F493379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1366 | 723 | 2732 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300048904|Ga0496101_0273333|Ga0496101_0273333_430_1134 |
| Length | 234 |
| Sequence | MRGGRLIHLNHLAVIDVALFGAGVLQRNNAKCAGGERKMAHKILVFYGSYRSDRMGIRLADFLVAGLRARGDDAELIDAKAVGLPMLDRMYKEYPSGSAPPAMEALASKIRGADAFVFVVGEYNWGVQPGLKNLTDHFLEEWFWRPAAIASYSAGRFSGVRSSFAWHNTLSEMGMVVISSALAVGPIAQTLDADGAPSGPTGKALELAFPRFADDLAWWTDAAKAQRAQRSPPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 119 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 120 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 160 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 161 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 162 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 165 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 255 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 256 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 257 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 258 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 259 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 260 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 261 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 262 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 263 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 267 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 269 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 278 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 279 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 280 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 283 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 285 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 286 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 289 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 290 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 291 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 292 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 295 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 300 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 309 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 317 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 318 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 319 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 320 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 321 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 322 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 323 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 324 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 325 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 329 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 330 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 331 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 332 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 333 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 338 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 339 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 340 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 419 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 420 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 421 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 422 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 423 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 424 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 427 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 428 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 429 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 430 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 431 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 432 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 433 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 434 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 435 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 436 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 437 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 438 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 439 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 440 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 441 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 442 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 443 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 462 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 472 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 473 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 474 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 476 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 477 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 490 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 493 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 494 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 495 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 496 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 499 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 500 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 502 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 503 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 504 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 507 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 509 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 511 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 512 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 513 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 515 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 517 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 519 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 523 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 524 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 528 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 529 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 530 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 532 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 533 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 537 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 539 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 540 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 541 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 542 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 543 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 544 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 547 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 548 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 549 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 550 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 551 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 552 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 553 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 554 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 555 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 556 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 557 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 558 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 559 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 560 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 561 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 562 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 563 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 564 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 565 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 566 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 567 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 568 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 569 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 570 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 571 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 572 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 573 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 574 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 575 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 576 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 577 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 578 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 579 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 580 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 581 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 582 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 583 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 584 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 585 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 586 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 587 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 588 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 589 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 590 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 591 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 592 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 593 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 594 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 595 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 596 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 597 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 598 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 599 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 600 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 601 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 602 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 603 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 604 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 605 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 606 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 607 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 608 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 609 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 610 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 611 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 612 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 613 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 614 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 615 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 616 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 617 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 618 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 619 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 620 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 621 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 622 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 623 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 624 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 625 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 626 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 627 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 628 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 629 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 630 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 631 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 632 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 633 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 634 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 635 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 636 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 637 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 638 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 639 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 640 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 641 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 642 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 643 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 644 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 645 | 2904699407 | |||
| 646 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 647 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 648 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 649 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 650 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 651 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 652 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 653 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 654 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 655 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 656 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 657 | 2922368715 | |||
| 658 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 659 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 660 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 661 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 662 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 663 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 664 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 665 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 666 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 667 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 668 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 669 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 670 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 671 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 672 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 673 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 674 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 675 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 676 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 677 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 678 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 679 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 680 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 681 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 682 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 683 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 684 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 685 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 686 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 687 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 688 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 689 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 690 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 691 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 692 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 693 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 694 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 695 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 696 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 697 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 698 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 699 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 700 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 701 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 702 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 703 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 704 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 705 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 706 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 707 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 708 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 709 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 710 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 711 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 712 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 713 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 714 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 715 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 716 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 717 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 718 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 719 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 720 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 721 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 722 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 723 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.73 |
| Metatranscriptomes | 0.22 |
| Isolates | 13.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.84 |
| Nodule | 9.15 |
| Rhizoplane | 6.08 |
| Rhizosphere | 57.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496101_0273333 | 3300048904 | Bacteria | 1319 |
| 2 | JGI24740J21852_10026939 | 3300001979 | Bacteria | 1919 |
| 3 | JGI24739J22299_10030477 | 3300001989 | Bacteria | 1870 |
| 4 | JGI25162J39368_1000577 | 3300002737 | Bacteria | 26905 |
| 5 | JGI25162J39368_1001401 | 3300002737 | Bacteria | 13172 |
| 6 | JGI25162J39368_1001515 | 3300002737 | Bacteria | 12058 |
| 7 | JGI25158J39367_1006561 | 3300002739 | Bacteria | 1664 |
| 8 | JGI25152J39213_1028894 | 3300002773 | Bacteria | 878 |
| 9 | JGI25159J45721_1029267 | 3300002987 | Bacteria | 909 |
| 10 | JGI25151J46595_10001814 | 3300003187 | Bacteria | 13785 |
| 11 | JGI25151J46595_10003602 | 3300003187 | Bacteria | 8481 |
| 12 | JGI25406J46586_10000104 | 3300003203 | Bacteria | 37774 |
| 13 | JGI25165J46597_1000654 | 3300003214 | Bacteria | 28366 |
| 14 | JGI25165J46597_1001229 | 3300003214 | Bacteria | 15248 |
| 15 | JGI25165J46597_1005089 | 3300003214 | Bacteria | 2617 |
| 16 | JGI25153J46596_10000022 | 3300003215 | Bacteria | 251919 |
| 17 | JGI25153J46596_10000531 | 3300003215 | Bacteria | 23973 |
| 18 | rootH1_10106416 | 3300003323 | Bacteria | 2809 |
| 19 | JGI25160J50197_1004582 | 3300003354 | Bacteria | 5953 |
| 20 | JGI25160J50197_1006303 | 3300003354 | Bacteria | 4817 |
| 21 | JGI25161J50226_1008089 | 3300003374 | Bacteria | 1663 |
| 22 | Ga0006562J51391_1096725 | 3300003578 | Bacteria | 5880 |
| 23 | Ga0006562J51391_1096726 | 3300003578 | Bacteria | 8227 |
| 24 | Ga0055526_1021043 | 3300003771 | Bacteria | 2288 |
| 25 | Ga0055537_1000134 | 3300003773 | Bacteria | 56046 |
| 26 | Ga0055524_1019623 | 3300003775 | Bacteria | 2304 |
| 27 | Ga0055536_1003710 | 3300003781 | Bacteria | 8101 |
| 28 | Ga0055536_1005818 | 3300003781 | Bacteria | 5927 |
| 29 | Ga0055534_1000088 | 3300003784 | Bacteria | 72004 |
| 30 | Ga0055534_1015173 | 3300003784 | Bacteria | 1419 |
| 31 | Ga0055528_1000493 | 3300003790 | Bacteria | 31199 |
| 32 | Ga0055530_10000495 | 3300003791 | Bacteria | 34154 |
| 33 | Ga0055540_1001986 | 3300003792 | Bacteria | 11424 |
| 34 | Ga0055540_1002205 | 3300003792 | Bacteria | 10582 |
| 35 | Ga0055540_1004978 | 3300003792 | Bacteria | 5788 |
| 36 | Ga0055540_1038840 | 3300003792 | Bacteria | 1041 |
| 37 | Ga0055531_10002338 | 3300003794 | Bacteria | 12771 |
| 38 | Ga0055531_10003743 | 3300003794 | Bacteria | 9554 |
| 39 | Ga0055543_1005204 | 3300004625 | Bacteria | 3366 |
| 40 | Ga0055543_1009121 | 3300004625 | Bacteria | 2154 |
| 41 | Ga0065165_1000780 | 3300005262 | Bacteria | 42673 |
| 42 | Ga0065165_1000826 | 3300005262 | Bacteria | 40863 |
| 43 | Ga0065165_1018204 | 3300005262 | Bacteria | 2554 |
| 44 | Ga0065165_1048388 | 3300005262 | Bacteria | 1221 |
| 45 | Ga0070658_10790892 | 3300005327 | Bacteria | 824 |
| 46 | Ga0070658_10995982 | 3300005327 | Bacteria | 729 |
| 47 | Ga0070676_10754911 | 3300005328 | Bacteria | 714 |
| 48 | Ga0070683_100060557 | 3300005329 | Bacteria | 3518 |
| 49 | Ga0070670_100272808 | 3300005331 | Bacteria | 1476 |
| 50 | Ga0070680_100043111 | 3300005336 | Bacteria | 3664 |
| 51 | Ga0070680_100055517 | 3300005336 | Bacteria | 3237 |
| 52 | Ga0070680_100506005 | 3300005336 | Bacteria | 1034 |
| 53 | Ga0070682_100404603 | 3300005337 | Bacteria | 1033 |
| 54 | Ga0070682_100537566 | 3300005337 | Bacteria | 912 |
| 55 | Ga0068868_100631688 | 3300005338 | Bacteria | 952 |
| 56 | Ga0068868_100890642 | 3300005338 | Bacteria | 808 |
| 57 | Ga0070660_100088577 | 3300005339 | Bacteria | 2437 |
| 58 | Ga0070691_10028452 | 3300005341 | Bacteria | 2611 |
| 59 | Ga0070691_10132829 | 3300005341 | Bacteria | 1263 |
| 60 | Ga0070687_100093724 | 3300005343 | Bacteria | 1666 |
| 61 | Ga0070661_100043450 | 3300005344 | Bacteria | 3283 |
| 62 | Ga0070661_100141174 | 3300005344 | Bacteria | 1815 |
| 63 | Ga0070692_10254507 | 3300005345 | Bacteria | 1053 |
| 64 | Ga0070668_100035983 | 3300005347 | Bacteria | 3778 |
| 65 | Ga0070668_100050905 | 3300005347 | Bacteria | 3190 |
| 66 | Ga0070668_100069611 | 3300005347 | Bacteria | 2738 |
| 67 | Ga0070668_100214967 | 3300005347 | Bacteria | 1583 |
| 68 | Ga0070668_100752685 | 3300005347 | Bacteria | 863 |
| 69 | Ga0070669_100163351 | 3300005353 | Bacteria | 1732 |
| 70 | Ga0070669_100453835 | 3300005353 | Bacteria | 1057 |
| 71 | Ga0070669_100593283 | 3300005353 | Bacteria | 927 |
| 72 | Ga0070675_100574806 | 3300005354 | Bacteria | 1021 |
| 73 | Ga0070671_100011820 | 3300005355 | Bacteria | 7023 |
| 74 | Ga0070671_100199501 | 3300005355 | Bacteria | 1696 |
| 75 | Ga0070674_100301223 | 3300005356 | Bacteria | 1278 |
| 76 | Ga0070673_100126972 | 3300005364 | Bacteria | 2135 |
| 77 | Ga0070688_100256917 | 3300005365 | Bacteria | 1246 |
| 78 | Ga0070659_100155671 | 3300005366 | Bacteria | 1866 |
| 79 | Ga0070659_100194377 | 3300005366 | Bacteria | 1668 |
| 80 | Ga0070667_100100625 | 3300005367 | Bacteria | 2496 |
| 81 | Ga0070667_100209805 | 3300005367 | Bacteria | 1731 |
| 82 | Ga0070667_100472534 | 3300005367 | Bacteria | 1147 |
| 83 | Ga0070667_100619121 | 3300005367 | Bacteria | 998 |
| 84 | Ga0070667_101034694 | 3300005367 | Bacteria | 767 |
| 85 | Ga0070703_10013557 | 3300005406 | Bacteria | 2316 |
| 86 | Ga0070703_10089962 | 3300005406 | Bacteria | 1062 |
| 87 | Ga0070714_100140826 | 3300005435 | Bacteria | 2165 |
| 88 | Ga0070713_100299529 | 3300005436 | Bacteria | 1480 |
| 89 | Ga0070713_100319379 | 3300005436 | Bacteria | 1434 |
| 90 | Ga0070710_10210652 | 3300005437 | Bacteria | 1232 |
| 91 | Ga0070710_10490937 | 3300005437 | Bacteria | 839 |
| 92 | Ga0070701_10138179 | 3300005438 | Bacteria | 1391 |
| 93 | Ga0070701_10138929 | 3300005438 | Bacteria | 1387 |
| 94 | Ga0070701_10339768 | 3300005438 | Bacteria | 935 |
| 95 | Ga0070711_100567895 | 3300005439 | Bacteria | 943 |
| 96 | Ga0070711_100874750 | 3300005439 | Bacteria | 766 |
| 97 | Ga0070705_100000144 | 3300005440 | Bacteria | 42003 |
| 98 | Ga0070705_100089856 | 3300005440 | Bacteria | 1910 |
| 99 | Ga0070705_100122839 | 3300005440 | Bacteria | 1679 |
| 100 | Ga0070705_100205007 | 3300005440 | Bacteria | 1355 |
| 101 | Ga0070700_100006214 | 3300005441 | Bacteria | 6367 |
| 102 | Ga0070694_100001328 | 3300005444 | Bacteria | 14406 |
| 103 | Ga0070694_100086792 | 3300005444 | Bacteria | 2187 |
| 104 | Ga0070694_100234679 | 3300005444 | Bacteria | 1381 |
| 105 | Ga0070694_100643394 | 3300005444 | Bacteria | 858 |
| 106 | Ga0070708_100004216 | 3300005445 | Bacteria | 11298 |
| 107 | Ga0070663_100153516 | 3300005455 | Bacteria | 1767 |
| 108 | Ga0070663_100157236 | 3300005455 | Bacteria | 1747 |
| 109 | Ga0070663_100238111 | 3300005455 | Bacteria | 1436 |
| 110 | Ga0070678_100015254 | 3300005456 | Bacteria | 4878 |
| 111 | Ga0070678_100093738 | 3300005456 | Bacteria | 2310 |
| 112 | Ga0070678_100322009 | 3300005456 | Bacteria | 1320 |
| 113 | Ga0070678_100884574 | 3300005456 | Bacteria | 816 |
| 114 | Ga0070662_100007222 | 3300005457 | Bacteria | 7197 |
| 115 | Ga0070662_100176306 | 3300005457 | Bacteria | 1682 |
| 116 | Ga0070662_100218509 | 3300005457 | Bacteria | 1520 |
| 117 | Ga0070662_100639093 | 3300005457 | Bacteria | 897 |
| 118 | Ga0070681_10036878 | 3300005458 | Bacteria | 4908 |
| 119 | Ga0070681_10885766 | 3300005458 | Bacteria | 811 |
| 120 | Ga0068867_100147402 | 3300005459 | Bacteria | 1846 |
| 121 | Ga0068867_100902520 | 3300005459 | Bacteria | 795 |
| 122 | Ga0070698_101134818 | 3300005471 | Bacteria | 730 |
| 123 | Ga0070699_100006781 | 3300005518 | Bacteria | 9963 |
| 124 | Ga0070679_100214536 | 3300005530 | Bacteria | 1887 |
| 125 | Ga0070684_100032782 | 3300005535 | Bacteria | 4431 |
| 126 | Ga0070684_100281542 | 3300005535 | Bacteria | 1523 |
| 127 | Ga0070697_100009721 | 3300005536 | Bacteria | 7508 |
| 128 | Ga0070697_100085543 | 3300005536 | Bacteria | 2601 |
| 129 | Ga0070697_100321850 | 3300005536 | Bacteria | 1332 |
| 130 | Ga0068853_100022177 | 3300005539 | Bacteria | 5300 |
| 131 | Ga0068853_100095568 | 3300005539 | Bacteria | 2620 |
| 132 | Ga0068853_100303162 | 3300005539 | Bacteria | 1477 |
| 133 | Ga0068853_100397131 | 3300005539 | Bacteria | 1290 |
| 134 | Ga0068853_101554697 | 3300005539 | Bacteria | 641 |
| 135 | Ga0070672_100194303 | 3300005543 | Bacteria | 1695 |
| 136 | Ga0070686_100000034 | 3300005544 | Bacteria | 112341 |
| 137 | Ga0070686_100101148 | 3300005544 | Bacteria | 1948 |
| 138 | Ga0070695_100000788 | 3300005545 | Bacteria | 17057 |
| 139 | Ga0070695_100058879 | 3300005545 | Bacteria | 2485 |
| 140 | Ga0070695_100066068 | 3300005545 | Bacteria | 2357 |
| 141 | Ga0070696_100002042 | 3300005546 | Bacteria | 13246 |
| 142 | Ga0070696_100275874 | 3300005546 | Bacteria | 1280 |
| 143 | Ga0070696_100389838 | 3300005546 | Bacteria | 1087 |
| 144 | Ga0070693_100150501 | 3300005547 | Bacteria | 1474 |
| 145 | Ga0070665_100000080 | 3300005548 | Bacteria | 185165 |
| 146 | Ga0070665_100028942 | 3300005548 | Bacteria | 5577 |
| 147 | Ga0070665_100073704 | 3300005548 | Bacteria | 3419 |
| 148 | Ga0070665_100692901 | 3300005548 | Bacteria | 1032 |
| 149 | Ga0070665_101116487 | 3300005548 | Bacteria | 800 |
| 150 | Ga0070665_101740274 | 3300005548 | Bacteria | 630 |
| 151 | Ga0070704_100000738 | 3300005549 | Bacteria | 16017 |
| 152 | Ga0068855_100012600 | 3300005563 | Bacteria | 10203 |
| 153 | Ga0068855_100039920 | 3300005563 | Bacteria | 5572 |
| 154 | Ga0068855_100137154 | 3300005563 | Bacteria | 2790 |
| 155 | Ga0068855_100685595 | 3300005563 | Bacteria | 1098 |
| 156 | Ga0068855_100984759 | 3300005563 | Bacteria | 887 |
| 157 | Ga0070664_100103775 | 3300005564 | Bacteria | 2475 |
| 158 | Ga0070664_100290694 | 3300005564 | Bacteria | 1475 |
| 159 | Ga0070664_100404338 | 3300005564 | Bacteria | 1249 |
| 160 | Ga0068857_100033416 | 3300005577 | Bacteria | 4549 |
| 161 | Ga0068857_100049057 | 3300005577 | Bacteria | 3746 |
| 162 | Ga0068857_100084690 | 3300005577 | Bacteria | 2833 |
| 163 | Ga0068857_100120139 | 3300005577 | Bacteria | 2365 |
| 164 | Ga0068854_100765719 | 3300005578 | Bacteria | 839 |
| 165 | Ga0068856_100003868 | 3300005614 | Bacteria | 15029 |
| 166 | Ga0068856_100018322 | 3300005614 | Bacteria | 6788 |
| 167 | Ga0068856_100062608 | 3300005614 | Bacteria | 3675 |
| 168 | Ga0068856_100252508 | 3300005614 | Bacteria | 1778 |
| 169 | Ga0068856_100404069 | 3300005614 | Bacteria | 1385 |
| 170 | Ga0068856_100605328 | 3300005614 | Bacteria | 1117 |
| 171 | Ga0068856_100790342 | 3300005614 | Bacteria | 969 |
| 172 | Ga0068856_100896732 | 3300005614 | Bacteria | 905 |
| 173 | Ga0070702_100047855 | 3300005615 | Bacteria | 2431 |
| 174 | Ga0070702_100138404 | 3300005615 | Bacteria | 1548 |
| 175 | Ga0068852_100036166 | 3300005616 | Bacteria | 4129 |
| 176 | Ga0068852_100040678 | 3300005616 | Bacteria | 3923 |
| 177 | Ga0068852_100225540 | 3300005616 | Bacteria | 1784 |
| 178 | Ga0068852_100345180 | 3300005616 | Bacteria | 1452 |
| 179 | Ga0068852_100729817 | 3300005616 | Unclassified | 1002 |
| 180 | Ga0068852_100791427 | 3300005616 | Bacteria | 962 |
| 181 | Ga0068852_100975910 | 3300005616 | Bacteria | 866 |
| 182 | Ga0068859_100000869 | 3300005617 | Bacteria | 30827 |
| 183 | Ga0068859_100002326 | 3300005617 | Bacteria | 19316 |
| 184 | Ga0068859_100659740 | 3300005617 | Bacteria | 1138 |
| 185 | Ga0068864_100017331 | 3300005618 | Bacteria | 6004 |
| 186 | Ga0068864_100027080 | 3300005618 | Bacteria | 4837 |
| 187 | Ga0068864_100102681 | 3300005618 | Bacteria | 2538 |
| 188 | Ga0068864_100135221 | 3300005618 | Bacteria | 2219 |
| 189 | Ga0068864_101301791 | 3300005618 | Bacteria | 727 |
| 190 | Ga0068866_10149793 | 3300005718 | Bacteria | 1350 |
| 191 | Ga0068861_100051037 | 3300005719 | Bacteria | 3139 |
| 192 | Ga0068861_100777191 | 3300005719 | Bacteria | 897 |
| 193 | Ga0068851_10016100 | 3300005834 | Bacteria | 3573 |
| 194 | Ga0068870_10105206 | 3300005840 | Bacteria | 1602 |
| 195 | Ga0068863_100106573 | 3300005841 | Bacteria | 2667 |
| 196 | Ga0068863_100898304 | 3300005841 | Bacteria | 886 |
| 197 | Ga0068858_100053503 | 3300005842 | Bacteria | 3734 |
| 198 | Ga0068858_100239591 | 3300005842 | Bacteria | 1721 |
| 199 | Ga0068858_100842948 | 3300005842 | Bacteria | 895 |
| 200 | Ga0068860_100000210 | 3300005843 | Bacteria | 91495 |
| 201 | Ga0068860_100000965 | 3300005843 | Bacteria | 31831 |
| 202 | Ga0068860_100339804 | 3300005843 | Bacteria | 1476 |
| 203 | Ga0068860_100419263 | 3300005843 | Bacteria | 1327 |
| 204 | Ga0068860_100773744 | 3300005843 | Bacteria | 972 |
| 205 | Ga0068862_100000912 | 3300005844 | Bacteria | 28638 |
| 206 | Ga0068862_100205330 | 3300005844 | Bacteria | 1778 |
| 207 | Ga0068862_100263320 | 3300005844 | Bacteria | 1575 |
| 208 | Ga0068862_100356386 | 3300005844 | Bacteria | 1359 |
| 209 | Ga0068862_100977808 | 3300005844 | Bacteria | 836 |
| 210 | Ga0081455_10002205 | 3300005937 | Bacteria | 23195 |
| 211 | Ga0081540_1046278 | 3300005983 | Bacteria | 2198 |
| 212 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 213 | Ga0081539_10123396 | 3300005985 | Bacteria | 1283 |
| 214 | Ga0070717_10016039 | 3300006028 | Bacteria | 5802 |
| 215 | Ga0070717_10287748 | 3300006028 | Bacteria | 1458 |
| 216 | Ga0075365_10022310 | 3300006038 | Bacteria | 3965 |
| 217 | Ga0075365_10543409 | 3300006038 | Bacteria | 822 |
| 218 | Ga0075368_10007965 | 3300006042 | Bacteria | 3758 |
| 219 | Ga0075363_100028828 | 3300006048 | Bacteria | 2860 |
| 220 | Ga0075363_100078167 | 3300006048 | Bacteria | 1806 |
| 221 | Ga0075364_10121280 | 3300006051 | Bacteria | 1750 |
| 222 | Ga0075364_10176672 | 3300006051 | Bacteria | 1444 |
| 223 | Ga0070716_100074153 | 3300006173 | Bacteria | 2010 |
| 224 | Ga0070716_100080787 | 3300006173 | Bacteria | 1939 |
| 225 | Ga0070716_100697358 | 3300006173 | Bacteria | 775 |
| 226 | Ga0070712_100433641 | 3300006175 | Bacteria | 1091 |
| 227 | Ga0075362_10003901 | 3300006177 | Bacteria | 5296 |
| 228 | Ga0075362_10183722 | 3300006177 | Bacteria | 1014 |
| 229 | Ga0075362_10222855 | 3300006177 | Bacteria | 922 |
| 230 | Ga0075367_10019079 | 3300006178 | Bacteria | 3796 |
| 231 | Ga0075367_10055605 | 3300006178 | Bacteria | 2349 |
| 232 | Ga0075369_10045749 | 3300006186 | Bacteria | 1883 |
| 233 | Ga0075369_10282093 | 3300006186 | Bacteria | 774 |
| 234 | Ga0075366_10146085 | 3300006195 | Bacteria | 1431 |
| 235 | Ga0075366_10240931 | 3300006195 | Bacteria | 1102 |
| 236 | Ga0075366_10245255 | 3300006195 | Bacteria | 1092 |
| 237 | Ga0075366_10305888 | 3300006195 | Bacteria | 973 |
| 238 | Ga0097621_100166546 | 3300006237 | Bacteria | 1897 |
| 239 | Ga0097621_100770517 | 3300006237 | Bacteria | 890 |
| 240 | Ga0075370_10000340 | 3300006353 | Bacteria | 16849 |
| 241 | Ga0075370_10003478 | 3300006353 | Bacteria | 7504 |
| 242 | Ga0075370_10006104 | 3300006353 | Bacteria | 6041 |
| 243 | Ga0075370_10009436 | 3300006353 | Bacteria | 5068 |
| 244 | Ga0075370_10013496 | 3300006353 | Bacteria | 4345 |
| 245 | Ga0075370_10057449 | 3300006353 | Bacteria | 2212 |
| 246 | Ga0075370_10101346 | 3300006353 | Bacteria | 1667 |
| 247 | Ga0075370_10236906 | 3300006353 | Bacteria | 1080 |
| 248 | Ga0075370_10271985 | 3300006353 | Bacteria | 1006 |
| 249 | Ga0068871_100647091 | 3300006358 | Bacteria | 965 |
| 250 | Ga0075428_100556934 | 3300006844 | Bacteria | 1225 |
| 251 | Ga0075430_100000704 | 3300006846 | Bacteria | 25487 |
| 252 | Ga0075433_10148882 | 3300006852 | Bacteria | 2082 |
| 253 | Ga0075433_10272009 | 3300006852 | Bacteria | 1501 |
| 254 | Ga0075433_10459509 | 3300006852 | Bacteria | 1122 |
| 255 | Ga0075434_100109048 | 3300006871 | Bacteria | 2779 |
| 256 | Ga0075434_100574720 | 3300006871 | Bacteria | 1146 |
| 257 | Ga0075429_100561037 | 3300006880 | Bacteria | 1001 |
| 258 | Ga0068865_100310691 | 3300006881 | Bacteria | 1265 |
| 259 | Ga0075436_100008201 | 3300006914 | Bacteria | 7149 |
| 260 | Ga0097620_100000869 | 3300006931 | Bacteria | 30827 |
| 261 | Ga0097620_100002326 | 3300006931 | Bacteria | 19316 |
| 262 | Ga0097620_100659669 | 3300006931 | Bacteria | 1138 |
| 263 | Ga0099825_1023258 | 3300006941 | Bacteria | 3836 |
| 264 | Ga0099824_1018212 | 3300006942 | Bacteria | 5833 |
| 265 | Ga0099824_1034018 | 3300006942 | Bacteria | 1670 |
| 266 | Ga0099823_1025049 | 3300006944 | Bacteria | 5359 |
| 267 | Ga0099826_10000527 | 3300006948 | Bacteria | 18882 |
| 268 | Ga0099826_10066619 | 3300006948 | Bacteria | 2309 |
| 269 | Ga0099826_10193958 | 3300006948 | Bacteria | 1118 |
| 270 | Ga0075435_100102104 | 3300007076 | Bacteria | 2377 |
| 271 | Ga0075435_100527947 | 3300007076 | Bacteria | 1021 |
| 272 | Ga0075435_100550900 | 3300007076 | Bacteria | 999 |
| 273 | Ga0075435_100686323 | 3300007076 | Bacteria | 890 |
| 274 | Ga0099794_10003083 | 3300007265 | Bacteria | 6297 |
| 275 | Ga0099795_10055335 | 3300007788 | Bacteria | 1457 |
| 276 | Ga0105244_10037542 | 3300009036 | Bacteria | 2532 |
| 277 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 278 | Ga0105240_10329682 | 3300009093 | Bacteria | 1737 |
| 279 | Ga0105240_10332635 | 3300009093 | Bacteria | 1728 |
| 280 | Ga0111539_10234844 | 3300009094 | Bacteria | 2135 |
| 281 | Ga0111539_10448524 | 3300009094 | Bacteria | 1502 |
| 282 | Ga0105245_10021271 | 3300009098 | Bacteria | 5688 |
| 283 | Ga0105245_10099026 | 3300009098 | Bacteria | 2695 |
| 284 | Ga0105245_10102553 | 3300009098 | Bacteria | 2650 |
| 285 | Ga0105245_10304571 | 3300009098 | Bacteria | 1565 |
| 286 | Ga0105245_10475149 | 3300009098 | Bacteria | 1262 |
| 287 | Ga0105245_10921319 | 3300009098 | Bacteria | 916 |
| 288 | Ga0105247_10012701 | 3300009101 | Bacteria | 5053 |
| 289 | Ga0105247_10034582 | 3300009101 | Bacteria | 3078 |
| 290 | Ga0105247_10043146 | 3300009101 | Bacteria | 2763 |
| 291 | Ga0105247_10249563 | 3300009101 | Bacteria | 1212 |
| 292 | Ga0114129_10761419 | 3300009147 | Bacteria | 1239 |
| 293 | Ga0105243_10004089 | 3300009148 | Bacteria | 11616 |
| 294 | Ga0105243_10098611 | 3300009148 | Bacteria | 2421 |
| 295 | Ga0105243_10221870 | 3300009148 | Bacteria | 1671 |
| 296 | Ga0105243_10590185 | 3300009148 | Bacteria | 1068 |
| 297 | Ga0105241_10009269 | 3300009174 | Bacteria | 7238 |
| 298 | Ga0105241_10012989 | 3300009174 | Bacteria | 6109 |
| 299 | Ga0105241_10013325 | 3300009174 | Bacteria | 6026 |
| 300 | Ga0105241_10120965 | 3300009174 | Bacteria | 2108 |
| 301 | Ga0105242_10225243 | 3300009176 | Bacteria | 1678 |
| 302 | Ga0105242_11111857 | 3300009176 | Bacteria | 805 |
| 303 | Ga0105237_10000773 | 3300009545 | Bacteria | 43739 |
| 304 | Ga0105237_10003857 | 3300009545 | Bacteria | 17627 |
| 305 | Ga0105237_10044608 | 3300009545 | Bacteria | 4465 |
| 306 | Ga0105237_10115667 | 3300009545 | Bacteria | 2675 |
| 307 | Ga0105237_10149449 | 3300009545 | Bacteria | 2332 |
| 308 | Ga0105237_10263223 | 3300009545 | Bacteria | 1727 |
| 309 | Ga0105237_11132214 | 3300009545 | Bacteria | 789 |
| 310 | Ga0105238_10030500 | 3300009551 | Bacteria | 5489 |
| 311 | Ga0105238_10108782 | 3300009551 | Bacteria | 2753 |
| 312 | Ga0105238_10163979 | 3300009551 | Bacteria | 2198 |
| 313 | Ga0105238_10199208 | 3300009551 | Bacteria | 1978 |
| 314 | Ga0105238_11258299 | 3300009551 | Bacteria | 765 |
| 315 | Ga0105249_10009032 | 3300009553 | Bacteria | 8712 |
| 316 | Ga0099796_10003721 | 3300010159 | Bacteria | 3584 |
| 317 | Ga0105239_10014053 | 3300010375 | Bacteria | 8887 |
| 318 | Ga0105239_10024440 | 3300010375 | Bacteria | 6657 |
| 319 | Ga0105239_10201930 | 3300010375 | Bacteria | 2227 |
| 320 | Ga0105239_10231432 | 3300010375 | Bacteria | 2073 |
| 321 | Ga0105239_10329501 | 3300010375 | Bacteria | 1722 |
| 322 | Ga0105239_10868651 | 3300010375 | Bacteria | 1035 |
| 323 | Ga0105239_11173624 | 3300010375 | Bacteria | 884 |
| 324 | Ga0105246_10024476 | 3300011119 | Bacteria | 3924 |
| 325 | Ga0105246_10104058 | 3300011119 | Bacteria | 2073 |
| 326 | Ga0105246_10131374 | 3300011119 | Bacteria | 1871 |
| 327 | Ga0157373_10046733 | 3300013100 | Bacteria | 3088 |
| 328 | Ga0157373_10338283 | 3300013100 | Bacteria | 1072 |
| 329 | Ga0157373_10505966 | 3300013100 | Bacteria | 873 |
| 330 | Ga0157370_10001070 | 3300013104 | Bacteria | 34278 |
| 331 | Ga0157370_10017784 | 3300013104 | Bacteria | 7165 |
| 332 | Ga0157370_10055881 | 3300013104 | Bacteria | 3759 |
| 333 | Ga0157370_10297240 | 3300013104 | Bacteria | 1491 |
| 334 | Ga0157370_10388926 | 3300013104 | Unclassified | 1284 |
| 335 | Ga0157370_10816105 | 3300013104 | Bacteria | 848 |
| 336 | Ga0157369_10081621 | 3300013105 | Bacteria | 3460 |
| 337 | Ga0157369_10605433 | 3300013105 | Bacteria | 1131 |
| 338 | Ga0157369_10663058 | 3300013105 | Bacteria | 1075 |
| 339 | Ga0157374_10049221 | 3300013296 | Bacteria | 3914 |
| 340 | Ga0157374_10791935 | 3300013296 | Bacteria | 964 |
| 341 | Ga0157378_10416560 | 3300013297 | Bacteria | 1327 |
| 342 | Ga0157378_10685795 | 3300013297 | Bacteria | 1043 |
| 343 | Ga0163162_10119621 | 3300013306 | Bacteria | 2737 |
| 344 | Ga0163162_10126464 | 3300013306 | Bacteria | 2662 |
| 345 | Ga0163162_10180113 | 3300013306 | Bacteria | 2239 |
| 346 | Ga0163162_11003933 | 3300013306 | Bacteria | 944 |
| 347 | Ga0163162_11473840 | 3300013306 | Bacteria | 775 |
| 348 | Ga0157372_10643187 | 3300013307 | Bacteria | 1235 |
| 349 | Ga0157375_10032801 | 3300013308 | Bacteria | 4929 |
| 350 | Ga0157375_10708692 | 3300013308 | Bacteria | 1160 |
| 351 | Ga0157375_11130436 | 3300013308 | Bacteria | 917 |
| 352 | Ga0163163_10011142 | 3300014325 | Bacteria | 8140 |
| 353 | Ga0163163_10272621 | 3300014325 | Bacteria | 1743 |
| 354 | Ga0163163_10853767 | 3300014325 | Bacteria | 974 |
| 355 | Ga0163163_12038541 | 3300014325 | Bacteria | 633 |
| 356 | Ga0157380_10177037 | 3300014326 | Bacteria | 1870 |
| 357 | Ga0157380_10381080 | 3300014326 | Bacteria | 1331 |
| 358 | Ga0182008_10001456 | 3300014497 | Bacteria | 15816 |
| 359 | Ga0182008_10006000 | 3300014497 | Bacteria | 6840 |
| 360 | Ga0182008_10118087 | 3300014497 | Bacteria | 1317 |
| 361 | Ga0182008_10159619 | 3300014497 | Bacteria | 1134 |
| 362 | Ga0157377_10023849 | 3300014745 | Bacteria | 3247 |
| 363 | Ga0157379_10022522 | 3300014968 | Bacteria | 5580 |
| 364 | Ga0157379_10074696 | 3300014968 | Bacteria | 3035 |
| 365 | Ga0157379_10120531 | 3300014968 | Bacteria | 2359 |
| 366 | Ga0157376_10207522 | 3300014969 | Bacteria | 1807 |
| 367 | Ga0157376_10266982 | 3300014969 | Bacteria | 1606 |
| 368 | Ga0157376_10355311 | 3300014969 | Bacteria | 1404 |
| 369 | Ga0182006_1005446 | 3300015261 | Bacteria | 6070 |
| 370 | Ga0182006_1015639 | 3300015261 | Bacteria | 3249 |
| 371 | Ga0182006_1072863 | 3300015261 | Bacteria | 1269 |
| 372 | Ga0182007_10000618 | 3300015262 | Bacteria | 20687 |
| 373 | Ga0182007_10000705 | 3300015262 | Bacteria | 19033 |
| 374 | Ga0182007_10003145 | 3300015262 | Bacteria | 7924 |
| 375 | Ga0182005_1002283 | 3300015265 | Bacteria | 7020 |
| 376 | Ga0182005_1022006 | 3300015265 | Bacteria | 1747 |
| 377 | Ga0163161_10000105 | 3300017792 | Bacteria | 80620 |
| 378 | Ga0163161_10009252 | 3300017792 | Bacteria | 6812 |
| 379 | Ga0163161_10036161 | 3300017792 | Bacteria | 3536 |
| 380 | Ga0163161_10140745 | 3300017792 | Bacteria | 1827 |
| 381 | Ga0206356_11464399 | 3300020070 | Bacteria | 998 |
| 382 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 383 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 384 | Ga0214542_1041125 | 3300021321 | Bacteria | 1161 |
| 385 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 386 | Ga0214545_1033424 | 3300021324 | Bacteria | 1871 |
| 387 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 388 | Ga0213876_10000384 | 3300021384 | Bacteria | 37354 |
| 389 | Ga0213871_10092503 | 3300021441 | Bacteria | 877 |
| 390 | Ga0209436_116869 | 3300025208 | Bacteria | 1084 |
| 391 | Ga0207427_109743 | 3300025231 | Bacteria | 1020 |
| 392 | Ga0209437_100122 | 3300025233 | Bacteria | 201364 |
| 393 | Ga0209437_100160 | 3300025233 | Bacteria | 149451 |
| 394 | Ga0209437_110384 | 3300025233 | Bacteria | 1423 |
| 395 | Ga0209677_101583 | 3300025253 | Bacteria | 9653 |
| 396 | Ga0209677_101865 | 3300025253 | Bacteria | 8564 |
| 397 | Ga0209148_1000289 | 3300025254 | Bacteria | 75390 |
| 398 | Ga0209129_1001398 | 3300025258 | Bacteria | 13503 |
| 399 | Ga0209129_1011590 | 3300025258 | Bacteria | 2093 |
| 400 | Ga0209233_1000168 | 3300025261 | Bacteria | 149312 |
| 401 | Ga0209233_1000170 | 3300025261 | Bacteria | 147527 |
| 402 | Ga0209233_1000297 | 3300025261 | Bacteria | 61773 |
| 403 | Ga0209233_1002174 | 3300025261 | Bacteria | 7347 |
| 404 | Ga0209233_1014997 | 3300025261 | Bacteria | 2170 |
| 405 | Ga0209565_1000046 | 3300025263 | Bacteria | 226073 |
| 406 | Ga0209455_1000612 | 3300025272 | Bacteria | 22684 |
| 407 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 408 | Ga0209673_1000559 | 3300025273 | Bacteria | 59593 |
| 409 | Ga0209130_1000215 | 3300025284 | Bacteria | 75723 |
| 410 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 411 | Ga0209675_1002925 | 3300025291 | Bacteria | 8432 |
| 412 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 413 | Ga0209676_1000172 | 3300025292 | Bacteria | 153664 |
| 414 | Ga0209676_1009807 | 3300025292 | Bacteria | 4076 |
| 415 | Ga0209025_1000122 | 3300025294 | Bacteria | 206064 |
| 416 | Ga0209025_1000686 | 3300025294 | Bacteria | 58086 |
| 417 | Ga0209025_1013681 | 3300025294 | Bacteria | 5072 |
| 418 | Ga0209025_1013966 | 3300025294 | Bacteria | 4996 |
| 419 | Ga0209564_1000413 | 3300025295 | Bacteria | 75268 |
| 420 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 421 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 422 | Ga0209758_1000777 | 3300025297 | Bacteria | 45841 |
| 423 | Ga0209758_1001948 | 3300025297 | Bacteria | 22345 |
| 424 | Ga0209758_1055006 | 3300025297 | Bacteria | 1356 |
| 425 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 426 | Ga0209050_1000509 | 3300025298 | Bacteria | 65792 |
| 427 | Ga0209050_1008280 | 3300025298 | Bacteria | 5600 |
| 428 | Ga0209256_1000067 | 3300025299 | Bacteria | 246812 |
| 429 | Ga0207426_1000178 | 3300025302 | Bacteria | 159291 |
| 430 | Ga0207426_1000264 | 3300025302 | Bacteria | 110747 |
| 431 | Ga0207426_1002608 | 3300025302 | Bacteria | 11182 |
| 432 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 433 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 434 | Ga0209051_1000159 | 3300025303 | Bacteria | 126836 |
| 435 | Ga0209051_1000278 | 3300025303 | Bacteria | 83769 |
| 436 | Ga0209051_1010695 | 3300025303 | Bacteria | 4599 |
| 437 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 438 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 439 | Ga0209257_1001087 | 3300025304 | Bacteria | 35572 |
| 440 | Ga0207697_10083776 | 3300025315 | Bacteria | 1346 |
| 441 | Ga0207656_10034550 | 3300025321 | Bacteria | 2111 |
| 442 | Ga0207655_1011777 | 3300025728 | Bacteria | 5171 |
| 443 | Ga0207655_1126776 | 3300025728 | Bacteria | 837 |
| 444 | Ga0207653_10004268 | 3300025885 | Bacteria | 4489 |
| 445 | Ga0207710_10010427 | 3300025900 | Bacteria | 3914 |
| 446 | Ga0207710_10022846 | 3300025900 | Bacteria | 2685 |
| 447 | Ga0207710_10123653 | 3300025900 | Bacteria | 1237 |
| 448 | Ga0207710_10386519 | 3300025900 | Bacteria | 717 |
| 449 | Ga0207680_10020320 | 3300025903 | Bacteria | 3570 |
| 450 | Ga0207680_10209532 | 3300025903 | Bacteria | 1332 |
| 451 | Ga0207647_10005160 | 3300025904 | Bacteria | 9607 |
| 452 | Ga0207647_10060474 | 3300025904 | Bacteria | 2315 |
| 453 | Ga0207647_10099127 | 3300025904 | Bacteria | 1731 |
| 454 | Ga0207647_10200906 | 3300025904 | Bacteria | 1153 |
| 455 | Ga0207647_10211500 | 3300025904 | Bacteria | 1120 |
| 456 | Ga0207643_10126933 | 3300025908 | Bacteria | 1515 |
| 457 | Ga0207705_10267593 | 3300025909 | Bacteria | 1306 |
| 458 | Ga0207705_10538347 | 3300025909 | Bacteria | 908 |
| 459 | Ga0207654_10019270 | 3300025911 | Bacteria | 3599 |
| 460 | Ga0207654_10199888 | 3300025911 | Bacteria | 1315 |
| 461 | Ga0207654_10365534 | 3300025911 | Bacteria | 996 |
| 462 | Ga0207707_10018205 | 3300025912 | Bacteria | 6123 |
| 463 | Ga0207707_10058939 | 3300025912 | Bacteria | 3340 |
| 464 | Ga0207707_10084972 | 3300025912 | Bacteria | 2765 |
| 465 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 466 | Ga0207695_10001631 | 3300025913 | Bacteria | 36265 |
| 467 | Ga0207695_10202413 | 3300025913 | Bacteria | 1899 |
| 468 | Ga0207671_10001637 | 3300025914 | Bacteria | 25476 |
| 469 | Ga0207671_10002644 | 3300025914 | Bacteria | 18834 |
| 470 | Ga0207671_10003901 | 3300025914 | Bacteria | 14538 |
| 471 | Ga0207671_10051707 | 3300025914 | Bacteria | 3045 |
| 472 | Ga0207671_10173190 | 3300025914 | Bacteria | 1677 |
| 473 | Ga0207671_10176862 | 3300025914 | Bacteria | 1659 |
| 474 | Ga0207671_10825902 | 3300025914 | Bacteria | 734 |
| 475 | Ga0207693_10017812 | 3300025915 | Bacteria | 5663 |
| 476 | Ga0207663_10050313 | 3300025916 | Bacteria | 2589 |
| 477 | Ga0207663_10094251 | 3300025916 | Bacteria | 1994 |
| 478 | Ga0207663_10382017 | 3300025916 | Bacteria | 1073 |
| 479 | Ga0207663_10408187 | 3300025916 | Bacteria | 1040 |
| 480 | Ga0207663_10695236 | 3300025916 | Bacteria | 805 |
| 481 | Ga0207660_10005245 | 3300025917 | Bacteria | 8420 |
| 482 | Ga0207660_10095920 | 3300025917 | Bacteria | 2207 |
| 483 | Ga0207660_10441300 | 3300025917 | Bacteria | 1052 |
| 484 | Ga0207662_10178198 | 3300025918 | Bacteria | 1366 |
| 485 | Ga0207657_10045084 | 3300025919 | Bacteria | 3872 |
| 486 | Ga0207657_10095794 | 3300025919 | Bacteria | 2469 |
| 487 | Ga0207657_10113141 | 3300025919 | Bacteria | 2239 |
| 488 | Ga0207657_10385830 | 3300025919 | Bacteria | 1102 |
| 489 | Ga0207657_10405870 | 3300025919 | Bacteria | 1071 |
| 490 | Ga0207649_10238147 | 3300025920 | Bacteria | 1305 |
| 491 | Ga0207649_10395456 | 3300025920 | Unclassified | 1033 |
| 492 | Ga0207681_10548452 | 3300025923 | Bacteria | 951 |
| 493 | Ga0207694_10080500 | 3300025924 | Bacteria | 2556 |
| 494 | Ga0207694_10134437 | 3300025924 | Bacteria | 1985 |
| 495 | Ga0207694_10176876 | 3300025924 | Bacteria | 1729 |
| 496 | Ga0207694_10500805 | 3300025924 | Bacteria | 1017 |
| 497 | Ga0207694_10562767 | 3300025924 | Bacteria | 957 |
| 498 | Ga0207650_10315156 | 3300025925 | Bacteria | 1280 |
| 499 | Ga0207700_10003559 | 3300025928 | Bacteria | 9073 |
| 500 | Ga0207700_10257555 | 3300025928 | Bacteria | 1493 |
| 501 | Ga0207664_10492587 | 3300025929 | Bacteria | 1097 |
| 502 | Ga0207644_10372114 | 3300025931 | Bacteria | 1164 |
| 503 | Ga0207644_10419193 | 3300025931 | Bacteria | 1097 |
| 504 | Ga0207644_10750217 | 3300025931 | Bacteria | 815 |
| 505 | Ga0207690_10187469 | 3300025932 | Bacteria | 1562 |
| 506 | Ga0207690_10597774 | 3300025932 | Bacteria | 900 |
| 507 | Ga0207706_10018115 | 3300025933 | Bacteria | 6336 |
| 508 | Ga0207706_10051455 | 3300025933 | Bacteria | 3637 |
| 509 | Ga0207706_10923913 | 3300025933 | Bacteria | 736 |
| 510 | Ga0207686_10211946 | 3300025934 | Bacteria | 1393 |
| 511 | Ga0207709_10003493 | 3300025935 | Bacteria | 9312 |
| 512 | Ga0207709_10060765 | 3300025935 | Bacteria | 2358 |
| 513 | Ga0207669_10049156 | 3300025937 | Bacteria | 2512 |
| 514 | Ga0207704_10711361 | 3300025938 | Bacteria | 832 |
| 515 | Ga0207665_10075953 | 3300025939 | Bacteria | 2302 |
| 516 | Ga0207665_10459389 | 3300025939 | Bacteria | 978 |
| 517 | Ga0207691_10402717 | 3300025940 | Bacteria | 1167 |
| 518 | Ga0207711_10032286 | 3300025941 | Bacteria | 4427 |
| 519 | Ga0207711_10363403 | 3300025941 | Bacteria | 1341 |
| 520 | Ga0207711_10965335 | 3300025941 | Bacteria | 791 |
| 521 | Ga0207689_10014529 | 3300025942 | Bacteria | 6696 |
| 522 | Ga0207689_10364419 | 3300025942 | Bacteria | 1202 |
| 523 | Ga0207661_10050057 | 3300025944 | Bacteria | 3327 |
| 524 | Ga0207661_10235662 | 3300025944 | Unclassified | 1622 |
| 525 | Ga0207661_10808329 | 3300025944 | Bacteria | 863 |
| 526 | Ga0207679_10160399 | 3300025945 | Bacteria | 1841 |
| 527 | Ga0207679_10196745 | 3300025945 | Bacteria | 1681 |
| 528 | Ga0207667_10015041 | 3300025949 | Bacteria | 8802 |
| 529 | Ga0207667_10045209 | 3300025949 | Bacteria | 4665 |
| 530 | Ga0207667_10170360 | 3300025949 | Bacteria | 2238 |
| 531 | Ga0207667_10196388 | 3300025949 | Bacteria | 2070 |
| 532 | Ga0207667_10392952 | 3300025949 | Bacteria | 1412 |
| 533 | Ga0207667_10450233 | 3300025949 | Bacteria | 1308 |
| 534 | Ga0207651_10772537 | 3300025960 | Bacteria | 850 |
| 535 | Ga0207712_10024490 | 3300025961 | Bacteria | 3998 |
| 536 | Ga0207712_10872602 | 3300025961 | Bacteria | 794 |
| 537 | Ga0207668_10099695 | 3300025972 | Bacteria | 2156 |
| 538 | Ga0207658_10101528 | 3300025986 | Bacteria | 2254 |
| 539 | Ga0207658_10510904 | 3300025986 | Bacteria | 1071 |
| 540 | Ga0207658_10513115 | 3300025986 | Bacteria | 1069 |
| 541 | Ga0207658_10781979 | 3300025986 | Bacteria | 866 |
| 542 | Ga0207703_10219125 | 3300026035 | Bacteria | 1700 |
| 543 | Ga0207703_10360805 | 3300026035 | Bacteria | 1340 |
| 544 | Ga0207703_10784020 | 3300026035 | Bacteria | 909 |
| 545 | Ga0207639_10261864 | 3300026041 | Bacteria | 1513 |
| 546 | Ga0207639_10266446 | 3300026041 | Bacteria | 1501 |
| 547 | Ga0207639_10987769 | 3300026041 | Bacteria | 788 |
| 548 | Ga0207678_10000337 | 3300026067 | Bacteria | 42242 |
| 549 | Ga0207678_10018039 | 3300026067 | Bacteria | 6201 |
| 550 | Ga0207678_10024825 | 3300026067 | Bacteria | 5233 |
| 551 | Ga0207678_10047440 | 3300026067 | Bacteria | 3715 |
| 552 | Ga0207678_10073747 | 3300026067 | Bacteria | 2925 |
| 553 | Ga0207678_10178025 | 3300026067 | Bacteria | 1816 |
| 554 | Ga0207678_10339727 | 3300026067 | Bacteria | 1294 |
| 555 | Ga0207708_10001974 | 3300026075 | Bacteria | 15141 |
| 556 | Ga0207708_10240634 | 3300026075 | Bacteria | 1456 |
| 557 | Ga0207702_10010148 | 3300026078 | Bacteria | 7885 |
| 558 | Ga0207702_10287065 | 3300026078 | Bacteria | 1558 |
| 559 | Ga0207702_10451637 | 3300026078 | Bacteria | 1247 |
| 560 | Ga0207702_10692841 | 3300026078 | Bacteria | 1004 |
| 561 | Ga0207702_10744360 | 3300026078 | Bacteria | 967 |
| 562 | Ga0207702_11173206 | 3300026078 | Bacteria | 762 |
| 563 | Ga0207641_10041110 | 3300026088 | Bacteria | 3874 |
| 564 | Ga0207641_10243477 | 3300026088 | Bacteria | 1677 |
| 565 | Ga0207641_11039906 | 3300026088 | Bacteria | 816 |
| 566 | Ga0207648_10118722 | 3300026089 | Bacteria | 2324 |
| 567 | Ga0207676_10039430 | 3300026095 | Bacteria | 3613 |
| 568 | Ga0207676_10073555 | 3300026095 | Bacteria | 2751 |
| 569 | Ga0207676_10372485 | 3300026095 | Bacteria | 1327 |
| 570 | Ga0207676_10698596 | 3300026095 | Bacteria | 982 |
| 571 | Ga0207676_10854398 | 3300026095 | Bacteria | 890 |
| 572 | Ga0207674_10029570 | 3300026116 | Bacteria | 5768 |
| 573 | Ga0207674_10031742 | 3300026116 | Bacteria | 5546 |
| 574 | Ga0207674_10048477 | 3300026116 | Bacteria | 4347 |
| 575 | Ga0207674_10098352 | 3300026116 | Bacteria | 2909 |
| 576 | Ga0207674_10141197 | 3300026116 | Bacteria | 2368 |
| 577 | Ga0207674_10700797 | 3300026116 | Bacteria | 978 |
| 578 | Ga0207675_100082728 | 3300026118 | Bacteria | 3011 |
| 579 | Ga0207683_10105677 | 3300026121 | Bacteria | 2517 |
| 580 | Ga0207683_10174784 | 3300026121 | Bacteria | 1946 |
| 581 | Ga0207683_10255192 | 3300026121 | Bacteria | 1600 |
| 582 | Ga0207683_10498464 | 3300026121 | Bacteria | 1125 |
| 583 | Ga0207698_10233167 | 3300026142 | Bacteria | 1672 |
| 584 | Ga0207698_10459446 | 3300026142 | Bacteria | 1231 |
| 585 | Ga0207698_10499971 | 3300026142 | Bacteria | 1183 |
| 586 | Ga0207698_10651999 | 3300026142 | Bacteria | 1043 |
| 587 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 588 | Ga0209389_1000081 | 3300027296 | Bacteria | 89601 |
| 589 | Ga0209589_1000091 | 3300027357 | Bacteria | 89601 |
| 590 | Ga0209489_100096 | 3300027361 | Bacteria | 122075 |
| 591 | Ga0209489_103917 | 3300027361 | Bacteria | 28294 |
| 592 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 593 | Ga0209282_1060656 | 3300027666 | Bacteria | 2110 |
| 594 | Ga0209588_1001221 | 3300027671 | Bacteria | 6646 |
| 595 | Ga0209813_10002519 | 3300027866 | Bacteria | 4196 |
| 596 | Ga0209813_10003776 | 3300027866 | Bacteria | 3574 |
| 597 | Ga0209813_10015641 | 3300027866 | Bacteria | 2060 |
| 598 | Ga0207428_10232096 | 3300027907 | Bacteria | 1381 |
| 599 | Ga0268266_10000055 | 3300028379 | Bacteria | 291630 |
| 600 | Ga0268266_10071995 | 3300028379 | Bacteria | 2996 |
| 601 | Ga0268266_10236782 | 3300028379 | Bacteria | 1683 |
| 602 | Ga0268266_10910896 | 3300028379 | Bacteria | 850 |
| 603 | Ga0268265_10006170 | 3300028380 | Bacteria | 8117 |
| 604 | Ga0268265_10008013 | 3300028380 | Bacteria | 7133 |
| 605 | Ga0268265_10414867 | 3300028380 | Bacteria | 1248 |
| 606 | Ga0268264_10000233 | 3300028381 | Bacteria | 106118 |
| 607 | Ga0268264_10018666 | 3300028381 | Bacteria | 5670 |
| 608 | Ga0268264_10349811 | 3300028381 | Bacteria | 1406 |
| 609 | Ga0265334_10012112 | 3300028573 | Bacteria | 3625 |
| 610 | Ga0307515_10012480 | 3300028794 | Bacteria | 15979 |
| 611 | Ga0265338_10007042 | 3300028800 | Bacteria | 14105 |
| 612 | Ga0265338_10016438 | 3300028800 | Bacteria | 8054 |
| 613 | Ga0265338_10032839 | 3300028800 | Bacteria | 5052 |
| 614 | Ga0307511_10096523 | 3300030521 | Bacteria | 1968 |
| 615 | Ga0307512_10141132 | 3300030522 | Bacteria | 1474 |
| 616 | Ga0316177_1220166 | 3300030731 | Bacteria | 3772 |
| 617 | Ga0316176_1074271 | 3300030732 | Bacteria | 1692 |
| 618 | Ga0314311_1023036 | 3300030733 | Bacteria | 7083 |
| 619 | Ga0316178_1123278 | 3300030735 | Bacteria | 2060 |
| 620 | Ga0316180_1019296 | 3300030736 | Bacteria | 4028 |
| 621 | Ga0316183_1126188 | 3300030742 | Bacteria | 20738 |
| 622 | Ga0316181_1028270 | 3300030744 | Bacteria | 9388 |
| 623 | Ga0316182_1164524 | 3300030745 | Bacteria | 5126 |
| 624 | Ga0316182_1282851 | 3300030745 | Bacteria | 2259 |
| 625 | Ga0265330_10169963 | 3300031235 | Bacteria | 924 |
| 626 | Ga0265332_10002293 | 3300031238 | Bacteria | 9786 |
| 627 | Ga0265332_10102714 | 3300031238 | Bacteria | 1205 |
| 628 | Ga0265328_10113442 | 3300031239 | Bacteria | 1008 |
| 629 | Ga0265320_10000102 | 3300031240 | Bacteria | 72957 |
| 630 | Ga0265325_10201373 | 3300031241 | Bacteria | 918 |
| 631 | Ga0265329_10042118 | 3300031242 | Bacteria | 1463 |
| 632 | Ga0265329_10085282 | 3300031242 | Bacteria | 1001 |
| 633 | Ga0265340_10003648 | 3300031247 | Bacteria | 8655 |
| 634 | Ga0265340_10023320 | 3300031247 | Bacteria | 3157 |
| 635 | Ga0265340_10036067 | 3300031247 | Bacteria | 2453 |
| 636 | Ga0265340_10068915 | 3300031247 | Bacteria | 1679 |
| 637 | Ga0265339_10002587 | 3300031249 | Bacteria | 12907 |
| 638 | Ga0265339_10107257 | 3300031249 | Bacteria | 1448 |
| 639 | Ga0265331_10004118 | 3300031250 | Bacteria | 9125 |
| 640 | Ga0265331_10006890 | 3300031250 | Bacteria | 6638 |
| 641 | Ga0265327_10012710 | 3300031251 | Bacteria | 5655 |
| 642 | Ga0265316_10256246 | 3300031344 | Bacteria | 1283 |
| 643 | Ga0307513_10218757 | 3300031456 | Bacteria | 1728 |
| 644 | Ga0307509_10038652 | 3300031507 | Bacteria | 5204 |
| 645 | Ga0307509_10305319 | 3300031507 | Bacteria | 1337 |
| 646 | Ga0307509_10335430 | 3300031507 | Bacteria | 1242 |
| 647 | Ga0307408_100186846 | 3300031548 | Bacteria | 1666 |
| 648 | Ga0307408_101460393 | 3300031548 | Bacteria | 645 |
| 649 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 650 | Ga0307508_10189352 | 3300031616 | Bacteria | 1659 |
| 651 | Ga0307508_10215585 | 3300031616 | Bacteria | 1520 |
| 652 | Ga0307514_10009275 | 3300031649 | Bacteria | 8289 |
| 653 | Ga0307514_10031724 | 3300031649 | Bacteria | 4235 |
| 654 | Ga0265314_10010572 | 3300031711 | Bacteria | 7681 |
| 655 | Ga0265314_10256811 | 3300031711 | Bacteria | 1000 |
| 656 | Ga0265342_10002113 | 3300031712 | Bacteria | 17530 |
| 657 | Ga0265342_10025322 | 3300031712 | Bacteria | 3733 |
| 658 | Ga0265342_10076999 | 3300031712 | Bacteria | 1933 |
| 659 | Ga0307516_10000131 | 3300031730 | Bacteria | 89180 |
| 660 | Ga0307516_10015237 | 3300031730 | Bacteria | 8099 |
| 661 | Ga0307516_10101139 | 3300031730 | Bacteria | 2698 |
| 662 | Ga0307405_10158862 | 3300031731 | Bacteria | 1598 |
| 663 | Ga0307413_10760582 | 3300031824 | Bacteria | 811 |
| 664 | Ga0307406_10288038 | 3300031901 | Bacteria | 1256 |
| 665 | Ga0307406_10802803 | 3300031901 | Bacteria | 794 |
| 666 | Ga0307406_10939853 | 3300031901 | Bacteria | 738 |
| 667 | Ga0307407_10430313 | 3300031903 | Bacteria | 953 |
| 668 | Ga0307412_10004706 | 3300031911 | Bacteria | 7614 |
| 669 | Ga0307412_10073269 | 3300031911 | Bacteria | 2342 |
| 670 | Ga0307412_10265496 | 3300031911 | Bacteria | 1340 |
| 671 | Ga0307412_10742219 | 3300031911 | Bacteria | 847 |
| 672 | Ga0307409_100384591 | 3300031995 | Bacteria | 1335 |
| 673 | Ga0307416_100280869 | 3300032002 | Bacteria | 1641 |
| 674 | Ga0307414_10070300 | 3300032004 | Bacteria | 2520 |
| 675 | Ga0307414_10092583 | 3300032004 | Bacteria | 2250 |
| 676 | Ga0307411_10065234 | 3300032005 | Bacteria | 2441 |
| 677 | Ga0307411_10221066 | 3300032005 | Bacteria | 1469 |
| 678 | Ga0307507_10099702 | 3300033179 | Bacteria | 2438 |
| 679 | Ga0307510_10007884 | 3300033180 | Bacteria | 12686 |
| 680 | Ga0307510_10026794 | 3300033180 | Bacteria | 6617 |
| 681 | Ga0307510_10330548 | 3300033180 | Bacteria | 979 |
| 682 | Ga0373930_0052507 | 3300034816 | Bacteria | 893 |
| 683 | Ga0373950_0054722 | 3300034818 | Bacteria | 790 |
| 684 | Ga0373958_0018666 | 3300034819 | Bacteria | 1260 |
| 685 | Ga0373951_0022432 | 3300035091 | Bacteria | 1454 |
| 686 | Ga0373936_0011012 | 3300035113 | Bacteria | 3418 |
| 687 | Ga0373939_0158049 | 3300035114 | Bacteria | 830 |
| 688 | Ga0373941_0031201 | 3300035115 | Bacteria | 1586 |
| 689 | Ga0373945_0172648 | 3300035116 | Bacteria | 886 |
| 690 | Ga0373954_0282272 | 3300035118 | Bacteria | 818 |
| 691 | Ga0373956_0034696 | 3300035119 | Bacteria | 2222 |
| 692 | Ga0373957_0012775 | 3300035120 | Bacteria | 2833 |
| 693 | Ga0373960_0006840 | 3300035121 | Bacteria | 2686 |
| 694 | Ga0373946_0266816 | 3300035171 | Bacteria | 839 |
| 695 | Ga0373961_0102261 | 3300035241 | Bacteria | 929 |
| 696 | Ga0373962_0089287 | 3300035242 | Bacteria | 947 |
| 697 | Ga0373924_0075033 | 3300035410 | Bacteria | 1431 |
| 698 | Ga0373935_0052251 | 3300035692 | Bacteria | 2597 |
| 699 | Ga0373935_0191097 | 3300035692 | Bacteria | 1410 |
| 700 | Ga0373935_0364418 | 3300035692 | Bacteria | 1032 |
| 701 | Ga0373927_0016488 | 3300035695 | Bacteria | 4871 |
| 702 | Ga0373927_0024569 | 3300035695 | Bacteria | 3940 |
| 703 | Ga0373937_0005850 | 3300036401 | Bacteria | 10576 |
| 704 | Ga0373925_0018284 | 3300037068 | Bacteria | 5094 |
| 705 | Ga0373925_0046851 | 3300037068 | Bacteria | 3216 |
| 706 | Ga0373925_0051972 | 3300037068 | Bacteria | 3060 |
| 707 | Ga0395900_0338430 | 3300037418 | Bacteria | 1481 |
| 708 | Ga0395900_0349930 | 3300037418 | Bacteria | 1451 |
| 709 | Ga0395900_0420206 | 3300037418 | Bacteria | 1298 |
| 710 | Ga0395898_0002853 | 3300037466 | Bacteria | 19760 |
| 711 | Ga0395898_0168415 | 3300037466 | Bacteria | 2094 |
| 712 | Ga0395898_0220282 | 3300037466 | Bacteria | 1810 |
| 713 | Ga0395905_0012510 | 3300037471 | Bacteria | 8167 |
| 714 | Ga0395905_0025312 | 3300037471 | Bacteria | 5596 |
| 715 | Ga0436364_0614298 | 3300037853 | Bacteria | 1246 |
| 716 | Ga0436364_1222287 | 3300037853 | Bacteria | 1065 |
| 717 | Ga0436364_1310055 | 3300037853 | Bacteria | 1138 |
| 718 | Ga0395901_0029183 | 3300038443 | Bacteria | 5677 |
| 719 | Ga0395901_0471290 | 3300038443 | Bacteria | 1282 |
| 720 | Ga0436365_0419344 | 3300039437 | Bacteria | 13419 |
| 721 | Ga0436365_0998612 | 3300039437 | Bacteria | 938 |
| 722 | Ga0436360_0511504 | 3300039438 | Bacteria | 2578 |
| 723 | Ga0436361_0125523 | 3300039447 | Bacteria | 2191 |
| 724 | Ga0436363_0942152 | 3300039450 | Bacteria | 3279 |
| 725 | Ga0436363_1316254 | 3300039450 | Bacteria | 703 |
| 726 | Ga0436362_0193018 | 3300039453 | Bacteria | 4144 |
| 727 | Ga0439436_0037931 | 3300041404 | Bacteria | 1387 |
| 728 | Ga0451797_0291897 | 3300041453 | Bacteria | 1455 |
| 729 | Ga0451800_1589477 | 3300041459 | Bacteria | 1182 |
| 730 | Ga0451807_0920577 | 3300041486 | Bacteria | 1020 |
| 731 | Ga0439431_0036137 | 3300041997 | Bacteria | 1243 |
| 732 | Ga0439449_0019933 | 3300042007 | Bacteria | 2514 |
| 733 | Ga0439463_058599 | 3300042016 | Bacteria | 985 |
| 734 | Ga0439459_0082101 | 3300042438 | Bacteria | 762 |
| 735 | Ga0450918_036931 | 3300042531 | Bacteria | 871 |
| 736 | Ga0466969_0040244 | 3300044656 | Bacteria | 2342 |
| 737 | Ga0466965_0035113 | 3300044683 | Bacteria | 2455 |
| 738 | Ga0466965_0345774 | 3300044683 | Bacteria | 814 |
| 739 | Ga0466966_0000743 | 3300044684 | Bacteria | 20686 |
| 740 | Ga0466961_0000013 | 3300044693 | Bacteria | 129640 |
| 741 | Ga0466968_0026713 | 3300044735 | Bacteria | 2371 |
| 742 | Ga0466960_0172473 | 3300044901 | Bacteria | 1168 |
| 743 | Ga0466959_0006806 | 3300045049 | Bacteria | 7964 |
| 744 | Ga0466958_0291494 | 3300045836 | Bacteria | 1047 |
| 745 | Ga0466967_1045263 | 3300045976 | Bacteria | 813 |
| 746 | Ga0495592_0270310 | 3300046454 | Bacteria | 1116 |
| 747 | Ga0495603_0025657 | 3300046455 | Bacteria | 3564 |
| 748 | Ga0495603_0067083 | 3300046455 | Bacteria | 2113 |
| 749 | Ga0495590_0039916 | 3300046457 | Bacteria | 1638 |
| 750 | Ga0495629_0034275 | 3300046459 | Bacteria | 3589 |
| 751 | Ga0495638_0000398 | 3300046460 | Bacteria | 53469 |
| 752 | Ga0495651_0000388 | 3300046462 | Bacteria | 33995 |
| 753 | Ga0495651_0226178 | 3300046462 | Bacteria | 1291 |
| 754 | Ga0495653_0137228 | 3300046463 | Bacteria | 1724 |
| 755 | Ga0495653_0181832 | 3300046463 | Bacteria | 1442 |
| 756 | Ga0495653_0329308 | 3300046463 | Bacteria | 988 |
| 757 | Ga0495582_0188040 | 3300046473 | Bacteria | 1178 |
| 758 | Ga0495639_0015245 | 3300046475 | Bacteria | 3331 |
| 759 | Ga0495639_0253867 | 3300046475 | Bacteria | 870 |
| 760 | Ga0495664_0072645 | 3300046477 | Bacteria | 2056 |
| 761 | Ga0495664_0370642 | 3300046477 | Bacteria | 861 |
| 762 | Ga0495664_0636870 | 3300046477 | Bacteria | 632 |
| 763 | Ga0495584_0175576 | 3300046491 | Bacteria | 1089 |
| 764 | Ga0495594_0218522 | 3300046499 | Bacteria | 1087 |
| 765 | Ga0495594_0565245 | 3300046499 | Bacteria | 645 |
| 766 | Ga0495596_0255698 | 3300046500 | Bacteria | 680 |
| 767 | Ga0495607_0092478 | 3300046501 | Bacteria | 1636 |
| 768 | Ga0495607_0313699 | 3300046501 | Bacteria | 734 |
| 769 | Ga0495606_0014901 | 3300046507 | Bacteria | 6034 |
| 770 | Ga0495608_0072084 | 3300046511 | Bacteria | 2253 |
| 771 | Ga0495610_0039139 | 3300046512 | Bacteria | 2400 |
| 772 | Ga0495616_0010771 | 3300046513 | Bacteria | 5272 |
| 773 | Ga0495618_0029042 | 3300046514 | Bacteria | 3448 |
| 774 | Ga0495620_0064751 | 3300046515 | Bacteria | 1511 |
| 775 | Ga0495620_0203721 | 3300046515 | Bacteria | 761 |
| 776 | Ga0495620_0289623 | 3300046515 | Bacteria | 623 |
| 777 | Ga0495628_0082800 | 3300046516 | Bacteria | 2492 |
| 778 | Ga0495628_0192298 | 3300046516 | Bacteria | 1540 |
| 779 | Ga0495630_0068555 | 3300046517 | Bacteria | 2668 |
| 780 | Ga0495631_0000021 | 3300046518 | Bacteria | 92765 |
| 781 | Ga0495631_0037954 | 3300046518 | Bacteria | 2144 |
| 782 | Ga0495631_0073638 | 3300046518 | Bacteria | 1475 |
| 783 | Ga0495632_0150137 | 3300046519 | Bacteria | 1078 |
| 784 | Ga0495632_0355279 | 3300046519 | Bacteria | 644 |
| 785 | Ga0495637_0020807 | 3300046520 | Bacteria | 3012 |
| 786 | Ga0495644_0082194 | 3300046523 | Bacteria | 1214 |
| 787 | Ga0495648_0009683 | 3300046524 | Bacteria | 7428 |
| 788 | Ga0495648_0105226 | 3300046524 | Bacteria | 1548 |
| 789 | Ga0495648_0180618 | 3300046524 | Bacteria | 1073 |
| 790 | Ga0495663_0054329 | 3300046525 | Bacteria | 1247 |
| 791 | Ga0495642_0025533 | 3300046528 | Bacteria | 2342 |
| 792 | Ga0495652_0003852 | 3300046529 | Bacteria | 14646 |
| 793 | Ga0495652_0501563 | 3300046529 | Bacteria | 841 |
| 794 | Ga0495654_0012310 | 3300046530 | Bacteria | 4597 |
| 795 | Ga0495665_0203568 | 3300046531 | Bacteria | 1026 |
| 796 | Ga0495640_0044552 | 3300046533 | Bacteria | 3084 |
| 797 | Ga0495640_0115249 | 3300046533 | Bacteria | 1751 |
| 798 | Ga0495587_0047352 | 3300046536 | Bacteria | 2550 |
| 799 | Ga0495587_0097573 | 3300046536 | Bacteria | 1694 |
| 800 | Ga0495598_0029644 | 3300046537 | Bacteria | 1527 |
| 801 | Ga0495609_0133280 | 3300046538 | Bacteria | 1063 |
| 802 | Ga0495609_0141091 | 3300046538 | Bacteria | 1028 |
| 803 | Ga0495621_0034955 | 3300046539 | Bacteria | 1738 |
| 804 | Ga0495621_0069279 | 3300046539 | Bacteria | 1296 |
| 805 | Ga0495597_0124787 | 3300046542 | Bacteria | 1071 |
| 806 | Ga0495622_0085031 | 3300046557 | Bacteria | 1455 |
| 807 | Ga0495633_0208613 | 3300046558 | Bacteria | 896 |
| 808 | Ga0495667_0002142 | 3300046559 | Bacteria | 13153 |
| 809 | Ga0495667_0433649 | 3300046559 | Bacteria | 826 |
| 810 | Ga0495656_0051564 | 3300046615 | Bacteria | 1761 |
| 811 | Ga0495668_0264189 | 3300046616 | Bacteria | 942 |
| 812 | Ga0495634_0022224 | 3300046642 | Bacteria | 4471 |
| 813 | Ga0495625_0021879 | 3300046660 | Bacteria | 4911 |
| 814 | Ga0495625_0089878 | 3300046660 | Bacteria | 2125 |
| 815 | Ga0495625_0159869 | 3300046660 | Bacteria | 1510 |
| 816 | Ga0495625_0163136 | 3300046660 | Bacteria | 1492 |
| 817 | Ga0495625_0301257 | 3300046660 | Bacteria | 1026 |
| 818 | Ga0495625_0335603 | 3300046660 | Bacteria | 959 |
| 819 | Ga0495659_0214878 | 3300046664 | Bacteria | 792 |
| 820 | Ga0495588_0101443 | 3300046674 | Bacteria | 1512 |
| 821 | Ga0495657_0013200 | 3300046675 | Bacteria | 6102 |
| 822 | Ga0495657_0098981 | 3300046675 | Bacteria | 1860 |
| 823 | Ga0495599_0059401 | 3300046678 | Bacteria | 2392 |
| 824 | Ga0495599_0133186 | 3300046678 | Bacteria | 1543 |
| 825 | Ga0495599_0181090 | 3300046678 | Bacteria | 1299 |
| 826 | Ga0495623_0079698 | 3300046679 | Bacteria | 2028 |
| 827 | Ga0495646_0020067 | 3300046680 | Bacteria | 4225 |
| 828 | Ga0495658_0142211 | 3300046683 | Bacteria | 1468 |
| 829 | Ga0495613_0270910 | 3300046689 | Bacteria | 1181 |
| 830 | Ga0495624_0048087 | 3300046690 | Bacteria | 2708 |
| 831 | Ga0495624_0267030 | 3300046690 | Bacteria | 1034 |
| 832 | Ga0495670_0092224 | 3300046691 | Bacteria | 1551 |
| 833 | Ga0495671_0077298 | 3300046692 | Bacteria | 1632 |
| 834 | Ga0495649_0025601 | 3300046694 | Bacteria | 3287 |
| 835 | Ga0495589_0267695 | 3300046794 | Bacteria | 796 |
| 836 | Ga0495589_0273129 | 3300046794 | Bacteria | 787 |
| 837 | Ga0495600_0023897 | 3300046809 | Bacteria | 3933 |
| 838 | Ga0495600_0330923 | 3300046809 | Bacteria | 956 |
| 839 | Ga0495660_0095171 | 3300046810 | Bacteria | 1541 |
| 840 | Ga0495581_0123239 | 3300047315 | Bacteria | 1509 |
| 841 | Ga0495604_0032057 | 3300047317 | Bacteria | 4166 |
| 842 | Ga0495604_0045919 | 3300047317 | Bacteria | 3407 |
| 843 | Ga0495674_0183924 | 3300047319 | Bacteria | 1739 |
| 844 | Ga0495674_0415177 | 3300047319 | Bacteria | 1085 |
| 845 | Ga0495674_0761055 | 3300047319 | Bacteria | 756 |
| 846 | Ga0495672_0027558 | 3300047320 | Bacteria | 3608 |
| 847 | Ga0495672_0048666 | 3300047320 | Bacteria | 2513 |
| 848 | Ga0495672_0090469 | 3300047320 | Bacteria | 1682 |
| 849 | Ga0495676_0018304 | 3300047321 | Bacteria | 6176 |
| 850 | Ga0495680_0016485 | 3300047322 | Bacteria | 6344 |
| 851 | Ga0495683_0047314 | 3300047323 | Bacteria | 2159 |
| 852 | Ga0495687_003920 | 3300047443 | Bacteria | 10425 |
| 853 | Ga0495675_0094720 | 3300047444 | Bacteria | 1872 |
| 854 | Ga0495673_0074127 | 3300047469 | Bacteria | 1425 |
| 855 | Ga0495673_0122884 | 3300047469 | Bacteria | 1027 |
| 856 | Ga0495686_0055461 | 3300047472 | Bacteria | 2478 |
| 857 | Ga0495686_0073886 | 3300047472 | Bacteria | 2093 |
| 858 | Ga0495686_0075766 | 3300047472 | Bacteria | 2062 |
| 859 | Ga0495686_0143347 | 3300047472 | Bacteria | 1408 |
| 860 | Ga0495686_0273894 | 3300047472 | Bacteria | 940 |
| 861 | Ga0495686_0351573 | 3300047472 | Bacteria | 801 |
| 862 | Ga0495686_0433544 | 3300047472 | Bacteria | 701 |
| 863 | Ga0495593_0007695 | 3300047673 | Bacteria | 6288 |
| 864 | Ga0495602_0026247 | 3300048088 | Bacteria | 5621 |
| 865 | Ga0495602_0174533 | 3300048088 | Bacteria | 1664 |
| 866 | Ga0495614_0003864 | 3300048089 | Bacteria | 6735 |
| 867 | Ga0495626_0014917 | 3300048091 | Bacteria | 3990 |
| 868 | Ga0496100_0007590 | 3300048903 | Bacteria | 5995 |
| 869 | Ga0496100_0028223 | 3300048903 | Bacteria | 3460 |
| 870 | Ga0496100_0344206 | 3300048903 | Bacteria | 1125 |
| 871 | Ga0496100_0617324 | 3300048903 | Bacteria | 843 |
| 872 | Ga0496101_0208454 | 3300048904 | Bacteria | 1513 |
| 873 | Ga0496102_0005180 | 3300048905 | Bacteria | 11067 |
| 874 | Ga0496102_0017154 | 3300048905 | Bacteria | 6340 |
| 875 | Ga0496102_0049421 | 3300048905 | Bacteria | 3826 |
| 876 | Ga0496102_0511438 | 3300048905 | Bacteria | 1123 |
| 877 | Ga0496103_0019495 | 3300048906 | Bacteria | 4073 |
| 878 | Ga0496103_0032651 | 3300048906 | Bacteria | 3177 |
| 879 | Ga0496103_0041509 | 3300048906 | Bacteria | 2828 |
| 880 | Ga0496103_0096293 | 3300048906 | Bacteria | 1870 |
| 881 | Ga0496103_0116311 | 3300048906 | Bacteria | 1701 |
| 882 | Ga0496103_0175439 | 3300048906 | Bacteria | 1377 |
| 883 | Ga0496104_0013720 | 3300048907 | Bacteria | 7309 |
| 884 | Ga0496104_0032278 | 3300048907 | Bacteria | 4873 |
| 885 | Ga0496104_0107715 | 3300048907 | Bacteria | 2670 |
| 886 | Ga0496104_0113317 | 3300048907 | Bacteria | 2600 |
| 887 | Ga0496104_0244122 | 3300048907 | Bacteria | 1708 |
| 888 | Ga0496104_0644269 | 3300048907 | Bacteria | 969 |
| 889 | Ga0496105_0007184 | 3300048908 | Bacteria | 8594 |
| 890 | Ga0496105_0019748 | 3300048908 | Bacteria | 5436 |
| 891 | Ga0496105_0028800 | 3300048908 | Bacteria | 4543 |
| 892 | Ga0496105_0041214 | 3300048908 | Bacteria | 3805 |
| 893 | Ga0496105_0209209 | 3300048908 | Bacteria | 1590 |
| 894 | Ga0496105_0709534 | 3300048908 | Bacteria | 771 |
| 895 | Ga0496106_0001152 | 3300048909 | Bacteria | 19595 |
| 896 | Ga0496106_0004584 | 3300048909 | Bacteria | 10252 |
| 897 | Ga0496106_0013136 | 3300048909 | Bacteria | 6111 |
| 898 | Ga0496106_0018500 | 3300048909 | Bacteria | 5153 |
| 899 | Ga0496106_0031853 | 3300048909 | Bacteria | 3929 |
| 900 | Ga0496106_0032086 | 3300048909 | Bacteria | 3915 |
| 901 | Ga0496106_0173881 | 3300048909 | Bacteria | 1708 |
| 902 | Ga0496106_0208207 | 3300048909 | Bacteria | 1557 |
| 903 | Ga0496106_0253998 | 3300048909 | Bacteria | 1406 |
| 904 | Ga0496106_0266595 | 3300048909 | Bacteria | 1371 |
| 905 | Ga0496107_0008261 | 3300048910 | Bacteria | 7204 |
| 906 | Ga0496107_0016800 | 3300048910 | Bacteria | 5145 |
| 907 | Ga0496107_0035132 | 3300048910 | Bacteria | 3593 |
| 908 | Ga0496107_0155721 | 3300048910 | Bacteria | 1692 |
| 909 | Ga0496107_0266087 | 3300048910 | Bacteria | 1276 |
| 910 | Ga0496107_0311859 | 3300048910 | Bacteria | 1171 |
| 911 | Ga0496107_0387995 | 3300048910 | Bacteria | 1039 |
| 912 | Ga0496107_0626244 | 3300048910 | Bacteria | 794 |
| 913 | Ga0496108_0020986 | 3300048911 | Bacteria | 5369 |
| 914 | Ga0496108_0079024 | 3300048911 | Bacteria | 2785 |
| 915 | Ga0496108_0087619 | 3300048911 | Bacteria | 2644 |
| 916 | Ga0496108_0508389 | 3300048911 | Bacteria | 1052 |
| 917 | Ga0496109_0045666 | 3300048912 | Bacteria | 3976 |
| 918 | Ga0496109_0064060 | 3300048912 | Bacteria | 3363 |
| 919 | Ga0496109_0196993 | 3300048912 | Bacteria | 1894 |
| 920 | Ga0496109_0313130 | 3300048912 | Bacteria | 1481 |
| 921 | Ga0496109_0428833 | 3300048912 | Bacteria | 1249 |
| 922 | Ga0496109_0520036 | 3300048912 | Bacteria | 1123 |
| 923 | Ga0496109_0600523 | 3300048912 | Bacteria | 1037 |
| 924 | Ga0496109_0648035 | 3300048912 | Bacteria | 993 |
| 925 | Ga0496110_0014187 | 3300048913 | Bacteria | 6610 |
| 926 | Ga0496110_0027366 | 3300048913 | Bacteria | 4888 |
| 927 | Ga0496110_0041293 | 3300048913 | Bacteria | 4024 |
| 928 | Ga0496110_0084470 | 3300048913 | Bacteria | 2833 |
| 929 | Ga0496110_0346769 | 3300048913 | Bacteria | 1353 |
| 930 | Ga0496111_0086380 | 3300048914 | Bacteria | 2295 |
| 931 | Ga0496111_0092307 | 3300048914 | Bacteria | 2219 |
| 932 | Ga0496111_0129848 | 3300048914 | Bacteria | 1864 |
| 933 | Ga0496112_0038824 | 3300048915 | Bacteria | 4651 |
| 934 | Ga0496112_0048748 | 3300048915 | Bacteria | 4151 |
| 935 | Ga0496112_0092747 | 3300048915 | Bacteria | 2989 |
| 936 | Ga0496112_0599215 | 3300048915 | Bacteria | 1034 |
| 937 | Ga0496113_0020094 | 3300048916 | Bacteria | 4688 |
| 938 | Ga0496113_0033739 | 3300048916 | Bacteria | 3729 |
| 939 | Ga0496113_0185899 | 3300048916 | Bacteria | 1648 |
| 940 | Ga0496113_0434342 | 3300048916 | Bacteria | 1055 |
| 941 | Ga0496114_0029970 | 3300048917 | Bacteria | 4474 |
| 942 | Ga0496114_0162823 | 3300048917 | Bacteria | 1941 |
| 943 | Ga0496114_0183202 | 3300048917 | Bacteria | 1829 |
| 944 | Ga0496115_0046865 | 3300048918 | Bacteria | 3456 |
| 945 | Ga0496115_0049686 | 3300048918 | Bacteria | 3358 |
| 946 | Ga0496115_0704927 | 3300048918 | Bacteria | 793 |
| 947 | Ga0496116_0025718 | 3300048919 | Bacteria | 4321 |
| 948 | Ga0496116_0069489 | 3300048919 | Bacteria | 2239 |
| 949 | Ga0496116_0290197 | 3300048919 | Bacteria | 786 |
| 950 | Ga0496117_0002298 | 3300048920 | Bacteria | 24600 |
| 951 | Ga0496117_0015458 | 3300048920 | Bacteria | 6506 |
| 952 | Ga0496117_0022441 | 3300048920 | Bacteria | 5061 |
| 953 | Ga0496117_0054188 | 3300048920 | Bacteria | 2811 |
| 954 | Ga0496118_0007362 | 3300048921 | Bacteria | 11698 |
| 955 | Ga0496118_0015802 | 3300048921 | Bacteria | 6963 |
| 956 | Ga0496118_0039123 | 3300048921 | Bacteria | 3789 |
| 957 | Ga0496118_0100107 | 3300048921 | Bacteria | 1962 |
| 958 | Ga0496118_0204153 | 3300048921 | Bacteria | 1167 |
| 959 | Ga0496119_0000801 | 3300048922 | Bacteria | 42070 |
| 960 | Ga0496119_0021437 | 3300048922 | Bacteria | 4672 |
| 961 | Ga0496119_0060252 | 3300048922 | Bacteria | 2274 |
| 962 | Ga0496119_0102027 | 3300048922 | Bacteria | 1609 |
| 963 | Ga0496119_0104686 | 3300048922 | Bacteria | 1582 |
| 964 | Ga0496120_0019393 | 3300048923 | Bacteria | 4351 |
| 965 | Ga0496120_0056343 | 3300048923 | Bacteria | 2219 |
| 966 | Ga0496120_0072422 | 3300048923 | Bacteria | 1888 |
| 967 | Ga0496121_0000994 | 3300048924 | Bacteria | 50714 |
| 968 | Ga0496121_0001567 | 3300048924 | Bacteria | 38104 |
| 969 | Ga0496121_0002309 | 3300048924 | Bacteria | 29564 |
| 970 | Ga0496121_0023552 | 3300048924 | Bacteria | 5923 |
| 971 | Ga0496121_0026483 | 3300048924 | Bacteria | 5462 |
| 972 | Ga0496121_0057543 | 3300048924 | Bacteria | 3221 |
| 973 | Ga0496121_0074965 | 3300048924 | Bacteria | 2704 |
| 974 | Ga0496121_0110103 | 3300048924 | Bacteria | 2102 |
| 975 | Ga0496121_0110388 | 3300048924 | Bacteria | 2099 |
| 976 | Ga0496122_0174951 | 3300048925 | Bacteria | 1288 |
| 977 | Ga0496123_0049995 | 3300048926 | Bacteria | 2797 |
| 978 | Ga0496123_0094679 | 3300048926 | Bacteria | 1759 |
| 979 | Ga0496123_0141390 | 3300048926 | Bacteria | 1315 |
| 980 | Ga0496124_0002590 | 3300048927 | Bacteria | 23408 |
| 981 | Ga0496124_0003412 | 3300048927 | Bacteria | 19487 |
| 982 | Ga0496124_0015526 | 3300048927 | Bacteria | 7292 |
| 983 | Ga0496124_0216950 | 3300048927 | Bacteria | 1442 |
| 984 | Ga0496124_0342192 | 3300048927 | Bacteria | 1061 |
| 985 | Ga0496124_0350205 | 3300048927 | Bacteria | 1045 |
| 986 | Ga0496124_0364466 | 3300048927 | Bacteria | 1017 |
| 987 | Ga0496125_0000090 | 3300048928 | Bacteria | 214433 |
| 988 | Ga0496125_0006401 | 3300048928 | Bacteria | 12754 |
| 989 | Ga0496125_0006952 | 3300048928 | Bacteria | 12116 |
| 990 | Ga0496125_0066369 | 3300048928 | Bacteria | 2852 |
| 991 | Ga0496125_0158183 | 3300048928 | Bacteria | 1544 |
| 992 | Ga0496126_0004395 | 3300048929 | Bacteria | 16896 |
| 993 | Ga0496126_0010244 | 3300048929 | Bacteria | 9854 |
| 994 | Ga0496126_0011274 | 3300048929 | Bacteria | 9274 |
| 995 | Ga0496126_0161727 | 3300048929 | Bacteria | 1913 |
| 996 | Ga0496126_0200250 | 3300048929 | Bacteria | 1687 |
| 997 | Ga0496126_0266763 | 3300048929 | Bacteria | 1422 |
| 998 | Ga0496126_0299072 | 3300048929 | Bacteria | 1328 |
| 999 | Ga0496126_0866858 | 3300048929 | Bacteria | 687 |
| 1000 | Ga0495682_0011145 | 3300049460 | Bacteria | 3464 |
| 1001 | Ga0495682_0172159 | 3300049460 | Bacteria | 770 |
| 1002 | Ga0501031_0016771 | 3300049568 | Bacteria | 4758 |
| 1003 | Ga0501032_0027553 | 3300049569 | Bacteria | 3904 |
| 1004 | Ga0501033_0001708 | 3300049570 | Bacteria | 19234 |
| 1005 | Ga0501033_0035762 | 3300049570 | Bacteria | 3723 |
| 1006 | Ga0501034_0056288 | 3300049571 | Bacteria | 3957 |
| 1007 | Ga0501036_0073804 | 3300049572 | Bacteria | 2884 |
| 1008 | Ga0501036_0144187 | 3300049572 | Bacteria | 2009 |
| 1009 | Ga0501036_0341389 | 3300049572 | Bacteria | 1251 |
| 1010 | Ga0501037_0001314 | 3300049573 | Bacteria | 18266 |
| 1011 | Ga0501039_0045504 | 3300049575 | Bacteria | 3391 |
| 1012 | Ga0501039_0175004 | 3300049575 | Bacteria | 1688 |
| 1013 | Ga0501042_0382198 | 3300049578 | Bacteria | 1019 |
| 1014 | Ga0501043_0000760 | 3300049579 | Bacteria | 28666 |
| 1015 | Ga0501043_0111743 | 3300049579 | Bacteria | 2145 |
| 1016 | Ga0501043_0736004 | 3300049579 | Bacteria | 718 |
| 1017 | Ga0501046_0092217 | 3300049580 | Bacteria | 2329 |
| 1018 | Ga0501046_0427739 | 3300049580 | Bacteria | 954 |
| 1019 | Ga0501047_0484827 | 3300049581 | Bacteria | 1064 |
| 1020 | Ga0501068_0269675 | 3300049584 | Bacteria | 1087 |
| 1021 | Ga0501070_0114195 | 3300049586 | Bacteria | 2231 |
| 1022 | Ga0501070_0321845 | 3300049586 | Bacteria | 1258 |
| 1023 | Ga0501073_0601455 | 3300049589 | Bacteria | 759 |
| 1024 | Ga0501075_0090248 | 3300049591 | Bacteria | 2325 |
| 1025 | Ga0501076_0017649 | 3300049592 | Bacteria | 5426 |
| 1026 | Ga0501076_0286797 | 3300049592 | Bacteria | 1349 |
| 1027 | Ga0501076_0361686 | 3300049592 | Bacteria | 1192 |
| 1028 | Ga0501076_0415986 | 3300049592 | Bacteria | 1106 |
| 1029 | Ga0501077_0024157 | 3300049593 | Bacteria | 3858 |
| 1030 | Ga0501077_0102836 | 3300049593 | Bacteria | 1810 |
| 1031 | Ga0501077_0294990 | 3300049593 | Bacteria | 1033 |
| 1032 | Ga0501249_000918 | 3300049679 | Bacteria | 6460 |
| 1033 | Ga0501257_072402 | 3300049686 | Bacteria | 882 |
| 1034 | Ga0501080_0646660 | 3300049742 | Unclassified | 936 |
| 1035 | Ga0501081_0084045 | 3300049743 | Bacteria | 2232 |
| 1036 | Ga0501081_0156475 | 3300049743 | Bacteria | 1640 |
| 1037 | Ga0501081_0421331 | 3300049743 | Bacteria | 990 |
| 1038 | Ga0501081_0542734 | 3300049743 | Bacteria | 868 |
| 1039 | Ga0501081_0560100 | 3300049743 | Bacteria | 854 |
| 1040 | Ga0501262_000119 | 3300049759 | Bacteria | 9781 |
| 1041 | Ga0501035_0043760 | 3300049822 | Bacteria | 4034 |
| 1042 | Ga0501035_0331617 | 3300049822 | Bacteria | 1276 |
| 1043 | Ga0501044_0034344 | 3300049823 | Bacteria | 5318 |
| 1044 | Ga0501044_0054261 | 3300049823 | Bacteria | 4121 |
| 1045 | Ga0501045_0084276 | 3300049824 | Bacteria | 2345 |
| 1046 | Ga0501045_0707362 | 3300049824 | Bacteria | 743 |
| 1047 | nmdc:mga03683_24020_c1 | 3300050489 | Bacteria | 2381 |
| 1048 | nmdc:mga03683_4079_c1 | 3300050489 | Bacteria | 4796 |
| 1049 | nmdc:mga03n38_432078_c1 | 3300050490 | Bacteria | 730 |
| 1050 | nmdc:mga00v17_67117_c1 | 3300050491 | Bacteria | 2216 |
| 1051 | nmdc:mga0yw44_114147_c1 | 3300050492 | Bacteria | 1733 |
| 1052 | nmdc:mga0yw44_19546_c1 | 3300050492 | Bacteria | 3738 |
| 1053 | nmdc:mga0k408_147970_c1 | 3300050493 | Bacteria | 1398 |
| 1054 | nmdc:mga0k408_183041_c1 | 3300050493 | Bacteria | 1250 |
| 1055 | nmdc:mga0k408_69404_c1 | 3300050493 | Bacteria | 2056 |
| 1056 | nmdc:mga06z11_4403_c1 | 3300050494 | Bacteria | 5545 |
| 1057 | nmdc:mga06z11_85286_c1 | 3300050494 | Bacteria | 1703 |
| 1058 | nmdc:mga04h51_13270_c1 | 3300050495 | Bacteria | 2330 |
| 1059 | nmdc:mga04h51_8875_c1 | 3300050495 | Bacteria | 2704 |
| 1060 | nmdc:mga07m45_176271_c1 | 3300050496 | Bacteria | 1243 |
| 1061 | nmdc:mga07m45_3642_c1 | 3300050496 | Bacteria | 7442 |
| 1062 | nmdc:mga07m45_37362_c2 | 3300050496 | Bacteria | 2472 |
| 1063 | nmdc:mga07m45_8596_c1 | 3300050496 | Bacteria | 5258 |
| 1064 | nmdc:mga05p37_644744_c1 | 3300050507 | Bacteria | 1187 |
| 1065 | nmdc:mga0qj67_476_c1 | 3300050509 | Bacteria | 27363 |
| 1066 | nmdc:mga06r32_3555_c1 | 3300050510 | Bacteria | 13921 |
| 1067 | nmdc:mga06r32_556679_c1 | 3300050510 | Bacteria | 1120 |
| 1068 | nmdc:mga08y16_399195_c1 | 3300050511 | Bacteria | 1407 |
| 1069 | nmdc:mga0n895_175299_c1 | 3300050512 | Bacteria | 2175 |
| 1070 | nmdc:mga0n895_282037_c1 | 3300050512 | Bacteria | 1685 |
| 1071 | nmdc:mga0rr50_218219_c1 | 3300050513 | Bacteria | 1574 |
| 1072 | nmdc:mga0rr50_590287_c1 | 3300050513 | Bacteria | 947 |
| 1073 | nmdc:mga0rr50_635335_c1 | 3300050513 | Bacteria | 911 |
| 1074 | nmdc:mga0rr50_949088_c1 | 3300050513 | Bacteria | 733 |
| 1075 | nmdc:mga08x19_145077_c1 | 3300050514 | Bacteria | 1605 |
| 1076 | nmdc:mga08x19_5793_c1 | 3300050514 | Bacteria | 7305 |
| 1077 | nmdc:mga0a205_152814_c1 | 3300050515 | Bacteria | 2207 |
| 1078 | nmdc:mga0sz30_74013_c1 | 3300050516 | Bacteria | 1469 |
| 1079 | Ga0495601_0017549 | 3300053077 | Bacteria | 4346 |
| 1080 | Ga0495601_0090553 | 3300053077 | Bacteria | 1968 |
| 1081 | Ga0495612_0034172 | 3300053078 | Bacteria | 2058 |
| 1082 | Ga0495612_0201248 | 3300053078 | Bacteria | 879 |
| 1083 | Ga0500610_0012735 | 3300053079 | Bacteria | 3886 |
| 1084 | Ga0500610_0044586 | 3300053079 | Bacteria | 2300 |
| 1085 | Ga0500610_0072327 | 3300053079 | Bacteria | 1798 |
| 1086 | Ga0500635_0000249 | 3300053080 | Bacteria | 23486 |
| 1087 | Ga0500635_0092243 | 3300053080 | Bacteria | 1103 |
| 1088 | Ga0495595_0260186 | 3300053084 | Bacteria | 869 |
| 1089 | Ga0495619_0056741 | 3300053085 | Bacteria | 2597 |
| 1090 | Ga0495619_0322387 | 3300053085 | Bacteria | 1069 |
| 1091 | Ga0495619_0463748 | 3300053085 | Bacteria | 873 |
| 1092 | Ga0500578_0157611 | 3300053086 | Bacteria | 1411 |
| 1093 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1094 | Ga0500643_000169 | 3300053087 | Bacteria | 64699 |
| 1095 | Ga0500643_019339 | 3300053087 | Bacteria | 2243 |
| 1096 | Ga0500647_0103704 | 3300053091 | Bacteria | 1357 |
| 1097 | Ga0500647_0115227 | 3300053091 | Bacteria | 1275 |
| 1098 | Ga0500651_0000095 | 3300053093 | Bacteria | 54857 |
| 1099 | Ga0500566_0000082 | 3300053094 | Bacteria | 47150 |
| 1100 | Ga0500566_0000536 | 3300053094 | Bacteria | 21299 |
| 1101 | Ga0500566_0110117 | 3300053094 | Bacteria | 1498 |
| 1102 | Ga0500566_0135996 | 3300053094 | Bacteria | 1309 |
| 1103 | Ga0500640_005617 | 3300053095 | Bacteria | 4702 |
| 1104 | Ga0500554_045377 | 3300053102 | Bacteria | 1365 |
| 1105 | Ga0500555_011988 | 3300053103 | Bacteria | 2490 |
| 1106 | Ga0500555_014312 | 3300053103 | Bacteria | 2286 |
| 1107 | Ga0500556_0065680 | 3300053104 | Bacteria | 1346 |
| 1108 | Ga0500557_000015 | 3300053105 | Bacteria | 106282 |
| 1109 | Ga0500562_016628 | 3300053108 | Bacteria | 1892 |
| 1110 | Ga0500562_018462 | 3300053108 | Bacteria | 1801 |
| 1111 | Ga0500569_019624 | 3300053109 | Bacteria | 1762 |
| 1112 | Ga0500571_000379 | 3300053110 | Bacteria | 17609 |
| 1113 | Ga0500572_000291 | 3300053111 | Bacteria | 18086 |
| 1114 | Ga0500572_013990 | 3300053111 | Bacteria | 1997 |
| 1115 | Ga0500572_033191 | 3300053111 | Bacteria | 1454 |
| 1116 | Ga0500591_043308 | 3300053115 | Bacteria | 2134 |
| 1117 | Ga0500593_001477 | 3300053117 | Bacteria | 8448 |
| 1118 | Ga0500595_019509 | 3300053119 | Bacteria | 2459 |
| 1119 | Ga0500595_022557 | 3300053119 | Bacteria | 2226 |
| 1120 | Ga0500597_023797 | 3300053120 | Bacteria | 2452 |
| 1121 | Ga0500607_078703 | 3300053121 | Bacteria | 1685 |
| 1122 | Ga0500608_000290 | 3300053122 | Bacteria | 19514 |
| 1123 | Ga0500608_008878 | 3300053122 | Bacteria | 4246 |
| 1124 | Ga0500614_000882 | 3300053123 | Bacteria | 7578 |
| 1125 | Ga0500618_003090 | 3300053125 | Bacteria | 5889 |
| 1126 | Ga0500618_012045 | 3300053125 | Bacteria | 2275 |
| 1127 | Ga0500618_020009 | 3300053125 | Bacteria | 1643 |
| 1128 | Ga0500621_238276 | 3300053126 | Bacteria | 619 |
| 1129 | Ga0500642_0000166 | 3300053130 | Bacteria | 27296 |
| 1130 | Ga0500642_0088967 | 3300053130 | Bacteria | 1425 |
| 1131 | Ga0500655_009192 | 3300053133 | Bacteria | 1778 |
| 1132 | Ga0500658_0000763 | 3300053134 | Bacteria | 13270 |
| 1133 | Ga0500658_0000783 | 3300053134 | Bacteria | 13145 |
| 1134 | Ga0500559_0000323 | 3300053136 | Bacteria | 36225 |
| 1135 | Ga0500559_0001387 | 3300053136 | Bacteria | 13795 |
| 1136 | Ga0500559_0015366 | 3300053136 | Bacteria | 3232 |
| 1137 | Ga0500564_027527 | 3300053138 | Bacteria | 2616 |
| 1138 | Ga0500568_0004399 | 3300053139 | Bacteria | 7538 |
| 1139 | Ga0500568_0028635 | 3300053139 | Bacteria | 2321 |
| 1140 | Ga0500568_0066645 | 3300053139 | Bacteria | 1384 |
| 1141 | Ga0500574_015820 | 3300053141 | Bacteria | 1810 |
| 1142 | Ga0500588_0126618 | 3300053146 | Bacteria | 906 |
| 1143 | Ga0500590_060305 | 3300053148 | Bacteria | 1908 |
| 1144 | Ga0500603_000122 | 3300053150 | Bacteria | 18283 |
| 1145 | Ga0500603_085817 | 3300053150 | Bacteria | 918 |
| 1146 | Ga0500616_0048633 | 3300053153 | Bacteria | 2247 |
| 1147 | Ga0500619_022128 | 3300053154 | Bacteria | 1842 |
| 1148 | Ga0500620_021405 | 3300053155 | Bacteria | 1932 |
| 1149 | Ga0500622_0001660 | 3300053156 | Bacteria | 17388 |
| 1150 | Ga0500622_0021694 | 3300053156 | Bacteria | 3407 |
| 1151 | Ga0500624_003999 | 3300053157 | Bacteria | 1933 |
| 1152 | Ga0500627_0026770 | 3300053158 | Bacteria | 2384 |
| 1153 | Ga0500630_007401 | 3300053159 | Bacteria | 5384 |
| 1154 | Ga0500634_0003453 | 3300053161 | Bacteria | 7028 |
| 1155 | Ga0500634_0039731 | 3300053161 | Bacteria | 2558 |
| 1156 | Ga0500638_004133 | 3300053162 | Bacteria | 5527 |
| 1157 | Ga0500638_050545 | 3300053162 | Bacteria | 2010 |
| 1158 | Ga0500638_077323 | 3300053162 | Bacteria | 1584 |
| 1159 | Ga0500638_163515 | 3300053162 | Bacteria | 977 |
| 1160 | Ga0500638_192867 | 3300053162 | Bacteria | 868 |
| 1161 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 1162 | Ga0500639_022629 | 3300053163 | Bacteria | 3320 |
| 1163 | Ga0500639_125960 | 3300053163 | Bacteria | 1222 |
| 1164 | Ga0500636_0037880 | 3300053177 | Bacteria | 2852 |
| 1165 | Ga0500636_0066749 | 3300053177 | Bacteria | 2091 |
| 1166 | Ga0500636_0067042 | 3300053177 | Bacteria | 2085 |
| 1167 | Ga0500636_0071217 | 3300053177 | Bacteria | 2016 |
| 1168 | Ga0500636_0076099 | 3300053177 | Bacteria | 1941 |
| 1169 | Ga0500637_0013284 | 3300053178 | Bacteria | 4314 |
| 1170 | Ga0500637_0179154 | 3300053178 | Bacteria | 1215 |
| 1171 | Ga0500637_0253446 | 3300053178 | Bacteria | 980 |
| 1172 | Ga0500576_042002 | 3300053725 | Bacteria | 2055 |
| 1173 | Ga0500576_151207 | 3300053725 | Bacteria | 867 |
| 1174 | Ga0500625_014727 | 3300053729 | Bacteria | 3617 |
| 1175 | Ga0500625_115951 | 3300053729 | Bacteria | 1088 |
| 1176 | Ga0500625_134774 | 3300053729 | Bacteria | 963 |
| 1177 | Ga0500645_015438 | 3300053730 | Bacteria | 2419 |
| 1178 | Ga0500609_034473 | 3300053731 | Bacteria | 697 |
| 1179 | Ga0500596_002414 | 3300053735 | Bacteria | 3683 |
| 1180 | Ga0500599_005969 | 3300053736 | Bacteria | 1543 |
| 1181 | Ga0500601_000032 | 3300053737 | Bacteria | 31109 |
| 1182 | Ga0501084_0253849 | 3300054114 | Bacteria | 1484 |
| 1183 | Ga0501082_0118989 | 3300060353 | Bacteria | 2289 |
| 1184 | Ga0501082_0136512 | 3300060353 | Bacteria | 2128 |
| 1185 | Ga0501082_0242661 | 3300060353 | Bacteria | 1568 |
| 1186 | Ga0530510_0010491 | 3300061734 | Bacteria | 6496 |
| 1187 | 2507508575 | 2507262055 | Bacteria | 8048963 |
| 1188 | 2508542651 | 2508501009 | Bacteria | 7784016 |
| 1189 | 2508691573 | 2508501042 | Bacteria | 8719808 |
| 1190 | 2509150894 | 2508501128 | Bacteria | 8613869 |
| 1191 | 2513229094 | 2513020051 | Bacteria | 6053213 |
| 1192 | 2513623040 | 2513237092 | Bacteria | 8341956 |
| 1193 | 2513638970 | 2513237094 | Bacteria | 8789602 |
| 1194 | 2513654732 | 2513237096 | Bacteria | 8722461 |
| 1195 | 2513722356 | 2513237104 | Bacteria | 10034502 |
| 1196 | 2513855846 | 2513237137 | Bacteria | 9558895 |
| 1197 | 2513872776 | 2513237139 | Bacteria | 8737671 |
| 1198 | 2513889135 | 2513237141 | Bacteria | 8496279 |
| 1199 | 2513915088 | 2513237145 | Bacteria | 8979722 |
| 1200 | 2514011848 | 2513237161 | Bacteria | 8871253 |
| 1201 | 2517106762 | 2517093001 | Bacteria | 9002274 |
| 1202 | 2517892383 | 2517572143 | Bacteria | 9484767 |
| 1203 | 2524443125 | 2524023205 | Bacteria | 8918781 |
| 1204 | 2524468897 | 2524023210 | Bacteria | 9029266 |
| 1205 | 2524538523 | 2524023228 | Bacteria | 10118060 |
| 1206 | 2585277017 | 2582581308 | Bacteria | 7413247 |
| 1207 | 2585333627 | 2582581316 | Bacteria | 7774528 |
| 1208 | 2585537028 | 2585427527 | Bacteria | 7273426 |
| 1209 | 2585551879 | 2585427530 | Bacteria | 7383882 |
| 1210 | 2616308391 | 2615840626 | Bacteria | 7921970 |
| 1211 | 2617349025 | 2617270735 | Bacteria | 9163226 |
| 1212 | 2617375770 | 2617270741 | Bacteria | 8201522 |
| 1213 | 2644288713 | 2643221651 | Bacteria | 4798932 |
| 1214 | 2644329178 | 2643221658 | Bacteria | 6064537 |
| 1215 | 2644401729 | 2643221672 | Bacteria | 6322190 |
| 1216 | 2728751171 | 2728368998 | Bacteria | 8720350 |
| 1217 | 2738717321 | 2738541277 | Bacteria | 7458140 |
| 1218 | 2738878896 | 2738541307 | Bacteria | 8606193 |
| 1219 | 2739278007 | 2738543019 | Bacteria | 7459457 |
| 1220 | 2793062388 | 2791355196 | Bacteria | 7323613 |
| 1221 | 2805915326 | 2802429603 | Bacteria | 8777136 |
| 1222 | 2818238879 | 2816332527 | Bacteria | 8933356 |
| 1223 | 2819638093 | 2818991453 | Bacteria | 7181617 |
| 1224 | 2824605755 | 2824600985 | Bacteria | 8488197 |
| 1225 | 2824614448 | 2824609381 | Bacteria | 8672835 |
| 1226 | 2824623244 | 2824617872 | Bacteria | 8814715 |
| 1227 | 2824633172 | 2824626560 | Bacteria | 8813858 |
| 1228 | 2824640009 | 2824635225 | Bacteria | 8785348 |
| 1229 | 2824650220 | 2824644064 | Bacteria | 8743947 |
| 1230 | 2824657739 | 2824653114 | Bacteria | 8493680 |
| 1231 | 2824677389 | 2824671348 | Bacteria | 8369588 |
| 1232 | 2824685255 | 2824679649 | Bacteria | 8248951 |
| 1233 | 2824693051 | 2824687955 | Bacteria | 8360029 |
| 1234 | 2824700748 | 2824696289 | Bacteria | 8335049 |
| 1235 | 2824711347 | 2824704595 | Bacteria | 9667483 |
| 1236 | 2824719494 | 2824714736 | Bacteria | 8717648 |
| 1237 | 2824729948 | 2824723954 | Bacteria | 8758240 |
| 1238 | 2824738043 | 2824732956 | Bacteria | 7810675 |
| 1239 | 2824749286 | 2824746037 | Bacteria | 7911610 |
| 1240 | 2824758206 | 2824753945 | Bacteria | 9787441 |
| 1241 | 2824768187 | 2824763712 | Bacteria | 9792355 |
| 1242 | 2824779550 | 2824773399 | Bacteria | 8360218 |
| 1243 | 2838060812 | 2838054893 | Bacteria | 7451788 |
| 1244 | 2838123744 | 2838122688 | Bacteria | 8803140 |
| 1245 | 2841914651 | 2841911363 | Bacteria | 6173697 |
| 1246 | 2841920184 | 2841917233 | Bacteria | 6173500 |
| 1247 | 2841948647 | 2841941048 | Bacteria | 8688029 |
| 1248 | 2841949845 | 2841949485 | Bacteria | 8680857 |
| 1249 | 2841958671 | 2841957949 | Bacteria | 8652217 |
| 1250 | 2841966263 | 2841966195 | Bacteria | 8673214 |
| 1251 | 2841975000 | 2841974524 | Bacteria | 8931498 |
| 1252 | 2841983432 | 2841983080 | Bacteria | 8395090 |
| 1253 | 2842039061 | 2842038055 | Bacteria | 8002051 |
| 1254 | 2842042949 | 2842038055 | Bacteria | 8002051 |
| 1255 | 2842047992 | 2842045827 | Bacteria | 8006841 |
| 1256 | 2842050990 | 2842045827 | Bacteria | 8006841 |
| 1257 | 2844319100 | 2844315083 | Bacteria | 8138177 |
| 1258 | 2847936214 | 2847930680 | Bacteria | 9342022 |
| 1259 | 2847946574 | 2847939898 | Bacteria | 8606328 |
| 1260 | 2849079302 | 2849076700 | Bacteria | 7039503 |
| 1261 | 2857514306 | 2857509624 | Bacteria | 7472071 |
| 1262 | 2874598052 | 2874590934 | Bacteria | 8299676 |
| 1263 | 2874615417 | 2874612657 | Bacteria | 8252029 |
| 1264 | 2874627823 | 2874620515 | Bacteria | 8290088 |
| 1265 | 2874647502 | 2874645413 | Bacteria | 8214782 |
| 1266 | 2876778470 | 2876771140 | Bacteria | 8287509 |
| 1267 | 2876811137 | 2876808645 | Bacteria | 8824342 |
| 1268 | 2876820416 | 2876818435 | Bacteria | 8274608 |
| 1269 | 2879082264 | 2879074833 | Bacteria | 8279565 |
| 1270 | 2879083711 | 2879083081 | Bacteria | 8587928 |
| 1271 | 2879111175 | 2879110137 | Bacteria | 8907982 |
| 1272 | 2879135411 | 2879127579 | Bacteria | 8294491 |
| 1273 | 2879150619 | 2879142872 | Bacteria | 8267021 |
| 1274 | 2881368828 | 2881364244 | Bacteria | 7710352 |
| 1275 | 2881671176 | 2881665667 | Bacteria | 8175609 |
| 1276 | 2885203550 | 2885198086 | Bacteria | 7212419 |
| 1277 | 2885217100 | 2885211737 | Bacteria | 7212420 |
| 1278 | 2885373163 | 2885366525 | Bacteria | 8326213 |
| 1279 | 2885410440 | 2885409591 | Bacteria | 9235467 |
| 1280 | 2888424537 | 2888419890 | Bacteria | 7857137 |
| 1281 | 2889039849 | 2889033259 | Bacteria | 9099371 |
| 1282 | 2903728976 | 2903727486 | Bacteria | 8281579 |
| 1283 | 2904450587 | 2904449895 | Bacteria | 6927402 |
| 1284 | 2904456591 | 2904456579 | Bacteria | 6819253 |
| 1285 | 2904549987 | 2904541872 | Bacteria | 8915136 |
| 1286 | 2904672857 | 2904666416 | Bacteria | 8226587 |
| 1287 | 2904703448 | |||
| 1288 | 2904714629 | 2904711408 | Bacteria | 9771557 |
| 1289 | 2906607109 | 2906602504 | Bacteria | 8295279 |
| 1290 | 2906633275 | 2906626472 | Bacteria | 8826946 |
| 1291 | 2906638920 | 2906635258 | Bacteria | 8601019 |
| 1292 | 2906651452 | 2906643746 | Bacteria | 8722424 |
| 1293 | 2906666363 | 2906660503 | Bacteria | 8595048 |
| 1294 | 2908780175 | 2908775508 | Bacteria | 8092255 |
| 1295 | 2919409847 | 2919408235 | Bacteria | 6149349 |
| 1296 | 2919462880 | 2919462493 | Bacteria | 5817112 |
| 1297 | 2919678807 | 2919675420 | Bacteria | 3969095 |
| 1298 | 2922365346 | 2922361189 | Bacteria | 7436256 |
| 1299 | 2922374400 | |||
| 1300 | 2922393950 | 2922393267 | Bacteria | 8285685 |
| 1301 | 2922396234 | 2922393267 | Bacteria | 8285685 |
| 1302 | 2928089028 | 2928084124 | Bacteria | 7159212 |
| 1303 | 2928117863 | 2928115317 | Bacteria | 6477646 |
| 1304 | 2929164875 | 2929160207 | Bacteria | 9075316 |
| 1305 | 2929521303 | 2929520902 | Bacteria | 6765052 |
| 1306 | 2932797462 | 2932794094 | Bacteria | 7915132 |
| 1307 | 2932802783 | 2932801729 | Bacteria | 7987968 |
| 1308 | 2935608890 | 2935608549 | Bacteria | 8203142 |
| 1309 | 2935650056 | 2935648319 | Bacteria | 8801166 |
| 1310 | 2935661792 | 2935656913 | Bacteria | 8965014 |
| 1311 | 2935773302 | 2935769743 | Bacteria | 7878163 |
| 1312 | 2935778543 | 2935777560 | Bacteria | 8077691 |
| 1313 | 2935792744 | 2935785616 | Bacteria | 7962367 |
| 1314 | 2935800771 | 2935793552 | Bacteria | 8012592 |
| 1315 | 2935822050 | 2935819856 | Bacteria | 8261050 |
| 1316 | 2935847632 | 2935847175 | Bacteria | 8228321 |
| 1317 | 2935889877 | 2935883170 | Bacteria | 7964738 |
| 1318 | 2935909097 | 2935908558 | Bacteria | 8568796 |
| 1319 | 2935919818 | 2935916978 | Bacteria | 9113783 |
| 1320 | 2935926329 | 2935926038 | Bacteria | 8601059 |
| 1321 | 2935934779 | 2935934488 | Bacteria | 8602579 |
| 1322 | 2935943229 | 2935942939 | Bacteria | 8599779 |
| 1323 | 2935951667 | 2935951376 | Bacteria | 8602333 |
| 1324 | 2935965839 | 2935959822 | Bacteria | 7869783 |
| 1325 | 2935967792 | 2935967501 | Bacteria | 8603075 |
| 1326 | 2935982666 | 2935975950 | Bacteria | 8347125 |
| 1327 | 2935988160 | 2935984226 | Bacteria | 8302647 |
| 1328 | 2936012460 | 2936011229 | Bacteria | 8801034 |
| 1329 | 2936021025 | 2936019824 | Bacteria | 8804134 |
| 1330 | 2936029753 | 2936028420 | Bacteria | 8965941 |
| 1331 | 2936047218 | 2936046547 | Bacteria | 8903709 |
| 1332 | 2936057623 | 2936055302 | Bacteria | 8785755 |
| 1333 | 2941532821 | 2941531003 | Bacteria | 7653939 |
| 1334 | 2945913744 | 2945909444 | Bacteria | 7065066 |
| 1335 | 2945949320 | 2945945610 | Bacteria | 5951079 |
| 1336 | 2945973368 | 2945972063 | Bacteria | 6086495 |
| 1337 | 2945990863 | 2945984333 | Bacteria | 7358892 |
| 1338 | 2954771043 | 2954767861 | Bacteria | 5535784 |
| 1339 | 3005592646 | 3005587118 | Bacteria | 7794411 |
| 1340 | 3005599241 | 3005594810 | Bacteria | 8716512 |
| 1341 | 3005714917 | 3005710791 | Bacteria | 7622528 |
| 1342 | 3005722332 | 3005718088 | Bacteria | 8283608 |
| 1343 | 8006940665 | 8006933436 | Bacteria | 10410654 |
| 1344 | 8006980355 | 8006973647 | Bacteria | 10679141 |
| 1345 | 8016529607 | 8016522445 | Bacteria | 8156687 |
| 1346 | 8016534822 | 8016530956 | Bacteria | 8155261 |
| 1347 | 8016548035 | 8016539877 | Bacteria | 8155419 |
| 1348 | 8016554092 | 8016548790 | Bacteria | 8155074 |
| 1349 | 8016591748 | 8016583857 | Bacteria | 10421953 |
| 1350 | 8016600262 | 8016595262 | Bacteria | 8149947 |
| 1351 | 8016610487 | 8016603502 | Bacteria | 8731218 |
| 1352 | 8016614448 | 8016613128 | Bacteria | 8794220 |
| 1353 | 8016626549 | 8016622563 | Bacteria | 7999408 |
| 1354 | 8016640331 | 8016630954 | Bacteria | 9217207 |
| 1355 | 8019534588 | 8019530166 | Bacteria | 8155624 |
| 1356 | 8019544884 | 8019538911 | Bacteria | 7872763 |
| 1357 | 8019553650 | 8019547302 | Bacteria | 7996444 |
| 1358 | 8019628164 | 8019619141 | Bacteria | 9218857 |
| 1359 | 8019634451 | 8019629233 | Bacteria | 8687553 |
| 1360 | 8019645278 | 8019638758 | Bacteria | 9062356 |
| 1361 | 8019658408 | 8019648815 | Bacteria | 10014479 |
| 1362 | 8019662342 | 8019659431 | Bacteria | 8577854 |
| 1363 | 8019671844 | 8019668869 | Bacteria | 8791617 |
| 1364 | 8019690084 | 8019687851 | Bacteria | 8712826 |
| 1365 | 8056686670 | 8056681323 | Bacteria | 8472857 |
| 1366 | 8056968048 | 8056967851 | Bacteria | 9038162 |
| 1367 | Ga0496101_0273333 | |||
| 1368 | JGI24740J21852_10026939 | |||
| 1369 | JGI24739J22299_10030477 | |||
| 1370 | JGI25162J39368_1000577 | |||
| 1371 | JGI25162J39368_1001401 | |||
| 1372 | JGI25162J39368_1001515 | |||
| 1373 | JGI25158J39367_1006561 | |||
| 1374 | JGI25152J39213_1028894 | |||
| 1375 | JGI25159J45721_1029267 | |||
| 1376 | JGI25151J46595_10001814 | |||
| 1377 | JGI25151J46595_10003602 | |||
| 1378 | JGI25406J46586_10000104 | |||
| 1379 | JGI25165J46597_1000654 | |||
| 1380 | JGI25165J46597_1001229 | |||
| 1381 | JGI25165J46597_1005089 | |||
| 1382 | JGI25153J46596_10000022 | |||
| 1383 | JGI25153J46596_10000531 | |||
| 1384 | rootH1_10106416 | |||
| 1385 | JGI25160J50197_1004582 | |||
| 1386 | JGI25160J50197_1006303 | |||
| 1387 | JGI25161J50226_1008089 | |||
| 1388 | Ga0006562J51391_1096725 | |||
| 1389 | Ga0006562J51391_1096726 | |||
| 1390 | Ga0055526_1021043 | |||
| 1391 | Ga0055537_1000134 | |||
| 1392 | Ga0055524_1019623 | |||
| 1393 | Ga0055536_1003710 | |||
| 1394 | Ga0055536_1005818 | |||
| 1395 | Ga0055534_1000088 | |||
| 1396 | Ga0055534_1015173 | |||
| 1397 | Ga0055528_1000493 | |||
| 1398 | Ga0055530_10000495 | |||
| 1399 | Ga0055540_1001986 | |||
| 1400 | Ga0055540_1002205 | |||
| 1401 | Ga0055540_1004978 | |||
| 1402 | Ga0055540_1038840 | |||
| 1403 | Ga0055531_10002338 | |||
| 1404 | Ga0055531_10003743 | |||
| 1405 | Ga0055543_1005204 | |||
| 1406 | Ga0055543_1009121 | |||
| 1407 | Ga0065165_1000780 | |||
| 1408 | Ga0065165_1000826 | |||
| 1409 | Ga0065165_1018204 | |||
| 1410 | Ga0065165_1048388 | |||
| 1411 | Ga0070658_10790892 | |||
| 1412 | Ga0070658_10995982 | |||
| 1413 | Ga0070676_10754911 | |||
| 1414 | Ga0070683_100060557 | |||
| 1415 | Ga0070670_100272808 | |||
| 1416 | Ga0070680_100043111 | |||
| 1417 | Ga0070680_100055517 | |||
| 1418 | Ga0070680_100506005 | |||
| 1419 | Ga0070682_100404603 | |||
| 1420 | Ga0070682_100537566 | |||
| 1421 | Ga0068868_100631688 | |||
| 1422 | Ga0068868_100890642 | |||
| 1423 | Ga0070660_100088577 | |||
| 1424 | Ga0070691_10028452 | |||
| 1425 | Ga0070691_10132829 | |||
| 1426 | Ga0070687_100093724 | |||
| 1427 | Ga0070661_100043450 | |||
| 1428 | Ga0070661_100141174 | |||
| 1429 | Ga0070692_10254507 | |||
| 1430 | Ga0070668_100035983 | |||
| 1431 | Ga0070668_100050905 | |||
| 1432 | Ga0070668_100069611 | |||
| 1433 | Ga0070668_100214967 | |||
| 1434 | Ga0070668_100752685 | |||
| 1435 | Ga0070669_100163351 | |||
| 1436 | Ga0070669_100453835 | |||
| 1437 | Ga0070669_100593283 | |||
| 1438 | Ga0070675_100574806 | |||
| 1439 | Ga0070671_100011820 | |||
| 1440 | Ga0070671_100199501 | |||
| 1441 | Ga0070674_100301223 | |||
| 1442 | Ga0070673_100126972 | |||
| 1443 | Ga0070688_100256917 | |||
| 1444 | Ga0070659_100155671 | |||
| 1445 | Ga0070659_100194377 | |||
| 1446 | Ga0070667_100100625 | |||
| 1447 | Ga0070667_100209805 | |||
| 1448 | Ga0070667_100472534 | |||
| 1449 | Ga0070667_100619121 | |||
| 1450 | Ga0070667_101034694 | |||
| 1451 | Ga0070703_10013557 | |||
| 1452 | Ga0070703_10089962 | |||
| 1453 | Ga0070714_100140826 | |||
| 1454 | Ga0070713_100299529 | |||
| 1455 | Ga0070713_100319379 | |||
| 1456 | Ga0070710_10210652 | |||
| 1457 | Ga0070710_10490937 | |||
| 1458 | Ga0070701_10138179 | |||
| 1459 | Ga0070701_10138929 | |||
| 1460 | Ga0070701_10339768 | |||
| 1461 | Ga0070711_100567895 | |||
| 1462 | Ga0070711_100874750 | |||
| 1463 | Ga0070705_100000144 | |||
| 1464 | Ga0070705_100089856 | |||
| 1465 | Ga0070705_100122839 | |||
| 1466 | Ga0070705_100205007 | |||
| 1467 | Ga0070700_100006214 | |||
| 1468 | Ga0070694_100001328 | |||
| 1469 | Ga0070694_100086792 | |||
| 1470 | Ga0070694_100234679 | |||
| 1471 | Ga0070694_100643394 | |||
| 1472 | Ga0070708_100004216 | |||
| 1473 | Ga0070663_100153516 | |||
| 1474 | Ga0070663_100157236 | |||
| 1475 | Ga0070663_100238111 | |||
| 1476 | Ga0070678_100015254 | |||
| 1477 | Ga0070678_100093738 | |||
| 1478 | Ga0070678_100322009 | |||
| 1479 | Ga0070678_100884574 | |||
| 1480 | Ga0070662_100007222 | |||
| 1481 | Ga0070662_100176306 | |||
| 1482 | Ga0070662_100218509 | |||
| 1483 | Ga0070662_100639093 | |||
| 1484 | Ga0070681_10036878 | |||
| 1485 | Ga0070681_10885766 | |||
| 1486 | Ga0068867_100147402 | |||
| 1487 | Ga0068867_100902520 | |||
| 1488 | Ga0070698_101134818 | |||
| 1489 | Ga0070699_100006781 | |||
| 1490 | Ga0070679_100214536 | |||
| 1491 | Ga0070684_100032782 | |||
| 1492 | Ga0070684_100281542 | |||
| 1493 | Ga0070697_100009721 | |||
| 1494 | Ga0070697_100085543 | |||
| 1495 | Ga0070697_100321850 | |||
| 1496 | Ga0068853_100022177 | |||
| 1497 | Ga0068853_100095568 | |||
| 1498 | Ga0068853_100303162 | |||
| 1499 | Ga0068853_100397131 | |||
| 1500 | Ga0068853_101554697 | |||
| 1501 | Ga0070672_100194303 | |||
| 1502 | Ga0070686_100000034 | |||
| 1503 | Ga0070686_100101148 | |||
| 1504 | Ga0070695_100000788 | |||
| 1505 | Ga0070695_100058879 | |||
| 1506 | Ga0070695_100066068 | |||
| 1507 | Ga0070696_100002042 | |||
| 1508 | Ga0070696_100275874 | |||
| 1509 | Ga0070696_100389838 | |||
| 1510 | Ga0070693_100150501 | |||
| 1511 | Ga0070665_100000080 | |||
| 1512 | Ga0070665_100028942 | |||
| 1513 | Ga0070665_100073704 | |||
| 1514 | Ga0070665_100692901 | |||
| 1515 | Ga0070665_101116487 | |||
| 1516 | Ga0070665_101740274 | |||
| 1517 | Ga0070704_100000738 | |||
| 1518 | Ga0068855_100012600 | |||
| 1519 | Ga0068855_100039920 | |||
| 1520 | Ga0068855_100137154 | |||
| 1521 | Ga0068855_100685595 | |||
| 1522 | Ga0068855_100984759 | |||
| 1523 | Ga0070664_100103775 | |||
| 1524 | Ga0070664_100290694 | |||
| 1525 | Ga0070664_100404338 | |||
| 1526 | Ga0068857_100033416 | |||
| 1527 | Ga0068857_100049057 | |||
| 1528 | Ga0068857_100084690 | |||
| 1529 | Ga0068857_100120139 | |||
| 1530 | Ga0068854_100765719 | |||
| 1531 | Ga0068856_100003868 | |||
| 1532 | Ga0068856_100018322 | |||
| 1533 | Ga0068856_100062608 | |||
| 1534 | Ga0068856_100252508 | |||
| 1535 | Ga0068856_100404069 | |||
| 1536 | Ga0068856_100605328 | |||
| 1537 | Ga0068856_100790342 | |||
| 1538 | Ga0068856_100896732 | |||
| 1539 | Ga0070702_100047855 | |||
| 1540 | Ga0070702_100138404 | |||
| 1541 | Ga0068852_100036166 | |||
| 1542 | Ga0068852_100040678 | |||
| 1543 | Ga0068852_100225540 | |||
| 1544 | Ga0068852_100345180 | |||
| 1545 | Ga0068852_100729817 | |||
| 1546 | Ga0068852_100791427 | |||
| 1547 | Ga0068852_100975910 | |||
| 1548 | Ga0068859_100000869 | |||
| 1549 | Ga0068859_100002326 | |||
| 1550 | Ga0068859_100659740 | |||
| 1551 | Ga0068864_100017331 | |||
| 1552 | Ga0068864_100027080 | |||
| 1553 | Ga0068864_100102681 | |||
| 1554 | Ga0068864_100135221 | |||
| 1555 | Ga0068864_101301791 | |||
| 1556 | Ga0068866_10149793 | |||
| 1557 | Ga0068861_100051037 | |||
| 1558 | Ga0068861_100777191 | |||
| 1559 | Ga0068851_10016100 | |||
| 1560 | Ga0068870_10105206 | |||
| 1561 | Ga0068863_100106573 | |||
| 1562 | Ga0068863_100898304 | |||
| 1563 | Ga0068858_100053503 | |||
| 1564 | Ga0068858_100239591 | |||
| 1565 | Ga0068858_100842948 | |||
| 1566 | Ga0068860_100000210 | |||
| 1567 | Ga0068860_100000965 | |||
| 1568 | Ga0068860_100339804 | |||
| 1569 | Ga0068860_100419263 | |||
| 1570 | Ga0068860_100773744 | |||
| 1571 | Ga0068862_100000912 | |||
| 1572 | Ga0068862_100205330 | |||
| 1573 | Ga0068862_100263320 | |||
| 1574 | Ga0068862_100356386 | |||
| 1575 | Ga0068862_100977808 | |||
| 1576 | Ga0081455_10002205 | |||
| 1577 | Ga0081540_1046278 | |||
| 1578 | Ga0081539_10000273 | |||
| 1579 | Ga0081539_10123396 | |||
| 1580 | Ga0070717_10016039 | |||
| 1581 | Ga0070717_10287748 | |||
| 1582 | Ga0075365_10022310 | |||
| 1583 | Ga0075365_10543409 | |||
| 1584 | Ga0075368_10007965 | |||
| 1585 | Ga0075363_100028828 | |||
| 1586 | Ga0075363_100078167 | |||
| 1587 | Ga0075364_10121280 | |||
| 1588 | Ga0075364_10176672 | |||
| 1589 | Ga0070716_100074153 | |||
| 1590 | Ga0070716_100080787 | |||
| 1591 | Ga0070716_100697358 | |||
| 1592 | Ga0070712_100433641 | |||
| 1593 | Ga0075362_10003901 | |||
| 1594 | Ga0075362_10183722 | |||
| 1595 | Ga0075362_10222855 | |||
| 1596 | Ga0075367_10019079 | |||
| 1597 | Ga0075367_10055605 | |||
| 1598 | Ga0075369_10045749 | |||
| 1599 | Ga0075369_10282093 | |||
| 1600 | Ga0075366_10146085 | |||
| 1601 | Ga0075366_10240931 | |||
| 1602 | Ga0075366_10245255 | |||
| 1603 | Ga0075366_10305888 | |||
| 1604 | Ga0097621_100166546 | |||
| 1605 | Ga0097621_100770517 | |||
| 1606 | Ga0075370_10000340 | |||
| 1607 | Ga0075370_10003478 | |||
| 1608 | Ga0075370_10006104 | |||
| 1609 | Ga0075370_10009436 | |||
| 1610 | Ga0075370_10013496 | |||
| 1611 | Ga0075370_10057449 | |||
| 1612 | Ga0075370_10101346 | |||
| 1613 | Ga0075370_10236906 | |||
| 1614 | Ga0075370_10271985 | |||
| 1615 | Ga0068871_100647091 | |||
| 1616 | Ga0075428_100556934 | |||
| 1617 | Ga0075430_100000704 | |||
| 1618 | Ga0075433_10148882 | |||
| 1619 | Ga0075433_10272009 | |||
| 1620 | Ga0075433_10459509 | |||
| 1621 | Ga0075434_100109048 | |||
| 1622 | Ga0075434_100574720 | |||
| 1623 | Ga0075429_100561037 | |||
| 1624 | Ga0068865_100310691 | |||
| 1625 | Ga0075436_100008201 | |||
| 1626 | Ga0097620_100000869 | |||
| 1627 | Ga0097620_100002326 | |||
| 1628 | Ga0097620_100659669 | |||
| 1629 | Ga0099825_1023258 | |||
| 1630 | Ga0099824_1018212 | |||
| 1631 | Ga0099824_1034018 | |||
| 1632 | Ga0099823_1025049 | |||
| 1633 | Ga0099826_10000527 | |||
| 1634 | Ga0099826_10066619 | |||
| 1635 | Ga0099826_10193958 | |||
| 1636 | Ga0075435_100102104 | |||
| 1637 | Ga0075435_100527947 | |||
| 1638 | Ga0075435_100550900 | |||
| 1639 | Ga0075435_100686323 | |||
| 1640 | Ga0099794_10003083 | |||
| 1641 | Ga0099795_10055335 | |||
| 1642 | Ga0105244_10037542 | |||
| 1643 | Ga0105240_10000005 | |||
| 1644 | Ga0105240_10329682 | |||
| 1645 | Ga0105240_10332635 | |||
| 1646 | Ga0111539_10234844 | |||
| 1647 | Ga0111539_10448524 | |||
| 1648 | Ga0105245_10021271 | |||
| 1649 | Ga0105245_10099026 | |||
| 1650 | Ga0105245_10102553 | |||
| 1651 | Ga0105245_10304571 | |||
| 1652 | Ga0105245_10475149 | |||
| 1653 | Ga0105245_10921319 | |||
| 1654 | Ga0105247_10012701 | |||
| 1655 | Ga0105247_10034582 | |||
| 1656 | Ga0105247_10043146 | |||
| 1657 | Ga0105247_10249563 | |||
| 1658 | Ga0114129_10761419 | |||
| 1659 | Ga0105243_10004089 | |||
| 1660 | Ga0105243_10098611 | |||
| 1661 | Ga0105243_10221870 | |||
| 1662 | Ga0105243_10590185 | |||
| 1663 | Ga0105241_10009269 | |||
| 1664 | Ga0105241_10012989 | |||
| 1665 | Ga0105241_10013325 | |||
| 1666 | Ga0105241_10120965 | |||
| 1667 | Ga0105242_10225243 | |||
| 1668 | Ga0105242_11111857 | |||
| 1669 | Ga0105237_10000773 | |||
| 1670 | Ga0105237_10003857 | |||
| 1671 | Ga0105237_10044608 | |||
| 1672 | Ga0105237_10115667 | |||
| 1673 | Ga0105237_10149449 | |||
| 1674 | Ga0105237_10263223 | |||
| 1675 | Ga0105237_11132214 | |||
| 1676 | Ga0105238_10030500 | |||
| 1677 | Ga0105238_10108782 | |||
| 1678 | Ga0105238_10163979 | |||
| 1679 | Ga0105238_10199208 | |||
| 1680 | Ga0105238_11258299 | |||
| 1681 | Ga0105249_10009032 | |||
| 1682 | Ga0099796_10003721 | |||
| 1683 | Ga0105239_10014053 | |||
| 1684 | Ga0105239_10024440 | |||
| 1685 | Ga0105239_10201930 | |||
| 1686 | Ga0105239_10231432 | |||
| 1687 | Ga0105239_10329501 | |||
| 1688 | Ga0105239_10868651 | |||
| 1689 | Ga0105239_11173624 | |||
| 1690 | Ga0105246_10024476 | |||
| 1691 | Ga0105246_10104058 | |||
| 1692 | Ga0105246_10131374 | |||
| 1693 | Ga0157373_10046733 | |||
| 1694 | Ga0157373_10338283 | |||
| 1695 | Ga0157373_10505966 | |||
| 1696 | Ga0157370_10001070 | |||
| 1697 | Ga0157370_10017784 | |||
| 1698 | Ga0157370_10055881 | |||
| 1699 | Ga0157370_10297240 | |||
| 1700 | Ga0157370_10388926 | |||
| 1701 | Ga0157370_10816105 | |||
| 1702 | Ga0157369_10081621 | |||
| 1703 | Ga0157369_10605433 | |||
| 1704 | Ga0157369_10663058 | |||
| 1705 | Ga0157374_10049221 | |||
| 1706 | Ga0157374_10791935 | |||
| 1707 | Ga0157378_10416560 | |||
| 1708 | Ga0157378_10685795 | |||
| 1709 | Ga0163162_10119621 | |||
| 1710 | Ga0163162_10126464 | |||
| 1711 | Ga0163162_10180113 | |||
| 1712 | Ga0163162_11003933 | |||
| 1713 | Ga0163162_11473840 | |||
| 1714 | Ga0157372_10643187 | |||
| 1715 | Ga0157375_10032801 | |||
| 1716 | Ga0157375_10708692 | |||
| 1717 | Ga0157375_11130436 | |||
| 1718 | Ga0163163_10011142 | |||
| 1719 | Ga0163163_10272621 | |||
| 1720 | Ga0163163_10853767 | |||
| 1721 | Ga0163163_12038541 | |||
| 1722 | Ga0157380_10177037 | |||
| 1723 | Ga0157380_10381080 | |||
| 1724 | Ga0182008_10001456 | |||
| 1725 | Ga0182008_10006000 | |||
| 1726 | Ga0182008_10118087 | |||
| 1727 | Ga0182008_10159619 | |||
| 1728 | Ga0157377_10023849 | |||
| 1729 | Ga0157379_10022522 | |||
| 1730 | Ga0157379_10074696 | |||
| 1731 | Ga0157379_10120531 | |||
| 1732 | Ga0157376_10207522 | |||
| 1733 | Ga0157376_10266982 | |||
| 1734 | Ga0157376_10355311 | |||
| 1735 | Ga0182006_1005446 | |||
| 1736 | Ga0182006_1015639 | |||
| 1737 | Ga0182006_1072863 | |||
| 1738 | Ga0182007_10000618 | |||
| 1739 | Ga0182007_10000705 | |||
| 1740 | Ga0182007_10003145 | |||
| 1741 | Ga0182005_1002283 | |||
| 1742 | Ga0182005_1022006 | |||
| 1743 | Ga0163161_10000105 | |||
| 1744 | Ga0163161_10009252 | |||
| 1745 | Ga0163161_10036161 | |||
| 1746 | Ga0163161_10140745 | |||
| 1747 | Ga0206356_11464399 | |||
| 1748 | Ga0214544_1000002 | |||
| 1749 | Ga0214542_1000001 | |||
| 1750 | Ga0214542_1041125 | |||
| 1751 | Ga0214545_1000001 | |||
| 1752 | Ga0214545_1033424 | |||
| 1753 | Ga0214543_1000001 | |||
| 1754 | Ga0213876_10000384 | |||
| 1755 | Ga0213871_10092503 | |||
| 1756 | Ga0209436_116869 | |||
| 1757 | Ga0207427_109743 | |||
| 1758 | Ga0209437_100122 | |||
| 1759 | Ga0209437_100160 | |||
| 1760 | Ga0209437_110384 | |||
| 1761 | Ga0209677_101583 | |||
| 1762 | Ga0209677_101865 | |||
| 1763 | Ga0209148_1000289 | |||
| 1764 | Ga0209129_1001398 | |||
| 1765 | Ga0209129_1011590 | |||
| 1766 | Ga0209233_1000168 | |||
| 1767 | Ga0209233_1000170 | |||
| 1768 | Ga0209233_1000297 | |||
| 1769 | Ga0209233_1002174 | |||
| 1770 | Ga0209233_1014997 | |||
| 1771 | Ga0209565_1000046 | |||
| 1772 | Ga0209455_1000612 | |||
| 1773 | Ga0209673_1000058 | |||
| 1774 | Ga0209673_1000559 | |||
| 1775 | Ga0209130_1000215 | |||
| 1776 | Ga0209675_1000010 | |||
| 1777 | Ga0209675_1002925 | |||
| 1778 | Ga0209676_1000004 | |||
| 1779 | Ga0209676_1000172 | |||
| 1780 | Ga0209676_1009807 | |||
| 1781 | Ga0209025_1000122 | |||
| 1782 | Ga0209025_1000686 | |||
| 1783 | Ga0209025_1013681 | |||
| 1784 | Ga0209025_1013966 | |||
| 1785 | Ga0209564_1000413 | |||
| 1786 | Ga0209758_1000005 | |||
| 1787 | Ga0209758_1000160 | |||
| 1788 | Ga0209758_1000777 | |||
| 1789 | Ga0209758_1001948 | |||
| 1790 | Ga0209758_1055006 | |||
| 1791 | Ga0209050_1000002 | |||
| 1792 | Ga0209050_1000509 | |||
| 1793 | Ga0209050_1008280 | |||
| 1794 | Ga0209256_1000067 | |||
| 1795 | Ga0207426_1000178 | |||
| 1796 | Ga0207426_1000264 | |||
| 1797 | Ga0207426_1002608 | |||
| 1798 | Ga0209051_1000002 | |||
| 1799 | Ga0209051_1000096 | |||
| 1800 | Ga0209051_1000159 | |||
| 1801 | Ga0209051_1000278 | |||
| 1802 | Ga0209051_1010695 | |||
| 1803 | Ga0209257_1000002 | |||
| 1804 | Ga0209257_1000072 | |||
| 1805 | Ga0209257_1001087 | |||
| 1806 | Ga0207697_10083776 | |||
| 1807 | Ga0207656_10034550 | |||
| 1808 | Ga0207655_1011777 | |||
| 1809 | Ga0207655_1126776 | |||
| 1810 | Ga0207653_10004268 | |||
| 1811 | Ga0207710_10010427 | |||
| 1812 | Ga0207710_10022846 | |||
| 1813 | Ga0207710_10123653 | |||
| 1814 | Ga0207710_10386519 | |||
| 1815 | Ga0207680_10020320 | |||
| 1816 | Ga0207680_10209532 | |||
| 1817 | Ga0207647_10005160 | |||
| 1818 | Ga0207647_10060474 | |||
| 1819 | Ga0207647_10099127 | |||
| 1820 | Ga0207647_10200906 | |||
| 1821 | Ga0207647_10211500 | |||
| 1822 | Ga0207643_10126933 | |||
| 1823 | Ga0207705_10267593 | |||
| 1824 | Ga0207705_10538347 | |||
| 1825 | Ga0207654_10019270 | |||
| 1826 | Ga0207654_10199888 | |||
| 1827 | Ga0207654_10365534 | |||
| 1828 | Ga0207707_10018205 | |||
| 1829 | Ga0207707_10058939 | |||
| 1830 | Ga0207707_10084972 | |||
| 1831 | Ga0207695_10000011 | |||
| 1832 | Ga0207695_10001631 | |||
| 1833 | Ga0207695_10202413 | |||
| 1834 | Ga0207671_10001637 | |||
| 1835 | Ga0207671_10002644 | |||
| 1836 | Ga0207671_10003901 | |||
| 1837 | Ga0207671_10051707 | |||
| 1838 | Ga0207671_10173190 | |||
| 1839 | Ga0207671_10176862 | |||
| 1840 | Ga0207671_10825902 | |||
| 1841 | Ga0207693_10017812 | |||
| 1842 | Ga0207663_10050313 | |||
| 1843 | Ga0207663_10094251 | |||
| 1844 | Ga0207663_10382017 | |||
| 1845 | Ga0207663_10408187 | |||
| 1846 | Ga0207663_10695236 | |||
| 1847 | Ga0207660_10005245 | |||
| 1848 | Ga0207660_10095920 | |||
| 1849 | Ga0207660_10441300 | |||
| 1850 | Ga0207662_10178198 | |||
| 1851 | Ga0207657_10045084 | |||
| 1852 | Ga0207657_10095794 | |||
| 1853 | Ga0207657_10113141 | |||
| 1854 | Ga0207657_10385830 | |||
| 1855 | Ga0207657_10405870 | |||
| 1856 | Ga0207649_10238147 | |||
| 1857 | Ga0207649_10395456 | |||
| 1858 | Ga0207681_10548452 | |||
| 1859 | Ga0207694_10080500 | |||
| 1860 | Ga0207694_10134437 | |||
| 1861 | Ga0207694_10176876 | |||
| 1862 | Ga0207694_10500805 | |||
| 1863 | Ga0207694_10562767 | |||
| 1864 | Ga0207650_10315156 | |||
| 1865 | Ga0207700_10003559 | |||
| 1866 | Ga0207700_10257555 | |||
| 1867 | Ga0207664_10492587 | |||
| 1868 | Ga0207644_10372114 | |||
| 1869 | Ga0207644_10419193 | |||
| 1870 | Ga0207644_10750217 | |||
| 1871 | Ga0207690_10187469 | |||
| 1872 | Ga0207690_10597774 | |||
| 1873 | Ga0207706_10018115 | |||
| 1874 | Ga0207706_10051455 | |||
| 1875 | Ga0207706_10923913 | |||
| 1876 | Ga0207686_10211946 | |||
| 1877 | Ga0207709_10003493 | |||
| 1878 | Ga0207709_10060765 | |||
| 1879 | Ga0207669_10049156 | |||
| 1880 | Ga0207704_10711361 | |||
| 1881 | Ga0207665_10075953 | |||
| 1882 | Ga0207665_10459389 | |||
| 1883 | Ga0207691_10402717 | |||
| 1884 | Ga0207711_10032286 | |||
| 1885 | Ga0207711_10363403 | |||
| 1886 | Ga0207711_10965335 | |||
| 1887 | Ga0207689_10014529 | |||
| 1888 | Ga0207689_10364419 | |||
| 1889 | Ga0207661_10050057 | |||
| 1890 | Ga0207661_10235662 | |||
| 1891 | Ga0207661_10808329 | |||
| 1892 | Ga0207679_10160399 | |||
| 1893 | Ga0207679_10196745 | |||
| 1894 | Ga0207667_10015041 | |||
| 1895 | Ga0207667_10045209 | |||
| 1896 | Ga0207667_10170360 | |||
| 1897 | Ga0207667_10196388 | |||
| 1898 | Ga0207667_10392952 | |||
| 1899 | Ga0207667_10450233 | |||
| 1900 | Ga0207651_10772537 | |||
| 1901 | Ga0207712_10024490 | |||
| 1902 | Ga0207712_10872602 | |||
| 1903 | Ga0207668_10099695 | |||
| 1904 | Ga0207658_10101528 | |||
| 1905 | Ga0207658_10510904 | |||
| 1906 | Ga0207658_10513115 | |||
| 1907 | Ga0207658_10781979 | |||
| 1908 | Ga0207703_10219125 | |||
| 1909 | Ga0207703_10360805 | |||
| 1910 | Ga0207703_10784020 | |||
| 1911 | Ga0207639_10261864 | |||
| 1912 | Ga0207639_10266446 | |||
| 1913 | Ga0207639_10987769 | |||
| 1914 | Ga0207678_10000337 | |||
| 1915 | Ga0207678_10018039 | |||
| 1916 | Ga0207678_10024825 | |||
| 1917 | Ga0207678_10047440 | |||
| 1918 | Ga0207678_10073747 | |||
| 1919 | Ga0207678_10178025 | |||
| 1920 | Ga0207678_10339727 | |||
| 1921 | Ga0207708_10001974 | |||
| 1922 | Ga0207708_10240634 | |||
| 1923 | Ga0207702_10010148 | |||
| 1924 | Ga0207702_10287065 | |||
| 1925 | Ga0207702_10451637 | |||
| 1926 | Ga0207702_10692841 | |||
| 1927 | Ga0207702_10744360 | |||
| 1928 | Ga0207702_11173206 | |||
| 1929 | Ga0207641_10041110 | |||
| 1930 | Ga0207641_10243477 | |||
| 1931 | Ga0207641_11039906 | |||
| 1932 | Ga0207648_10118722 | |||
| 1933 | Ga0207676_10039430 | |||
| 1934 | Ga0207676_10073555 | |||
| 1935 | Ga0207676_10372485 | |||
| 1936 | Ga0207676_10698596 | |||
| 1937 | Ga0207676_10854398 | |||
| 1938 | Ga0207674_10029570 | |||
| 1939 | Ga0207674_10031742 | |||
| 1940 | Ga0207674_10048477 | |||
| 1941 | Ga0207674_10098352 | |||
| 1942 | Ga0207674_10141197 | |||
| 1943 | Ga0207674_10700797 | |||
| 1944 | Ga0207675_100082728 | |||
| 1945 | Ga0207683_10105677 | |||
| 1946 | Ga0207683_10174784 | |||
| 1947 | Ga0207683_10255192 | |||
| 1948 | Ga0207683_10498464 | |||
| 1949 | Ga0207698_10233167 | |||
| 1950 | Ga0207698_10459446 | |||
| 1951 | Ga0207698_10499971 | |||
| 1952 | Ga0207698_10651999 | |||
| 1953 | Ga0209389_1000008 | |||
| 1954 | Ga0209389_1000081 | |||
| 1955 | Ga0209589_1000091 | |||
| 1956 | Ga0209489_100096 | |||
| 1957 | Ga0209489_103917 | |||
| 1958 | Ga0209700_100036 | |||
| 1959 | Ga0209282_1060656 | |||
| 1960 | Ga0209588_1001221 | |||
| 1961 | Ga0209813_10002519 | |||
| 1962 | Ga0209813_10003776 | |||
| 1963 | Ga0209813_10015641 | |||
| 1964 | Ga0207428_10232096 | |||
| 1965 | Ga0268266_10000055 | |||
| 1966 | Ga0268266_10071995 | |||
| 1967 | Ga0268266_10236782 | |||
| 1968 | Ga0268266_10910896 | |||
| 1969 | Ga0268265_10006170 | |||
| 1970 | Ga0268265_10008013 | |||
| 1971 | Ga0268265_10414867 | |||
| 1972 | Ga0268264_10000233 | |||
| 1973 | Ga0268264_10018666 | |||
| 1974 | Ga0268264_10349811 | |||
| 1975 | Ga0265334_10012112 | |||
| 1976 | Ga0307515_10012480 | |||
| 1977 | Ga0265338_10007042 | |||
| 1978 | Ga0265338_10016438 | |||
| 1979 | Ga0265338_10032839 | |||
| 1980 | Ga0307511_10096523 | |||
| 1981 | Ga0307512_10141132 | |||
| 1982 | Ga0316177_1220166 | |||
| 1983 | Ga0316176_1074271 | |||
| 1984 | Ga0314311_1023036 | |||
| 1985 | Ga0316178_1123278 | |||
| 1986 | Ga0316180_1019296 | |||
| 1987 | Ga0316183_1126188 | |||
| 1988 | Ga0316181_1028270 | |||
| 1989 | Ga0316182_1164524 | |||
| 1990 | Ga0316182_1282851 | |||
| 1991 | Ga0265330_10169963 | |||
| 1992 | Ga0265332_10002293 | |||
| 1993 | Ga0265332_10102714 | |||
| 1994 | Ga0265328_10113442 | |||
| 1995 | Ga0265320_10000102 | |||
| 1996 | Ga0265325_10201373 | |||
| 1997 | Ga0265329_10042118 | |||
| 1998 | Ga0265329_10085282 | |||
| 1999 | Ga0265340_10003648 | |||
| 2000 | Ga0265340_10023320 | |||
| 2001 | Ga0265340_10036067 | |||
| 2002 | Ga0265340_10068915 | |||
| 2003 | Ga0265339_10002587 | |||
| 2004 | Ga0265339_10107257 | |||
| 2005 | Ga0265331_10004118 | |||
| 2006 | Ga0265331_10006890 | |||
| 2007 | Ga0265327_10012710 | |||
| 2008 | Ga0265316_10256246 | |||
| 2009 | Ga0307513_10218757 | |||
| 2010 | Ga0307509_10038652 | |||
| 2011 | Ga0307509_10305319 | |||
| 2012 | Ga0307509_10335430 | |||
| 2013 | Ga0307408_100186846 | |||
| 2014 | Ga0307408_101460393 | |||
| 2015 | Ga0307508_10000010 | |||
| 2016 | Ga0307508_10189352 | |||
| 2017 | Ga0307508_10215585 | |||
| 2018 | Ga0307514_10009275 | |||
| 2019 | Ga0307514_10031724 | |||
| 2020 | Ga0265314_10010572 | |||
| 2021 | Ga0265314_10256811 | |||
| 2022 | Ga0265342_10002113 | |||
| 2023 | Ga0265342_10025322 | |||
| 2024 | Ga0265342_10076999 | |||
| 2025 | Ga0307516_10000131 | |||
| 2026 | Ga0307516_10015237 | |||
| 2027 | Ga0307516_10101139 | |||
| 2028 | Ga0307405_10158862 | |||
| 2029 | Ga0307413_10760582 | |||
| 2030 | Ga0307406_10288038 | |||
| 2031 | Ga0307406_10802803 | |||
| 2032 | Ga0307406_10939853 | |||
| 2033 | Ga0307407_10430313 | |||
| 2034 | Ga0307412_10004706 | |||
| 2035 | Ga0307412_10073269 | |||
| 2036 | Ga0307412_10265496 | |||
| 2037 | Ga0307412_10742219 | |||
| 2038 | Ga0307409_100384591 | |||
| 2039 | Ga0307416_100280869 | |||
| 2040 | Ga0307414_10070300 | |||
| 2041 | Ga0307414_10092583 | |||
| 2042 | Ga0307411_10065234 | |||
| 2043 | Ga0307411_10221066 | |||
| 2044 | Ga0307507_10099702 | |||
| 2045 | Ga0307510_10007884 | |||
| 2046 | Ga0307510_10026794 | |||
| 2047 | Ga0307510_10330548 | |||
| 2048 | Ga0373930_0052507 | |||
| 2049 | Ga0373950_0054722 | |||
| 2050 | Ga0373958_0018666 | |||
| 2051 | Ga0373951_0022432 | |||
| 2052 | Ga0373936_0011012 | |||
| 2053 | Ga0373939_0158049 | |||
| 2054 | Ga0373941_0031201 | |||
| 2055 | Ga0373945_0172648 | |||
| 2056 | Ga0373954_0282272 | |||
| 2057 | Ga0373956_0034696 | |||
| 2058 | Ga0373957_0012775 | |||
| 2059 | Ga0373960_0006840 | |||
| 2060 | Ga0373946_0266816 | |||
| 2061 | Ga0373961_0102261 | |||
| 2062 | Ga0373962_0089287 | |||
| 2063 | Ga0373924_0075033 | |||
| 2064 | Ga0373935_0052251 | |||
| 2065 | Ga0373935_0191097 | |||
| 2066 | Ga0373935_0364418 | |||
| 2067 | Ga0373927_0016488 | |||
| 2068 | Ga0373927_0024569 | |||
| 2069 | Ga0373937_0005850 | |||
| 2070 | Ga0373925_0018284 | |||
| 2071 | Ga0373925_0046851 | |||
| 2072 | Ga0373925_0051972 | |||
| 2073 | Ga0395900_0338430 | |||
| 2074 | Ga0395900_0349930 | |||
| 2075 | Ga0395900_0420206 | |||
| 2076 | Ga0395898_0002853 | |||
| 2077 | Ga0395898_0168415 | |||
| 2078 | Ga0395898_0220282 | |||
| 2079 | Ga0395905_0012510 | |||
| 2080 | Ga0395905_0025312 | |||
| 2081 | Ga0436364_0614298 | |||
| 2082 | Ga0436364_1222287 | |||
| 2083 | Ga0436364_1310055 | |||
| 2084 | Ga0395901_0029183 | |||
| 2085 | Ga0395901_0471290 | |||
| 2086 | Ga0436365_0419344 | |||
| 2087 | Ga0436365_0998612 | |||
| 2088 | Ga0436360_0511504 | |||
| 2089 | Ga0436361_0125523 | |||
| 2090 | Ga0436363_0942152 | |||
| 2091 | Ga0436363_1316254 | |||
| 2092 | Ga0436362_0193018 | |||
| 2093 | Ga0439436_0037931 | |||
| 2094 | Ga0451797_0291897 | |||
| 2095 | Ga0451800_1589477 | |||
| 2096 | Ga0451807_0920577 | |||
| 2097 | Ga0439431_0036137 | |||
| 2098 | Ga0439449_0019933 | |||
| 2099 | Ga0439463_058599 | |||
| 2100 | Ga0439459_0082101 | |||
| 2101 | Ga0450918_036931 | |||
| 2102 | Ga0466969_0040244 | |||
| 2103 | Ga0466965_0035113 | |||
| 2104 | Ga0466965_0345774 | |||
| 2105 | Ga0466966_0000743 | |||
| 2106 | Ga0466961_0000013 | |||
| 2107 | Ga0466968_0026713 | |||
| 2108 | Ga0466960_0172473 | |||
| 2109 | Ga0466959_0006806 | |||
| 2110 | Ga0466958_0291494 | |||
| 2111 | Ga0466967_1045263 | |||
| 2112 | Ga0495592_0270310 | |||
| 2113 | Ga0495603_0025657 | |||
| 2114 | Ga0495603_0067083 | |||
| 2115 | Ga0495590_0039916 | |||
| 2116 | Ga0495629_0034275 | |||
| 2117 | Ga0495638_0000398 | |||
| 2118 | Ga0495651_0000388 | |||
| 2119 | Ga0495651_0226178 | |||
| 2120 | Ga0495653_0137228 | |||
| 2121 | Ga0495653_0181832 | |||
| 2122 | Ga0495653_0329308 | |||
| 2123 | Ga0495582_0188040 | |||
| 2124 | Ga0495639_0015245 | |||
| 2125 | Ga0495639_0253867 | |||
| 2126 | Ga0495664_0072645 | |||
| 2127 | Ga0495664_0370642 | |||
| 2128 | Ga0495664_0636870 | |||
| 2129 | Ga0495584_0175576 | |||
| 2130 | Ga0495594_0218522 | |||
| 2131 | Ga0495594_0565245 | |||
| 2132 | Ga0495596_0255698 | |||
| 2133 | Ga0495607_0092478 | |||
| 2134 | Ga0495607_0313699 | |||
| 2135 | Ga0495606_0014901 | |||
| 2136 | Ga0495608_0072084 | |||
| 2137 | Ga0495610_0039139 | |||
| 2138 | Ga0495616_0010771 | |||
| 2139 | Ga0495618_0029042 | |||
| 2140 | Ga0495620_0064751 | |||
| 2141 | Ga0495620_0203721 | |||
| 2142 | Ga0495620_0289623 | |||
| 2143 | Ga0495628_0082800 | |||
| 2144 | Ga0495628_0192298 | |||
| 2145 | Ga0495630_0068555 | |||
| 2146 | Ga0495631_0000021 | |||
| 2147 | Ga0495631_0037954 | |||
| 2148 | Ga0495631_0073638 | |||
| 2149 | Ga0495632_0150137 | |||
| 2150 | Ga0495632_0355279 | |||
| 2151 | Ga0495637_0020807 | |||
| 2152 | Ga0495644_0082194 | |||
| 2153 | Ga0495648_0009683 | |||
| 2154 | Ga0495648_0105226 | |||
| 2155 | Ga0495648_0180618 | |||
| 2156 | Ga0495663_0054329 | |||
| 2157 | Ga0495642_0025533 | |||
| 2158 | Ga0495652_0003852 | |||
| 2159 | Ga0495652_0501563 | |||
| 2160 | Ga0495654_0012310 | |||
| 2161 | Ga0495665_0203568 | |||
| 2162 | Ga0495640_0044552 | |||
| 2163 | Ga0495640_0115249 | |||
| 2164 | Ga0495587_0047352 | |||
| 2165 | Ga0495587_0097573 | |||
| 2166 | Ga0495598_0029644 | |||
| 2167 | Ga0495609_0133280 | |||
| 2168 | Ga0495609_0141091 | |||
| 2169 | Ga0495621_0034955 | |||
| 2170 | Ga0495621_0069279 | |||
| 2171 | Ga0495597_0124787 | |||
| 2172 | Ga0495622_0085031 | |||
| 2173 | Ga0495633_0208613 | |||
| 2174 | Ga0495667_0002142 | |||
| 2175 | Ga0495667_0433649 | |||
| 2176 | Ga0495656_0051564 | |||
| 2177 | Ga0495668_0264189 | |||
| 2178 | Ga0495634_0022224 | |||
| 2179 | Ga0495625_0021879 | |||
| 2180 | Ga0495625_0089878 | |||
| 2181 | Ga0495625_0159869 | |||
| 2182 | Ga0495625_0163136 | |||
| 2183 | Ga0495625_0301257 | |||
| 2184 | Ga0495625_0335603 | |||
| 2185 | Ga0495659_0214878 | |||
| 2186 | Ga0495588_0101443 | |||
| 2187 | Ga0495657_0013200 | |||
| 2188 | Ga0495657_0098981 | |||
| 2189 | Ga0495599_0059401 | |||
| 2190 | Ga0495599_0133186 | |||
| 2191 | Ga0495599_0181090 | |||
| 2192 | Ga0495623_0079698 | |||
| 2193 | Ga0495646_0020067 | |||
| 2194 | Ga0495658_0142211 | |||
| 2195 | Ga0495613_0270910 | |||
| 2196 | Ga0495624_0048087 | |||
| 2197 | Ga0495624_0267030 | |||
| 2198 | Ga0495670_0092224 | |||
| 2199 | Ga0495671_0077298 | |||
| 2200 | Ga0495649_0025601 | |||
| 2201 | Ga0495589_0267695 | |||
| 2202 | Ga0495589_0273129 | |||
| 2203 | Ga0495600_0023897 | |||
| 2204 | Ga0495600_0330923 | |||
| 2205 | Ga0495660_0095171 | |||
| 2206 | Ga0495581_0123239 | |||
| 2207 | Ga0495604_0032057 | |||
| 2208 | Ga0495604_0045919 | |||
| 2209 | Ga0495674_0183924 | |||
| 2210 | Ga0495674_0415177 | |||
| 2211 | Ga0495674_0761055 | |||
| 2212 | Ga0495672_0027558 | |||
| 2213 | Ga0495672_0048666 | |||
| 2214 | Ga0495672_0090469 | |||
| 2215 | Ga0495676_0018304 | |||
| 2216 | Ga0495680_0016485 | |||
| 2217 | Ga0495683_0047314 | |||
| 2218 | Ga0495687_003920 | |||
| 2219 | Ga0495675_0094720 | |||
| 2220 | Ga0495673_0074127 | |||
| 2221 | Ga0495673_0122884 | |||
| 2222 | Ga0495686_0055461 | |||
| 2223 | Ga0495686_0073886 | |||
| 2224 | Ga0495686_0075766 | |||
| 2225 | Ga0495686_0143347 | |||
| 2226 | Ga0495686_0273894 | |||
| 2227 | Ga0495686_0351573 | |||
| 2228 | Ga0495686_0433544 | |||
| 2229 | Ga0495593_0007695 | |||
| 2230 | Ga0495602_0026247 | |||
| 2231 | Ga0495602_0174533 | |||
| 2232 | Ga0495614_0003864 | |||
| 2233 | Ga0495626_0014917 | |||
| 2234 | Ga0496100_0007590 | |||
| 2235 | Ga0496100_0028223 | |||
| 2236 | Ga0496100_0344206 | |||
| 2237 | Ga0496100_0617324 | |||
| 2238 | Ga0496101_0208454 | |||
| 2239 | Ga0496102_0005180 | |||
| 2240 | Ga0496102_0017154 | |||
| 2241 | Ga0496102_0049421 | |||
| 2242 | Ga0496102_0511438 | |||
| 2243 | Ga0496103_0019495 | |||
| 2244 | Ga0496103_0032651 | |||
| 2245 | Ga0496103_0041509 | |||
| 2246 | Ga0496103_0096293 | |||
| 2247 | Ga0496103_0116311 | |||
| 2248 | Ga0496103_0175439 | |||
| 2249 | Ga0496104_0013720 | |||
| 2250 | Ga0496104_0032278 | |||
| 2251 | Ga0496104_0107715 | |||
| 2252 | Ga0496104_0113317 | |||
| 2253 | Ga0496104_0244122 | |||
| 2254 | Ga0496104_0644269 | |||
| 2255 | Ga0496105_0007184 | |||
| 2256 | Ga0496105_0019748 | |||
| 2257 | Ga0496105_0028800 | |||
| 2258 | Ga0496105_0041214 | |||
| 2259 | Ga0496105_0209209 | |||
| 2260 | Ga0496105_0709534 | |||
| 2261 | Ga0496106_0001152 | |||
| 2262 | Ga0496106_0004584 | |||
| 2263 | Ga0496106_0013136 | |||
| 2264 | Ga0496106_0018500 | |||
| 2265 | Ga0496106_0031853 | |||
| 2266 | Ga0496106_0032086 | |||
| 2267 | Ga0496106_0173881 | |||
| 2268 | Ga0496106_0208207 | |||
| 2269 | Ga0496106_0253998 | |||
| 2270 | Ga0496106_0266595 | |||
| 2271 | Ga0496107_0008261 | |||
| 2272 | Ga0496107_0016800 | |||
| 2273 | Ga0496107_0035132 | |||
| 2274 | Ga0496107_0155721 | |||
| 2275 | Ga0496107_0266087 | |||
| 2276 | Ga0496107_0311859 | |||
| 2277 | Ga0496107_0387995 | |||
| 2278 | Ga0496107_0626244 | |||
| 2279 | Ga0496108_0020986 | |||
| 2280 | Ga0496108_0079024 | |||
| 2281 | Ga0496108_0087619 | |||
| 2282 | Ga0496108_0508389 | |||
| 2283 | Ga0496109_0045666 | |||
| 2284 | Ga0496109_0064060 | |||
| 2285 | Ga0496109_0196993 | |||
| 2286 | Ga0496109_0313130 | |||
| 2287 | Ga0496109_0428833 | |||
| 2288 | Ga0496109_0520036 | |||
| 2289 | Ga0496109_0600523 | |||
| 2290 | Ga0496109_0648035 | |||
| 2291 | Ga0496110_0014187 | |||
| 2292 | Ga0496110_0027366 | |||
| 2293 | Ga0496110_0041293 | |||
| 2294 | Ga0496110_0084470 | |||
| 2295 | Ga0496110_0346769 | |||
| 2296 | Ga0496111_0086380 | |||
| 2297 | Ga0496111_0092307 | |||
| 2298 | Ga0496111_0129848 | |||
| 2299 | Ga0496112_0038824 | |||
| 2300 | Ga0496112_0048748 | |||
| 2301 | Ga0496112_0092747 | |||
| 2302 | Ga0496112_0599215 | |||
| 2303 | Ga0496113_0020094 | |||
| 2304 | Ga0496113_0033739 | |||
| 2305 | Ga0496113_0185899 | |||
| 2306 | Ga0496113_0434342 | |||
| 2307 | Ga0496114_0029970 | |||
| 2308 | Ga0496114_0162823 | |||
| 2309 | Ga0496114_0183202 | |||
| 2310 | Ga0496115_0046865 | |||
| 2311 | Ga0496115_0049686 | |||
| 2312 | Ga0496115_0704927 | |||
| 2313 | Ga0496116_0025718 | |||
| 2314 | Ga0496116_0069489 | |||
| 2315 | Ga0496116_0290197 | |||
| 2316 | Ga0496117_0002298 | |||
| 2317 | Ga0496117_0015458 | |||
| 2318 | Ga0496117_0022441 | |||
| 2319 | Ga0496117_0054188 | |||
| 2320 | Ga0496118_0007362 | |||
| 2321 | Ga0496118_0015802 | |||
| 2322 | Ga0496118_0039123 | |||
| 2323 | Ga0496118_0100107 | |||
| 2324 | Ga0496118_0204153 | |||
| 2325 | Ga0496119_0000801 | |||
| 2326 | Ga0496119_0021437 | |||
| 2327 | Ga0496119_0060252 | |||
| 2328 | Ga0496119_0102027 | |||
| 2329 | Ga0496119_0104686 | |||
| 2330 | Ga0496120_0019393 | |||
| 2331 | Ga0496120_0056343 | |||
| 2332 | Ga0496120_0072422 | |||
| 2333 | Ga0496121_0000994 | |||
| 2334 | Ga0496121_0001567 | |||
| 2335 | Ga0496121_0002309 | |||
| 2336 | Ga0496121_0023552 | |||
| 2337 | Ga0496121_0026483 | |||
| 2338 | Ga0496121_0057543 | |||
| 2339 | Ga0496121_0074965 | |||
| 2340 | Ga0496121_0110103 | |||
| 2341 | Ga0496121_0110388 | |||
| 2342 | Ga0496122_0174951 | |||
| 2343 | Ga0496123_0049995 | |||
| 2344 | Ga0496123_0094679 | |||
| 2345 | Ga0496123_0141390 | |||
| 2346 | Ga0496124_0002590 | |||
| 2347 | Ga0496124_0003412 | |||
| 2348 | Ga0496124_0015526 | |||
| 2349 | Ga0496124_0216950 | |||
| 2350 | Ga0496124_0342192 | |||
| 2351 | Ga0496124_0350205 | |||
| 2352 | Ga0496124_0364466 | |||
| 2353 | Ga0496125_0000090 | |||
| 2354 | Ga0496125_0006401 | |||
| 2355 | Ga0496125_0006952 | |||
| 2356 | Ga0496125_0066369 | |||
| 2357 | Ga0496125_0158183 | |||
| 2358 | Ga0496126_0004395 | |||
| 2359 | Ga0496126_0010244 | |||
| 2360 | Ga0496126_0011274 | |||
| 2361 | Ga0496126_0161727 | |||
| 2362 | Ga0496126_0200250 | |||
| 2363 | Ga0496126_0266763 | |||
| 2364 | Ga0496126_0299072 | |||
| 2365 | Ga0496126_0866858 | |||
| 2366 | Ga0495682_0011145 | |||
| 2367 | Ga0495682_0172159 | |||
| 2368 | Ga0501031_0016771 | |||
| 2369 | Ga0501032_0027553 | |||
| 2370 | Ga0501033_0001708 | |||
| 2371 | Ga0501033_0035762 | |||
| 2372 | Ga0501034_0056288 | |||
| 2373 | Ga0501036_0073804 | |||
| 2374 | Ga0501036_0144187 | |||
| 2375 | Ga0501036_0341389 | |||
| 2376 | Ga0501037_0001314 | |||
| 2377 | Ga0501039_0045504 | |||
| 2378 | Ga0501039_0175004 | |||
| 2379 | Ga0501042_0382198 | |||
| 2380 | Ga0501043_0000760 | |||
| 2381 | Ga0501043_0111743 | |||
| 2382 | Ga0501043_0736004 | |||
| 2383 | Ga0501046_0092217 | |||
| 2384 | Ga0501046_0427739 | |||
| 2385 | Ga0501047_0484827 | |||
| 2386 | Ga0501068_0269675 | |||
| 2387 | Ga0501070_0114195 | |||
| 2388 | Ga0501070_0321845 | |||
| 2389 | Ga0501073_0601455 | |||
| 2390 | Ga0501075_0090248 | |||
| 2391 | Ga0501076_0017649 | |||
| 2392 | Ga0501076_0286797 | |||
| 2393 | Ga0501076_0361686 | |||
| 2394 | Ga0501076_0415986 | |||
| 2395 | Ga0501077_0024157 | |||
| 2396 | Ga0501077_0102836 | |||
| 2397 | Ga0501077_0294990 | |||
| 2398 | Ga0501249_000918 | |||
| 2399 | Ga0501257_072402 | |||
| 2400 | Ga0501080_0646660 | |||
| 2401 | Ga0501081_0084045 | |||
| 2402 | Ga0501081_0156475 | |||
| 2403 | Ga0501081_0421331 | |||
| 2404 | Ga0501081_0542734 | |||
| 2405 | Ga0501081_0560100 | |||
| 2406 | Ga0501262_000119 | |||
| 2407 | Ga0501035_0043760 | |||
| 2408 | Ga0501035_0331617 | |||
| 2409 | Ga0501044_0034344 | |||
| 2410 | Ga0501044_0054261 | |||
| 2411 | Ga0501045_0084276 | |||
| 2412 | Ga0501045_0707362 | |||
| 2413 | nmdc:mga03683_24020_c1 | |||
| 2414 | nmdc:mga03683_4079_c1 | |||
| 2415 | nmdc:mga03n38_432078_c1 | |||
| 2416 | nmdc:mga00v17_67117_c1 | |||
| 2417 | nmdc:mga0yw44_114147_c1 | |||
| 2418 | nmdc:mga0yw44_19546_c1 | |||
| 2419 | nmdc:mga0k408_147970_c1 | |||
| 2420 | nmdc:mga0k408_183041_c1 | |||
| 2421 | nmdc:mga0k408_69404_c1 | |||
| 2422 | nmdc:mga06z11_4403_c1 | |||
| 2423 | nmdc:mga06z11_85286_c1 | |||
| 2424 | nmdc:mga04h51_13270_c1 | |||
| 2425 | nmdc:mga04h51_8875_c1 | |||
| 2426 | nmdc:mga07m45_176271_c1 | |||
| 2427 | nmdc:mga07m45_3642_c1 | |||
| 2428 | nmdc:mga07m45_37362_c2 | |||
| 2429 | nmdc:mga07m45_8596_c1 | |||
| 2430 | nmdc:mga05p37_644744_c1 | |||
| 2431 | nmdc:mga0qj67_476_c1 | |||
| 2432 | nmdc:mga06r32_3555_c1 | |||
| 2433 | nmdc:mga06r32_556679_c1 | |||
| 2434 | nmdc:mga08y16_399195_c1 | |||
| 2435 | nmdc:mga0n895_175299_c1 | |||
| 2436 | nmdc:mga0n895_282037_c1 | |||
| 2437 | nmdc:mga0rr50_218219_c1 | |||
| 2438 | nmdc:mga0rr50_590287_c1 | |||
| 2439 | nmdc:mga0rr50_635335_c1 | |||
| 2440 | nmdc:mga0rr50_949088_c1 | |||
| 2441 | nmdc:mga08x19_145077_c1 | |||
| 2442 | nmdc:mga08x19_5793_c1 | |||
| 2443 | nmdc:mga0a205_152814_c1 | |||
| 2444 | nmdc:mga0sz30_74013_c1 | |||
| 2445 | Ga0495601_0017549 | |||
| 2446 | Ga0495601_0090553 | |||
| 2447 | Ga0495612_0034172 | |||
| 2448 | Ga0495612_0201248 | |||
| 2449 | Ga0500610_0012735 | |||
| 2450 | Ga0500610_0044586 | |||
| 2451 | Ga0500610_0072327 | |||
| 2452 | Ga0500635_0000249 | |||
| 2453 | Ga0500635_0092243 | |||
| 2454 | Ga0495595_0260186 | |||
| 2455 | Ga0495619_0056741 | |||
| 2456 | Ga0495619_0322387 | |||
| 2457 | Ga0495619_0463748 | |||
| 2458 | Ga0500578_0157611 | |||
| 2459 | Ga0500643_000015 | |||
| 2460 | Ga0500643_000169 | |||
| 2461 | Ga0500643_019339 | |||
| 2462 | Ga0500647_0103704 | |||
| 2463 | Ga0500647_0115227 | |||
| 2464 | Ga0500651_0000095 | |||
| 2465 | Ga0500566_0000082 | |||
| 2466 | Ga0500566_0000536 | |||
| 2467 | Ga0500566_0110117 | |||
| 2468 | Ga0500566_0135996 | |||
| 2469 | Ga0500640_005617 | |||
| 2470 | Ga0500554_045377 | |||
| 2471 | Ga0500555_011988 | |||
| 2472 | Ga0500555_014312 | |||
| 2473 | Ga0500556_0065680 | |||
| 2474 | Ga0500557_000015 | |||
| 2475 | Ga0500562_016628 | |||
| 2476 | Ga0500562_018462 | |||
| 2477 | Ga0500569_019624 | |||
| 2478 | Ga0500571_000379 | |||
| 2479 | Ga0500572_000291 | |||
| 2480 | Ga0500572_013990 | |||
| 2481 | Ga0500572_033191 | |||
| 2482 | Ga0500591_043308 | |||
| 2483 | Ga0500593_001477 | |||
| 2484 | Ga0500595_019509 | |||
| 2485 | Ga0500595_022557 | |||
| 2486 | Ga0500597_023797 | |||
| 2487 | Ga0500607_078703 | |||
| 2488 | Ga0500608_000290 | |||
| 2489 | Ga0500608_008878 | |||
| 2490 | Ga0500614_000882 | |||
| 2491 | Ga0500618_003090 | |||
| 2492 | Ga0500618_012045 | |||
| 2493 | Ga0500618_020009 | |||
| 2494 | Ga0500621_238276 | |||
| 2495 | Ga0500642_0000166 | |||
| 2496 | Ga0500642_0088967 | |||
| 2497 | Ga0500655_009192 | |||
| 2498 | Ga0500658_0000763 | |||
| 2499 | Ga0500658_0000783 | |||
| 2500 | Ga0500559_0000323 | |||
| 2501 | Ga0500559_0001387 | |||
| 2502 | Ga0500559_0015366 | |||
| 2503 | Ga0500564_027527 | |||
| 2504 | Ga0500568_0004399 | |||
| 2505 | Ga0500568_0028635 | |||
| 2506 | Ga0500568_0066645 | |||
| 2507 | Ga0500574_015820 | |||
| 2508 | Ga0500588_0126618 | |||
| 2509 | Ga0500590_060305 | |||
| 2510 | Ga0500603_000122 | |||
| 2511 | Ga0500603_085817 | |||
| 2512 | Ga0500616_0048633 | |||
| 2513 | Ga0500619_022128 | |||
| 2514 | Ga0500620_021405 | |||
| 2515 | Ga0500622_0001660 | |||
| 2516 | Ga0500622_0021694 | |||
| 2517 | Ga0500624_003999 | |||
| 2518 | Ga0500627_0026770 | |||
| 2519 | Ga0500630_007401 | |||
| 2520 | Ga0500634_0003453 | |||
| 2521 | Ga0500634_0039731 | |||
| 2522 | Ga0500638_004133 | |||
| 2523 | Ga0500638_050545 | |||
| 2524 | Ga0500638_077323 | |||
| 2525 | Ga0500638_163515 | |||
| 2526 | Ga0500638_192867 | |||
| 2527 | Ga0500639_000001 | |||
| 2528 | Ga0500639_022629 | |||
| 2529 | Ga0500639_125960 | |||
| 2530 | Ga0500636_0037880 | |||
| 2531 | Ga0500636_0066749 | |||
| 2532 | Ga0500636_0067042 | |||
| 2533 | Ga0500636_0071217 | |||
| 2534 | Ga0500636_0076099 | |||
| 2535 | Ga0500637_0013284 | |||
| 2536 | Ga0500637_0179154 | |||
| 2537 | Ga0500637_0253446 | |||
| 2538 | Ga0500576_042002 | |||
| 2539 | Ga0500576_151207 | |||
| 2540 | Ga0500625_014727 | |||
| 2541 | Ga0500625_115951 | |||
| 2542 | Ga0500625_134774 | |||
| 2543 | Ga0500645_015438 | |||
| 2544 | Ga0500609_034473 | |||
| 2545 | Ga0500596_002414 | |||
| 2546 | Ga0500599_005969 | |||
| 2547 | Ga0500601_000032 | |||
| 2548 | Ga0501084_0253849 | |||
| 2549 | Ga0501082_0118989 | |||
| 2550 | Ga0501082_0136512 | |||
| 2551 | Ga0501082_0242661 | |||
| 2552 | Ga0530510_0010491 | |||
| 2553 | 2507508575 | |||
| 2554 | 2508542651 | |||
| 2555 | 2508691573 | |||
| 2556 | 2509150894 | |||
| 2557 | 2513229094 | |||
| 2558 | 2513623040 | |||
| 2559 | 2513638970 | |||
| 2560 | 2513654732 | |||
| 2561 | 2513722356 | |||
| 2562 | 2513855846 | |||
| 2563 | 2513872776 | |||
| 2564 | 2513889135 | |||
| 2565 | 2513915088 | |||
| 2566 | 2514011848 | |||
| 2567 | 2517106762 | |||
| 2568 | 2517892383 | |||
| 2569 | 2524443125 | |||
| 2570 | 2524468897 | |||
| 2571 | 2524538523 | |||
| 2572 | 2585277017 | |||
| 2573 | 2585333627 | |||
| 2574 | 2585537028 | |||
| 2575 | 2585551879 | |||
| 2576 | 2616308391 | |||
| 2577 | 2617349025 | |||
| 2578 | 2617375770 | |||
| 2579 | 2644288713 | |||
| 2580 | 2644329178 | |||
| 2581 | 2644401729 | |||
| 2582 | 2728751171 | |||
| 2583 | 2738717321 | |||
| 2584 | 2738878896 | |||
| 2585 | 2739278007 | |||
| 2586 | 2793062388 | |||
| 2587 | 2805915326 | |||
| 2588 | 2818238879 | |||
| 2589 | 2819638093 | |||
| 2590 | 2824605755 | |||
| 2591 | 2824614448 | |||
| 2592 | 2824623244 | |||
| 2593 | 2824633172 | |||
| 2594 | 2824640009 | |||
| 2595 | 2824650220 | |||
| 2596 | 2824657739 | |||
| 2597 | 2824677389 | |||
| 2598 | 2824685255 | |||
| 2599 | 2824693051 | |||
| 2600 | 2824700748 | |||
| 2601 | 2824711347 | |||
| 2602 | 2824719494 | |||
| 2603 | 2824729948 | |||
| 2604 | 2824738043 | |||
| 2605 | 2824749286 | |||
| 2606 | 2824758206 | |||
| 2607 | 2824768187 | |||
| 2608 | 2824779550 | |||
| 2609 | 2838060812 | |||
| 2610 | 2838123744 | |||
| 2611 | 2841914651 | |||
| 2612 | 2841920184 | |||
| 2613 | 2841948647 | |||
| 2614 | 2841949845 | |||
| 2615 | 2841958671 | |||
| 2616 | 2841966263 | |||
| 2617 | 2841975000 | |||
| 2618 | 2841983432 | |||
| 2619 | 2842039061 | |||
| 2620 | 2842042949 | |||
| 2621 | 2842047992 | |||
| 2622 | 2842050990 | |||
| 2623 | 2844319100 | |||
| 2624 | 2847936214 | |||
| 2625 | 2847946574 | |||
| 2626 | 2849079302 | |||
| 2627 | 2857514306 | |||
| 2628 | 2874598052 | |||
| 2629 | 2874615417 | |||
| 2630 | 2874627823 | |||
| 2631 | 2874647502 | |||
| 2632 | 2876778470 | |||
| 2633 | 2876811137 | |||
| 2634 | 2876820416 | |||
| 2635 | 2879082264 | |||
| 2636 | 2879083711 | |||
| 2637 | 2879111175 | |||
| 2638 | 2879135411 | |||
| 2639 | 2879150619 | |||
| 2640 | 2881368828 | |||
| 2641 | 2881671176 | |||
| 2642 | 2885203550 | |||
| 2643 | 2885217100 | |||
| 2644 | 2885373163 | |||
| 2645 | 2885410440 | |||
| 2646 | 2888424537 | |||
| 2647 | 2889039849 | |||
| 2648 | 2903728976 | |||
| 2649 | 2904450587 | |||
| 2650 | 2904456591 | |||
| 2651 | 2904549987 | |||
| 2652 | 2904672857 | |||
| 2653 | 2904703448 | |||
| 2654 | 2904714629 | |||
| 2655 | 2906607109 | |||
| 2656 | 2906633275 | |||
| 2657 | 2906638920 | |||
| 2658 | 2906651452 | |||
| 2659 | 2906666363 | |||
| 2660 | 2908780175 | |||
| 2661 | 2919409847 | |||
| 2662 | 2919462880 | |||
| 2663 | 2919678807 | |||
| 2664 | 2922365346 | |||
| 2665 | 2922374400 | |||
| 2666 | 2922393950 | |||
| 2667 | 2922396234 | |||
| 2668 | 2928089028 | |||
| 2669 | 2928117863 | |||
| 2670 | 2929164875 | |||
| 2671 | 2929521303 | |||
| 2672 | 2932797462 | |||
| 2673 | 2932802783 | |||
| 2674 | 2935608890 | |||
| 2675 | 2935650056 | |||
| 2676 | 2935661792 | |||
| 2677 | 2935773302 | |||
| 2678 | 2935778543 | |||
| 2679 | 2935792744 | |||
| 2680 | 2935800771 | |||
| 2681 | 2935822050 | |||
| 2682 | 2935847632 | |||
| 2683 | 2935889877 | |||
| 2684 | 2935909097 | |||
| 2685 | 2935919818 | |||
| 2686 | 2935926329 | |||
| 2687 | 2935934779 | |||
| 2688 | 2935943229 | |||
| 2689 | 2935951667 | |||
| 2690 | 2935965839 | |||
| 2691 | 2935967792 | |||
| 2692 | 2935982666 | |||
| 2693 | 2935988160 | |||
| 2694 | 2936012460 | |||
| 2695 | 2936021025 | |||
| 2696 | 2936029753 | |||
| 2697 | 2936047218 | |||
| 2698 | 2936057623 | |||
| 2699 | 2941532821 | |||
| 2700 | 2945913744 | |||
| 2701 | 2945949320 | |||
| 2702 | 2945973368 | |||
| 2703 | 2945990863 | |||
| 2704 | 2954771043 | |||
| 2705 | 3005592646 | |||
| 2706 | 3005599241 | |||
| 2707 | 3005714917 | |||
| 2708 | 3005722332 | |||
| 2709 | 8006940665 | |||
| 2710 | 8006980355 | |||
| 2711 | 8016529607 | |||
| 2712 | 8016534822 | |||
| 2713 | 8016548035 | |||
| 2714 | 8016554092 | |||
| 2715 | 8016591748 | |||
| 2716 | 8016600262 | |||
| 2717 | 8016610487 | |||
| 2718 | 8016614448 | |||
| 2719 | 8016626549 | |||
| 2720 | 8016640331 | |||
| 2721 | 8019534588 | |||
| 2722 | 8019544884 | |||
| 2723 | 8019553650 | |||
| 2724 | 8019628164 | |||
| 2725 | 8019634451 | |||
| 2726 | 8019645278 | |||
| 2727 | 8019658408 | |||
| 2728 | 8019662342 | |||
| 2729 | 8019671844 | |||
| 2730 | 8019690084 | |||
| 2731 | 8056686670 | |||
| 2732 | 8056968048 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gsw-assembly2.cif.gz_D | crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 | 0.8746 | 6 | 184 |
| 3gfr-assembly2.cif.gz_B | structure of yhda, d137l variant | 0.8661 | 6 | 183 |
| 3gfs-assembly1.cif.gz_A | structure of yhda, k109d/d137k variant | 0.863 | 6 | 183 |
| 2gsw-assembly2.cif.gz_D | crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 | 0.8602 | 6 | 184 |
| 7bx9-assembly1.cif.gz_A | purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis | 0.8601 | 5 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8671 | 5 | 147 | 3.40.50.360 |
| 2gswD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8585 | 7 | 184 | 3.40.50.360 |
| 2gswD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8441 | 7 | 184 | 3.40.50.360 |
| 2q62A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8409 | 2 | 182 | 3.40.50.360 |
| 4c76B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8235 | 2 | 183 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B0UI47-F1-model_v4 | deleted | 0.9924 | 1 | 196 |
|
| AF-J2WMA2-F1-model_v4 | Putative flavoprotein | 0.989 | 1 | 157 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-B0UI47-F1-model_v4 | deleted | 0.9874 | 1 | 196 |
|
| AF-A0A4Q5TC04-F1-model_v4 | NADPH-dependent oxidoreductase | 0.9862 | 25 | 196 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A562KEK0-F1-model_v4 | NAD(P)H-dependent FMN reductase | 0.985 | 1 | 189 |
GO:0005829
GO:0010181 GO:0016491 |