
130 Ga0068853_100022177 3300005539 Bacteria 5300
131 Ga0068853_100095568 3300005539 Bacteria 2620
132 Ga0068853_100303162 3300005539 Bacteria 1477
133 Ga0068853_100397131 3300005539 Bacteria 1290
134 Ga0068853_101554697 3300005539 Bacteria 641
135 Ga0070672_100194303 3300005543 Bacteria 1695
136 Ga0070686_100000034 3300005544 Bacteria 112341
137 Ga0070686_100101148 3300005544 Bacteria 1948
138 Ga0070695_100000788 3300005545 Bacteria 17057
139 Ga0070695_100058879 3300005545 Bacteria 2485
140 Ga0070695_100066068 3300005545 Bacteria 2357
141 Ga0070696_100002042 3300005546 Bacteria 13246
142 Ga0070696_100275874 3300005546 Bacteria 1280
143 Ga0070696_100389838 3300005546 Bacteria 1087
144 Ga0070693_100150501 3300005547 Bacteria 1474
145 Ga0070665_100000080 3300005548 Bacteria 185165
146 Ga0070665_100028942 3300005548 Bacteria 5577
147 Ga0070665_100073704 3300005548 Bacteria 3419
148 Ga0070665_100692901 3300005548 Bacteria 1032
149 Ga0070665_101116487 3300005548 Bacteria 800
150 Ga0070665_101740274 3300005548 Bacteria 630
151 Ga0070704_100000738 3300005549 Bacteria 16017
152 Ga0068855_100012600 3300005563 Bacteria 10203
153 Ga0068855_100039920 3300005563 Bacteria 5572
154 Ga0068855_100137154 3300005563 Bacteria 2790
155 Ga0068855_100685595 3300005563 Bacteria 1098
156 Ga0068855_100984759 3300005563 Bacteria 887
157 Ga0070664_100103775 3300005564 Bacteria 2475
158 Ga0070664_100290694 3300005564 Bacteria 1475
159 Ga0070664_100404338 3300005564 Bacteria 1249
160 Ga0068857_100033416 3300005577 Bacteria 4549
161 Ga0068857_100049057 3300005577 Bacteria 3746
162 Ga0068857_100084690 3300005577 Bacteria 2833
163 Ga0068857_100120139 3300005577 Bacteria 2365
164 Ga0068854_100765719 3300005578 Bacteria 839
165 Ga0068856_100003868 3300005614 Bacteria 15029
166 Ga0068856_100018322 3300005614 Bacteria 6788
167 Ga0068856_100062608 3300005614 Bacteria 3675
168 Ga0068856_100252508 3300005614 Bacteria 1778
169 Ga0068856_100404069 3300005614 Bacteria 1385
170 Ga0068856_100605328 3300005614 Bacteria 1117
171 Ga0068856_100790342 3300005614 Bacteria 969
172 Ga0068856_100896732 3300005614 Bacteria 905
173 Ga0070702_100047855 3300005615 Bacteria 2431
174 Ga0070702_100138404 3300005615 Bacteria 1548
175 Ga0068852_100036166 3300005616 Bacteria 4129
176 Ga0068852_100040678 3300005616 Bacteria 3923
177 Ga0068852_100225540 3300005616 Bacteria 1784
178 Ga0068852_100345180 3300005616 Bacteria 1452
179 Ga0068852_100729817 3300005616 Unclassified 1002
180 Ga0068852_100791427 3300005616 Bacteria 962
181 Ga0068852_100975910 3300005616 Bacteria 866
182 Ga0068859_100000869 3300005617 Bacteria 30827
183 Ga0068859_100002326 3300005617 Bacteria 19316
184 Ga0068859_100659740 3300005617 Bacteria 1138
185 Ga0068864_100017331 3300005618 Bacteria 6004
186 Ga0068864_100027080 3300005618 Bacteria 4837
187 Ga0068864_100102681 3300005618 Bacteria 2538
188 Ga0068864_100135221 3300005618 Bacteria 2219
189 Ga0068864_101301791 3300005618 Bacteria 727
190 Ga0068866_10149793 3300005718 Bacteria 1350
191 Ga0068861_100051037 3300005719 Bacteria 3139
192 Ga0068861_100777191 3300005719 Bacteria 897
193 Ga0068851_10016100 3300005834 Bacteria 3573
194 Ga0068870_10105206 3300005840 Bacteria 1602
195 Ga0068863_100106573 3300005841 Bacteria 2667
196 Ga0068863_100898304 3300005841 Bacteria 886
197 Ga0068858_100053503 3300005842 Bacteria 3734
198 Ga0068858_100239591 3300005842 Bacteria 1721
199 Ga0068858_100842948 3300005842 Bacteria 895
200 Ga0068860_100000210 3300005843 Bacteria 91495
201 Ga0068860_100000965 3300005843 Bacteria 31831
202 Ga0068860_100339804 3300005843 Bacteria 1476
203 Ga0068860_100419263 3300005843 Bacteria 1327
204 Ga0068860_100773744 3300005843 Bacteria 972
205 Ga0068862_100000912 3300005844 Bacteria 28638
206 Ga0068862_100205330 3300005844 Bacteria 1778
207 Ga0068862_100263320 3300005844 Bacteria 1575
208 Ga0068862_100356386 3300005844 Bacteria 1359
209 Ga0068862_100977808 3300005844 Bacteria 836
210 Ga0081455_10002205 3300005937 Bacteria 23195
211 Ga0081540_1046278 3300005983 Bacteria 2198
212 Ga0081539_10000273 3300005985 Bacteria 117936
213 Ga0081539_10123396 3300005985 Bacteria 1283
214 Ga0070717_10016039 3300006028 Bacteria 5802
215 Ga0070717_10287748 3300006028 Bacteria 1458
216 Ga0075365_10022310 3300006038 Bacteria 3965
217 Ga0075365_10543409 3300006038 Bacteria 822
218 Ga0075368_10007965 3300006042 Bacteria 3758
219 Ga0075363_100028828 3300006048 Bacteria 2860
220 Ga0075363_100078167 3300006048 Bacteria 1806
221 Ga0075364_10121280 3300006051 Bacteria 1750
222 Ga0075364_10176672 3300006051 Bacteria 1444
223 Ga0070716_100074153 3300006173 Bacteria 2010
224 Ga0070716_100080787 3300006173 Bacteria 1939
225 Ga0070716_100697358 3300006173 Bacteria 775
226 Ga0070712_100433641 3300006175 Bacteria 1091
227 Ga0075362_10003901 3300006177 Bacteria 5296
228 Ga0075362_10183722 3300006177 Bacteria 1014
229 Ga0075362_10222855 3300006177 Bacteria 922
230 Ga0075367_10019079 3300006178 Bacteria 3796
231 Ga0075367_10055605 3300006178 Bacteria 2349
232 Ga0075369_10045749 3300006186 Bacteria 1883
233 Ga0075369_10282093 3300006186 Bacteria 774
234 Ga0075366_10146085 3300006195 Bacteria 1431
235 Ga0075366_10240931 3300006195 Bacteria 1102
236 Ga0075366_10245255 3300006195 Bacteria 1092
237 Ga0075366_10305888 3300006195 Bacteria 973
238 Ga0097621_100166546 3300006237 Bacteria 1897
239 Ga0097621_100770517 3300006237 Bacteria 890
240 Ga0075370_10000340 3300006353 Bacteria 16849
241 Ga0075370_10003478 3300006353 Bacteria 7504
242 Ga0075370_10006104 3300006353 Bacteria 6041
243 Ga0075370_10009436 3300006353 Bacteria 5068
244 Ga0075370_10013496 3300006353 Bacteria 4345
245 Ga0075370_10057449 3300006353 Bacteria 2212
246 Ga0075370_10101346 3300006353 Bacteria 1667
247 Ga0075370_10236906 3300006353 Bacteria 1080
248 Ga0075370_10271985 3300006353 Bacteria 1006
249 Ga0068871_100647091 3300006358 Bacteria 965
250 Ga0075428_100556934 3300006844 Bacteria 1225
251 Ga0075430_100000704 3300006846 Bacteria 25487
252 Ga0075433_10148882 3300006852 Bacteria 2082
253 Ga0075433_10272009 3300006852 Bacteria 1501
254 Ga0075433_10459509 3300006852 Bacteria 1122
255 Ga0075434_100109048 3300006871 Bacteria 2779
256 Ga0075434_100574720 3300006871 Bacteria 1146
257 Ga0075429_100561037 3300006880 Bacteria 1001
258 Ga0068865_100310691 3300006881 Bacteria 1265
259 Ga0075436_100008201 3300006914 Bacteria 7149
260 Ga0097620_100000869 3300006931 Bacteria 30827
261 Ga0097620_100002326 3300006931 Bacteria 19316
262 Ga0097620_100659669 3300006931 Bacteria 1138
263 Ga0099825_1023258 3300006941 Bacteria 3836
264 Ga0099824_1018212 3300006942 Bacteria 5833
265 Ga0099824_1034018 3300006942 Bacteria 1670
266 Ga0099823_1025049 3300006944 Bacteria 5359
267 Ga0099826_10000527 3300006948 Bacteria 18882
268 Ga0099826_10066619 3300006948 Bacteria 2309
269 Ga0099826_10193958 3300006948 Bacteria 1118
270 Ga0075435_100102104 3300007076 Bacteria 2377
271 Ga0075435_100527947 3300007076 Bacteria 1021
272 Ga0075435_100550900 3300007076 Bacteria 999
273 Ga0075435_100686323 3300007076 Bacteria 890
274 Ga0099794_10003083 3300007265 Bacteria 6297
275 Ga0099795_10055335 3300007788 Bacteria 1457
276 Ga0105244_10037542 3300009036 Bacteria 2532
277 Ga0105240_10000005 3300009093 Bacteria 702630
278 Ga0105240_10329682 3300009093 Bacteria 1737
279 Ga0105240_10332635 3300009093 Bacteria 1728
280 Ga0111539_10234844 3300009094 Bacteria 2135
281 Ga0111539_10448524 3300009094 Bacteria 1502
282 Ga0105245_10021271 3300009098 Bacteria 5688
283 Ga0105245_10099026 3300009098 Bacteria 2695
284 Ga0105245_10102553 3300009098 Bacteria 2650
285 Ga0105245_10304571 3300009098 Bacteria 1565
286 Ga0105245_10475149 3300009098 Bacteria 1262
287 Ga0105245_10921319 3300009098 Bacteria 916
288 Ga0105247_10012701 3300009101 Bacteria 5053
289 Ga0105247_10034582 3300009101 Bacteria 3078
290 Ga0105247_10043146 3300009101 Bacteria 2763
291 Ga0105247_10249563 3300009101 Bacteria 1212
292 Ga0114129_10761419 3300009147 Bacteria 1239
293 Ga0105243_10004089 3300009148 Bacteria 11616
294 Ga0105243_10098611 3300009148 Bacteria 2421
295 Ga0105243_10221870 3300009148 Bacteria 1671
296 Ga0105243_10590185 3300009148 Bacteria 1068
297 Ga0105241_10009269 3300009174 Bacteria 7238
298 Ga0105241_10012989 3300009174 Bacteria 6109
299 Ga0105241_10013325 3300009174 Bacteria 6026
300 Ga0105241_10120965 3300009174 Bacteria 2108
301 Ga0105242_10225243 3300009176 Bacteria 1678
302 Ga0105242_11111857 3300009176 Bacteria 805
303 Ga0105237_10000773 3300009545 Bacteria 43739
304 Ga0105237_10003857 3300009545 Bacteria 17627
305 Ga0105237_10044608 3300009545 Bacteria 4465
306 Ga0105237_10115667 3300009545 Bacteria 2675
307 Ga0105237_10149449 3300009545 Bacteria 2332
308 Ga0105237_10263223 3300009545 Bacteria 1727
309 Ga0105237_11132214 3300009545 Bacteria 789
310 Ga0105238_10030500 3300009551 Bacteria 5489
311 Ga0105238_10108782 3300009551 Bacteria 2753
312 Ga0105238_10163979 3300009551 Bacteria 2198
313 Ga0105238_10199208 3300009551 Bacteria 1978
314 Ga0105238_11258299 3300009551 Bacteria 765
315 Ga0105249_10009032 3300009553 Bacteria 8712
316 Ga0099796_10003721 3300010159 Bacteria 3584
317 Ga0105239_10014053 3300010375 Bacteria 8887
318 Ga0105239_10024440 3300010375 Bacteria 6657
319 Ga0105239_10201930 3300010375 Bacteria 2227
320 Ga0105239_10231432 3300010375 Bacteria 2073
321 Ga0105239_10329501 3300010375 Bacteria 1722
322 Ga0105239_10868651 3300010375 Bacteria 1035
323 Ga0105239_11173624 3300010375 Bacteria 884
324 Ga0105246_10024476 3300011119 Bacteria 3924
325 Ga0105246_10104058 3300011119 Bacteria 2073
326 Ga0105246_10131374 3300011119 Bacteria 1871
327 Ga0157373_10046733 3300013100 Bacteria 3088
328 Ga0157373_10338283 3300013100 Bacteria 1072
329 Ga0157373_10505966 3300013100 Bacteria 873
330 Ga0157370_10001070 3300013104 Bacteria 34278
331 Ga0157370_10017784 3300013104 Bacteria 7165
332 Ga0157370_10055881 3300013104 Bacteria 3759
333 Ga0157370_10297240 3300013104 Bacteria 1491
334 Ga0157370_10388926 3300013104 Unclassified 1284
335 Ga0157370_10816105 3300013104 Bacteria 848
336 Ga0157369_10081621 3300013105 Bacteria 3460
337 Ga0157369_10605433 3300013105 Bacteria 1131
338 Ga0157369_10663058 3300013105 Bacteria 1075
339 Ga0157374_10049221 3300013296 Bacteria 3914
340 Ga0157374_10791935 3300013296 Bacteria 964
341 Ga0157378_10416560 3300013297 Bacteria 1327
342 Ga0157378_10685795 3300013297 Bacteria 1043
343 Ga0163162_10119621 3300013306 Bacteria 2737
344 Ga0163162_10126464 3300013306 Bacteria 2662
345 Ga0163162_10180113 3300013306 Bacteria 2239
346 Ga0163162_11003933 3300013306 Bacteria 944
347 Ga0163162_11473840 3300013306 Bacteria 775
348 Ga0157372_10643187 3300013307 Bacteria 1235
349 Ga0157375_10032801 3300013308 Bacteria 4929
350 Ga0157375_10708692 3300013308 Bacteria 1160
351 Ga0157375_11130436 3300013308 Bacteria 917
352 Ga0163163_10011142 3300014325 Bacteria 8140
353 Ga0163163_10272621 3300014325 Bacteria 1743
354 Ga0163163_10853767 3300014325 Bacteria 974
355 Ga0163163_12038541 3300014325 Bacteria 633
356 Ga0157380_10177037 3300014326 Bacteria 1870
357 Ga0157380_10381080 3300014326 Bacteria 1331
358 Ga0182008_10001456 3300014497 Bacteria 15816
359 Ga0182008_10006000 3300014497 Bacteria 6840
360 Ga0182008_10118087 3300014497 Bacteria 1317
361 Ga0182008_10159619 3300014497 Bacteria 1134
362 Ga0157377_10023849 3300014745 Bacteria 3247
363 Ga0157379_10022522 3300014968 Bacteria 5580
364 Ga0157379_10074696 3300014968 Bacteria 3035
365 Ga0157379_10120531 3300014968 Bacteria 2359
366 Ga0157376_10207522 3300014969 Bacteria 1807
367 Ga0157376_10266982 3300014969 Bacteria 1606
368 Ga0157376_10355311 3300014969 Bacteria 1404
369 Ga0182006_1005446 3300015261 Bacteria 6070
370 Ga0182006_1015639 3300015261 Bacteria 3249
371 Ga0182006_1072863 3300015261 Bacteria 1269
372 Ga0182007_10000618 3300015262 Bacteria 20687
373 Ga0182007_10000705 3300015262 Bacteria 19033
374 Ga0182007_10003145 3300015262 Bacteria 7924
375 Ga0182005_1002283 3300015265 Bacteria 7020
376 Ga0182005_1022006 3300015265 Bacteria 1747
377 Ga0163161_10000105 3300017792 Bacteria 80620
378 Ga0163161_10009252 3300017792 Bacteria 6812
379 Ga0163161_10036161 3300017792 Bacteria 3536
380 Ga0163161_10140745 3300017792 Bacteria 1827
381 Ga0206356_11464399 3300020070 Bacteria 998
382 Ga0214544_1000002 3300021320 Bacteria 753857
383 Ga0214542_1000001 3300021321 Bacteria 1018696
384 Ga0214542_1041125 3300021321 Bacteria 1161
385 Ga0214545_1000001 3300021324 Bacteria 1092817
386 Ga0214545_1033424 3300021324 Bacteria 1871
387 Ga0214543_1000001 3300021327 Bacteria 776921
388 Ga0213876_10000384 3300021384 Bacteria 37354
389 Ga0213871_10092503 3300021441 Bacteria 877
390 Ga0209436_116869 3300025208 Bacteria 1084
391 Ga0207427_109743 3300025231 Bacteria 1020
392 Ga0209437_100122 3300025233 Bacteria 201364
393 Ga0209437_100160 3300025233 Bacteria 149451
394 Ga0209437_110384 3300025233 Bacteria 1423
395 Ga0209677_101583 3300025253 Bacteria 9653
396 Ga0209677_101865 3300025253 Bacteria 8564
397 Ga0209148_1000289 3300025254 Bacteria 75390
398 Ga0209129_1001398 3300025258 Bacteria 13503
399 Ga0209129_1011590 3300025258 Bacteria 2093
400 Ga0209233_1000168 3300025261 Bacteria 149312
401 Ga0209233_1000170 3300025261 Bacteria 147527
402 Ga0209233_1000297 3300025261 Bacteria 61773
403 Ga0209233_1002174 3300025261 Bacteria 7347
404 Ga0209233_1014997 3300025261 Bacteria 2170
405 Ga0209565_1000046 3300025263 Bacteria 226073
406 Ga0209455_1000612 3300025272 Bacteria 22684
407 Ga0209673_1000058 3300025273 Bacteria 269028
408 Ga0209673_1000559 3300025273 Bacteria 59593
409 Ga0209130_1000215 3300025284 Bacteria 75723
410 Ga0209675_1000010 3300025291 Bacteria 541927
411 Ga0209675_1002925 3300025291 Bacteria 8432
412 Ga0209676_1000004 3300025292 Bacteria 1138360
413 Ga0209676_1000172 3300025292 Bacteria 153664
414 Ga0209676_1009807 3300025292 Bacteria 4076
415 Ga0209025_1000122 3300025294 Bacteria 206064
416 Ga0209025_1000686 3300025294 Bacteria 58086
417 Ga0209025_1013681 3300025294 Bacteria 5072
418 Ga0209025_1013966 3300025294 Bacteria 4996
419 Ga0209564_1000413 3300025295 Bacteria 75268
420 Ga0209758_1000005 3300025297 Bacteria 1368918
421 Ga0209758_1000160 3300025297 Bacteria 154304
422 Ga0209758_1000777 3300025297 Bacteria 45841
423 Ga0209758_1001948 3300025297 Bacteria 22345
424 Ga0209758_1055006 3300025297 Bacteria 1356
425 Ga0209050_1000002 3300025298 Bacteria 1792849
426 Ga0209050_1000509 3300025298 Bacteria 65792
427 Ga0209050_1008280 3300025298 Bacteria 5600
428 Ga0209256_1000067 3300025299 Bacteria 246812
429 Ga0207426_1000178 3300025302 Bacteria 159291
430 Ga0207426_1000264 3300025302 Bacteria 110747
431 Ga0207426_1002608 3300025302 Bacteria 11182
432 Ga0209051_1000002 3300025303 Bacteria 1631846
433 Ga0209051_1000096 3300025303 Bacteria 167399
434 Ga0209051_1000159 3300025303 Bacteria 126836
435 Ga0209051_1000278 3300025303 Bacteria 83769
436 Ga0209051_1010695 3300025303 Bacteria 4599
437 Ga0209257_1000002 3300025304 Bacteria 1767052
438 Ga0209257_1000072 3300025304 Bacteria 332791
439 Ga0209257_1001087 3300025304 Bacteria 35572
440 Ga0207697_10083776 3300025315 Bacteria 1346
441 Ga0207656_10034550 3300025321 Bacteria 2111
442 Ga0207655_1011777 3300025728 Bacteria 5171
443 Ga0207655_1126776 3300025728 Bacteria 837
444 Ga0207653_10004268 3300025885 Bacteria 4489
445 Ga0207710_10010427 3300025900 Bacteria 3914
446 Ga0207710_10022846 3300025900 Bacteria 2685
447 Ga0207710_10123653 3300025900 Bacteria 1237
448 Ga0207710_10386519 3300025900 Bacteria 717
449 Ga0207680_10020320 3300025903 Bacteria 3570
450 Ga0207680_10209532 3300025903 Bacteria 1332
451 Ga0207647_10005160 3300025904 Bacteria 9607
452 Ga0207647_10060474 3300025904 Bacteria 2315
453 Ga0207647_10099127 3300025904 Bacteria 1731
454 Ga0207647_10200906 3300025904 Bacteria 1153
455 Ga0207647_10211500 3300025904 Bacteria 1120
456 Ga0207643_10126933 3300025908 Bacteria 1515
457 Ga0207705_10267593 3300025909 Bacteria 1306
458 Ga0207705_10538347 3300025909 Bacteria 908
459 Ga0207654_10019270 3300025911 Bacteria 3599
460 Ga0207654_10199888 3300025911 Bacteria 1315
461 Ga0207654_10365534 3300025911 Bacteria 996
462 Ga0207707_10018205 3300025912 Bacteria 6123
463 Ga0207707_10058939 3300025912 Bacteria 3340
464 Ga0207707_10084972 3300025912 Bacteria 2765
465 Ga0207695_10000011 3300025913 Bacteria 910221
466 Ga0207695_10001631 3300025913 Bacteria 36265
467 Ga0207695_10202413 3300025913 Bacteria 1899
468 Ga0207671_10001637 3300025914 Bacteria 25476
469 Ga0207671_10002644 3300025914 Bacteria 18834
470 Ga0207671_10003901 3300025914 Bacteria 14538
471 Ga0207671_10051707 3300025914 Bacteria 3045
472 Ga0207671_10173190 3300025914 Bacteria 1677
473 Ga0207671_10176862 3300025914 Bacteria 1659
474 Ga0207671_10825902 3300025914 Bacteria 734
475 Ga0207693_10017812 3300025915 Bacteria 5663
476 Ga0207663_10050313 3300025916 Bacteria 2589
477 Ga0207663_10094251 3300025916 Bacteria 1994
478 Ga0207663_10382017 3300025916 Bacteria 1073
479 Ga0207663_10408187 3300025916 Bacteria 1040
480 Ga0207663_10695236 3300025916 Bacteria 805
481 Ga0207660_10005245 3300025917 Bacteria 8420
482 Ga0207660_10095920 3300025917 Bacteria 2207
483 Ga0207660_10441300 3300025917 Bacteria 1052
484 Ga0207662_10178198 3300025918 Bacteria 1366
485 Ga0207657_10045084 3300025919 Bacteria 3872
486 Ga0207657_10095794 3300025919 Bacteria 2469
487 Ga0207657_10113141 3300025919 Bacteria 2239
488 Ga0207657_10385830 3300025919 Bacteria 1102
489 Ga0207657_10405870 3300025919 Bacteria 1071
490 Ga0207649_10238147 3300025920 Bacteria 1305
491 Ga0207649_10395456 3300025920 Unclassified 1033
492 Ga0207681_10548452 3300025923 Bacteria 951
493 Ga0207694_10080500 3300025924 Bacteria 2556
494 Ga0207694_10134437 3300025924 Bacteria 1985
495 Ga0207694_10176876 3300025924 Bacteria 1729
496 Ga0207694_10500805 3300025924 Bacteria 1017
497 Ga0207694_10562767 3300025924 Bacteria 957
498 Ga0207650_10315156 3300025925 Bacteria 1280
499 Ga0207700_10003559 3300025928 Bacteria 9073
500 Ga0207700_10257555 3300025928 Bacteria 1493
501 Ga0207664_10492587 3300025929 Bacteria 1097
502 Ga0207644_10372114 3300025931 Bacteria 1164
503 Ga0207644_10419193 3300025931 Bacteria 1097
504 Ga0207644_10750217 3300025931 Bacteria 815
505 Ga0207690_10187469 3300025932 Bacteria 1562
506 Ga0207690_10597774 3300025932 Bacteria 900
507 Ga0207706_10018115 3300025933 Bacteria 6336
508 Ga0207706_10051455 3300025933 Bacteria 3637
509 Ga0207706_10923913 3300025933 Bacteria 736
510 Ga0207686_10211946 3300025934 Bacteria 1393
511 Ga0207709_10003493 3300025935 Bacteria 9312
512 Ga0207709_10060765 3300025935 Bacteria 2358
513 Ga0207669_10049156 3300025937 Bacteria 2512
514 Ga0207704_10711361 3300025938 Bacteria 832
515 Ga0207665_10075953 3300025939 Bacteria 2302
516 Ga0207665_10459389 3300025939 Bacteria 978
517 Ga0207691_10402717 3300025940 Bacteria 1167
518 Ga0207711_10032286 3300025941 Bacteria 4427
519 Ga0207711_10363403 3300025941 Bacteria 1341
520 Ga0207711_10965335 3300025941 Bacteria 791
521 Ga0207689_10014529 3300025942 Bacteria 6696
522 Ga0207689_10364419 3300025942 Bacteria 1202
523 Ga0207661_10050057 3300025944 Bacteria 3327
524 Ga0207661_10235662 3300025944 Unclassified 1622
525 Ga0207661_10808329 3300025944 Bacteria 863
526 Ga0207679_10160399 3300025945 Bacteria 1841
527 Ga0207679_10196745 3300025945 Bacteria 1681
528 Ga0207667_10015041 3300025949 Bacteria 8802
529 Ga0207667_10045209 3300025949 Bacteria 4665
530 Ga0207667_10170360 3300025949 Bacteria 2238
531 Ga0207667_10196388 3300025949 Bacteria 2070
532 Ga0207667_10392952 3300025949 Bacteria 1412
533 Ga0207667_10450233 3300025949 Bacteria 1308
534 Ga0207651_10772537 3300025960 Bacteria 850
535 Ga0207712_10024490 3300025961 Bacteria 3998
536 Ga0207712_10872602 3300025961 Bacteria 794
537 Ga0207668_10099695 3300025972 Bacteria 2156
538 Ga0207658_10101528 3300025986 Bacteria 2254
539 Ga0207658_10510904 3300025986 Bacteria 1071
540 Ga0207658_10513115 3300025986 Bacteria 1069
541 Ga0207658_10781979 3300025986 Bacteria 866
542 Ga0207703_10219125 3300026035 Bacteria 1700
543 Ga0207703_10360805 3300026035 Bacteria 1340
544 Ga0207703_10784020 3300026035 Bacteria 909
545 Ga0207639_10261864 3300026041 Bacteria 1513
546 Ga0207639_10266446 3300026041 Bacteria 1501
547 Ga0207639_10987769 3300026041 Bacteria 788
548 Ga0207678_10000337 3300026067 Bacteria 42242
549 Ga0207678_10018039 3300026067 Bacteria 6201
550 Ga0207678_10024825 3300026067 Bacteria 5233
551 Ga0207678_10047440 3300026067 Bacteria 3715
552 Ga0207678_10073747 3300026067 Bacteria 2925
553 Ga0207678_10178025 3300026067 Bacteria 1816
554 Ga0207678_10339727 3300026067 Bacteria 1294
555 Ga0207708_10001974 3300026075 Bacteria 15141
556 Ga0207708_10240634 3300026075 Bacteria 1456
557 Ga0207702_10010148 3300026078 Bacteria 7885
558 Ga0207702_10287065 3300026078 Bacteria 1558
559 Ga0207702_10451637 3300026078 Bacteria 1247
560 Ga0207702_10692841 3300026078 Bacteria 1004
561 Ga0207702_10744360 3300026078 Bacteria 967
562 Ga0207702_11173206 3300026078 Bacteria 762
563 Ga0207641_10041110 3300026088 Bacteria 3874
564 Ga0207641_10243477 3300026088 Bacteria 1677
565 Ga0207641_11039906 3300026088 Bacteria 816
566 Ga0207648_10118722 3300026089 Bacteria 2324
567 Ga0207676_10039430 3300026095 Bacteria 3613
568 Ga0207676_10073555 3300026095 Bacteria 2751
569 Ga0207676_10372485 3300026095 Bacteria 1327
570 Ga0207676_10698596 3300026095 Bacteria 982
571 Ga0207676_10854398 3300026095 Bacteria 890
572 Ga0207674_10029570 3300026116 Bacteria 5768
573 Ga0207674_10031742 3300026116 Bacteria 5546
574 Ga0207674_10048477 3300026116 Bacteria 4347
575 Ga0207674_10098352 3300026116 Bacteria 2909
576 Ga0207674_10141197 3300026116 Bacteria 2368
577 Ga0207674_10700797 3300026116 Bacteria 978
578 Ga0207675_100082728 3300026118 Bacteria 3011
579 Ga0207683_10105677 3300026121 Bacteria 2517
580 Ga0207683_10174784 3300026121 Bacteria 1946
581 Ga0207683_10255192 3300026121 Bacteria 1600
582 Ga0207683_10498464 3300026121 Bacteria 1125
583 Ga0207698_10233167 3300026142 Bacteria 1672
584 Ga0207698_10459446 3300026142 Bacteria 1231
585 Ga0207698_10499971 3300026142 Bacteria 1183
586 Ga0207698_10651999 3300026142 Bacteria 1043
587 Ga0209389_1000008 3300027296 Bacteria 227385
588 Ga0209389_1000081 3300027296 Bacteria 89601
589 Ga0209589_1000091 3300027357 Bacteria 89601
590 Ga0209489_100096 3300027361 Bacteria 122075
591 Ga0209489_103917 3300027361 Bacteria 28294
592 Ga0209700_100036 3300027363 Bacteria 187888
593 Ga0209282_1060656 3300027666 Bacteria 2110
594 Ga0209588_1001221 3300027671 Bacteria 6646
595 Ga0209813_10002519 3300027866 Bacteria 4196
596 Ga0209813_10003776 3300027866 Bacteria 3574
597 Ga0209813_10015641 3300027866 Bacteria 2060
598 Ga0207428_10232096 3300027907 Bacteria 1381
599 Ga0268266_10000055 3300028379 Bacteria 291630
600 Ga0268266_10071995 3300028379 Bacteria 2996
601 Ga0268266_10236782 3300028379 Bacteria 1683
602 Ga0268266_10910896 3300028379 Bacteria 850
603 Ga0268265_10006170 3300028380 Bacteria 8117
604 Ga0268265_10008013 3300028380 Bacteria 7133
605 Ga0268265_10414867 3300028380 Bacteria 1248
606 Ga0268264_10000233 3300028381 Bacteria 106118
607 Ga0268264_10018666 3300028381 Bacteria 5670
608 Ga0268264_10349811 3300028381 Bacteria 1406
609 Ga0265334_10012112 3300028573 Bacteria 3625
610 Ga0307515_10012480 3300028794 Bacteria 15979
611 Ga0265338_10007042 3300028800 Bacteria 14105
612 Ga0265338_10016438 3300028800 Bacteria 8054
613 Ga0265338_10032839 3300028800 Bacteria 5052
614 Ga0307511_10096523 3300030521 Bacteria 1968
615 Ga0307512_10141132 3300030522 Bacteria 1474
616 Ga0316177_1220166 3300030731 Bacteria 3772
617 Ga0316176_1074271 3300030732 Bacteria 1692
618 Ga0314311_1023036 3300030733 Bacteria 7083
619 Ga0316178_1123278 3300030735 Bacteria 2060
620 Ga0316180_1019296 3300030736 Bacteria 4028
621 Ga0316183_1126188 3300030742 Bacteria 20738
622 Ga0316181_1028270 3300030744 Bacteria 9388
623 Ga0316182_1164524 3300030745 Bacteria 5126
624 Ga0316182_1282851 3300030745 Bacteria 2259
625 Ga0265330_10169963 3300031235 Bacteria 924
626 Ga0265332_10002293 3300031238 Bacteria 9786
627 Ga0265332_10102714 3300031238 Bacteria 1205
628 Ga0265328_10113442 3300031239 Bacteria 1008
629 Ga0265320_10000102 3300031240 Bacteria 72957
630 Ga0265325_10201373 3300031241 Bacteria 918
631 Ga0265329_10042118 3300031242 Bacteria 1463
632 Ga0265329_10085282 3300031242 Bacteria 1001
633 Ga0265340_10003648 3300031247 Bacteria 8655
634 Ga0265340_10023320 3300031247 Bacteria 3157
635 Ga0265340_10036067 3300031247 Bacteria 2453
636 Ga0265340_10068915 3300031247 Bacteria 1679
637 Ga0265339_10002587 3300031249 Bacteria 12907
638 Ga0265339_10107257 3300031249 Bacteria 1448
639 Ga0265331_10004118 3300031250 Bacteria 9125
640 Ga0265331_10006890 3300031250 Bacteria 6638
641 Ga0265327_10012710 3300031251 Bacteria 5655
642 Ga0265316_10256246 3300031344 Bacteria 1283
643 Ga0307513_10218757 3300031456 Bacteria 1728
644 Ga0307509_10038652 3300031507 Bacteria 5204
645 Ga0307509_10305319 3300031507 Bacteria 1337
646 Ga0307509_10335430 3300031507 Bacteria 1242
647 Ga0307408_100186846 3300031548 Bacteria 1666
648 Ga0307408_101460393 3300031548 Bacteria 645
649 Ga0307508_10000010 3300031616 Bacteria 255747
650 Ga0307508_10189352 3300031616 Bacteria 1659
651 Ga0307508_10215585 3300031616 Bacteria 1520
652 Ga0307514_10009275 3300031649 Bacteria 8289
653 Ga0307514_10031724 3300031649 Bacteria 4235
654 Ga0265314_10010572 3300031711 Bacteria 7681
655 Ga0265314_10256811 3300031711 Bacteria 1000
656 Ga0265342_10002113 3300031712 Bacteria 17530
657 Ga0265342_10025322 3300031712 Bacteria 3733
658 Ga0265342_10076999 3300031712 Bacteria 1933
659 Ga0307516_10000131 3300031730 Bacteria 89180
660 Ga0307516_10015237 3300031730 Bacteria 8099
661 Ga0307516_10101139 3300031730 Bacteria 2698
662 Ga0307405_10158862 3300031731 Bacteria 1598
663 Ga0307413_10760582 3300031824 Bacteria 811
664 Ga0307406_10288038 3300031901 Bacteria 1256
665 Ga0307406_10802803 3300031901 Bacteria 794
666 Ga0307406_10939853 3300031901 Bacteria 738
667 Ga0307407_10430313 3300031903 Bacteria 953
668 Ga0307412_10004706 3300031911 Bacteria 7614
669 Ga0307412_10073269 3300031911 Bacteria 2342
670 Ga0307412_10265496 3300031911 Bacteria 1340
671 Ga0307412_10742219 3300031911 Bacteria 847
672 Ga0307409_100384591 3300031995 Bacteria 1335
673 Ga0307416_100280869 3300032002 Bacteria 1641
674 Ga0307414_10070300 3300032004 Bacteria 2520
675 Ga0307414_10092583 3300032004 Bacteria 2250
676 Ga0307411_10065234 3300032005 Bacteria 2441
677 Ga0307411_10221066 3300032005 Bacteria 1469
678 Ga0307507_10099702 3300033179 Bacteria 2438
679 Ga0307510_10007884 3300033180 Bacteria 12686
680 Ga0307510_10026794 3300033180 Bacteria 6617
681 Ga0307510_10330548 3300033180 Bacteria 979
682 Ga0373930_0052507 3300034816 Bacteria 893
683 Ga0373950_0054722 3300034818 Bacteria 790
684 Ga0373958_0018666 3300034819 Bacteria 1260
685 Ga0373951_0022432 3300035091 Bacteria 1454
686 Ga0373936_0011012 3300035113 Bacteria 3418
687 Ga0373939_0158049 3300035114 Bacteria 830
688 Ga0373941_0031201 3300035115 Bacteria 1586
689 Ga0373945_0172648 3300035116 Bacteria 886
690 Ga0373954_0282272 3300035118 Bacteria 818
691 Ga0373956_0034696 3300035119 Bacteria 2222
692 Ga0373957_0012775 3300035120 Bacteria 2833
693 Ga0373960_0006840 3300035121 Bacteria 2686
694 Ga0373946_0266816 3300035171 Bacteria 839
695 Ga0373961_0102261 3300035241 Bacteria 929
696 Ga0373962_0089287 3300035242 Bacteria 947
697 Ga0373924_0075033 3300035410 Bacteria 1431
698 Ga0373935_0052251 3300035692 Bacteria 2597
699 Ga0373935_0191097 3300035692 Bacteria 1410
700 Ga0373935_0364418 3300035692 Bacteria 1032
701 Ga0373927_0016488 3300035695 Bacteria 4871
702 Ga0373927_0024569 3300035695 Bacteria 3940
703 Ga0373937_0005850 3300036401 Bacteria 10576
704 Ga0373925_0018284 3300037068 Bacteria 5094
705 Ga0373925_0046851 3300037068 Bacteria 3216
706 Ga0373925_0051972 3300037068 Bacteria 3060
707 Ga0395900_0338430 3300037418 Bacteria 1481
708 Ga0395900_0349930 3300037418 Bacteria 1451
709 Ga0395900_0420206 3300037418 Bacteria 1298
710 Ga0395898_0002853 3300037466 Bacteria 19760
711 Ga0395898_0168415 3300037466 Bacteria 2094
712 Ga0395898_0220282 3300037466 Bacteria 1810
713 Ga0395905_0012510 3300037471 Bacteria 8167
714 Ga0395905_0025312 3300037471 Bacteria 5596
715 Ga0436364_0614298 3300037853 Bacteria 1246
716 Ga0436364_1222287 3300037853 Bacteria 1065
717 Ga0436364_1310055 3300037853 Bacteria 1138
718 Ga0395901_0029183 3300038443 Bacteria 5677
719 Ga0395901_0471290 3300038443 Bacteria 1282
720 Ga0436365_0419344 3300039437 Bacteria 13419
721 Ga0436365_0998612 3300039437 Bacteria 938
722 Ga0436360_0511504 3300039438 Bacteria 2578
723 Ga0436361_0125523 3300039447 Bacteria 2191
724 Ga0436363_0942152 3300039450 Bacteria 3279
725 Ga0436363_1316254 3300039450 Bacteria 703
726 Ga0436362_0193018 3300039453 Bacteria 4144
727 Ga0439436_0037931 3300041404 Bacteria 1387
728 Ga0451797_0291897 3300041453 Bacteria 1455
729 Ga0451800_1589477 3300041459 Bacteria 1182
730 Ga0451807_0920577 3300041486 Bacteria 1020
731 Ga0439431_0036137 3300041997 Bacteria 1243
732 Ga0439449_0019933 3300042007 Bacteria 2514
733 Ga0439463_058599 3300042016 Bacteria 985
734 Ga0439459_0082101 3300042438 Bacteria 762
735 Ga0450918_036931 3300042531 Bacteria 871
736 Ga0466969_0040244 3300044656 Bacteria 2342
737 Ga0466965_0035113 3300044683 Bacteria 2455
738 Ga0466965_0345774 3300044683 Bacteria 814
739 Ga0466966_0000743 3300044684 Bacteria 20686
740 Ga0466961_0000013 3300044693 Bacteria 129640
741 Ga0466968_0026713 3300044735 Bacteria 2371
742 Ga0466960_0172473 3300044901 Bacteria 1168
743 Ga0466959_0006806 3300045049 Bacteria 7964
744 Ga0466958_0291494 3300045836 Bacteria 1047
745 Ga0466967_1045263 3300045976 Bacteria 813
746 Ga0495592_0270310 3300046454 Bacteria 1116
747 Ga0495603_0025657 3300046455 Bacteria 3564
748 Ga0495603_0067083 3300046455 Bacteria 2113
749 Ga0495590_0039916 3300046457 Bacteria 1638
750 Ga0495629_0034275 3300046459 Bacteria 3589
751 Ga0495638_0000398 3300046460 Bacteria 53469
752 Ga0495651_0000388 3300046462 Bacteria 33995
753 Ga0495651_0226178 3300046462 Bacteria 1291
754 Ga0495653_0137228 3300046463 Bacteria 1724
755 Ga0495653_0181832 3300046463 Bacteria 1442
756 Ga0495653_0329308 3300046463 Bacteria 988
757 Ga0495582_0188040 3300046473 Bacteria 1178
758 Ga0495639_0015245 3300046475 Bacteria 3331
759 Ga0495639_0253867 3300046475 Bacteria 870
760 Ga0495664_0072645 3300046477 Bacteria 2056
761 Ga0495664_0370642 3300046477 Bacteria 861
762 Ga0495664_0636870 3300046477 Bacteria 632
763 Ga0495584_0175576 3300046491 Bacteria 1089
764 Ga0495594_0218522 3300046499 Bacteria 1087
765 Ga0495594_0565245 3300046499 Bacteria 645
766 Ga0495596_0255698 3300046500 Bacteria 680
767 Ga0495607_0092478 3300046501 Bacteria 1636
768 Ga0495607_0313699 3300046501 Bacteria 734
769 Ga0495606_0014901 3300046507 Bacteria 6034
770 Ga0495608_0072084 3300046511 Bacteria 2253
771 Ga0495610_0039139 3300046512 Bacteria 2400
772 Ga0495616_0010771 3300046513 Bacteria 5272
773 Ga0495618_0029042 3300046514 Bacteria 3448
774 Ga0495620_0064751 3300046515 Bacteria 1511
775 Ga0495620_0203721 3300046515 Bacteria 761
776 Ga0495620_0289623 3300046515 Bacteria 623
777 Ga0495628_0082800 3300046516 Bacteria 2492
778 Ga0495628_0192298 3300046516 Bacteria 1540
779 Ga0495630_0068555 3300046517 Bacteria 2668
780 Ga0495631_0000021 3300046518 Bacteria 92765
781 Ga0495631_0037954 3300046518 Bacteria 2144
782 Ga0495631_0073638 3300046518 Bacteria 1475
783 Ga0495632_0150137 3300046519 Bacteria 1078
784 Ga0495632_0355279 3300046519 Bacteria 644
785 Ga0495637_0020807 3300046520 Bacteria 3012
786 Ga0495644_0082194 3300046523 Bacteria 1214
787 Ga0495648_0009683 3300046524 Bacteria 7428
788 Ga0495648_0105226 3300046524 Bacteria 1548
789 Ga0495648_0180618 3300046524 Bacteria 1073
790 Ga0495663_0054329 3300046525 Bacteria 1247
791 Ga0495642_0025533 3300046528 Bacteria 2342
792 Ga0495652_0003852 3300046529 Bacteria 14646
793 Ga0495652_0501563 3300046529 Bacteria 841
794 Ga0495654_0012310 3300046530 Bacteria 4597
795 Ga0495665_0203568 3300046531 Bacteria 1026
796 Ga0495640_0044552 3300046533 Bacteria 3084
797 Ga0495640_0115249 3300046533 Bacteria 1751
798 Ga0495587_0047352 3300046536 Bacteria 2550
799 Ga0495587_0097573 3300046536 Bacteria 1694
800 Ga0495598_0029644 3300046537 Bacteria 1527
801 Ga0495609_0133280 3300046538 Bacteria 1063
802 Ga0495609_0141091 3300046538 Bacteria 1028
803 Ga0495621_0034955 3300046539 Bacteria 1738
804 Ga0495621_0069279 3300046539 Bacteria 1296
805 Ga0495597_0124787 3300046542 Bacteria 1071
806 Ga0495622_0085031 3300046557 Bacteria 1455
807 Ga0495633_0208613 3300046558 Bacteria 896
808 Ga0495667_0002142 3300046559 Bacteria 13153
809 Ga0495667_0433649 3300046559 Bacteria 826
810 Ga0495656_0051564 3300046615 Bacteria 1761
811 Ga0495668_0264189 3300046616 Bacteria 942
812 Ga0495634_0022224 3300046642 Bacteria 4471
813 Ga0495625_0021879 3300046660 Bacteria 4911
814 Ga0495625_0089878 3300046660 Bacteria 2125
815 Ga0495625_0159869 3300046660 Bacteria 1510
816 Ga0495625_0163136 3300046660 Bacteria 1492
817 Ga0495625_0301257 3300046660 Bacteria 1026
818 Ga0495625_0335603 3300046660 Bacteria 959
819 Ga0495659_0214878 3300046664 Bacteria 792
820 Ga0495588_0101443 3300046674 Bacteria 1512
821 Ga0495657_0013200 3300046675 Bacteria 6102
822 Ga0495657_0098981 3300046675 Bacteria 1860
823 Ga0495599_0059401 3300046678 Bacteria 2392
824 Ga0495599_0133186 3300046678 Bacteria 1543
825 Ga0495599_0181090 3300046678 Bacteria 1299
826 Ga0495623_0079698 3300046679 Bacteria 2028
827 Ga0495646_0020067 3300046680 Bacteria 4225
828 Ga0495658_0142211 3300046683 Bacteria 1468
829 Ga0495613_0270910 3300046689 Bacteria 1181
830 Ga0495624_0048087 3300046690 Bacteria 2708
831 Ga0495624_0267030 3300046690 Bacteria 1034
832 Ga0495670_0092224 3300046691 Bacteria 1551
833 Ga0495671_0077298 3300046692 Bacteria 1632
834 Ga0495649_0025601 3300046694 Bacteria 3287
835 Ga0495589_0267695 3300046794 Bacteria 796
836 Ga0495589_0273129 3300046794 Bacteria 787
837 Ga0495600_0023897 3300046809 Bacteria 3933
838 Ga0495600_0330923 3300046809 Bacteria 956
839 Ga0495660_0095171 3300046810 Bacteria 1541
840 Ga0495581_0123239 3300047315 Bacteria 1509
841 Ga0495604_0032057 3300047317 Bacteria 4166
842 Ga0495604_0045919 3300047317 Bacteria 3407
843 Ga0495674_0183924 3300047319 Bacteria 1739
844 Ga0495674_0415177 3300047319 Bacteria 1085
845 Ga0495674_0761055 3300047319 Bacteria 756
846 Ga0495672_0027558 3300047320 Bacteria 3608
847 Ga0495672_0048666 3300047320 Bacteria 2513
848 Ga0495672_0090469 3300047320 Bacteria 1682
849 Ga0495676_0018304 3300047321 Bacteria 6176
850 Ga0495680_0016485 3300047322 Bacteria 6344
851 Ga0495683_0047314 3300047323 Bacteria 2159
852 Ga0495687_003920 3300047443 Bacteria 10425
853 Ga0495675_0094720 3300047444 Bacteria 1872
854 Ga0495673_0074127 3300047469 Bacteria 1425
855 Ga0495673_0122884 3300047469 Bacteria 1027
856 Ga0495686_0055461 3300047472 Bacteria 2478
857 Ga0495686_0073886 3300047472 Bacteria 2093
858 Ga0495686_0075766 3300047472 Bacteria 2062
859 Ga0495686_0143347 3300047472 Bacteria 1408
860 Ga0495686_0273894 3300047472 Bacteria 940
861 Ga0495686_0351573 3300047472 Bacteria 801
862 Ga0495686_0433544 3300047472 Bacteria 701
863 Ga0495593_0007695 3300047673 Bacteria 6288
864 Ga0495602_0026247 3300048088 Bacteria 5621
865 Ga0495602_0174533 3300048088 Bacteria 1664
866 Ga0495614_0003864 3300048089 Bacteria 6735
867 Ga0495626_0014917 3300048091 Bacteria 3990
868 Ga0496100_0007590 3300048903 Bacteria 5995
869 Ga0496100_0028223 3300048903 Bacteria 3460
870 Ga0496100_0344206 3300048903 Bacteria 1125
871 Ga0496100_0617324 3300048903 Bacteria 843
872 Ga0496101_0208454 3300048904 Bacteria 1513
873 Ga0496102_0005180 3300048905 Bacteria 11067
874 Ga0496102_0017154 3300048905 Bacteria 6340
875 Ga0496102_0049421 3300048905 Bacteria 3826
876 Ga0496102_0511438 3300048905 Bacteria 1123
877 Ga0496103_0019495 3300048906 Bacteria 4073
878 Ga0496103_0032651 3300048906 Bacteria 3177
879 Ga0496103_0041509 3300048906 Bacteria 2828
880 Ga0496103_0096293 3300048906 Bacteria 1870
881 Ga0496103_0116311 3300048906 Bacteria 1701
882 Ga0496103_0175439 3300048906 Bacteria 1377
883 Ga0496104_0013720 3300048907 Bacteria 7309
884 Ga0496104_0032278 3300048907 Bacteria 4873
885 Ga0496104_0107715 3300048907 Bacteria 2670
886 Ga0496104_0113317 3300048907 Bacteria 2600
887 Ga0496104_0244122 3300048907 Bacteria 1708
888 Ga0496104_0644269 3300048907 Bacteria 969
889 Ga0496105_0007184 3300048908 Bacteria 8594
890 Ga0496105_0019748 3300048908 Bacteria 5436
891 Ga0496105_0028800 3300048908 Bacteria 4543
892 Ga0496105_0041214 3300048908 Bacteria 3805
893 Ga0496105_0209209 3300048908 Bacteria 1590
894 Ga0496105_0709534 3300048908 Bacteria 771
895 Ga0496106_0001152 3300048909 Bacteria 19595
896 Ga0496106_0004584 3300048909 Bacteria 10252
897 Ga0496106_0013136 3300048909 Bacteria 6111
898 Ga0496106_0018500 3300048909 Bacteria 5153
899 Ga0496106_0031853 3300048909 Bacteria 3929
900 Ga0496106_0032086 3300048909 Bacteria 3915
901 Ga0496106_0173881 3300048909 Bacteria 1708
902 Ga0496106_0208207 3300048909 Bacteria 1557
903 Ga0496106_0253998 3300048909 Bacteria 1406
904 Ga0496106_0266595 3300048909 Bacteria 1371
905 Ga0496107_0008261 3300048910 Bacteria 7204
906 Ga0496107_0016800 3300048910 Bacteria 5145
907 Ga0496107_0035132 3300048910 Bacteria 3593
908 Ga0496107_0155721 3300048910 Bacteria 1692
909 Ga0496107_0266087 3300048910 Bacteria 1276
910 Ga0496107_0311859 3300048910 Bacteria 1171
911 Ga0496107_0387995 3300048910 Bacteria 1039
912 Ga0496107_0626244 3300048910 Bacteria 794
913 Ga0496108_0020986 3300048911 Bacteria 5369
914 Ga0496108_0079024 3300048911 Bacteria 2785
915 Ga0496108_0087619 3300048911 Bacteria 2644
916 Ga0496108_0508389 3300048911 Bacteria 1052
917 Ga0496109_0045666 3300048912 Bacteria 3976
918 Ga0496109_0064060 3300048912 Bacteria 3363
919 Ga0496109_0196993 3300048912 Bacteria 1894
920 Ga0496109_0313130 3300048912 Bacteria 1481
921 Ga0496109_0428833 3300048912 Bacteria 1249
922 Ga0496109_0520036 3300048912 Bacteria 1123
923 Ga0496109_0600523 3300048912 Bacteria 1037
924 Ga0496109_0648035 3300048912 Bacteria 993
925 Ga0496110_0014187 3300048913 Bacteria 6610
926 Ga0496110_0027366 3300048913 Bacteria 4888
927 Ga0496110_0041293 3300048913 Bacteria 4024
928 Ga0496110_0084470 3300048913 Bacteria 2833
929 Ga0496110_0346769 3300048913 Bacteria 1353
930 Ga0496111_0086380 3300048914 Bacteria 2295
931 Ga0496111_0092307 3300048914 Bacteria 2219
932 Ga0496111_0129848 3300048914 Bacteria 1864
933 Ga0496112_0038824 3300048915 Bacteria 4651
934 Ga0496112_0048748 3300048915 Bacteria 4151
935 Ga0496112_0092747 3300048915 Bacteria 2989
936 Ga0496112_0599215 3300048915 Bacteria 1034
937 Ga0496113_0020094 3300048916 Bacteria 4688
938 Ga0496113_0033739 3300048916 Bacteria 3729
939 Ga0496113_0185899 3300048916 Bacteria 1648
940 Ga0496113_0434342 3300048916 Bacteria 1055
941 Ga0496114_0029970 3300048917 Bacteria 4474
942 Ga0496114_0162823 3300048917 Bacteria 1941
943 Ga0496114_0183202 3300048917 Bacteria 1829
944 Ga0496115_0046865 3300048918 Bacteria 3456
945 Ga0496115_0049686 3300048918 Bacteria 3358
946 Ga0496115_0704927 3300048918 Bacteria 793
947 Ga0496116_0025718 3300048919 Bacteria 4321
948 Ga0496116_0069489 3300048919 Bacteria 2239
949 Ga0496116_0290197 3300048919 Bacteria 786
950 Ga0496117_0002298 3300048920 Bacteria 24600
951 Ga0496117_0015458 3300048920 Bacteria 6506
952 Ga0496117_0022441 3300048920 Bacteria 5061
953 Ga0496117_0054188 3300048920 Bacteria 2811
954 Ga0496118_0007362 3300048921 Bacteria 11698
955 Ga0496118_0015802 3300048921 Bacteria 6963
956 Ga0496118_0039123 3300048921 Bacteria 3789
957 Ga0496118_0100107 3300048921 Bacteria 1962
958 Ga0496118_0204153 3300048921 Bacteria 1167
959 Ga0496119_0000801 3300048922 Bacteria 42070
960 Ga0496119_0021437 3300048922 Bacteria 4672
961 Ga0496119_0060252 3300048922 Bacteria 2274
962 Ga0496119_0102027 3300048922 Bacteria 1609
963 Ga0496119_0104686 3300048922 Bacteria 1582
964 Ga0496120_0019393 3300048923 Bacteria 4351
965 Ga0496120_0056343 3300048923 Bacteria 2219
966 Ga0496120_0072422 3300048923 Bacteria 1888
967 Ga0496121_0000994 3300048924 Bacteria 50714
968 Ga0496121_0001567 3300048924 Bacteria 38104
969 Ga0496121_0002309 3300048924 Bacteria 29564
970 Ga0496121_0023552 3300048924 Bacteria 5923
971 Ga0496121_0026483 3300048924 Bacteria 5462
972 Ga0496121_0057543 3300048924 Bacteria 3221
973 Ga0496121_0074965 3300048924 Bacteria 2704
974 Ga0496121_0110103 3300048924 Bacteria 2102
975 Ga0496121_0110388 3300048924 Bacteria 2099
976 Ga0496122_0174951 3300048925 Bacteria 1288
977 Ga0496123_0049995 3300048926 Bacteria 2797
978 Ga0496123_0094679 3300048926 Bacteria 1759
979 Ga0496123_0141390 3300048926 Bacteria 1315
980 Ga0496124_0002590 3300048927 Bacteria 23408
981 Ga0496124_0003412 3300048927 Bacteria 19487
982 Ga0496124_0015526 3300048927 Bacteria 7292
983 Ga0496124_0216950 3300048927 Bacteria 1442
984 Ga0496124_0342192 3300048927 Bacteria 1061
985 Ga0496124_0350205 3300048927 Bacteria 1045
986 Ga0496124_0364466 3300048927 Bacteria 1017
987 Ga0496125_0000090 3300048928 Bacteria 214433
988 Ga0496125_0006401 3300048928 Bacteria 12754
989 Ga0496125_0006952 3300048928 Bacteria 12116
990 Ga0496125_0066369 3300048928 Bacteria 2852
991 Ga0496125_0158183 3300048928 Bacteria 1544
992 Ga0496126_0004395 3300048929 Bacteria 16896
993 Ga0496126_0010244 3300048929 Bacteria 9854
994 Ga0496126_0011274 3300048929 Bacteria 9274
995 Ga0496126_0161727 3300048929 Bacteria 1913
996 Ga0496126_0200250 3300048929 Bacteria 1687
997 Ga0496126_0266763 3300048929 Bacteria 1422
998 Ga0496126_0299072 3300048929 Bacteria 1328
999 Ga0496126_0866858 3300048929 Bacteria 687
1000 Ga0495682_0011145 3300049460 Bacteria 3464
1001 Ga0495682_0172159 3300049460 Bacteria 770
1002 Ga0501031_0016771 3300049568 Bacteria 4758
1003 Ga0501032_0027553 3300049569 Bacteria 3904
1004 Ga0501033_0001708 3300049570 Bacteria 19234
1005 Ga0501033_0035762 3300049570 Bacteria 3723
1006 Ga0501034_0056288 3300049571 Bacteria 3957
1007 Ga0501036_0073804 3300049572 Bacteria 2884
1008 Ga0501036_0144187 3300049572 Bacteria 2009
1009 Ga0501036_0341389 3300049572 Bacteria 1251
1010 Ga0501037_0001314 3300049573 Bacteria 18266
1011 Ga0501039_0045504 3300049575 Bacteria 3391
1012 Ga0501039_0175004 3300049575 Bacteria 1688
1013 Ga0501042_0382198 3300049578 Bacteria 1019
1014 Ga0501043_0000760 3300049579 Bacteria 28666
1015 Ga0501043_0111743 3300049579 Bacteria 2145
1016 Ga0501043_0736004 3300049579 Bacteria 718
1017 Ga0501046_0092217 3300049580 Bacteria 2329
1018 Ga0501046_0427739 3300049580 Bacteria 954
1019 Ga0501047_0484827 3300049581 Bacteria 1064
1020 Ga0501068_0269675 3300049584 Bacteria 1087
1021 Ga0501070_0114195 3300049586 Bacteria 2231
1022 Ga0501070_0321845 3300049586 Bacteria 1258
1023 Ga0501073_0601455 3300049589 Bacteria 759
1024 Ga0501075_0090248 3300049591 Bacteria 2325
1025 Ga0501076_0017649 3300049592 Bacteria 5426
1026 Ga0501076_0286797 3300049592 Bacteria 1349
1027 Ga0501076_0361686 3300049592 Bacteria 1192
1028 Ga0501076_0415986 3300049592 Bacteria 1106
1029 Ga0501077_0024157 3300049593 Bacteria 3858
1030 Ga0501077_0102836 3300049593 Bacteria 1810
1031 Ga0501077_0294990 3300049593 Bacteria 1033
1032 Ga0501249_000918 3300049679 Bacteria 6460
1033 Ga0501257_072402 3300049686 Bacteria 882
1034 Ga0501080_0646660 3300049742 Unclassified 936
1035 Ga0501081_0084045 3300049743 Bacteria 2232
1036 Ga0501081_0156475 3300049743 Bacteria 1640
1037 Ga0501081_0421331 3300049743 Bacteria 990
1038 Ga0501081_0542734 3300049743 Bacteria 868
1039 Ga0501081_0560100 3300049743 Bacteria 854
1040 Ga0501262_000119 3300049759 Bacteria 9781
1041 Ga0501035_0043760 3300049822 Bacteria 4034
1042 Ga0501035_0331617 3300049822 Bacteria 1276
1043 Ga0501044_0034344 3300049823 Bacteria 5318
1044 Ga0501044_0054261 3300049823 Bacteria 4121
1045 Ga0501045_0084276 3300049824 Bacteria 2345
1046 Ga0501045_0707362 3300049824 Bacteria 743
1047 nmdc:mga03683_24020_c1 3300050489 Bacteria 2381
1048 nmdc:mga03683_4079_c1 3300050489 Bacteria 4796
1049 nmdc:mga03n38_432078_c1 3300050490 Bacteria 730
1050 nmdc:mga00v17_67117_c1 3300050491 Bacteria 2216
1051 nmdc:mga0yw44_114147_c1 3300050492 Bacteria 1733
1052 nmdc:mga0yw44_19546_c1 3300050492 Bacteria 3738
1053 nmdc:mga0k408_147970_c1 3300050493 Bacteria 1398
1054 nmdc:mga0k408_183041_c1 3300050493 Bacteria 1250
1055 nmdc:mga0k408_69404_c1 3300050493 Bacteria 2056
1056 nmdc:mga06z11_4403_c1 3300050494 Bacteria 5545
1057 nmdc:mga06z11_85286_c1 3300050494 Bacteria 1703
1058 nmdc:mga04h51_13270_c1 3300050495 Bacteria 2330
1059 nmdc:mga04h51_8875_c1 3300050495 Bacteria 2704
1060 nmdc:mga07m45_176271_c1 3300050496 Bacteria 1243
1061 nmdc:mga07m45_3642_c1 3300050496 Bacteria 7442
1062 nmdc:mga07m45_37362_c2 3300050496 Bacteria 2472
1063 nmdc:mga07m45_8596_c1 3300050496 Bacteria 5258
1064 nmdc:mga05p37_644744_c1 3300050507 Bacteria 1187
1065 nmdc:mga0qj67_476_c1 3300050509 Bacteria 27363
1066 nmdc:mga06r32_3555_c1 3300050510 Bacteria 13921
1067 nmdc:mga06r32_556679_c1 3300050510 Bacteria 1120
1068 nmdc:mga08y16_399195_c1 3300050511 Bacteria 1407
1069 nmdc:mga0n895_175299_c1 3300050512 Bacteria 2175
1070 nmdc:mga0n895_282037_c1 3300050512 Bacteria 1685
1071 nmdc:mga0rr50_218219_c1 3300050513 Bacteria 1574
1072 nmdc:mga0rr50_590287_c1 3300050513 Bacteria 947
1073 nmdc:mga0rr50_635335_c1 3300050513 Bacteria 911
1074 nmdc:mga0rr50_949088_c1 3300050513 Bacteria 733
1075 nmdc:mga08x19_145077_c1 3300050514 Bacteria 1605
1076 nmdc:mga08x19_5793_c1 3300050514 Bacteria 7305
1077 nmdc:mga0a205_152814_c1 3300050515 Bacteria 2207
1078 nmdc:mga0sz30_74013_c1 3300050516 Bacteria 1469
1079 Ga0495601_0017549 3300053077 Bacteria 4346
1080 Ga0495601_0090553 3300053077 Bacteria 1968
1081 Ga0495612_0034172 3300053078 Bacteria 2058
1082 Ga0495612_0201248 3300053078 Bacteria 879
1083 Ga0500610_0012735 3300053079 Bacteria 3886
1084 Ga0500610_0044586 3300053079 Bacteria 2300
1085 Ga0500610_0072327 3300053079 Bacteria 1798
1086 Ga0500635_0000249 3300053080 Bacteria 23486
1087 Ga0500635_0092243 3300053080 Bacteria 1103
1088 Ga0495595_0260186 3300053084 Bacteria 869
1089 Ga0495619_0056741 3300053085 Bacteria 2597
1090 Ga0495619_0322387 3300053085 Bacteria 1069
1091 Ga0495619_0463748 3300053085 Bacteria 873
1092 Ga0500578_0157611 3300053086 Bacteria 1411
1093 Ga0500643_000015 3300053087 Bacteria 310312
1094 Ga0500643_000169 3300053087 Bacteria 64699
1095 Ga0500643_019339 3300053087 Bacteria 2243
1096 Ga0500647_0103704 3300053091 Bacteria 1357
1097 Ga0500647_0115227 3300053091 Bacteria 1275
1098 Ga0500651_0000095 3300053093 Bacteria 54857
1099 Ga0500566_0000082 3300053094 Bacteria 47150
1100 Ga0500566_0000536 3300053094 Bacteria 21299
1101 Ga0500566_0110117 3300053094 Bacteria 1498
1102 Ga0500566_0135996 3300053094 Bacteria 1309
1103 Ga0500640_005617 3300053095 Bacteria 4702
1104 Ga0500554_045377 3300053102 Bacteria 1365
1105 Ga0500555_011988 3300053103 Bacteria 2490
1106 Ga0500555_014312 3300053103 Bacteria 2286
1107 Ga0500556_0065680 3300053104 Bacteria 1346
1108 Ga0500557_000015 3300053105 Bacteria 106282
1109 Ga0500562_016628 3300053108 Bacteria 1892
1110 Ga0500562_018462 3300053108 Bacteria 1801
1111 Ga0500569_019624 3300053109 Bacteria 1762
1112 Ga0500571_000379 3300053110 Bacteria 17609
1113 Ga0500572_000291 3300053111 Bacteria 18086
1114 Ga0500572_013990 3300053111 Bacteria 1997
1115 Ga0500572_033191 3300053111 Bacteria 1454
1116 Ga0500591_043308 3300053115 Bacteria 2134
1117 Ga0500593_001477 3300053117 Bacteria 8448
1118 Ga0500595_019509 3300053119 Bacteria 2459
1119 Ga0500595_022557 3300053119 Bacteria 2226
1120 Ga0500597_023797 3300053120 Bacteria 2452
1121 Ga0500607_078703 3300053121 Bacteria 1685
1122 Ga0500608_000290 3300053122 Bacteria 19514
1123 Ga0500608_008878 3300053122 Bacteria 4246
1124 Ga0500614_000882 3300053123 Bacteria 7578
1125 Ga0500618_003090 3300053125 Bacteria 5889
1126 Ga0500618_012045 3300053125 Bacteria 2275
1127 Ga0500618_020009 3300053125 Bacteria 1643
1128 Ga0500621_238276 3300053126 Bacteria 619
1129 Ga0500642_0000166 3300053130 Bacteria 27296
1130 Ga0500642_0088967 3300053130 Bacteria 1425
1131 Ga0500655_009192 3300053133 Bacteria 1778
1132 Ga0500658_0000763 3300053134 Bacteria 13270
1133 Ga0500658_0000783 3300053134 Bacteria 13145
1134 Ga0500559_0000323 3300053136 Bacteria 36225
1135 Ga0500559_0001387 3300053136 Bacteria 13795
1136 Ga0500559_0015366 3300053136 Bacteria 3232
1137 Ga0500564_027527 3300053138 Bacteria 2616
1138 Ga0500568_0004399 3300053139 Bacteria 7538
1139 Ga0500568_0028635 3300053139 Bacteria 2321
1140 Ga0500568_0066645 3300053139 Bacteria 1384
1141 Ga0500574_015820 3300053141 Bacteria 1810
1142 Ga0500588_0126618 3300053146 Bacteria 906
1143 Ga0500590_060305 3300053148 Bacteria 1908
1144 Ga0500603_000122 3300053150 Bacteria 18283
1145 Ga0500603_085817 3300053150 Bacteria 918
1146 Ga0500616_0048633 3300053153 Bacteria 2247
1147 Ga0500619_022128 3300053154 Bacteria 1842
1148 Ga0500620_021405 3300053155 Bacteria 1932
1149 Ga0500622_0001660 3300053156 Bacteria 17388
1150 Ga0500622_0021694 3300053156 Bacteria 3407
1151 Ga0500624_003999 3300053157 Bacteria 1933
1152 Ga0500627_0026770 3300053158 Bacteria 2384
1153 Ga0500630_007401 3300053159 Bacteria 5384
1154 Ga0500634_0003453 3300053161 Bacteria 7028
1155 Ga0500634_0039731 3300053161 Bacteria 2558
1156 Ga0500638_004133 3300053162 Bacteria 5527
1157 Ga0500638_050545 3300053162 Bacteria 2010
1158 Ga0500638_077323 3300053162 Bacteria 1584
1159 Ga0500638_163515 3300053162 Bacteria 977
1160 Ga0500638_192867 3300053162 Bacteria 868
1161 Ga0500639_000001 3300053163 Bacteria 244795
1162 Ga0500639_022629 3300053163 Bacteria 3320
1163 Ga0500639_125960 3300053163 Bacteria 1222
1164 Ga0500636_0037880 3300053177 Bacteria 2852
1165 Ga0500636_0066749 3300053177 Bacteria 2091
1166 Ga0500636_0067042 3300053177 Bacteria 2085
1167 Ga0500636_0071217 3300053177 Bacteria 2016
1168 Ga0500636_0076099 3300053177 Bacteria 1941
1169 Ga0500637_0013284 3300053178 Bacteria 4314
1170 Ga0500637_0179154 3300053178 Bacteria 1215
1171 Ga0500637_0253446 3300053178 Bacteria 980
1172 Ga0500576_042002 3300053725 Bacteria 2055
1173 Ga0500576_151207 3300053725 Bacteria 867
1174 Ga0500625_014727 3300053729 Bacteria 3617
1175 Ga0500625_115951 3300053729 Bacteria 1088
1176 Ga0500625_134774 3300053729 Bacteria 963
1177 Ga0500645_015438 3300053730 Bacteria 2419
1178 Ga0500609_034473 3300053731 Bacteria 697
1179 Ga0500596_002414 3300053735 Bacteria 3683
1180 Ga0500599_005969 3300053736 Bacteria 1543
1181 Ga0500601_000032 3300053737 Bacteria 31109
1182 Ga0501084_0253849 3300054114 Bacteria 1484
1183 Ga0501082_0118989 3300060353 Bacteria 2289
1184 Ga0501082_0136512 3300060353 Bacteria 2128
1185 Ga0501082_0242661 3300060353 Bacteria 1568
1186 Ga0530510_0010491 3300061734 Bacteria 6496
1187 2507508575 2507262055 Bacteria 8048963
1188 2508542651 2508501009 Bacteria 7784016
1189 2508691573 2508501042 Bacteria 8719808
1190 2509150894 2508501128 Bacteria 8613869
1191 2513229094 2513020051 Bacteria 6053213
1192 2513623040 2513237092 Bacteria 8341956
1193 2513638970 2513237094 Bacteria 8789602
1194 2513654732 2513237096 Bacteria 8722461
1195 2513722356 2513237104 Bacteria 10034502
1196 2513855846 2513237137 Bacteria 9558895
1197 2513872776 2513237139 Bacteria 8737671
1198 2513889135 2513237141 Bacteria 8496279
1199 2513915088 2513237145 Bacteria 8979722
1200 2514011848 2513237161 Bacteria 8871253
1201 2517106762 2517093001 Bacteria 9002274
1202 2517892383 2517572143 Bacteria 9484767
1203 2524443125 2524023205 Bacteria 8918781
1204 2524468897 2524023210 Bacteria 9029266
1205 2524538523 2524023228 Bacteria 10118060
1206 2585277017 2582581308 Bacteria 7413247
1207 2585333627 2582581316 Bacteria 7774528
1208 2585537028 2585427527 Bacteria 7273426
1209 2585551879 2585427530 Bacteria 7383882
1210 2616308391 2615840626 Bacteria 7921970
1211 2617349025 2617270735 Bacteria 9163226
1212 2617375770 2617270741 Bacteria 8201522
1213 2644288713 2643221651 Bacteria 4798932
1214 2644329178 2643221658 Bacteria 6064537
1215 2644401729 2643221672 Bacteria 6322190
1216 2728751171 2728368998 Bacteria 8720350
1217 2738717321 2738541277 Bacteria 7458140
1218 2738878896 2738541307 Bacteria 8606193
1219 2739278007 2738543019 Bacteria 7459457
1220 2793062388 2791355196 Bacteria 7323613
1221 2805915326 2802429603 Bacteria 8777136
1222 2818238879 2816332527 Bacteria 8933356
1223 2819638093 2818991453 Bacteria 7181617
1224 2824605755 2824600985 Bacteria 8488197
1225 2824614448 2824609381 Bacteria 8672835
1226 2824623244 2824617872 Bacteria 8814715
1227 2824633172 2824626560 Bacteria 8813858
1228 2824640009 2824635225 Bacteria 8785348
1229 2824650220 2824644064 Bacteria 8743947
1230 2824657739 2824653114 Bacteria 8493680
1231 2824677389 2824671348 Bacteria 8369588
1232 2824685255 2824679649 Bacteria 8248951
1233 2824693051 2824687955 Bacteria 8360029
1234 2824700748 2824696289 Bacteria 8335049
1235 2824711347 2824704595 Bacteria 9667483
1236 2824719494 2824714736 Bacteria 8717648
1237 2824729948 2824723954 Bacteria 8758240
1238 2824738043 2824732956 Bacteria 7810675
1239 2824749286 2824746037 Bacteria 7911610
1240 2824758206 2824753945 Bacteria 9787441
1241 2824768187 2824763712 Bacteria 9792355
1242 2824779550 2824773399 Bacteria 8360218
1243 2838060812 2838054893 Bacteria 7451788
1244 2838123744 2838122688 Bacteria 8803140
1245 2841914651 2841911363 Bacteria 6173697
1246 2841920184 2841917233 Bacteria 6173500
1247 2841948647 2841941048 Bacteria 8688029
1248 2841949845 2841949485 Bacteria 8680857
1249 2841958671 2841957949 Bacteria 8652217
1250 2841966263 2841966195 Bacteria 8673214
1251 2841975000 2841974524 Bacteria 8931498
1252 2841983432 2841983080 Bacteria 8395090
1253 2842039061 2842038055 Bacteria 8002051
1254 2842042949 2842038055 Bacteria 8002051
1255 2842047992 2842045827 Bacteria 8006841
1256 2842050990 2842045827 Bacteria 8006841
1257 2844319100 2844315083 Bacteria 8138177
1258 2847936214 2847930680 Bacteria 9342022
1259 2847946574 2847939898 Bacteria 8606328
1260 2849079302 2849076700 Bacteria 7039503
1261 2857514306 2857509624 Bacteria 7472071
1262 2874598052 2874590934 Bacteria 8299676
1263 2874615417 2874612657 Bacteria 8252029
1264 2874627823 2874620515 Bacteria 8290088
1265 2874647502 2874645413 Bacteria 8214782
1266 2876778470 2876771140 Bacteria 8287509
1267 2876811137 2876808645 Bacteria 8824342
1268 2876820416 2876818435 Bacteria 8274608
1269 2879082264 2879074833 Bacteria 8279565
1270 2879083711 2879083081 Bacteria 8587928
1271 2879111175 2879110137 Bacteria 8907982
1272 2879135411 2879127579 Bacteria 8294491
1273 2879150619 2879142872 Bacteria 8267021
1274 2881368828 2881364244 Bacteria 7710352
1275 2881671176 2881665667 Bacteria 8175609
1276 2885203550 2885198086 Bacteria 7212419
1277 2885217100 2885211737 Bacteria 7212420
1278 2885373163 2885366525 Bacteria 8326213
1279 2885410440 2885409591 Bacteria 9235467
1280 2888424537 2888419890 Bacteria 7857137
1281 2889039849 2889033259 Bacteria 9099371
1282 2903728976 2903727486 Bacteria 8281579
1283 2904450587 2904449895 Bacteria 6927402
1284 2904456591 2904456579 Bacteria 6819253
1285 2904549987 2904541872 Bacteria 8915136
1286 2904672857 2904666416 Bacteria 8226587
1287 2904703448
1288 2904714629 2904711408 Bacteria 9771557
1289 2906607109 2906602504 Bacteria 8295279
1290 2906633275 2906626472 Bacteria 8826946
1291 2906638920 2906635258 Bacteria 8601019
1292 2906651452 2906643746 Bacteria 8722424
1293 2906666363 2906660503 Bacteria 8595048
1294 2908780175 2908775508 Bacteria 8092255
1295 2919409847 2919408235 Bacteria 6149349
1296 2919462880 2919462493 Bacteria 5817112
1297 2919678807 2919675420 Bacteria 3969095
1298 2922365346 2922361189 Bacteria 7436256
1299 2922374400
1300 2922393950 2922393267 Bacteria 8285685
1301 2922396234 2922393267 Bacteria 8285685
1302 2928089028 2928084124 Bacteria 7159212
1303 2928117863 2928115317 Bacteria 6477646
1304 2929164875 2929160207 Bacteria 9075316
1305 2929521303 2929520902 Bacteria 6765052
1306 2932797462 2932794094 Bacteria 7915132
1307 2932802783 2932801729 Bacteria 7987968
1308 2935608890 2935608549 Bacteria 8203142
1309 2935650056 2935648319 Bacteria 8801166
1310 2935661792 2935656913 Bacteria 8965014
1311 2935773302 2935769743 Bacteria 7878163
1312 2935778543 2935777560 Bacteria 8077691
1313 2935792744 2935785616 Bacteria 7962367
1314 2935800771 2935793552 Bacteria 8012592
1315 2935822050 2935819856 Bacteria 8261050
1316 2935847632 2935847175 Bacteria 8228321
1317 2935889877 2935883170 Bacteria 7964738
1318 2935909097 2935908558 Bacteria 8568796
1319 2935919818 2935916978 Bacteria 9113783
1320 2935926329 2935926038 Bacteria 8601059
1321 2935934779 2935934488 Bacteria 8602579
1322 2935943229 2935942939 Bacteria 8599779
1323 2935951667 2935951376 Bacteria 8602333
1324 2935965839 2935959822 Bacteria 7869783
1325 2935967792 2935967501 Bacteria 8603075
1326 2935982666 2935975950 Bacteria 8347125
1327 2935988160 2935984226 Bacteria 8302647
1328 2936012460 2936011229 Bacteria 8801034
1329 2936021025 2936019824 Bacteria 8804134
1330 2936029753 2936028420 Bacteria 8965941
1331 2936047218 2936046547 Bacteria 8903709
1332 2936057623 2936055302 Bacteria 8785755
1333 2941532821 2941531003 Bacteria 7653939
1334 2945913744 2945909444 Bacteria 7065066
1335 2945949320 2945945610 Bacteria 5951079
1336 2945973368 2945972063 Bacteria 6086495
1337 2945990863 2945984333 Bacteria 7358892
1338 2954771043 2954767861 Bacteria 5535784
1339 3005592646 3005587118 Bacteria 7794411
1340 3005599241 3005594810 Bacteria 8716512
1341 3005714917 3005710791 Bacteria 7622528
1342 3005722332 3005718088 Bacteria 8283608
1343 8006940665 8006933436 Bacteria 10410654
1344 8006980355 8006973647 Bacteria 10679141
1345 8016529607 8016522445 Bacteria 8156687
1346 8016534822 8016530956 Bacteria 8155261
1347 8016548035 8016539877 Bacteria 8155419
1348 8016554092 8016548790 Bacteria 8155074
1349 8016591748 8016583857 Bacteria 10421953
1350 8016600262 8016595262 Bacteria 8149947
1351 8016610487 8016603502 Bacteria 8731218
1352 8016614448 8016613128 Bacteria 8794220
1353 8016626549 8016622563 Bacteria 7999408
1354 8016640331 8016630954 Bacteria 9217207
1355 8019534588 8019530166 Bacteria 8155624
1356 8019544884 8019538911 Bacteria 7872763
1357 8019553650 8019547302 Bacteria 7996444
1358 8019628164 8019619141 Bacteria 9218857
1359 8019634451 8019629233 Bacteria 8687553
1360 8019645278 8019638758 Bacteria 9062356
1361 8019658408 8019648815 Bacteria 10014479
1362 8019662342 8019659431 Bacteria 8577854
1363 8019671844 8019668869 Bacteria 8791617
1364 8019690084 8019687851 Bacteria 8712826
1365 8056686670 8056681323 Bacteria 8472857
1366 8056968048 8056967851 Bacteria 9038162
1367 Ga0496101_0273333
1368 JGI24740J21852_10026939
1369 JGI24739J22299_10030477
1370 JGI25162J39368_1000577
1371 JGI25162J39368_1001401
1372 JGI25162J39368_1001515
1373 JGI25158J39367_1006561
1374 JGI25152J39213_1028894
1375 JGI25159J45721_1029267
1376 JGI25151J46595_10001814
1377 JGI25151J46595_10003602
1378 JGI25406J46586_10000104
1379 JGI25165J46597_1000654
1380 JGI25165J46597_1001229
1381 JGI25165J46597_1005089
1382 JGI25153J46596_10000022
1383 JGI25153J46596_10000531
1384 rootH1_10106416
1385 JGI25160J50197_1004582
1386 JGI25160J50197_1006303
1387 JGI25161J50226_1008089
1388 Ga0006562J51391_1096725
1389 Ga0006562J51391_1096726
1390 Ga0055526_1021043
1391 Ga0055537_1000134
1392 Ga0055524_1019623
1393 Ga0055536_1003710
1394 Ga0055536_1005818
1395 Ga0055534_1000088
1396 Ga0055534_1015173
1397 Ga0055528_1000493
1398 Ga0055530_10000495
1399 Ga0055540_1001986
1400 Ga0055540_1002205
1401 Ga0055540_1004978
1402 Ga0055540_1038840
1403 Ga0055531_10002338
1404 Ga0055531_10003743
1405 Ga0055543_1005204
1406 Ga0055543_1009121
1407 Ga0065165_1000780
1408 Ga0065165_1000826
1409 Ga0065165_1018204
1410 Ga0065165_1048388
1411 Ga0070658_10790892
1412 Ga0070658_10995982
1413 Ga0070676_10754911
1414 Ga0070683_100060557
1415 Ga0070670_100272808
1416 Ga0070680_100043111
1417 Ga0070680_100055517
1418 Ga0070680_100506005
1419 Ga0070682_100404603
1420 Ga0070682_100537566
1421 Ga0068868_100631688
1422 Ga0068868_100890642
1423 Ga0070660_100088577
1424 Ga0070691_10028452
1425 Ga0070691_10132829
1426 Ga0070687_100093724
1427 Ga0070661_100043450
1428 Ga0070661_100141174
1429 Ga0070692_10254507
1430 Ga0070668_100035983
1431 Ga0070668_100050905
1432 Ga0070668_100069611
1433 Ga0070668_100214967
1434 Ga0070668_100752685
1435 Ga0070669_100163351
1436 Ga0070669_100453835
1437 Ga0070669_100593283
1438 Ga0070675_100574806
1439 Ga0070671_100011820
1440 Ga0070671_100199501
1441 Ga0070674_100301223
1442 Ga0070673_100126972
1443 Ga0070688_100256917
1444 Ga0070659_100155671
1445 Ga0070659_100194377
1446 Ga0070667_100100625
1447 Ga0070667_100209805
1448 Ga0070667_100472534
1449 Ga0070667_100619121
1450 Ga0070667_101034694
1451 Ga0070703_10013557
1452 Ga0070703_10089962
1453 Ga0070714_100140826
1454 Ga0070713_100299529
1455 Ga0070713_100319379
1456 Ga0070710_10210652
1457 Ga0070710_10490937
1458 Ga0070701_10138179
1459 Ga0070701_10138929
1460 Ga0070701_10339768
1461 Ga0070711_100567895
1462 Ga0070711_100874750
1463 Ga0070705_100000144
1464 Ga0070705_100089856
1465 Ga0070705_100122839
1466 Ga0070705_100205007
1467 Ga0070700_100006214
1468 Ga0070694_100001328
1469 Ga0070694_100086792
1470 Ga0070694_100234679
1471 Ga0070694_100643394
1472 Ga0070708_100004216
1473 Ga0070663_100153516
1474 Ga0070663_100157236
1475 Ga0070663_100238111
1476 Ga0070678_100015254
1477 Ga0070678_100093738
1478 Ga0070678_100322009
1479 Ga0070678_100884574
1480 Ga0070662_100007222
1481 Ga0070662_100176306
1482 Ga0070662_100218509
1483 Ga0070662_100639093
1484 Ga0070681_10036878
1485 Ga0070681_10885766
1486 Ga0068867_100147402
1487 Ga0068867_100902520
1488 Ga0070698_101134818
1489 Ga0070699_100006781
1490 Ga0070679_100214536
1491 Ga0070684_100032782
1492 Ga0070684_100281542
1493 Ga0070697_100009721
1494 Ga0070697_100085543
1495 Ga0070697_100321850
1496 Ga0068853_100022177
1497 Ga0068853_100095568
1498 Ga0068853_100303162
1499 Ga0068853_100397131
1500 Ga0068853_101554697
1501 Ga0070672_100194303
1502 Ga0070686_100000034
1503 Ga0070686_100101148
1504 Ga0070695_100000788
1505 Ga0070695_100058879
1506 Ga0070695_100066068
1507 Ga0070696_100002042
1508 Ga0070696_100275874
1509 Ga0070696_100389838
1510 Ga0070693_100150501
1511 Ga0070665_100000080
1512 Ga0070665_100028942
1513 Ga0070665_100073704
1514 Ga0070665_100692901
1515 Ga0070665_101116487
1516 Ga0070665_101740274
1517 Ga0070704_100000738
1518 Ga0068855_100012600
1519 Ga0068855_100039920
1520 Ga0068855_100137154
1521 Ga0068855_100685595
1522 Ga0068855_100984759
1523 Ga0070664_100103775
1524 Ga0070664_100290694
1525 Ga0070664_100404338
1526 Ga0068857_100033416
1527 Ga0068857_100049057
1528 Ga0068857_100084690
1529 Ga0068857_100120139
1530 Ga0068854_100765719
1531 Ga0068856_100003868
1532 Ga0068856_100018322
1533 Ga0068856_100062608
1534 Ga0068856_100252508
1535 Ga0068856_100404069
1536 Ga0068856_100605328
1537 Ga0068856_100790342
1538 Ga0068856_100896732
1539 Ga0070702_100047855
1540 Ga0070702_100138404
1541 Ga0068852_100036166
1542 Ga0068852_100040678
1543 Ga0068852_100225540
1544 Ga0068852_100345180
1545 Ga0068852_100729817
1546 Ga0068852_100791427
1547 Ga0068852_100975910
1548 Ga0068859_100000869
1549 Ga0068859_100002326
1550 Ga0068859_100659740
1551 Ga0068864_100017331
1552 Ga0068864_100027080
1553 Ga0068864_100102681
1554 Ga0068864_100135221
1555 Ga0068864_101301791
1556 Ga0068866_10149793
1557 Ga0068861_100051037
1558 Ga0068861_100777191
1559 Ga0068851_10016100
1560 Ga0068870_10105206
1561 Ga0068863_100106573
1562 Ga0068863_100898304
1563 Ga0068858_100053503
1564 Ga0068858_100239591
1565 Ga0068858_100842948
1566 Ga0068860_100000210
1567 Ga0068860_100000965
1568 Ga0068860_100339804
1569 Ga0068860_100419263
1570 Ga0068860_100773744
1571 Ga0068862_100000912
1572 Ga0068862_100205330
1573 Ga0068862_100263320
1574 Ga0068862_100356386
1575 Ga0068862_100977808
1576 Ga0081455_10002205
1577 Ga0081540_1046278
1578 Ga0081539_10000273
1579 Ga0081539_10123396
1580 Ga0070717_10016039
1581 Ga0070717_10287748
1582 Ga0075365_10022310
1583 Ga0075365_10543409
1584 Ga0075368_10007965
1585 Ga0075363_100028828
1586 Ga0075363_100078167
1587 Ga0075364_10121280
1588 Ga0075364_10176672
1589 Ga0070716_100074153
1590 Ga0070716_100080787
1591 Ga0070716_100697358
1592 Ga0070712_100433641
1593 Ga0075362_10003901
1594 Ga0075362_10183722
1595 Ga0075362_10222855
1596 Ga0075367_10019079
1597 Ga0075367_10055605
1598 Ga0075369_10045749
1599 Ga0075369_10282093
1600 Ga0075366_10146085
1601 Ga0075366_10240931
1602 Ga0075366_10245255
1603 Ga0075366_10305888
1604 Ga0097621_100166546
1605 Ga0097621_100770517
1606 Ga0075370_10000340
1607 Ga0075370_10003478
1608 Ga0075370_10006104
1609 Ga0075370_10009436
1610 Ga0075370_10013496
1611 Ga0075370_10057449
1612 Ga0075370_10101346
1613 Ga0075370_10236906
1614 Ga0075370_10271985
1615 Ga0068871_100647091
1616 Ga0075428_100556934
1617 Ga0075430_100000704
1618 Ga0075433_10148882
1619 Ga0075433_10272009
1620 Ga0075433_10459509
1621 Ga0075434_100109048
1622 Ga0075434_100574720
1623 Ga0075429_100561037
1624 Ga0068865_100310691
1625 Ga0075436_100008201
1626 Ga0097620_100000869
1627 Ga0097620_100002326
1628 Ga0097620_100659669
1629 Ga0099825_1023258
1630 Ga0099824_1018212
1631 Ga0099824_1034018
1632 Ga0099823_1025049
1633 Ga0099826_10000527
1634 Ga0099826_10066619
1635 Ga0099826_10193958
1636 Ga0075435_100102104
1637 Ga0075435_100527947
1638 Ga0075435_100550900
1639 Ga0075435_100686323
1640 Ga0099794_10003083
1641 Ga0099795_10055335
1642 Ga0105244_10037542
1643 Ga0105240_10000005
1644 Ga0105240_10329682
1645 Ga0105240_10332635
1646 Ga0111539_10234844
1647 Ga0111539_10448524
1648 Ga0105245_10021271
1649 Ga0105245_10099026
1650 Ga0105245_10102553
1651 Ga0105245_10304571
1652 Ga0105245_10475149
1653 Ga0105245_10921319
1654 Ga0105247_10012701
1655 Ga0105247_10034582
1656 Ga0105247_10043146
1657 Ga0105247_10249563
1658 Ga0114129_10761419
1659 Ga0105243_10004089
1660 Ga0105243_10098611
1661 Ga0105243_10221870
1662 Ga0105243_10590185
1663 Ga0105241_10009269
1664 Ga0105241_10012989
1665 Ga0105241_10013325
1666 Ga0105241_10120965
1667 Ga0105242_10225243
1668 Ga0105242_11111857
1669 Ga0105237_10000773
1670 Ga0105237_10003857
1671 Ga0105237_10044608
1672 Ga0105237_10115667
1673 Ga0105237_10149449
1674 Ga0105237_10263223
1675 Ga0105237_11132214
1676 Ga0105238_10030500
1677 Ga0105238_10108782
1678 Ga0105238_10163979
1679 Ga0105238_10199208
1680 Ga0105238_11258299
1681 Ga0105249_10009032
1682 Ga0099796_10003721
1683 Ga0105239_10014053
1684 Ga0105239_10024440
1685 Ga0105239_10201930
1686 Ga0105239_10231432
1687 Ga0105239_10329501
1688 Ga0105239_10868651
1689 Ga0105239_11173624
1690 Ga0105246_10024476
1691 Ga0105246_10104058
1692 Ga0105246_10131374
1693 Ga0157373_10046733
1694 Ga0157373_10338283
1695 Ga0157373_10505966
1696 Ga0157370_10001070
1697 Ga0157370_10017784
1698 Ga0157370_10055881
1699 Ga0157370_10297240
1700 Ga0157370_10388926
1701 Ga0157370_10816105
1702 Ga0157369_10081621
1703 Ga0157369_10605433
1704 Ga0157369_10663058
1705 Ga0157374_10049221
1706 Ga0157374_10791935
1707 Ga0157378_10416560
1708 Ga0157378_10685795
1709 Ga0163162_10119621
1710 Ga0163162_10126464
1711 Ga0163162_10180113
1712 Ga0163162_11003933
1713 Ga0163162_11473840
1714 Ga0157372_10643187
1715 Ga0157375_10032801
1716 Ga0157375_10708692
1717 Ga0157375_11130436
1718 Ga0163163_10011142
1719 Ga0163163_10272621
1720 Ga0163163_10853767
1721 Ga0163163_12038541
1722 Ga0157380_10177037
1723 Ga0157380_10381080
1724 Ga0182008_10001456
1725 Ga0182008_10006000
1726 Ga0182008_10118087
1727 Ga0182008_10159619
1728 Ga0157377_10023849
1729 Ga0157379_10022522
1730 Ga0157379_10074696
1731 Ga0157379_10120531
1732 Ga0157376_10207522
1733 Ga0157376_10266982
1734 Ga0157376_10355311
1735 Ga0182006_1005446
1736 Ga0182006_1015639
1737 Ga0182006_1072863
1738 Ga0182007_10000618
1739 Ga0182007_10000705
1740 Ga0182007_10003145
1741 Ga0182005_1002283
1742 Ga0182005_1022006
1743 Ga0163161_10000105
1744 Ga0163161_10009252
1745 Ga0163161_10036161
1746 Ga0163161_10140745
1747 Ga0206356_11464399
1748 Ga0214544_1000002
1749 Ga0214542_1000001
1750 Ga0214542_1041125
1751 Ga0214545_1000001
1752 Ga0214545_1033424
1753 Ga0214543_1000001
1754 Ga0213876_10000384
1755 Ga0213871_10092503
1756 Ga0209436_116869
1757 Ga0207427_109743
1758 Ga0209437_100122
1759 Ga0209437_100160
1760 Ga0209437_110384
1761 Ga0209677_101583
1762 Ga0209677_101865
1763 Ga0209148_1000289
1764 Ga0209129_1001398
1765 Ga0209129_1011590
1766 Ga0209233_1000168
1767 Ga0209233_1000170
1768 Ga0209233_1000297
1769 Ga0209233_1002174
1770 Ga0209233_1014997
1771 Ga0209565_1000046
1772 Ga0209455_1000612
1773 Ga0209673_1000058
1774 Ga0209673_1000559
1775 Ga0209130_1000215
1776 Ga0209675_1000010
1777 Ga0209675_1002925
1778 Ga0209676_1000004
1779 Ga0209676_1000172
1780 Ga0209676_1009807
1781 Ga0209025_1000122
1782 Ga0209025_1000686
1783 Ga0209025_1013681
1784 Ga0209025_1013966
1785 Ga0209564_1000413
1786 Ga0209758_1000005
1787 Ga0209758_1000160
1788 Ga0209758_1000777
1789 Ga0209758_1001948
1790 Ga0209758_1055006
1791 Ga0209050_1000002
1792 Ga0209050_1000509
1793 Ga0209050_1008280
1794 Ga0209256_1000067
1795 Ga0207426_1000178
1796 Ga0207426_1000264
1797 Ga0207426_1002608
1798 Ga0209051_1000002
1799 Ga0209051_1000096
1800 Ga0209051_1000159
1801 Ga0209051_1000278
1802 Ga0209051_1010695
1803 Ga0209257_1000002
1804 Ga0209257_1000072
1805 Ga0209257_1001087
1806 Ga0207697_10083776
1807 Ga0207656_10034550
1808 Ga0207655_1011777
1809 Ga0207655_1126776
1810 Ga0207653_10004268
1811 Ga0207710_10010427
1812 Ga0207710_10022846
1813 Ga0207710_10123653
1814 Ga0207710_10386519
1815 Ga0207680_10020320
1816 Ga0207680_10209532
1817 Ga0207647_10005160
1818 Ga0207647_10060474
1819 Ga0207647_10099127
1820 Ga0207647_10200906
1821 Ga0207647_10211500
1822 Ga0207643_10126933
1823 Ga0207705_10267593
1824 Ga0207705_10538347
1825 Ga0207654_10019270
1826 Ga0207654_10199888
1827 Ga0207654_10365534
1828 Ga0207707_10018205
1829 Ga0207707_10058939
1830 Ga0207707_10084972
1831 Ga0207695_10000011
1832 Ga0207695_10001631
1833 Ga0207695_10202413
1834 Ga0207671_10001637
1835 Ga0207671_10002644
1836 Ga0207671_10003901
1837 Ga0207671_10051707
1838 Ga0207671_10173190
1839 Ga0207671_10176862
1840 Ga0207671_10825902
1841 Ga0207693_10017812
1842 Ga0207663_10050313
1843 Ga0207663_10094251
1844 Ga0207663_10382017
1845 Ga0207663_10408187
1846 Ga0207663_10695236
1847 Ga0207660_10005245
1848 Ga0207660_10095920
1849 Ga0207660_10441300
1850 Ga0207662_10178198
1851 Ga0207657_10045084
1852 Ga0207657_10095794
1853 Ga0207657_10113141
1854 Ga0207657_10385830
1855 Ga0207657_10405870
1856 Ga0207649_10238147
1857 Ga0207649_10395456
1858 Ga0207681_10548452
1859 Ga0207694_10080500
1860 Ga0207694_10134437
1861 Ga0207694_10176876
1862 Ga0207694_10500805
1863 Ga0207694_10562767
1864 Ga0207650_10315156
1865 Ga0207700_10003559
1866 Ga0207700_10257555
1867 Ga0207664_10492587
1868 Ga0207644_10372114
1869 Ga0207644_10419193
1870 Ga0207644_10750217
1871 Ga0207690_10187469
1872 Ga0207690_10597774
1873 Ga0207706_10018115
1874 Ga0207706_10051455
1875 Ga0207706_10923913
1876 Ga0207686_10211946
1877 Ga0207709_10003493
1878 Ga0207709_10060765
1879 Ga0207669_10049156
1880 Ga0207704_10711361
1881 Ga0207665_10075953
1882 Ga0207665_10459389
1883 Ga0207691_10402717
1884 Ga0207711_10032286
1885 Ga0207711_10363403
1886 Ga0207711_10965335
1887 Ga0207689_10014529
1888 Ga0207689_10364419
1889 Ga0207661_10050057
1890 Ga0207661_10235662
1891 Ga0207661_10808329
1892 Ga0207679_10160399
1893 Ga0207679_10196745
1894 Ga0207667_10015041
1895 Ga0207667_10045209
1896 Ga0207667_10170360
1897 Ga0207667_10196388
1898 Ga0207667_10392952
1899 Ga0207667_10450233
1900 Ga0207651_10772537
1901 Ga0207712_10024490
1902 Ga0207712_10872602
1903 Ga0207668_10099695
1904 Ga0207658_10101528
1905 Ga0207658_10510904
1906 Ga0207658_10513115
1907 Ga0207658_10781979
1908 Ga0207703_10219125
1909 Ga0207703_10360805
1910 Ga0207703_10784020
1911 Ga0207639_10261864
1912 Ga0207639_10266446
1913 Ga0207639_10987769
1914 Ga0207678_10000337
1915 Ga0207678_10018039
1916 Ga0207678_10024825
1917 Ga0207678_10047440
1918 Ga0207678_10073747
1919 Ga0207678_10178025
1920 Ga0207678_10339727
1921 Ga0207708_10001974
1922 Ga0207708_10240634
1923 Ga0207702_10010148
1924 Ga0207702_10287065
1925 Ga0207702_10451637
1926 Ga0207702_10692841
1927 Ga0207702_10744360
1928 Ga0207702_11173206
1929 Ga0207641_10041110
1930 Ga0207641_10243477
1931 Ga0207641_11039906
1932 Ga0207648_10118722
1933 Ga0207676_10039430
1934 Ga0207676_10073555
1935 Ga0207676_10372485
1936 Ga0207676_10698596
1937 Ga0207676_10854398
1938 Ga0207674_10029570
1939 Ga0207674_10031742
1940 Ga0207674_10048477
1941 Ga0207674_10098352
1942 Ga0207674_10141197
1943 Ga0207674_10700797
1944 Ga0207675_100082728
1945 Ga0207683_10105677
1946 Ga0207683_10174784
1947 Ga0207683_10255192
1948 Ga0207683_10498464
1949 Ga0207698_10233167
1950 Ga0207698_10459446
1951 Ga0207698_10499971
1952 Ga0207698_10651999
1953 Ga0209389_1000008
1954 Ga0209389_1000081
1955 Ga0209589_1000091
1956 Ga0209489_100096
1957 Ga0209489_103917
1958 Ga0209700_100036
1959 Ga0209282_1060656
1960 Ga0209588_1001221
1961 Ga0209813_10002519
1962 Ga0209813_10003776
1963 Ga0209813_10015641
1964 Ga0207428_10232096
1965 Ga0268266_10000055
1966 Ga0268266_10071995
1967 Ga0268266_10236782
1968 Ga0268266_10910896
1969 Ga0268265_10006170
1970 Ga0268265_10008013
1971 Ga0268265_10414867
1972 Ga0268264_10000233
1973 Ga0268264_10018666
1974 Ga0268264_10349811
1975 Ga0265334_10012112
1976 Ga0307515_10012480
1977 Ga0265338_10007042
1978 Ga0265338_10016438
1979 Ga0265338_10032839
1980 Ga0307511_10096523
1981 Ga0307512_10141132
1982 Ga0316177_1220166
1983 Ga0316176_1074271
1984 Ga0314311_1023036
1985 Ga0316178_1123278
1986 Ga0316180_1019296
1987 Ga0316183_1126188
1988 Ga0316181_1028270
1989 Ga0316182_1164524
1990 Ga0316182_1282851
1991 Ga0265330_10169963
1992 Ga0265332_10002293
1993 Ga0265332_10102714
1994 Ga0265328_10113442
1995 Ga0265320_10000102
1996 Ga0265325_10201373
1997 Ga0265329_10042118
1998 Ga0265329_10085282
1999 Ga0265340_10003648
2000 Ga0265340_10023320
2001 Ga0265340_10036067
2002 Ga0265340_10068915
2003 Ga0265339_10002587
2004 Ga0265339_10107257
2005 Ga0265331_10004118
2006 Ga0265331_10006890
2007 Ga0265327_10012710
2008 Ga0265316_10256246
2009 Ga0307513_10218757
2010 Ga0307509_10038652
2011 Ga0307509_10305319
2012 Ga0307509_10335430
2013 Ga0307408_100186846
2014 Ga0307408_101460393
2015 Ga0307508_10000010
2016 Ga0307508_10189352
2017 Ga0307508_10215585
2018 Ga0307514_10009275
2019 Ga0307514_10031724
2020 Ga0265314_10010572
2021 Ga0265314_10256811
2022 Ga0265342_10002113
2023 Ga0265342_10025322
2024 Ga0265342_10076999
2025 Ga0307516_10000131
2026 Ga0307516_10015237
2027 Ga0307516_10101139
2028 Ga0307405_10158862
2029 Ga0307413_10760582
2030 Ga0307406_10288038
2031 Ga0307406_10802803
2032 Ga0307406_10939853
2033 Ga0307407_10430313
2034 Ga0307412_10004706
2035 Ga0307412_10073269
2036 Ga0307412_10265496
2037 Ga0307412_10742219
2038 Ga0307409_100384591
2039 Ga0307416_100280869
2040 Ga0307414_10070300
2041 Ga0307414_10092583
2042 Ga0307411_10065234
2043 Ga0307411_10221066
2044 Ga0307507_10099702
2045 Ga0307510_10007884
2046 Ga0307510_10026794
2047 Ga0307510_10330548
2048 Ga0373930_0052507
2049 Ga0373950_0054722
2050 Ga0373958_0018666
2051 Ga0373951_0022432
2052 Ga0373936_0011012
2053 Ga0373939_0158049
2054 Ga0373941_0031201
2055 Ga0373945_0172648
2056 Ga0373954_0282272
2057 Ga0373956_0034696
2058 Ga0373957_0012775
2059 Ga0373960_0006840
2060 Ga0373946_0266816
2061 Ga0373961_0102261
2062 Ga0373962_0089287
2063 Ga0373924_0075033
2064 Ga0373935_0052251
2065 Ga0373935_0191097
2066 Ga0373935_0364418
2067 Ga0373927_0016488
2068 Ga0373927_0024569
2069 Ga0373937_0005850
2070 Ga0373925_0018284
2071 Ga0373925_0046851
2072 Ga0373925_0051972
2073 Ga0395900_0338430
2074 Ga0395900_0349930
2075 Ga0395900_0420206
2076 Ga0395898_0002853
2077 Ga0395898_0168415
2078 Ga0395898_0220282
2079 Ga0395905_0012510
2080 Ga0395905_0025312
2081 Ga0436364_0614298
2082 Ga0436364_1222287
2083 Ga0436364_1310055
2084 Ga0395901_0029183
2085 Ga0395901_0471290
2086 Ga0436365_0419344
2087 Ga0436365_0998612
2088 Ga0436360_0511504
2089 Ga0436361_0125523
2090 Ga0436363_0942152
2091 Ga0436363_1316254
2092 Ga0436362_0193018
2093 Ga0439436_0037931
2094 Ga0451797_0291897
2095 Ga0451800_1589477
2096 Ga0451807_0920577
2097 Ga0439431_0036137
2098 Ga0439449_0019933
2099 Ga0439463_058599
2100 Ga0439459_0082101
2101 Ga0450918_036931
2102 Ga0466969_0040244
2103 Ga0466965_0035113
2104 Ga0466965_0345774
2105 Ga0466966_0000743
2106 Ga0466961_0000013
2107 Ga0466968_0026713
2108 Ga0466960_0172473
2109 Ga0466959_0006806
2110 Ga0466958_0291494
2111 Ga0466967_1045263
2112 Ga0495592_0270310
2113 Ga0495603_0025657
2114 Ga0495603_0067083
2115 Ga0495590_0039916
2116 Ga0495629_0034275
2117 Ga0495638_0000398
2118 Ga0495651_0000388
2119 Ga0495651_0226178
2120 Ga0495653_0137228
2121 Ga0495653_0181832
2122 Ga0495653_0329308
2123 Ga0495582_0188040
2124 Ga0495639_0015245
2125 Ga0495639_0253867
2126 Ga0495664_0072645
2127 Ga0495664_0370642
2128 Ga0495664_0636870
2129 Ga0495584_0175576
2130 Ga0495594_0218522
2131 Ga0495594_0565245
2132 Ga0495596_0255698
2133 Ga0495607_0092478
2134 Ga0495607_0313699
2135 Ga0495606_0014901
2136 Ga0495608_0072084
2137 Ga0495610_0039139
2138 Ga0495616_0010771
2139 Ga0495618_0029042
2140 Ga0495620_0064751
2141 Ga0495620_0203721
2142 Ga0495620_0289623
2143 Ga0495628_0082800
2144 Ga0495628_0192298
2145 Ga0495630_0068555
2146 Ga0495631_0000021
2147 Ga0495631_0037954
2148 Ga0495631_0073638
2149 Ga0495632_0150137
2150 Ga0495632_0355279
2151 Ga0495637_0020807
2152 Ga0495644_0082194
2153 Ga0495648_0009683
2154 Ga0495648_0105226
2155 Ga0495648_0180618
2156 Ga0495663_0054329
2157 Ga0495642_0025533
2158 Ga0495652_0003852
2159 Ga0495652_0501563
2160 Ga0495654_0012310
2161 Ga0495665_0203568
2162 Ga0495640_0044552
2163 Ga0495640_0115249
2164 Ga0495587_0047352
2165 Ga0495587_0097573
2166 Ga0495598_0029644
2167 Ga0495609_0133280
2168 Ga0495609_0141091
2169 Ga0495621_0034955
2170 Ga0495621_0069279
2171 Ga0495597_0124787
2172 Ga0495622_0085031
2173 Ga0495633_0208613
2174 Ga0495667_0002142
2175 Ga0495667_0433649
2176 Ga0495656_0051564
2177 Ga0495668_0264189
2178 Ga0495634_0022224
2179 Ga0495625_0021879
2180 Ga0495625_0089878
2181 Ga0495625_0159869
2182 Ga0495625_0163136
2183 Ga0495625_0301257
2184 Ga0495625_0335603
2185 Ga0495659_0214878
2186 Ga0495588_0101443
2187 Ga0495657_0013200
2188 Ga0495657_0098981
2189 Ga0495599_0059401
2190 Ga0495599_0133186
2191 Ga0495599_0181090
2192 Ga0495623_0079698
2193 Ga0495646_0020067
2194 Ga0495658_0142211
2195 Ga0495613_0270910
2196 Ga0495624_0048087
2197 Ga0495624_0267030
2198 Ga0495670_0092224
2199 Ga0495671_0077298
2200 Ga0495649_0025601
2201 Ga0495589_0267695
2202 Ga0495589_0273129
2203 Ga0495600_0023897
2204 Ga0495600_0330923
2205 Ga0495660_0095171
2206 Ga0495581_0123239
2207 Ga0495604_0032057
2208 Ga0495604_0045919
2209 Ga0495674_0183924
2210 Ga0495674_0415177
2211 Ga0495674_0761055
2212 Ga0495672_0027558
2213 Ga0495672_0048666
2214 Ga0495672_0090469
2215 Ga0495676_0018304
2216 Ga0495680_0016485
2217 Ga0495683_0047314
2218 Ga0495687_003920
2219 Ga0495675_0094720
2220 Ga0495673_0074127
2221 Ga0495673_0122884
2222 Ga0495686_0055461
2223 Ga0495686_0073886
2224 Ga0495686_0075766
2225 Ga0495686_0143347
2226 Ga0495686_0273894
2227 Ga0495686_0351573
2228 Ga0495686_0433544
2229 Ga0495593_0007695
2230 Ga0495602_0026247
2231 Ga0495602_0174533
2232 Ga0495614_0003864
2233 Ga0495626_0014917
2234 Ga0496100_0007590
2235 Ga0496100_0028223
2236 Ga0496100_0344206
2237 Ga0496100_0617324
2238 Ga0496101_0208454
2239 Ga0496102_0005180
2240 Ga0496102_0017154
2241 Ga0496102_0049421
2242 Ga0496102_0511438
2243 Ga0496103_0019495
2244 Ga0496103_0032651
2245 Ga0496103_0041509
2246 Ga0496103_0096293
2247 Ga0496103_0116311
2248 Ga0496103_0175439
2249 Ga0496104_0013720
2250 Ga0496104_0032278
2251 Ga0496104_0107715
2252 Ga0496104_0113317
2253 Ga0496104_0244122
2254 Ga0496104_0644269
2255 Ga0496105_0007184
2256 Ga0496105_0019748
2257 Ga0496105_0028800
2258 Ga0496105_0041214
2259 Ga0496105_0209209
2260 Ga0496105_0709534
2261 Ga0496106_0001152
2262 Ga0496106_0004584
2263 Ga0496106_0013136
2264 Ga0496106_0018500
2265 Ga0496106_0031853
2266 Ga0496106_0032086
2267 Ga0496106_0173881
2268 Ga0496106_0208207
2269 Ga0496106_0253998
2270 Ga0496106_0266595
2271 Ga0496107_0008261
2272 Ga0496107_0016800
2273 Ga0496107_0035132
2274 Ga0496107_0155721
2275 Ga0496107_0266087
2276 Ga0496107_0311859
2277 Ga0496107_0387995
2278 Ga0496107_0626244
2279 Ga0496108_0020986
2280 Ga0496108_0079024
2281 Ga0496108_0087619
2282 Ga0496108_0508389
2283 Ga0496109_0045666
2284 Ga0496109_0064060
2285 Ga0496109_0196993
2286 Ga0496109_0313130
2287 Ga0496109_0428833
2288 Ga0496109_0520036
2289 Ga0496109_0600523
2290 Ga0496109_0648035
2291 Ga0496110_0014187
2292 Ga0496110_0027366
2293 Ga0496110_0041293
2294 Ga0496110_0084470
2295 Ga0496110_0346769
2296 Ga0496111_0086380
2297 Ga0496111_0092307
2298 Ga0496111_0129848
2299 Ga0496112_0038824
2300 Ga0496112_0048748
2301 Ga0496112_0092747
2302 Ga0496112_0599215
2303 Ga0496113_0020094
2304 Ga0496113_0033739
2305 Ga0496113_0185899
2306 Ga0496113_0434342
2307 Ga0496114_0029970
2308 Ga0496114_0162823
2309 Ga0496114_0183202
2310 Ga0496115_0046865
2311 Ga0496115_0049686
2312 Ga0496115_0704927
2313 Ga0496116_0025718
2314 Ga0496116_0069489
2315 Ga0496116_0290197
2316 Ga0496117_0002298
2317 Ga0496117_0015458
2318 Ga0496117_0022441
2319 Ga0496117_0054188
2320 Ga0496118_0007362
2321 Ga0496118_0015802
2322 Ga0496118_0039123
2323 Ga0496118_0100107
2324 Ga0496118_0204153
2325 Ga0496119_0000801
2326 Ga0496119_0021437
2327 Ga0496119_0060252
2328 Ga0496119_0102027
2329 Ga0496119_0104686
2330 Ga0496120_0019393
2331 Ga0496120_0056343
2332 Ga0496120_0072422
2333 Ga0496121_0000994
2334 Ga0496121_0001567
2335 Ga0496121_0002309
2336 Ga0496121_0023552
2337 Ga0496121_0026483
2338 Ga0496121_0057543
2339 Ga0496121_0074965
2340 Ga0496121_0110103
2341 Ga0496121_0110388
2342 Ga0496122_0174951
2343 Ga0496123_0049995
2344 Ga0496123_0094679
2345 Ga0496123_0141390
2346 Ga0496124_0002590
2347 Ga0496124_0003412
2348 Ga0496124_0015526
2349 Ga0496124_0216950
2350 Ga0496124_0342192
2351 Ga0496124_0350205
2352 Ga0496124_0364466
2353 Ga0496125_0000090
2354 Ga0496125_0006401
2355 Ga0496125_0006952
2356 Ga0496125_0066369
2357 Ga0496125_0158183
2358 Ga0496126_0004395
2359 Ga0496126_0010244
2360 Ga0496126_0011274
2361 Ga0496126_0161727
2362 Ga0496126_0200250
2363 Ga0496126_0266763
2364 Ga0496126_0299072
2365 Ga0496126_0866858
2366 Ga0495682_0011145
2367 Ga0495682_0172159
2368 Ga0501031_0016771
2369 Ga0501032_0027553
2370 Ga0501033_0001708
2371 Ga0501033_0035762
2372 Ga0501034_0056288
2373 Ga0501036_0073804
2374 Ga0501036_0144187
2375 Ga0501036_0341389
2376 Ga0501037_0001314
2377 Ga0501039_0045504
2378 Ga0501039_0175004
2379 Ga0501042_0382198
2380 Ga0501043_0000760
2381 Ga0501043_0111743
2382 Ga0501043_0736004
2383 Ga0501046_0092217
2384 Ga0501046_0427739
2385 Ga0501047_0484827
2386 Ga0501068_0269675
2387 Ga0501070_0114195
2388 Ga0501070_0321845
2389 Ga0501073_0601455
2390 Ga0501075_0090248
2391 Ga0501076_0017649
2392 Ga0501076_0286797
2393 Ga0501076_0361686
2394 Ga0501076_0415986
2395 Ga0501077_0024157
2396 Ga0501077_0102836
2397 Ga0501077_0294990
2398 Ga0501249_000918
2399 Ga0501257_072402
2400 Ga0501080_0646660
2401 Ga0501081_0084045
2402 Ga0501081_0156475
2403 Ga0501081_0421331
2404 Ga0501081_0542734
2405 Ga0501081_0560100
2406 Ga0501262_000119
2407 Ga0501035_0043760
2408 Ga0501035_0331617
2409 Ga0501044_0034344
2410 Ga0501044_0054261
2411 Ga0501045_0084276
2412 Ga0501045_0707362
2413 nmdc:mga03683_24020_c1
2414 nmdc:mga03683_4079_c1
2415 nmdc:mga03n38_432078_c1
2416 nmdc:mga00v17_67117_c1
2417 nmdc:mga0yw44_114147_c1
2418 nmdc:mga0yw44_19546_c1
2419 nmdc:mga0k408_147970_c1
2420 nmdc:mga0k408_183041_c1
2421 nmdc:mga0k408_69404_c1
2422 nmdc:mga06z11_4403_c1
2423 nmdc:mga06z11_85286_c1
2424 nmdc:mga04h51_13270_c1
2425 nmdc:mga04h51_8875_c1
2426 nmdc:mga07m45_176271_c1
2427 nmdc:mga07m45_3642_c1
2428 nmdc:mga07m45_37362_c2
2429 nmdc:mga07m45_8596_c1
2430 nmdc:mga05p37_644744_c1
2431 nmdc:mga0qj67_476_c1
2432 nmdc:mga06r32_3555_c1
2433 nmdc:mga06r32_556679_c1
2434 nmdc:mga08y16_399195_c1
2435 nmdc:mga0n895_175299_c1
2436 nmdc:mga0n895_282037_c1
2437 nmdc:mga0rr50_218219_c1
2438 nmdc:mga0rr50_590287_c1
2439 nmdc:mga0rr50_635335_c1
2440 nmdc:mga0rr50_949088_c1
2441 nmdc:mga08x19_145077_c1
2442 nmdc:mga08x19_5793_c1
2443 nmdc:mga0a205_152814_c1
2444 nmdc:mga0sz30_74013_c1
2445 Ga0495601_0017549
2446 Ga0495601_0090553
2447 Ga0495612_0034172
2448 Ga0495612_0201248
2449 Ga0500610_0012735
2450 Ga0500610_0044586
2451 Ga0500610_0072327
2452 Ga0500635_0000249
2453 Ga0500635_0092243
2454 Ga0495595_0260186
2455 Ga0495619_0056741
2456 Ga0495619_0322387
2457 Ga0495619_0463748
2458 Ga0500578_0157611
2459 Ga0500643_000015
2460 Ga0500643_000169
2461 Ga0500643_019339
2462 Ga0500647_0103704
2463 Ga0500647_0115227
2464 Ga0500651_0000095
2465 Ga0500566_0000082
2466 Ga0500566_0000536
2467 Ga0500566_0110117
2468 Ga0500566_0135996
2469 Ga0500640_005617
2470 Ga0500554_045377
2471 Ga0500555_011988
2472 Ga0500555_014312
2473 Ga0500556_0065680
2474 Ga0500557_000015
2475 Ga0500562_016628
2476 Ga0500562_018462
2477 Ga0500569_019624
2478 Ga0500571_000379
2479 Ga0500572_000291
2480 Ga0500572_013990
2481 Ga0500572_033191
2482 Ga0500591_043308
2483 Ga0500593_001477
2484 Ga0500595_019509
2485 Ga0500595_022557
2486 Ga0500597_023797
2487 Ga0500607_078703
2488 Ga0500608_000290
2489 Ga0500608_008878
2490 Ga0500614_000882
2491 Ga0500618_003090
2492 Ga0500618_012045
2493 Ga0500618_020009
2494 Ga0500621_238276
2495 Ga0500642_0000166
2496 Ga0500642_0088967
2497 Ga0500655_009192
2498 Ga0500658_0000763
2499 Ga0500658_0000783
2500 Ga0500559_0000323
2501 Ga0500559_0001387
2502 Ga0500559_0015366
2503 Ga0500564_027527
2504 Ga0500568_0004399
2505 Ga0500568_0028635
2506 Ga0500568_0066645
2507 Ga0500574_015820
2508 Ga0500588_0126618
2509 Ga0500590_060305
2510 Ga0500603_000122
2511 Ga0500603_085817
2512 Ga0500616_0048633
2513 Ga0500619_022128
2514 Ga0500620_021405
2515 Ga0500622_0001660
2516 Ga0500622_0021694
2517 Ga0500624_003999
2518 Ga0500627_0026770
2519 Ga0500630_007401
2520 Ga0500634_0003453
2521 Ga0500634_0039731
2522 Ga0500638_004133
2523 Ga0500638_050545
2524 Ga0500638_077323
2525 Ga0500638_163515
2526 Ga0500638_192867
2527 Ga0500639_000001
2528 Ga0500639_022629
2529 Ga0500639_125960
2530 Ga0500636_0037880
2531 Ga0500636_0066749
2532 Ga0500636_0067042
2533 Ga0500636_0071217
2534 Ga0500636_0076099
2535 Ga0500637_0013284
2536 Ga0500637_0179154
2537 Ga0500637_0253446
2538 Ga0500576_042002
2539 Ga0500576_151207
2540 Ga0500625_014727
2541 Ga0500625_115951
2542 Ga0500625_134774
2543 Ga0500645_015438
2544 Ga0500609_034473
2545 Ga0500596_002414
2546 Ga0500599_005969
2547 Ga0500601_000032
2548 Ga0501084_0253849
2549 Ga0501082_0118989
2550 Ga0501082_0136512
2551 Ga0501082_0242661
2552 Ga0530510_0010491
2553 2507508575
2554 2508542651
2555 2508691573
2556 2509150894
2557 2513229094
2558 2513623040
2559 2513638970
2560 2513654732
2561 2513722356
2562 2513855846
2563 2513872776
2564 2513889135
2565 2513915088
2566 2514011848
2567 2517106762
2568 2517892383
2569 2524443125
2570 2524468897
2571 2524538523
2572 2585277017
2573 2585333627
2574 2585537028
2575 2585551879
2576 2616308391
2577 2617349025
2578 2617375770
2579 2644288713
2580 2644329178
2581 2644401729
2582 2728751171
2583 2738717321
2584 2738878896
2585 2739278007
2586 2793062388
2587 2805915326
2588 2818238879
2589 2819638093
2590 2824605755
2591 2824614448
2592 2824623244
2593 2824633172
2594 2824640009
2595 2824650220
2596 2824657739
2597 2824677389
2598 2824685255
2599 2824693051
2600 2824700748
2601 2824711347
2602 2824719494
2603 2824729948
2604 2824738043
2605 2824749286
2606 2824758206
2607 2824768187
2608 2824779550
2609 2838060812
2610 2838123744
2611 2841914651
2612 2841920184
2613 2841948647
2614 2841949845
2615 2841958671
2616 2841966263
2617 2841975000
2618 2841983432
2619 2842039061
2620 2842042949
2621 2842047992
2622 2842050990
2623 2844319100
2624 2847936214
2625 2847946574
2626 2849079302
2627 2857514306
2628 2874598052
2629 2874615417
2630 2874627823
2631 2874647502
2632 2876778470
2633 2876811137
2634 2876820416
2635 2879082264
2636 2879083711
2637 2879111175
2638 2879135411
2639 2879150619
2640 2881368828
2641 2881671176
2642 2885203550
2643 2885217100
2644 2885373163
2645 2885410440
2646 2888424537
2647 2889039849
2648 2903728976
2649 2904450587
2650 2904456591
2651 2904549987
2652 2904672857
2653 2904703448
2654 2904714629
2655 2906607109
2656 2906633275
2657 2906638920
2658 2906651452
2659 2906666363
2660 2908780175
2661 2919409847
2662 2919462880
2663 2919678807
2664 2922365346
2665 2922374400
2666 2922393950
2667 2922396234
2668 2928089028
2669 2928117863
2670 2929164875
2671 2929521303
2672 2932797462
2673 2932802783
2674 2935608890
2675 2935650056
2676 2935661792
2677 2935773302
2678 2935778543
2679 2935792744
2680 2935800771
2681 2935822050
2682 2935847632
2683 2935889877
2684 2935909097
2685 2935919818
2686 2935926329
2687 2935934779
2688 2935943229
2689 2935951667
2690 2935965839
2691 2935967792
2692 2935982666
2693 2935988160
2694 2936012460
2695 2936021025
2696 2936029753
2697 2936047218
2698 2936057623
2699 2941532821
2700 2945913744
2701 2945949320
2702 2945973368
2703 2945990863
2704 2954771043
2705 3005592646
2706 3005599241
2707 3005714917
2708 3005722332
2709 8006940665
2710 8006980355
2711 8016529607
2712 8016534822
2713 8016548035
2714 8016554092
2715 8016591748
2716 8016600262
2717 8016610487
2718 8016614448
2719 8016626549
2720 8016640331
2721 8019534588
2722 8019544884
2723 8019553650
2724 8019628164
2725 8019634451
2726 8019645278
2727 8019658408
2728 8019662342
2729 8019671844
2730 8019690084
2731 8056686670
2732 8056968048

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

41

189

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

41

161

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8746 6 184
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.8661 6 183
3gfs-assembly1.cif.gz_A structure of yhda, k109d/d137k variant 0.863 6 183
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8602 6 184
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8601 5 181
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8671 5 147 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8585 7 184 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8441 7 184 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8409 2 182 3.40.50.360
4c76B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8235 2 183 3.40.50.360
ID Description Score Start End GO Terms
AF-B0UI47-F1-model_v4 deleted 0.9924 1 196
AF-J2WMA2-F1-model_v4 Putative flavoprotein 0.989 1 157 GO:0005829
GO:0010181
GO:0016491
AF-B0UI47-F1-model_v4 deleted 0.9874 1 196
AF-A0A4Q5TC04-F1-model_v4 NADPH-dependent oxidoreductase 0.9862 25 196 GO:0005829
GO:0010181
GO:0016491
AF-A0A562KEK0-F1-model_v4 NAD(P)H-dependent FMN reductase 0.985 1 189 GO:0005829
GO:0010181
GO:0016491

Map