F493383
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1367 | 520 | 2734 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10153483|Ga0105251_101534832 |
| Length | 97 |
| Sequence | MNLDDGIEVFSILGNEYSVKAPPGEQHALRRAFEMLERTLAQTKRSHPTLVGDRLLVLAALNLCQRQVELSQGHAQAMDQCKSRIDALVSRCSDTGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 47 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 59 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 60 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 119 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 121 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 122 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 123 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 124 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 125 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 141 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 142 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 145 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 146 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 149 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 150 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 151 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 152 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 153 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 154 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 155 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 156 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 157 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 158 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 159 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 160 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 161 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 162 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 163 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 164 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 165 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 166 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 167 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 168 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 169 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 170 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 171 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 172 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 173 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 174 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 175 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 176 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 177 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 178 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 274 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 282 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 283 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 291 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 292 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 293 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 294 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 295 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 296 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 297 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 298 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 299 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 300 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 301 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 302 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 303 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 304 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 305 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 306 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 307 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 308 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 309 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 310 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 311 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 312 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 313 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 314 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 315 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 316 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 317 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 318 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 319 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 320 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 321 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 322 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 323 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 324 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 325 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 326 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 327 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 328 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 329 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 330 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 331 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 332 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 333 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 334 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 335 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 336 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 337 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 338 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 339 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 340 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 341 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 342 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 343 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 344 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 345 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 346 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 347 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 348 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 349 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 350 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 351 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 352 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 353 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 354 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 355 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 356 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 357 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 358 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 359 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 360 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 361 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 362 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 363 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 364 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 365 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 366 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 367 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 368 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 369 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 370 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 371 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 372 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 373 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 374 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 375 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 376 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 377 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 378 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 379 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 380 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 381 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 382 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 383 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 384 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 385 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 386 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 387 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 388 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 389 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 390 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 391 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 392 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 393 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 394 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 395 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 396 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 397 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 398 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 399 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 400 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 401 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 402 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 403 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 404 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 405 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 406 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 407 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 408 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 409 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 410 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 411 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 412 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 413 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 414 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 415 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 416 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 417 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 418 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 419 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 420 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 421 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 422 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 423 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 424 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 425 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 426 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 427 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 428 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 429 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 430 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 431 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 432 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 433 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 434 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 435 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 436 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 437 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 438 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 439 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 440 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 441 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 442 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 443 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 444 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 445 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 446 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 447 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 448 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 449 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 450 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 451 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 452 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 453 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 454 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 455 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 456 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 457 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 458 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 459 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 460 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 461 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 462 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 463 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 464 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 465 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 466 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 467 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 468 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 469 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 470 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 471 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 472 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 473 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 474 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 475 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 476 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 477 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 478 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 479 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 480 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 481 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 482 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 483 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 484 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 485 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 486 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 487 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 488 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 489 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 490 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 491 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 492 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 493 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 494 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 495 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 496 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 497 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 498 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 499 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 500 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 501 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 502 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 503 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 504 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 505 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 506 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 507 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 508 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 509 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 510 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 511 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 512 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 513 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 514 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 515 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 516 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 517 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 518 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 519 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 520 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.17 |
| Metatranscriptomes | 0.15 |
| Isolates | 16.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.97 |
| Nodule | 2.12 |
| Rhizoplane | 5.93 |
| Rhizosphere | 76.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105251_10153483 | 3300009011 | Bacteria | 1039 |
| 2 | MRS2a_Contig_1202 | 2124908027 | Bacteria | 12032 |
| 3 | MRS2a_Contig_12030 | 2124908027 | Bacteria | 647 |
| 4 | MRS2a_Contig_261 | 2124908027 | Bacteria | 7113 |
| 5 | SwRhRL2b_contig_2895489 | 2162886007 | Bacteria | 2678 |
| 6 | SwRhRL2b_contig_3371764 | 2162886007 | Bacteria | 1219 |
| 7 | SwRhRL2b_contig_3606189 | 2162886007 | Bacteria | 2081 |
| 8 | MRS1b_contig_8627672 | 2162886011 | Bacteria | 2475 |
| 9 | JGI24741J21665_1008600 | 3300001915 | Bacteria | 1918 |
| 10 | JGI24741J21665_1025949 | 3300001915 | Bacteria | 893 |
| 11 | JGI25155J39150_1002704 | 3300002704 | Bacteria | 942 |
| 12 | JGI25156J39149_1030158 | 3300002705 | Bacteria | 819 |
| 13 | JGI25162J39368_1000140 | 3300002737 | Bacteria | 78251 |
| 14 | JGI25162J39368_1000181 | 3300002737 | Bacteria | 67817 |
| 15 | JGI25154J39366_1008058 | 3300002738 | Bacteria | 1391 |
| 16 | JGI25163J39215_1000705 | 3300002771 | Bacteria | 8752 |
| 17 | JGI25163J39215_1001334 | 3300002771 | Bacteria | 4257 |
| 18 | JGI25164J39214_1000110 | 3300002772 | Bacteria | 78251 |
| 19 | JGI25164J39214_1000146 | 3300002772 | Bacteria | 67817 |
| 20 | JGI25165J46597_1000228 | 3300003214 | Bacteria | 78251 |
| 21 | JGI25165J46597_1000267 | 3300003214 | Bacteria | 67817 |
| 22 | Ga0055538_1000037 | 3300003751 | Bacteria | 190238 |
| 23 | Ga0055539_1000048 | 3300003752 | Bacteria | 190238 |
| 24 | Ga0055533_1000059 | 3300003756 | Bacteria | 190238 |
| 25 | Ga0055532_1000096 | 3300003758 | Bacteria | 98889 |
| 26 | Ga0055525_1000128 | 3300003759 | Bacteria | 113553 |
| 27 | Ga0055536_1000783 | 3300003781 | Bacteria | 21203 |
| 28 | Ga0055536_1003636 | 3300003781 | Bacteria | 8219 |
| 29 | Ga0055536_1034266 | 3300003781 | Bacteria | 1285 |
| 30 | Ga0055530_10000098 | 3300003791 | Bacteria | 73644 |
| 31 | Ga0055530_10000333 | 3300003791 | Bacteria | 42485 |
| 32 | Ga0055540_1000138 | 3300003792 | Bacteria | 73170 |
| 33 | Ga0055540_1000586 | 3300003792 | Bacteria | 26511 |
| 34 | Ga0055541_1000035 | 3300003841 | Bacteria | 190238 |
| 35 | Ga0058859_10063450 | 3300004798 | Bacteria | 669 |
| 36 | Ga0065714_10002564 | 3300005288 | Bacteria | 14476 |
| 37 | Ga0065714_10011292 | 3300005288 | Bacteria | 3865 |
| 38 | Ga0065714_10013869 | 3300005288 | Bacteria | 2557 |
| 39 | Ga0065714_10017780 | 3300005288 | Bacteria | 3625 |
| 40 | Ga0065714_10039436 | 3300005288 | Bacteria | 686 |
| 41 | Ga0065714_10042967 | 3300005288 | Bacteria | 694 |
| 42 | Ga0065714_10064847 | 3300005288 | Bacteria | 17130 |
| 43 | Ga0065714_10079634 | 3300005288 | Bacteria | 2498 |
| 44 | Ga0065714_10113182 | 3300005288 | Bacteria | 1445 |
| 45 | Ga0065714_10156250 | 3300005288 | Bacteria | 1076 |
| 46 | Ga0065714_10230683 | 3300005288 | Bacteria | 817 |
| 47 | Ga0065704_10000971 | 3300005289 | Bacteria | 15989 |
| 48 | Ga0065704_10017175 | 3300005289 | Bacteria | 1707 |
| 49 | Ga0065704_10035179 | 3300005289 | Bacteria | 1373 |
| 50 | Ga0065704_10037598 | 3300005289 | Bacteria | 1091 |
| 51 | Ga0065704_10084746 | 3300005289 | Bacteria | 3301 |
| 52 | Ga0065704_10097649 | 3300005289 | Bacteria | 2384 |
| 53 | Ga0065704_10121382 | 3300005289 | Bacteria | 1755 |
| 54 | Ga0065704_10231969 | 3300005289 | Bacteria | 1040 |
| 55 | Ga0065704_10362676 | 3300005289 | Bacteria | 795 |
| 56 | Ga0065712_10000856 | 3300005290 | Bacteria | 9107 |
| 57 | Ga0065712_10070791 | 3300005290 | Bacteria | 5705 |
| 58 | Ga0065712_10081097 | 3300005290 | Bacteria | 3039 |
| 59 | Ga0065715_10024528 | 3300005293 | Bacteria | 1271 |
| 60 | Ga0070676_10106676 | 3300005328 | Bacteria | 1738 |
| 61 | Ga0070670_100002334 | 3300005331 | Bacteria | 15630 |
| 62 | Ga0070661_100000078 | 3300005344 | Bacteria | 77449 |
| 63 | Ga0070669_100005413 | 3300005353 | Bacteria | 9207 |
| 64 | Ga0070669_100119689 | 3300005353 | Bacteria | 2007 |
| 65 | Ga0070663_100392322 | 3300005455 | Bacteria | 1133 |
| 66 | Ga0070662_100000095 | 3300005457 | Bacteria | 48526 |
| 67 | Ga0070662_100010267 | 3300005457 | Bacteria | 6139 |
| 68 | Ga0070706_102121994 | 3300005467 | Bacteria | 508 |
| 69 | Ga0068853_100000089 | 3300005539 | Bacteria | 62291 |
| 70 | Ga0070665_100032153 | 3300005548 | Bacteria | 5280 |
| 71 | Ga0070665_100187316 | 3300005548 | Bacteria | 2070 |
| 72 | Ga0070664_100001480 | 3300005564 | Bacteria | 18717 |
| 73 | Ga0070664_100012404 | 3300005564 | Bacteria | 6925 |
| 74 | Ga0068857_101626977 | 3300005577 | Bacteria | 631 |
| 75 | Ga0068854_100014211 | 3300005578 | Bacteria | 5242 |
| 76 | Ga0068851_10000024 | 3300005834 | Bacteria | 125917 |
| 77 | Ga0075363_100090844 | 3300006048 | Bacteria | 1680 |
| 78 | Ga0075364_10175931 | 3300006051 | Bacteria | 1447 |
| 79 | Ga0075364_10213932 | 3300006051 | Bacteria | 1307 |
| 80 | Ga0075364_10254883 | 3300006051 | Bacteria | 1193 |
| 81 | Ga0075364_10330929 | 3300006051 | Bacteria | 1037 |
| 82 | Ga0075432_10002453 | 3300006058 | Bacteria | 6175 |
| 83 | Ga0075432_10004245 | 3300006058 | Bacteria | 4878 |
| 84 | Ga0075432_10015082 | 3300006058 | Bacteria | 2633 |
| 85 | Ga0075432_10028993 | 3300006058 | Bacteria | 1910 |
| 86 | Ga0075432_10031036 | 3300006058 | Bacteria | 1849 |
| 87 | Ga0075432_10284271 | 3300006058 | Bacteria | 682 |
| 88 | Ga0075362_10084396 | 3300006177 | Bacteria | 1467 |
| 89 | Ga0075362_10332350 | 3300006177 | Bacteria | 758 |
| 90 | Ga0075362_10336752 | 3300006177 | Bacteria | 753 |
| 91 | Ga0075370_10611028 | 3300006353 | Bacteria | 661 |
| 92 | Ga0075436_100088086 | 3300006914 | Bacteria | 2156 |
| 93 | Ga0075436_100496148 | 3300006914 | Bacteria | 893 |
| 94 | Ga0075436_100746880 | 3300006914 | Bacteria | 726 |
| 95 | Ga0075436_100981421 | 3300006914 | Bacteria | 633 |
| 96 | Ga0075436_101152415 | 3300006914 | Bacteria | 584 |
| 97 | Ga0075436_101184160 | 3300006914 | Bacteria | 576 |
| 98 | Ga0079104_1000229 | 3300006946 | Bacteria | 75907 |
| 99 | Ga0079104_1000296 | 3300006946 | Bacteria | 63123 |
| 100 | Ga0079104_1036795 | 3300006946 | Bacteria | 1171 |
| 101 | Ga0099826_10005189 | 3300006948 | Bacteria | 9283 |
| 102 | Ga0105251_10000019 | 3300009011 | Bacteria | 141884 |
| 103 | Ga0105251_10000087 | 3300009011 | Bacteria | 88628 |
| 104 | Ga0105251_10001365 | 3300009011 | Bacteria | 21115 |
| 105 | Ga0105251_10001500 | 3300009011 | Bacteria | 20051 |
| 106 | Ga0105251_10004756 | 3300009011 | Bacteria | 9093 |
| 107 | Ga0105251_10007074 | 3300009011 | Bacteria | 6992 |
| 108 | Ga0105251_10024639 | 3300009011 | Bacteria | 3088 |
| 109 | Ga0105251_10039229 | 3300009011 | Bacteria | 2315 |
| 110 | Ga0105244_10000150 | 3300009036 | Bacteria | 73078 |
| 111 | Ga0105244_10003392 | 3300009036 | Bacteria | 11385 |
| 112 | Ga0105244_10006033 | 3300009036 | Bacteria | 7938 |
| 113 | Ga0105244_10015928 | 3300009036 | Bacteria | 4300 |
| 114 | Ga0105244_10025579 | 3300009036 | Bacteria | 3207 |
| 115 | Ga0105244_10032137 | 3300009036 | Bacteria | 2781 |
| 116 | Ga0105244_10072005 | 3300009036 | Bacteria | 1722 |
| 117 | Ga0105244_10137465 | 3300009036 | Bacteria | 1177 |
| 118 | Ga0105244_10140739 | 3300009036 | Bacteria | 1161 |
| 119 | Ga0105244_10162711 | 3300009036 | Bacteria | 1065 |
| 120 | Ga0105244_10235346 | 3300009036 | Bacteria | 856 |
| 121 | Ga0105244_10257747 | 3300009036 | Bacteria | 812 |
| 122 | Ga0105244_10268191 | 3300009036 | Bacteria | 793 |
| 123 | Ga0105244_10347310 | 3300009036 | Bacteria | 684 |
| 124 | Ga0105250_10000189 | 3300009092 | Bacteria | 52791 |
| 125 | Ga0105250_10000563 | 3300009092 | Bacteria | 24835 |
| 126 | Ga0105250_10003375 | 3300009092 | Bacteria | 7577 |
| 127 | Ga0105250_10011966 | 3300009092 | Bacteria | 3593 |
| 128 | Ga0105250_10012895 | 3300009092 | Bacteria | 3440 |
| 129 | Ga0105250_10022989 | 3300009092 | Bacteria | 2512 |
| 130 | Ga0105250_10035736 | 3300009092 | Bacteria | 1994 |
| 131 | Ga0105250_10112493 | 3300009092 | Bacteria | 1115 |
| 132 | Ga0105250_10113245 | 3300009092 | Bacteria | 1112 |
| 133 | Ga0105250_10275142 | 3300009092 | Bacteria | 724 |
| 134 | Ga0105245_10865035 | 3300009098 | Bacteria | 944 |
| 135 | Ga0105243_10005012 | 3300009148 | Bacteria | 10382 |
| 136 | Ga0105243_10006596 | 3300009148 | Bacteria | 8964 |
| 137 | Ga0105243_10140269 | 3300009148 | Bacteria | 2061 |
| 138 | Ga0105243_10279483 | 3300009148 | Bacteria | 1503 |
| 139 | Ga0105242_10000136 | 3300009176 | Bacteria | 53348 |
| 140 | Ga0105242_10040113 | 3300009176 | Bacteria | 3772 |
| 141 | Ga0105242_12054315 | 3300009176 | Bacteria | 615 |
| 142 | Ga0105248_10082623 | 3300009177 | Bacteria | 3613 |
| 143 | Ga0105237_10001470 | 3300009545 | Bacteria | 31051 |
| 144 | Ga0105237_10262504 | 3300009545 | Bacteria | 1730 |
| 145 | Ga0105249_10015383 | 3300009553 | Bacteria | 6771 |
| 146 | Ga0105239_11280485 | 3300010375 | Bacteria | 846 |
| 147 | Ga0105246_10000042 | 3300011119 | Bacteria | 48091 |
| 148 | Ga0105246_10008921 | 3300011119 | Bacteria | 6170 |
| 149 | Ga0105246_10023172 | 3300011119 | Bacteria | 4015 |
| 150 | Ga0105246_10096915 | 3300011119 | Bacteria | 2139 |
| 151 | Ga0105246_11691895 | 3300011119 | Bacteria | 601 |
| 152 | Ga0157319_1012460 | 3300012497 | Bacteria | 718 |
| 153 | Ga0157345_1000150 | 3300012498 | Bacteria | 12039 |
| 154 | Ga0157345_1001360 | 3300012498 | Bacteria | 1728 |
| 155 | Ga0157347_1003012 | 3300012502 | Bacteria | 1483 |
| 156 | Ga0157347_1017063 | 3300012502 | Bacteria | 822 |
| 157 | Ga0157373_10006406 | 3300013100 | Bacteria | 8794 |
| 158 | Ga0157373_10009306 | 3300013100 | Bacteria | 7263 |
| 159 | Ga0157373_10018548 | 3300013100 | Bacteria | 5064 |
| 160 | Ga0157373_10020368 | 3300013100 | Bacteria | 4821 |
| 161 | Ga0157373_10030338 | 3300013100 | Bacteria | 3890 |
| 162 | Ga0157373_10051111 | 3300013100 | Bacteria | 2944 |
| 163 | Ga0157373_10084064 | 3300013100 | Bacteria | 2243 |
| 164 | Ga0157373_10126206 | 3300013100 | Bacteria | 1799 |
| 165 | Ga0157373_10505065 | 3300013100 | Bacteria | 874 |
| 166 | Ga0157373_10989018 | 3300013100 | Bacteria | 627 |
| 167 | Ga0157371_10000233 | 3300013102 | Bacteria | 79696 |
| 168 | Ga0157371_10006166 | 3300013102 | Bacteria | 9950 |
| 169 | Ga0157371_10006436 | 3300013102 | Bacteria | 9690 |
| 170 | Ga0157371_10017734 | 3300013102 | Bacteria | 5282 |
| 171 | Ga0157371_10071084 | 3300013102 | Bacteria | 2463 |
| 172 | Ga0157371_10434187 | 3300013102 | Bacteria | 964 |
| 173 | Ga0157370_10024235 | 3300013104 | Bacteria | 6012 |
| 174 | Ga0157370_10072622 | 3300013104 | Bacteria | 3246 |
| 175 | Ga0157370_10111146 | 3300013104 | Bacteria | 2561 |
| 176 | Ga0157370_10536650 | 3300013104 | Bacteria | 1073 |
| 177 | Ga0157370_10568183 | 3300013104 | Bacteria | 1039 |
| 178 | Ga0157370_11631393 | 3300013104 | Bacteria | 579 |
| 179 | Ga0157369_10015281 | 3300013105 | Bacteria | 8656 |
| 180 | Ga0157369_10015630 | 3300013105 | Bacteria | 8553 |
| 181 | Ga0157369_10029826 | 3300013105 | Bacteria | 6024 |
| 182 | Ga0157369_10049867 | 3300013105 | Bacteria | 4536 |
| 183 | Ga0157369_10599537 | 3300013105 | Bacteria | 1137 |
| 184 | Ga0157369_10857660 | 3300013105 | Bacteria | 932 |
| 185 | Ga0163162_10004175 | 3300013306 | Bacteria | 13879 |
| 186 | Ga0163162_10603127 | 3300013306 | Bacteria | 1224 |
| 187 | Ga0163162_12786312 | 3300013306 | Bacteria | 563 |
| 188 | Ga0157372_10006718 | 3300013307 | Bacteria | 12233 |
| 189 | Ga0157372_10017841 | 3300013307 | Bacteria | 7622 |
| 190 | Ga0157372_11580379 | 3300013307 | Bacteria | 755 |
| 191 | Ga0157375_10010484 | 3300013308 | Bacteria | 8157 |
| 192 | Ga0157375_10061058 | 3300013308 | Bacteria | 3741 |
| 193 | Ga0157375_10078787 | 3300013308 | Bacteria | 3329 |
| 194 | Ga0157375_10506430 | 3300013308 | Bacteria | 1371 |
| 195 | Ga0182008_10007521 | 3300014497 | Bacteria | 6011 |
| 196 | Ga0182008_10021797 | 3300014497 | Bacteria | 3289 |
| 197 | Ga0182008_10022595 | 3300014497 | Bacteria | 3220 |
| 198 | Ga0182008_10023689 | 3300014497 | Bacteria | 3132 |
| 199 | Ga0182008_10043259 | 3300014497 | Bacteria | 2243 |
| 200 | Ga0182008_10071170 | 3300014497 | Bacteria | 1711 |
| 201 | Ga0182008_10091340 | 3300014497 | Bacteria | 1501 |
| 202 | Ga0182008_10265757 | 3300014497 | Bacteria | 888 |
| 203 | Ga0182008_10453331 | 3300014497 | Bacteria | 698 |
| 204 | Ga0182006_1000380 | 3300015261 | Bacteria | 36760 |
| 205 | Ga0182006_1001500 | 3300015261 | Bacteria | 13980 |
| 206 | Ga0182006_1002034 | 3300015261 | Bacteria | 11350 |
| 207 | Ga0182006_1024996 | 3300015261 | Bacteria | 2458 |
| 208 | Ga0182006_1078140 | 3300015261 | Bacteria | 1212 |
| 209 | Ga0182006_1080600 | 3300015261 | Bacteria | 1188 |
| 210 | Ga0182006_1140704 | 3300015261 | Bacteria | 824 |
| 211 | Ga0182007_10000194 | 3300015262 | Bacteria | 40895 |
| 212 | Ga0182007_10011603 | 3300015262 | Bacteria | 3424 |
| 213 | Ga0182005_1001882 | 3300015265 | Bacteria | 7951 |
| 214 | Ga0182005_1009562 | 3300015265 | Bacteria | 2817 |
| 215 | Ga0182005_1009677 | 3300015265 | Bacteria | 2795 |
| 216 | Ga0182005_1043094 | 3300015265 | Bacteria | 1227 |
| 217 | Ga0163161_10010163 | 3300017792 | Bacteria | 6515 |
| 218 | Ga0163161_10013821 | 3300017792 | Bacteria | 5623 |
| 219 | Ga0163161_10020284 | 3300017792 | Bacteria | 4664 |
| 220 | Ga0163161_10144766 | 3300017792 | Bacteria | 1802 |
| 221 | Ga0163161_10244012 | 3300017792 | Bacteria | 1398 |
| 222 | Ga0163161_10402568 | 3300017792 | Bacteria | 1098 |
| 223 | Ga0163161_10465147 | 3300017792 | Bacteria | 1024 |
| 224 | Ga0163161_10474558 | 3300017792 | Bacteria | 1015 |
| 225 | Ga0163161_10962900 | 3300017792 | Bacteria | 726 |
| 226 | Ga0163161_11469852 | 3300017792 | Bacteria | 597 |
| 227 | Ga0209435_107630 | 3300025206 | Bacteria | 1196 |
| 228 | Ga0209760_100037 | 3300025207 | Bacteria | 129761 |
| 229 | Ga0209760_100128 | 3300025207 | Bacteria | 50562 |
| 230 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 231 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 232 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 233 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 234 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 235 | Ga0209563_101918 | 3300025230 | Bacteria | 5031 |
| 236 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 237 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 238 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 239 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 240 | Ga0209258_100150 | 3300025242 | Bacteria | 161813 |
| 241 | Ga0209646_1002644 | 3300025246 | Bacteria | 3844 |
| 242 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 243 | Ga0209759_1004406 | 3300025256 | Bacteria | 5272 |
| 244 | Ga0209759_1006221 | 3300025256 | Bacteria | 4049 |
| 245 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 246 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 247 | Ga0209675_1013183 | 3300025291 | Bacteria | 2605 |
| 248 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 249 | Ga0209676_1000318 | 3300025292 | Bacteria | 94045 |
| 250 | Ga0209676_1000917 | 3300025292 | Bacteria | 36740 |
| 251 | Ga0209676_1007187 | 3300025292 | Bacteria | 5308 |
| 252 | Ga0209676_1018639 | 3300025292 | Bacteria | 2415 |
| 253 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 254 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 255 | Ga0209050_1018157 | 3300025298 | Bacteria | 2750 |
| 256 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 257 | Ga0209051_1000334 | 3300025303 | Bacteria | 70713 |
| 258 | Ga0209051_1028205 | 3300025303 | Bacteria | 2222 |
| 259 | Ga0209257_1003931 | 3300025304 | Bacteria | 12076 |
| 260 | Ga0207656_10000007 | 3300025321 | Bacteria | 289154 |
| 261 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 262 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 263 | Ga0207696_1000094 | 3300025711 | Bacteria | 184065 |
| 264 | Ga0207696_1001227 | 3300025711 | Bacteria | 14541 |
| 265 | Ga0207696_1008849 | 3300025711 | Bacteria | 3805 |
| 266 | Ga0207696_1022518 | 3300025711 | Bacteria | 2001 |
| 267 | Ga0207696_1022870 | 3300025711 | Bacteria | 1979 |
| 268 | Ga0207696_1027622 | 3300025711 | Bacteria | 1748 |
| 269 | Ga0207696_1041058 | 3300025711 | Bacteria | 1353 |
| 270 | Ga0207655_1000326 | 3300025728 | Bacteria | 70089 |
| 271 | Ga0207655_1001453 | 3300025728 | Bacteria | 21920 |
| 272 | Ga0207655_1001564 | 3300025728 | Bacteria | 20589 |
| 273 | Ga0207655_1002818 | 3300025728 | Bacteria | 13475 |
| 274 | Ga0207655_1003190 | 3300025728 | Bacteria | 12358 |
| 275 | Ga0207655_1004885 | 3300025728 | Bacteria | 9300 |
| 276 | Ga0207655_1005690 | 3300025728 | Bacteria | 8425 |
| 277 | Ga0207655_1030358 | 3300025728 | Bacteria | 2515 |
| 278 | Ga0207655_1032538 | 3300025728 | Bacteria | 2381 |
| 279 | Ga0207655_1059076 | 3300025728 | Bacteria | 1495 |
| 280 | Ga0207655_1069941 | 3300025728 | Bacteria | 1309 |
| 281 | Ga0207655_1085012 | 3300025728 | Bacteria | 1130 |
| 282 | Ga0207655_1085532 | 3300025728 | Bacteria | 1125 |
| 283 | Ga0207655_1195513 | 3300025728 | Bacteria | 607 |
| 284 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 285 | Ga0207713_1000081 | 3300025735 | Bacteria | 166910 |
| 286 | Ga0207713_1000331 | 3300025735 | Bacteria | 53100 |
| 287 | Ga0207713_1000434 | 3300025735 | Bacteria | 44039 |
| 288 | Ga0207713_1001155 | 3300025735 | Bacteria | 22292 |
| 289 | Ga0207713_1001511 | 3300025735 | Bacteria | 18343 |
| 290 | Ga0207713_1001867 | 3300025735 | Bacteria | 16020 |
| 291 | Ga0207713_1003673 | 3300025735 | Bacteria | 10325 |
| 292 | Ga0207713_1023716 | 3300025735 | Bacteria | 2880 |
| 293 | Ga0207713_1035648 | 3300025735 | Bacteria | 2144 |
| 294 | Ga0207713_1037064 | 3300025735 | Bacteria | 2084 |
| 295 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 296 | Ga0207671_10190917 | 3300025914 | Bacteria | 1597 |
| 297 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 298 | Ga0207681_10000236 | 3300025923 | Bacteria | 42706 |
| 299 | Ga0207681_10601043 | 3300025923 | Bacteria | 909 |
| 300 | Ga0207650_10000273 | 3300025925 | Bacteria | 54321 |
| 301 | Ga0207650_10001191 | 3300025925 | Bacteria | 19101 |
| 302 | Ga0207706_10000069 | 3300025933 | Bacteria | 105541 |
| 303 | Ga0207706_10016749 | 3300025933 | Bacteria | 6616 |
| 304 | Ga0207686_10018937 | 3300025934 | Bacteria | 3905 |
| 305 | Ga0207686_10199424 | 3300025934 | Bacteria | 1432 |
| 306 | Ga0207709_10000164 | 3300025935 | Bacteria | 91154 |
| 307 | Ga0207709_10003988 | 3300025935 | Bacteria | 8606 |
| 308 | Ga0207709_10182663 | 3300025935 | Bacteria | 1483 |
| 309 | Ga0207711_10192508 | 3300025941 | Bacteria | 1859 |
| 310 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 311 | Ga0207679_10201276 | 3300025945 | Bacteria | 1663 |
| 312 | Ga0207712_10088941 | 3300025961 | Bacteria | 2269 |
| 313 | Ga0207640_10018682 | 3300025981 | Bacteria | 4079 |
| 314 | Ga0207639_10001938 | 3300026041 | Bacteria | 13895 |
| 315 | Ga0207678_10396408 | 3300026067 | Bacteria | 1195 |
| 316 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 317 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 318 | Ga0209281_1010165 | 3300027111 | Bacteria | 2168 |
| 319 | Ga0209281_1013711 | 3300027111 | Bacteria | 1740 |
| 320 | Ga0209371_1003572 | 3300027312 | Bacteria | 7448 |
| 321 | Ga0209967_1015633 | 3300027364 | Bacteria | 1086 |
| 322 | Ga0209999_1016517 | 3300027543 | Bacteria | 1343 |
| 323 | Ga0210002_1026310 | 3300027617 | Bacteria | 954 |
| 324 | Ga0209282_1055635 | 3300027666 | Bacteria | 2237 |
| 325 | Ga0209974_10149544 | 3300027876 | Bacteria | 842 |
| 326 | Ga0209974_10229996 | 3300027876 | Bacteria | 693 |
| 327 | Ga0207428_10010522 | 3300027907 | Bacteria | 8258 |
| 328 | Ga0207428_10037461 | 3300027907 | Bacteria | 3945 |
| 329 | Ga0207428_10041265 | 3300027907 | Bacteria | 3736 |
| 330 | Ga0207428_10054765 | 3300027907 | Bacteria | 3176 |
| 331 | Ga0207428_10107138 | 3300027907 | Bacteria | 2153 |
| 332 | Ga0207428_10210799 | 3300027907 | Bacteria | 1460 |
| 333 | Ga0207428_10301035 | 3300027907 | Bacteria | 1187 |
| 334 | Ga0207428_10438070 | 3300027907 | Bacteria | 954 |
| 335 | Ga0207428_10652450 | 3300027907 | Bacteria | 755 |
| 336 | Ga0207428_11310930 | 3300027907 | Bacteria | 502 |
| 337 | Ga0268266_10190656 | 3300028379 | Bacteria | 1871 |
| 338 | Ga0268266_11291082 | 3300028379 | Bacteria | 705 |
| 339 | Ga0307517_10273045 | 3300028786 | Bacteria | 971 |
| 340 | Ga0268256_1003564 | 3300030500 | Bacteria | 6958 |
| 341 | Ga0307511_10168437 | 3300030521 | Bacteria | 1210 |
| 342 | Ga0314311_1052920 | 3300030733 | Bacteria | 6049 |
| 343 | Ga0316179_1119071 | 3300030734 | Bacteria | 582 |
| 344 | Ga0316178_1039458 | 3300030735 | Bacteria | 28546 |
| 345 | Ga0316183_1008127 | 3300030742 | Bacteria | 2183 |
| 346 | Ga0316183_1136437 | 3300030742 | Bacteria | 520 |
| 347 | Ga0316183_1174722 | 3300030742 | Bacteria | 1254 |
| 348 | Ga0316181_1167159 | 3300030744 | Bacteria | 1922 |
| 349 | Ga0265316_10244112 | 3300031344 | Bacteria | 1320 |
| 350 | Ga0307509_10313682 | 3300031507 | Bacteria | 1309 |
| 351 | Ga0307408_100003159 | 3300031548 | Bacteria | 11358 |
| 352 | Ga0307408_100008950 | 3300031548 | Bacteria | 6612 |
| 353 | Ga0307408_100009139 | 3300031548 | Bacteria | 6537 |
| 354 | Ga0307408_100029957 | 3300031548 | Bacteria | 3775 |
| 355 | Ga0307514_10556022 | 3300031649 | Bacteria | 528 |
| 356 | Ga0307516_10277155 | 3300031730 | Bacteria | 1360 |
| 357 | Ga0307516_10318467 | 3300031730 | Bacteria | 1227 |
| 358 | Ga0307516_10694635 | 3300031730 | Bacteria | 674 |
| 359 | Ga0307405_10002831 | 3300031731 | Bacteria | 7789 |
| 360 | Ga0307405_10013908 | 3300031731 | Bacteria | 4308 |
| 361 | Ga0307405_11212027 | 3300031731 | Bacteria | 653 |
| 362 | Ga0307413_10067790 | 3300031824 | Bacteria | 2232 |
| 363 | Ga0307413_10181364 | 3300031824 | Bacteria | 1501 |
| 364 | Ga0307406_10006076 | 3300031901 | Bacteria | 6635 |
| 365 | Ga0307406_10167042 | 3300031901 | Bacteria | 1588 |
| 366 | Ga0307407_10131949 | 3300031903 | Bacteria | 1599 |
| 367 | Ga0307407_10743082 | 3300031903 | Bacteria | 742 |
| 368 | Ga0307412_10005224 | 3300031911 | Bacteria | 7279 |
| 369 | Ga0307412_10017377 | 3300031911 | Bacteria | 4305 |
| 370 | Ga0307412_10019891 | 3300031911 | Bacteria | 4075 |
| 371 | Ga0307412_10143806 | 3300031911 | Bacteria | 1750 |
| 372 | Ga0307412_10288616 | 3300031911 | Bacteria | 1291 |
| 373 | Ga0307412_11230588 | 3300031911 | Bacteria | 671 |
| 374 | Ga0307409_100003250 | 3300031995 | Bacteria | 8767 |
| 375 | Ga0307409_100025053 | 3300031995 | Bacteria | 4175 |
| 376 | Ga0307416_100161931 | 3300032002 | Bacteria | 2069 |
| 377 | Ga0307414_10028481 | 3300032004 | Bacteria | 3624 |
| 378 | Ga0307414_10036860 | 3300032004 | Bacteria | 3269 |
| 379 | Ga0307414_10218747 | 3300032004 | Bacteria | 1562 |
| 380 | Ga0307414_10342963 | 3300032004 | Bacteria | 1279 |
| 381 | Ga0307411_10003995 | 3300032005 | Bacteria | 6968 |
| 382 | Ga0307411_10091971 | 3300032005 | Bacteria | 2120 |
| 383 | Ga0307411_10164009 | 3300032005 | Bacteria | 1668 |
| 384 | Ga0307411_11934714 | 3300032005 | Bacteria | 549 |
| 385 | Ga0307510_10008778 | 3300033180 | Bacteria | 12045 |
| 386 | Ga0307510_10209008 | 3300033180 | Bacteria | 1476 |
| 387 | Ga0439438_000895 | 3300041405 | Bacteria | 13240 |
| 388 | Ga0439438_000943 | 3300041405 | Bacteria | 12963 |
| 389 | Ga0439438_001610 | 3300041405 | Bacteria | 9901 |
| 390 | Ga0439438_001695 | 3300041405 | Bacteria | 9696 |
| 391 | Ga0439438_007573 | 3300041405 | Bacteria | 3696 |
| 392 | Ga0439438_008436 | 3300041405 | Bacteria | 3419 |
| 393 | Ga0439438_043599 | 3300041405 | Bacteria | 1157 |
| 394 | Ga0439438_062669 | 3300041405 | Bacteria | 929 |
| 395 | Ga0439447_000594 | 3300041407 | Bacteria | 13509 |
| 396 | Ga0439447_001937 | 3300041407 | Bacteria | 7573 |
| 397 | Ga0439447_009105 | 3300041407 | Bacteria | 3027 |
| 398 | Ga0439447_010596 | 3300041407 | Bacteria | 2729 |
| 399 | Ga0439447_014384 | 3300041407 | Bacteria | 2221 |
| 400 | Ga0439447_016669 | 3300041407 | Bacteria | 2012 |
| 401 | Ga0439447_019275 | 3300041407 | Bacteria | 1821 |
| 402 | Ga0439461_0132493 | 3300041410 | Bacteria | 631 |
| 403 | Ga0439466_0001027 | 3300041411 | Bacteria | 10750 |
| 404 | Ga0439466_0003876 | 3300041411 | Bacteria | 5772 |
| 405 | Ga0439466_0011287 | 3300041411 | Bacteria | 3306 |
| 406 | Ga0439466_0022289 | 3300041411 | Bacteria | 2236 |
| 407 | Ga0439466_0026737 | 3300041411 | Bacteria | 2003 |
| 408 | Ga0439466_0029296 | 3300041411 | Bacteria | 1894 |
| 409 | Ga0439465_0025755 | 3300041413 | Bacteria | 1857 |
| 410 | Ga0451797_0245844 | 3300041453 | Bacteria | 784 |
| 411 | Ga0451800_1202188 | 3300041459 | Bacteria | 521 |
| 412 | Ga0451839_1515046 | 3300041496 | Bacteria | 524 |
| 413 | Ga0451843_0348190 | 3300041509 | Bacteria | 569 |
| 414 | Ga0439431_0007158 | 3300041997 | Bacteria | 2484 |
| 415 | Ga0439437_040551 | 3300042000 | Bacteria | 603 |
| 416 | Ga0439445_0005035 | 3300042004 | Bacteria | 3000 |
| 417 | Ga0439445_0070018 | 3300042004 | Bacteria | 969 |
| 418 | Ga0439432_001591 | 3300042006 | Bacteria | 8496 |
| 419 | Ga0439432_001979 | 3300042006 | Bacteria | 7746 |
| 420 | Ga0439432_003888 | 3300042006 | Bacteria | 5501 |
| 421 | Ga0439432_005422 | 3300042006 | Bacteria | 4595 |
| 422 | Ga0439432_008732 | 3300042006 | Bacteria | 3549 |
| 423 | Ga0439432_029115 | 3300042006 | Bacteria | 1796 |
| 424 | Ga0439451_000295 | 3300042009 | Bacteria | 9663 |
| 425 | Ga0439451_001271 | 3300042009 | Bacteria | 4985 |
| 426 | Ga0439451_002836 | 3300042009 | Bacteria | 3529 |
| 427 | Ga0439451_009844 | 3300042009 | Bacteria | 1929 |
| 428 | Ga0439451_021672 | 3300042009 | Bacteria | 1295 |
| 429 | Ga0439451_027034 | 3300042009 | Bacteria | 1156 |
| 430 | Ga0439451_047915 | 3300042009 | Bacteria | 855 |
| 431 | Ga0439452_000245 | 3300042010 | Bacteria | 37540 |
| 432 | Ga0439452_000916 | 3300042010 | Bacteria | 13398 |
| 433 | Ga0439452_002389 | 3300042010 | Bacteria | 6958 |
| 434 | Ga0439452_003442 | 3300042010 | Bacteria | 5539 |
| 435 | Ga0439452_008811 | 3300042010 | Bacteria | 3009 |
| 436 | Ga0439452_011602 | 3300042010 | Bacteria | 2525 |
| 437 | Ga0439452_011979 | 3300042010 | Bacteria | 2478 |
| 438 | Ga0439452_015522 | 3300042010 | Bacteria | 2087 |
| 439 | Ga0439456_000068 | 3300042013 | Bacteria | 36709 |
| 440 | Ga0439456_001604 | 3300042013 | Bacteria | 4559 |
| 441 | Ga0439456_005484 | 3300042013 | Bacteria | 2574 |
| 442 | Ga0439456_006247 | 3300042013 | Bacteria | 2430 |
| 443 | Ga0439456_014350 | 3300042013 | Bacteria | 1651 |
| 444 | Ga0439456_039327 | 3300042013 | Bacteria | 1023 |
| 445 | Ga0439456_045928 | 3300042013 | Bacteria | 951 |
| 446 | Ga0439456_114566 | 3300042013 | Bacteria | 615 |
| 447 | Ga0439463_001959 | 3300042016 | Bacteria | 5355 |
| 448 | Ga0439463_002347 | 3300042016 | Bacteria | 4822 |
| 449 | Ga0439463_009395 | 3300042016 | Bacteria | 2406 |
| 450 | Ga0439463_011578 | 3300042016 | Bacteria | 2165 |
| 451 | Ga0439463_023609 | 3300042016 | Bacteria | 1540 |
| 452 | Ga0439463_029459 | 3300042016 | Bacteria | 1382 |
| 453 | Ga0450911_000931 | 3300042115 | Bacteria | 7695 |
| 454 | Ga0450911_007407 | 3300042115 | Bacteria | 1591 |
| 455 | Ga0450919_000254 | 3300042121 | Bacteria | 6116 |
| 456 | Ga0450920_000169 | 3300042122 | Bacteria | 9193 |
| 457 | Ga0450922_000220 | 3300042124 | Bacteria | 6100 |
| 458 | Ga0450922_000469 | 3300042124 | Bacteria | 4306 |
| 459 | Ga0450890_000360 | 3300042127 | Bacteria | 6660 |
| 460 | Ga0450902_002273 | 3300042137 | Bacteria | 2716 |
| 461 | Ga0450902_005477 | 3300042137 | Bacteria | 1920 |
| 462 | Ga0450903_000405 | 3300042138 | Bacteria | 9238 |
| 463 | Ga0450903_000944 | 3300042138 | Bacteria | 5579 |
| 464 | Ga0450903_003293 | 3300042138 | Bacteria | 2804 |
| 465 | Ga0450903_018666 | 3300042138 | Bacteria | 1079 |
| 466 | Ga0450904_001729 | 3300042139 | Bacteria | 2884 |
| 467 | Ga0450904_002969 | 3300042139 | Bacteria | 1908 |
| 468 | Ga0450906_001172 | 3300042145 | Bacteria | 5801 |
| 469 | Ga0450906_001316 | 3300042145 | Bacteria | 5444 |
| 470 | Ga0450906_007193 | 3300042145 | Bacteria | 2206 |
| 471 | Ga0450907_000396 | 3300042146 | Bacteria | 13194 |
| 472 | Ga0450907_001068 | 3300042146 | Bacteria | 6377 |
| 473 | Ga0450907_006889 | 3300042146 | Bacteria | 1895 |
| 474 | Ga0450910_005651 | 3300042147 | Bacteria | 1712 |
| 475 | Ga0450910_014634 | 3300042147 | Bacteria | 1149 |
| 476 | Ga0439446_0001252 | 3300042156 | Bacteria | 5709 |
| 477 | Ga0439446_0010469 | 3300042156 | Bacteria | 2497 |
| 478 | Ga0439446_0352807 | 3300042156 | Bacteria | 524 |
| 479 | Ga0450908_000362 | 3300042184 | Bacteria | 8786 |
| 480 | Ga0450908_010904 | 3300042184 | Bacteria | 1669 |
| 481 | Ga0450908_033253 | 3300042184 | Bacteria | 894 |
| 482 | Ga0450909_000403 | 3300042185 | Bacteria | 5523 |
| 483 | Ga0450909_025204 | 3300042185 | Bacteria | 894 |
| 484 | Ga0439434_0001038 | 3300042435 | Bacteria | 8054 |
| 485 | Ga0439464_0011426 | 3300042439 | Bacteria | 2354 |
| 486 | Ga0439460_0000843 | 3300042461 | Bacteria | 6979 |
| 487 | Ga0439460_0001275 | 3300042461 | Bacteria | 5930 |
| 488 | Ga0439460_0011869 | 3300042461 | Bacteria | 2251 |
| 489 | Ga0439460_0175187 | 3300042461 | Bacteria | 723 |
| 490 | Ga0450893_0116644 | 3300042532 | Bacteria | 554 |
| 491 | Ga0450901_001516 | 3300042533 | Bacteria | 2641 |
| 492 | Ga0439440_0007592 | 3300042993 | Bacteria | 2206 |
| 493 | Ga0439440_0010898 | 3300042993 | Bacteria | 1909 |
| 494 | Ga0439440_0015543 | 3300042993 | Bacteria | 1655 |
| 495 | Ga0495617_001252 | 3300046452 | Bacteria | 11397 |
| 496 | Ga0495617_002036 | 3300046452 | Bacteria | 8398 |
| 497 | Ga0495617_009461 | 3300046452 | Bacteria | 3346 |
| 498 | Ga0495617_016040 | 3300046452 | Bacteria | 2534 |
| 499 | Ga0495617_025538 | 3300046452 | Bacteria | 1991 |
| 500 | Ga0495617_035712 | 3300046452 | Bacteria | 1668 |
| 501 | Ga0495617_039006 | 3300046452 | Bacteria | 1588 |
| 502 | Ga0495617_067035 | 3300046452 | Bacteria | 1182 |
| 503 | Ga0495617_130402 | 3300046452 | Bacteria | 806 |
| 504 | Ga0495617_192372 | 3300046452 | Bacteria | 639 |
| 505 | Ga0495617_196449 | 3300046452 | Bacteria | 631 |
| 506 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 507 | Ga0495627_002567 | 3300046453 | Bacteria | 8625 |
| 508 | Ga0495627_002595 | 3300046453 | Bacteria | 8536 |
| 509 | Ga0495627_002735 | 3300046453 | Bacteria | 8228 |
| 510 | Ga0495627_003498 | 3300046453 | Bacteria | 6897 |
| 511 | Ga0495627_006230 | 3300046453 | Bacteria | 4692 |
| 512 | Ga0495627_055006 | 3300046453 | Bacteria | 1188 |
| 513 | Ga0495627_070778 | 3300046453 | Bacteria | 1019 |
| 514 | Ga0495627_086507 | 3300046453 | Bacteria | 904 |
| 515 | Ga0495627_130841 | 3300046453 | Bacteria | 706 |
| 516 | Ga0495603_0002137 | 3300046455 | Bacteria | 11627 |
| 517 | Ga0495603_0014300 | 3300046455 | Bacteria | 4800 |
| 518 | Ga0495590_0002152 | 3300046457 | Bacteria | 8267 |
| 519 | Ga0495590_0003297 | 3300046457 | Bacteria | 6607 |
| 520 | Ga0495590_0008119 | 3300046457 | Bacteria | 4020 |
| 521 | Ga0495590_0047060 | 3300046457 | Bacteria | 1504 |
| 522 | Ga0495590_0070298 | 3300046457 | Bacteria | 1227 |
| 523 | Ga0495590_0112100 | 3300046457 | Bacteria | 974 |
| 524 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 525 | Ga0495591_000244 | 3300046458 | Bacteria | 52389 |
| 526 | Ga0495591_001373 | 3300046458 | Bacteria | 15251 |
| 527 | Ga0495591_003017 | 3300046458 | Bacteria | 8961 |
| 528 | Ga0495591_004206 | 3300046458 | Bacteria | 7132 |
| 529 | Ga0495591_005508 | 3300046458 | Bacteria | 5843 |
| 530 | Ga0495591_005520 | 3300046458 | Bacteria | 5833 |
| 531 | Ga0495591_005940 | 3300046458 | Bacteria | 5515 |
| 532 | Ga0495591_006499 | 3300046458 | Bacteria | 5161 |
| 533 | Ga0495591_007664 | 3300046458 | Bacteria | 4550 |
| 534 | Ga0495591_015706 | 3300046458 | Bacteria | 2664 |
| 535 | Ga0495591_026961 | 3300046458 | Bacteria | 1777 |
| 536 | Ga0495629_0122911 | 3300046459 | Bacteria | 1808 |
| 537 | Ga0495638_0003976 | 3300046460 | Bacteria | 11374 |
| 538 | Ga0495638_0024770 | 3300046460 | Bacteria | 3906 |
| 539 | Ga0495638_0028408 | 3300046460 | Bacteria | 3612 |
| 540 | Ga0495638_0040944 | 3300046460 | Bacteria | 2933 |
| 541 | Ga0495638_0045473 | 3300046460 | Bacteria | 2761 |
| 542 | Ga0495638_0052331 | 3300046460 | Bacteria | 2543 |
| 543 | Ga0495638_0077130 | 3300046460 | Bacteria | 2029 |
| 544 | Ga0495638_0175252 | 3300046460 | Bacteria | 1227 |
| 545 | Ga0495638_0180132 | 3300046460 | Bacteria | 1206 |
| 546 | Ga0495638_0214706 | 3300046460 | Bacteria | 1078 |
| 547 | Ga0495638_0251377 | 3300046460 | Bacteria | 974 |
| 548 | Ga0495638_0362105 | 3300046460 | Bacteria | 762 |
| 549 | Ga0495653_0012150 | 3300046463 | Bacteria | 7026 |
| 550 | Ga0495653_0015283 | 3300046463 | Bacteria | 6256 |
| 551 | Ga0495653_0117071 | 3300046463 | Bacteria | 1904 |
| 552 | Ga0495650_0001139 | 3300046471 | Bacteria | 28818 |
| 553 | Ga0495650_0005815 | 3300046471 | Bacteria | 7863 |
| 554 | Ga0495650_0013469 | 3300046471 | Bacteria | 4321 |
| 555 | Ga0495650_0035876 | 3300046471 | Bacteria | 2177 |
| 556 | Ga0495650_0100235 | 3300046471 | Bacteria | 1088 |
| 557 | Ga0495650_0147655 | 3300046471 | Bacteria | 846 |
| 558 | Ga0495580_0215592 | 3300046472 | Bacteria | 1320 |
| 559 | Ga0495582_0003045 | 3300046473 | Bacteria | 9387 |
| 560 | Ga0495605_0000019 | 3300046474 | Bacteria | 270010 |
| 561 | Ga0495605_0000590 | 3300046474 | Bacteria | 28966 |
| 562 | Ga0495605_0001401 | 3300046474 | Bacteria | 15854 |
| 563 | Ga0495605_0002078 | 3300046474 | Bacteria | 12623 |
| 564 | Ga0495605_0004708 | 3300046474 | Bacteria | 7980 |
| 565 | Ga0495605_0013797 | 3300046474 | Bacteria | 4441 |
| 566 | Ga0495605_0014665 | 3300046474 | Bacteria | 4283 |
| 567 | Ga0495605_0015980 | 3300046474 | Bacteria | 4072 |
| 568 | Ga0495605_0028743 | 3300046474 | Bacteria | 2868 |
| 569 | Ga0495605_0032698 | 3300046474 | Bacteria | 2646 |
| 570 | Ga0495605_0053149 | 3300046474 | Bacteria | 1966 |
| 571 | Ga0495605_0074953 | 3300046474 | Bacteria | 1591 |
| 572 | Ga0495605_0122104 | 3300046474 | Bacteria | 1180 |
| 573 | Ga0495639_0000839 | 3300046475 | Bacteria | 14001 |
| 574 | Ga0495584_0001559 | 3300046491 | Bacteria | 13610 |
| 575 | Ga0495584_0003862 | 3300046491 | Bacteria | 8126 |
| 576 | Ga0495584_0008899 | 3300046491 | Bacteria | 5189 |
| 577 | Ga0495584_0013034 | 3300046491 | Bacteria | 4241 |
| 578 | Ga0495584_0013406 | 3300046491 | Bacteria | 4185 |
| 579 | Ga0495584_0014901 | 3300046491 | Bacteria | 3960 |
| 580 | Ga0495584_0016932 | 3300046491 | Bacteria | 3714 |
| 581 | Ga0495584_0030067 | 3300046491 | Bacteria | 2752 |
| 582 | Ga0495584_0045569 | 3300046491 | Bacteria | 2212 |
| 583 | Ga0495584_0171292 | 3300046491 | Bacteria | 1103 |
| 584 | Ga0495584_0193554 | 3300046491 | Bacteria | 1033 |
| 585 | Ga0495584_0355969 | 3300046491 | Bacteria | 743 |
| 586 | Ga0495585_0000279 | 3300046492 | Bacteria | 51082 |
| 587 | Ga0495585_0004049 | 3300046492 | Bacteria | 9646 |
| 588 | Ga0495585_0006058 | 3300046492 | Bacteria | 7566 |
| 589 | Ga0495585_0008285 | 3300046492 | Bacteria | 6310 |
| 590 | Ga0495585_0017741 | 3300046492 | Bacteria | 4109 |
| 591 | Ga0495585_0039667 | 3300046492 | Bacteria | 2646 |
| 592 | Ga0495585_0069924 | 3300046492 | Bacteria | 1915 |
| 593 | Ga0495585_0082562 | 3300046492 | Bacteria | 1739 |
| 594 | Ga0495585_0134041 | 3300046492 | Bacteria | 1301 |
| 595 | Ga0495585_0159267 | 3300046492 | Bacteria | 1172 |
| 596 | Ga0495585_0412471 | 3300046492 | Bacteria | 649 |
| 597 | Ga0495594_0003858 | 3300046499 | Bacteria | 7702 |
| 598 | Ga0495594_0164820 | 3300046499 | Bacteria | 1260 |
| 599 | Ga0495596_0000273 | 3300046500 | Bacteria | 34263 |
| 600 | Ga0495596_0006975 | 3300046500 | Bacteria | 5136 |
| 601 | Ga0495596_0007429 | 3300046500 | Bacteria | 4944 |
| 602 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 603 | Ga0495607_0001773 | 3300046501 | Bacteria | 18456 |
| 604 | Ga0495607_0005339 | 3300046501 | Bacteria | 9231 |
| 605 | Ga0495607_0006721 | 3300046501 | Bacteria | 8047 |
| 606 | Ga0495607_0010685 | 3300046501 | Bacteria | 6153 |
| 607 | Ga0495607_0012678 | 3300046501 | Bacteria | 5552 |
| 608 | Ga0495607_0014232 | 3300046501 | Bacteria | 5186 |
| 609 | Ga0495607_0015050 | 3300046501 | Bacteria | 5023 |
| 610 | Ga0495607_0020866 | 3300046501 | Bacteria | 4130 |
| 611 | Ga0495607_0020932 | 3300046501 | Bacteria | 4122 |
| 612 | Ga0495607_0021828 | 3300046501 | Bacteria | 4026 |
| 613 | Ga0495607_0028371 | 3300046501 | Bacteria | 3454 |
| 614 | Ga0495607_0029331 | 3300046501 | Bacteria | 3385 |
| 615 | Ga0495607_0029336 | 3300046501 | Bacteria | 3385 |
| 616 | Ga0495607_0042096 | 3300046501 | Bacteria | 2709 |
| 617 | Ga0495607_0042171 | 3300046501 | Bacteria | 2706 |
| 618 | Ga0495607_0048570 | 3300046501 | Bacteria | 2481 |
| 619 | Ga0495607_0051269 | 3300046501 | Bacteria | 2397 |
| 620 | Ga0495607_0057366 | 3300046501 | Bacteria | 2231 |
| 621 | Ga0495607_0058053 | 3300046501 | Bacteria | 2215 |
| 622 | Ga0495607_0059245 | 3300046501 | Bacteria | 2184 |
| 623 | Ga0495607_0106124 | 3300046501 | Bacteria | 1496 |
| 624 | Ga0495607_0168836 | 3300046501 | Bacteria | 1106 |
| 625 | Ga0495607_0252192 | 3300046501 | Bacteria | 849 |
| 626 | Ga0495607_0334228 | 3300046501 | Bacteria | 703 |
| 627 | Ga0495607_0521332 | 3300046501 | Bacteria | 525 |
| 628 | Ga0495583_0000097 | 3300046506 | Bacteria | 149533 |
| 629 | Ga0495583_0002661 | 3300046506 | Bacteria | 14867 |
| 630 | Ga0495583_0005952 | 3300046506 | Bacteria | 8095 |
| 631 | Ga0495583_0007988 | 3300046506 | Bacteria | 6544 |
| 632 | Ga0495583_0016635 | 3300046506 | Bacteria | 3944 |
| 633 | Ga0495583_0027385 | 3300046506 | Bacteria | 2812 |
| 634 | Ga0495583_0034029 | 3300046506 | Bacteria | 2445 |
| 635 | Ga0495583_0034553 | 3300046506 | Bacteria | 2420 |
| 636 | Ga0495583_0037392 | 3300046506 | Bacteria | 2301 |
| 637 | Ga0495583_0041212 | 3300046506 | Bacteria | 2164 |
| 638 | Ga0495606_0000237 | 3300046507 | Bacteria | 97568 |
| 639 | Ga0495606_0002076 | 3300046507 | Bacteria | 24480 |
| 640 | Ga0495606_0004691 | 3300046507 | Bacteria | 13501 |
| 641 | Ga0495606_0009720 | 3300046507 | Bacteria | 8092 |
| 642 | Ga0495606_0017306 | 3300046507 | Bacteria | 5456 |
| 643 | Ga0495606_0020279 | 3300046507 | Bacteria | 4907 |
| 644 | Ga0495606_0023807 | 3300046507 | Bacteria | 4428 |
| 645 | Ga0495606_0026099 | 3300046507 | Bacteria | 4167 |
| 646 | Ga0495606_0036618 | 3300046507 | Bacteria | 3340 |
| 647 | Ga0495606_0039526 | 3300046507 | Bacteria | 3177 |
| 648 | Ga0495606_0133160 | 3300046507 | Bacteria | 1475 |
| 649 | Ga0495606_0159045 | 3300046507 | Bacteria | 1319 |
| 650 | Ga0495606_0257321 | 3300046507 | Bacteria | 965 |
| 651 | Ga0495606_0403815 | 3300046507 | Bacteria | 711 |
| 652 | Ga0495610_0006632 | 3300046512 | Bacteria | 7905 |
| 653 | Ga0495610_0007628 | 3300046512 | Bacteria | 7159 |
| 654 | Ga0495610_0010780 | 3300046512 | Bacteria | 5648 |
| 655 | Ga0495610_0014248 | 3300046512 | Bacteria | 4681 |
| 656 | Ga0495610_0015247 | 3300046512 | Bacteria | 4474 |
| 657 | Ga0495610_0020165 | 3300046512 | Bacteria | 3708 |
| 658 | Ga0495610_0029109 | 3300046512 | Bacteria | 2913 |
| 659 | Ga0495610_0039557 | 3300046512 | Bacteria | 2383 |
| 660 | Ga0495610_0133919 | 3300046512 | Bacteria | 1073 |
| 661 | Ga0495610_0189861 | 3300046512 | Bacteria | 848 |
| 662 | Ga0495610_0209132 | 3300046512 | Bacteria | 794 |
| 663 | Ga0495610_0297949 | 3300046512 | Bacteria | 622 |
| 664 | Ga0495610_0322549 | 3300046512 | Bacteria | 589 |
| 665 | Ga0495616_0003539 | 3300046513 | Bacteria | 9981 |
| 666 | Ga0495616_0008647 | 3300046513 | Bacteria | 6012 |
| 667 | Ga0495616_0010889 | 3300046513 | Bacteria | 5237 |
| 668 | Ga0495616_0018172 | 3300046513 | Bacteria | 3864 |
| 669 | Ga0495616_0023109 | 3300046513 | Bacteria | 3349 |
| 670 | Ga0495616_0029138 | 3300046513 | Bacteria | 2917 |
| 671 | Ga0495616_0070581 | 3300046513 | Bacteria | 1691 |
| 672 | Ga0495616_0097104 | 3300046513 | Bacteria | 1386 |
| 673 | Ga0495616_0295219 | 3300046513 | Bacteria | 685 |
| 674 | Ga0495616_0470255 | 3300046513 | Bacteria | 506 |
| 675 | Ga0495620_0000199 | 3300046515 | Bacteria | 46081 |
| 676 | Ga0495620_0000798 | 3300046515 | Bacteria | 19340 |
| 677 | Ga0495620_0003430 | 3300046515 | Bacteria | 9067 |
| 678 | Ga0495620_0015499 | 3300046515 | Bacteria | 3846 |
| 679 | Ga0495620_0018305 | 3300046515 | Bacteria | 3471 |
| 680 | Ga0495620_0018686 | 3300046515 | Bacteria | 3428 |
| 681 | Ga0495620_0031579 | 3300046515 | Bacteria | 2425 |
| 682 | Ga0495620_0039954 | 3300046515 | Bacteria | 2069 |
| 683 | Ga0495620_0044178 | 3300046515 | Bacteria | 1937 |
| 684 | Ga0495620_0048867 | 3300046515 | Bacteria | 1813 |
| 685 | Ga0495630_0065616 | 3300046517 | Bacteria | 2728 |
| 686 | Ga0495630_0150193 | 3300046517 | Bacteria | 1772 |
| 687 | Ga0495631_0000772 | 3300046518 | Bacteria | 20599 |
| 688 | Ga0495631_0003335 | 3300046518 | Bacteria | 8818 |
| 689 | Ga0495631_0006752 | 3300046518 | Bacteria | 5890 |
| 690 | Ga0495631_0015542 | 3300046518 | Bacteria | 3644 |
| 691 | Ga0495631_0020507 | 3300046518 | Bacteria | 3088 |
| 692 | Ga0495631_0043333 | 3300046518 | Bacteria | 1985 |
| 693 | Ga0495631_0057746 | 3300046518 | Bacteria | 1688 |
| 694 | Ga0495631_0060810 | 3300046518 | Bacteria | 1638 |
| 695 | Ga0495631_0102190 | 3300046518 | Bacteria | 1233 |
| 696 | Ga0495631_0112900 | 3300046518 | Bacteria | 1168 |
| 697 | Ga0495631_0114209 | 3300046518 | Bacteria | 1161 |
| 698 | Ga0495631_0189058 | 3300046518 | Bacteria | 882 |
| 699 | Ga0495632_0003630 | 3300046519 | Bacteria | 10842 |
| 700 | Ga0495632_0003904 | 3300046519 | Bacteria | 10360 |
| 701 | Ga0495632_0003917 | 3300046519 | Bacteria | 10340 |
| 702 | Ga0495632_0007161 | 3300046519 | Bacteria | 7052 |
| 703 | Ga0495632_0012468 | 3300046519 | Bacteria | 4901 |
| 704 | Ga0495632_0014516 | 3300046519 | Bacteria | 4451 |
| 705 | Ga0495632_0019146 | 3300046519 | Bacteria | 3736 |
| 706 | Ga0495632_0025863 | 3300046519 | Bacteria | 3098 |
| 707 | Ga0495632_0032297 | 3300046519 | Bacteria | 2698 |
| 708 | Ga0495632_0072565 | 3300046519 | Bacteria | 1651 |
| 709 | Ga0495632_0123316 | 3300046519 | Bacteria | 1209 |
| 710 | Ga0495632_0203366 | 3300046519 | Bacteria | 901 |
| 711 | Ga0495632_0225021 | 3300046519 | Bacteria | 847 |
| 712 | Ga0495632_0242218 | 3300046519 | Bacteria | 811 |
| 713 | Ga0495632_0277529 | 3300046519 | Bacteria | 746 |
| 714 | Ga0495632_0349209 | 3300046519 | Bacteria | 650 |
| 715 | Ga0495632_0378422 | 3300046519 | Bacteria | 620 |
| 716 | Ga0495637_0000333 | 3300046520 | Bacteria | 36498 |
| 717 | Ga0495637_0001859 | 3300046520 | Bacteria | 12069 |
| 718 | Ga0495637_0002804 | 3300046520 | Bacteria | 9447 |
| 719 | Ga0495637_0003493 | 3300046520 | Bacteria | 8341 |
| 720 | Ga0495637_0003851 | 3300046520 | Bacteria | 7870 |
| 721 | Ga0495637_0004813 | 3300046520 | Bacteria | 6965 |
| 722 | Ga0495637_0009864 | 3300046520 | Bacteria | 4644 |
| 723 | Ga0495637_0015007 | 3300046520 | Bacteria | 3643 |
| 724 | Ga0495637_0016477 | 3300046520 | Bacteria | 3453 |
| 725 | Ga0495637_0020565 | 3300046520 | Bacteria | 3036 |
| 726 | Ga0495637_0021554 | 3300046520 | Bacteria | 2953 |
| 727 | Ga0495637_0025432 | 3300046520 | Bacteria | 2667 |
| 728 | Ga0495637_0026362 | 3300046520 | Bacteria | 2610 |
| 729 | Ga0495637_0043095 | 3300046520 | Bacteria | 1928 |
| 730 | Ga0495637_0047846 | 3300046520 | Bacteria | 1803 |
| 731 | Ga0495637_0063188 | 3300046520 | Bacteria | 1513 |
| 732 | Ga0495637_0067211 | 3300046520 | Bacteria | 1455 |
| 733 | Ga0495637_0086913 | 3300046520 | Bacteria | 1238 |
| 734 | Ga0495637_0120707 | 3300046520 | Bacteria | 1008 |
| 735 | Ga0495637_0366454 | 3300046520 | Bacteria | 503 |
| 736 | Ga0495643_0030417 | 3300046522 | Bacteria | 3015 |
| 737 | Ga0495643_0036762 | 3300046522 | Bacteria | 2688 |
| 738 | Ga0495643_0037350 | 3300046522 | Bacteria | 2665 |
| 739 | Ga0495643_0057689 | 3300046522 | Bacteria | 2068 |
| 740 | Ga0495643_0082163 | 3300046522 | Bacteria | 1674 |
| 741 | Ga0495644_0001079 | 3300046523 | Bacteria | 11314 |
| 742 | Ga0495644_0002667 | 3300046523 | Bacteria | 7094 |
| 743 | Ga0495644_0019228 | 3300046523 | Bacteria | 2608 |
| 744 | Ga0495644_0107319 | 3300046523 | Bacteria | 1058 |
| 745 | Ga0495644_0310905 | 3300046523 | Bacteria | 617 |
| 746 | Ga0495648_0004484 | 3300046524 | Bacteria | 11922 |
| 747 | Ga0495648_0007362 | 3300046524 | Bacteria | 8818 |
| 748 | Ga0495648_0010745 | 3300046524 | Bacteria | 6951 |
| 749 | Ga0495648_0012344 | 3300046524 | Bacteria | 6380 |
| 750 | Ga0495648_0020594 | 3300046524 | Bacteria | 4593 |
| 751 | Ga0495648_0025399 | 3300046524 | Bacteria | 4011 |
| 752 | Ga0495648_0032368 | 3300046524 | Bacteria | 3432 |
| 753 | Ga0495648_0038504 | 3300046524 | Bacteria | 3056 |
| 754 | Ga0495648_0061353 | 3300046524 | Bacteria | 2234 |
| 755 | Ga0495648_0095615 | 3300046524 | Bacteria | 1652 |
| 756 | Ga0495648_0096639 | 3300046524 | Bacteria | 1640 |
| 757 | Ga0495648_0158710 | 3300046524 | Bacteria | 1171 |
| 758 | Ga0495648_0203612 | 3300046524 | Bacteria | 988 |
| 759 | Ga0495666_0020494 | 3300046526 | Bacteria | 3275 |
| 760 | Ga0495666_0025496 | 3300046526 | Bacteria | 2919 |
| 761 | Ga0495666_0295167 | 3300046526 | Bacteria | 733 |
| 762 | Ga0495642_0000088 | 3300046528 | Bacteria | 53831 |
| 763 | Ga0495642_0002833 | 3300046528 | Bacteria | 6925 |
| 764 | Ga0495642_0006336 | 3300046528 | Bacteria | 4535 |
| 765 | Ga0495652_0918076 | 3300046529 | Bacteria | 577 |
| 766 | Ga0495654_0003162 | 3300046530 | Bacteria | 10219 |
| 767 | Ga0495654_0005006 | 3300046530 | Bacteria | 7778 |
| 768 | Ga0495654_0007765 | 3300046530 | Bacteria | 5968 |
| 769 | Ga0495654_0008006 | 3300046530 | Bacteria | 5868 |
| 770 | Ga0495654_0013905 | 3300046530 | Bacteria | 4295 |
| 771 | Ga0495654_0014278 | 3300046530 | Bacteria | 4231 |
| 772 | Ga0495654_0015695 | 3300046530 | Bacteria | 4019 |
| 773 | Ga0495654_0024480 | 3300046530 | Bacteria | 3117 |
| 774 | Ga0495654_0029209 | 3300046530 | Bacteria | 2812 |
| 775 | Ga0495654_0032489 | 3300046530 | Bacteria | 2646 |
| 776 | Ga0495654_0034708 | 3300046530 | Bacteria | 2543 |
| 777 | Ga0495654_0036733 | 3300046530 | Bacteria | 2460 |
| 778 | Ga0495654_0047465 | 3300046530 | Bacteria | 2110 |
| 779 | Ga0495654_0068708 | 3300046530 | Bacteria | 1683 |
| 780 | Ga0495654_0163503 | 3300046530 | Bacteria | 975 |
| 781 | Ga0495586_0093975 | 3300046535 | Bacteria | 1658 |
| 782 | Ga0495587_0020259 | 3300046536 | Bacteria | 4105 |
| 783 | Ga0495587_0084461 | 3300046536 | Bacteria | 1838 |
| 784 | Ga0495587_0245911 | 3300046536 | Bacteria | 1006 |
| 785 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 786 | Ga0495609_0000057 | 3300046538 | Bacteria | 143793 |
| 787 | Ga0495609_0000223 | 3300046538 | Bacteria | 55773 |
| 788 | Ga0495609_0003348 | 3300046538 | Bacteria | 9243 |
| 789 | Ga0495609_0009468 | 3300046538 | Bacteria | 4712 |
| 790 | Ga0495609_0022218 | 3300046538 | Bacteria | 2923 |
| 791 | Ga0495609_0409236 | 3300046538 | Bacteria | 542 |
| 792 | Ga0495597_0000068 | 3300046542 | Bacteria | 90143 |
| 793 | Ga0495597_0003733 | 3300046542 | Bacteria | 8690 |
| 794 | Ga0495597_0005108 | 3300046542 | Bacteria | 7003 |
| 795 | Ga0495597_0006159 | 3300046542 | Bacteria | 6236 |
| 796 | Ga0495597_0015117 | 3300046542 | Bacteria | 3659 |
| 797 | Ga0495597_0015539 | 3300046542 | Bacteria | 3603 |
| 798 | Ga0495597_0022429 | 3300046542 | Bacteria | 2929 |
| 799 | Ga0495597_0028744 | 3300046542 | Bacteria | 2542 |
| 800 | Ga0495597_0043844 | 3300046542 | Bacteria | 1990 |
| 801 | Ga0495597_0105257 | 3300046542 | Bacteria | 1186 |
| 802 | Ga0495622_0001129 | 3300046557 | Bacteria | 13944 |
| 803 | Ga0495622_0001853 | 3300046557 | Bacteria | 10431 |
| 804 | Ga0495622_0003426 | 3300046557 | Bacteria | 7476 |
| 805 | Ga0495622_0009910 | 3300046557 | Bacteria | 4408 |
| 806 | Ga0495622_0016619 | 3300046557 | Bacteria | 3427 |
| 807 | Ga0495622_0125520 | 3300046557 | Bacteria | 1170 |
| 808 | Ga0495622_0372424 | 3300046557 | Bacteria | 617 |
| 809 | Ga0495633_0000038 | 3300046558 | Bacteria | 182144 |
| 810 | Ga0495633_0007155 | 3300046558 | Bacteria | 6472 |
| 811 | Ga0495633_0327738 | 3300046558 | Bacteria | 694 |
| 812 | Ga0495656_0138879 | 3300046615 | Bacteria | 1163 |
| 813 | Ga0495656_0192773 | 3300046615 | Bacteria | 1007 |
| 814 | Ga0495656_0622416 | 3300046615 | Bacteria | 578 |
| 815 | Ga0495668_0008897 | 3300046616 | Bacteria | 6212 |
| 816 | Ga0495668_0013745 | 3300046616 | Bacteria | 4763 |
| 817 | Ga0495668_0021876 | 3300046616 | Bacteria | 3659 |
| 818 | Ga0495668_0085301 | 3300046616 | Bacteria | 1732 |
| 819 | Ga0495668_0118823 | 3300046616 | Bacteria | 1445 |
| 820 | Ga0495668_0212029 | 3300046616 | Bacteria | 1060 |
| 821 | Ga0495668_0230338 | 3300046616 | Bacteria | 1014 |
| 822 | Ga0495668_0251049 | 3300046616 | Bacteria | 968 |
| 823 | Ga0495634_0002154 | 3300046642 | Bacteria | 16568 |
| 824 | Ga0495611_0001347 | 3300046648 | Bacteria | 12427 |
| 825 | Ga0495611_0001666 | 3300046648 | Bacteria | 10769 |
| 826 | Ga0495611_0007468 | 3300046648 | Bacteria | 4639 |
| 827 | Ga0495611_0008270 | 3300046648 | Bacteria | 4411 |
| 828 | Ga0495611_0129438 | 3300046648 | Bacteria | 1177 |
| 829 | Ga0495611_0153660 | 3300046648 | Bacteria | 1074 |
| 830 | Ga0495611_0349589 | 3300046648 | Bacteria | 678 |
| 831 | Ga0495625_0000027 | 3300046660 | Bacteria | 258545 |
| 832 | Ga0495625_0006192 | 3300046660 | Bacteria | 10719 |
| 833 | Ga0495625_0023688 | 3300046660 | Bacteria | 4685 |
| 834 | Ga0495625_0043629 | 3300046660 | Bacteria | 3251 |
| 835 | Ga0495625_0114443 | 3300046660 | Bacteria | 1841 |
| 836 | Ga0495625_0240886 | 3300046660 | Bacteria | 1177 |
| 837 | Ga0495625_0484612 | 3300046660 | Bacteria | 758 |
| 838 | Ga0495635_0002064 | 3300046663 | Bacteria | 13612 |
| 839 | Ga0495635_0048295 | 3300046663 | Bacteria | 2934 |
| 840 | Ga0495659_0000084 | 3300046664 | Bacteria | 40750 |
| 841 | Ga0495659_0011412 | 3300046664 | Bacteria | 2862 |
| 842 | Ga0495661_0000079 | 3300046665 | Bacteria | 117662 |
| 843 | Ga0495661_0000174 | 3300046665 | Bacteria | 74521 |
| 844 | Ga0495661_0000605 | 3300046665 | Bacteria | 36676 |
| 845 | Ga0495661_0003371 | 3300046665 | Bacteria | 11839 |
| 846 | Ga0495661_0008638 | 3300046665 | Bacteria | 7041 |
| 847 | Ga0495661_0012878 | 3300046665 | Bacteria | 5636 |
| 848 | Ga0495661_0034417 | 3300046665 | Bacteria | 3188 |
| 849 | Ga0495661_0051015 | 3300046665 | Bacteria | 2500 |
| 850 | Ga0495661_0081179 | 3300046665 | Bacteria | 1869 |
| 851 | Ga0495661_0138820 | 3300046665 | Bacteria | 1324 |
| 852 | Ga0495661_0164656 | 3300046665 | Bacteria | 1187 |
| 853 | Ga0495661_0288527 | 3300046665 | Bacteria | 825 |
| 854 | Ga0495661_0315930 | 3300046665 | Bacteria | 777 |
| 855 | Ga0495661_0351744 | 3300046665 | Bacteria | 725 |
| 856 | Ga0495657_0083417 | 3300046675 | Bacteria | 2063 |
| 857 | Ga0495599_0324178 | 3300046678 | Bacteria | 927 |
| 858 | Ga0495623_0018100 | 3300046679 | Bacteria | 4550 |
| 859 | Ga0495623_0029091 | 3300046679 | Bacteria | 3556 |
| 860 | Ga0495646_0034891 | 3300046680 | Bacteria | 3121 |
| 861 | Ga0495646_0048135 | 3300046680 | Bacteria | 2591 |
| 862 | Ga0495669_0092214 | 3300046684 | Bacteria | 1399 |
| 863 | Ga0495613_0267246 | 3300046689 | Bacteria | 1190 |
| 864 | Ga0495670_0001330 | 3300046691 | Bacteria | 12054 |
| 865 | Ga0495670_0001845 | 3300046691 | Bacteria | 10422 |
| 866 | Ga0495670_0028455 | 3300046691 | Bacteria | 2770 |
| 867 | Ga0495670_0049620 | 3300046691 | Bacteria | 2100 |
| 868 | Ga0495670_0124297 | 3300046691 | Bacteria | 1342 |
| 869 | Ga0495671_0000157 | 3300046692 | Bacteria | 59803 |
| 870 | Ga0495671_0003172 | 3300046692 | Bacteria | 10211 |
| 871 | Ga0495671_0008732 | 3300046692 | Bacteria | 5689 |
| 872 | Ga0495671_0009522 | 3300046692 | Bacteria | 5425 |
| 873 | Ga0495671_0020056 | 3300046692 | Bacteria | 3526 |
| 874 | Ga0495671_0020261 | 3300046692 | Bacteria | 3506 |
| 875 | Ga0495671_0023491 | 3300046692 | Bacteria | 3220 |
| 876 | Ga0495671_0036229 | 3300046692 | Bacteria | 2499 |
| 877 | Ga0495671_0036976 | 3300046692 | Bacteria | 2471 |
| 878 | Ga0495671_0044620 | 3300046692 | Bacteria | 2221 |
| 879 | Ga0495671_0110184 | 3300046692 | Bacteria | 1345 |
| 880 | Ga0495671_0124046 | 3300046692 | Bacteria | 1259 |
| 881 | Ga0495671_0137802 | 3300046692 | Bacteria | 1189 |
| 882 | Ga0495671_0171835 | 3300046692 | Bacteria | 1053 |
| 883 | Ga0495671_0373810 | 3300046692 | Bacteria | 683 |
| 884 | Ga0495671_0410960 | 3300046692 | Bacteria | 647 |
| 885 | Ga0495649_0001274 | 3300046694 | Bacteria | 19389 |
| 886 | Ga0495649_0005977 | 3300046694 | Bacteria | 7625 |
| 887 | Ga0495649_0006800 | 3300046694 | Bacteria | 7082 |
| 888 | Ga0495649_0006831 | 3300046694 | Bacteria | 7064 |
| 889 | Ga0495649_0006917 | 3300046694 | Bacteria | 7014 |
| 890 | Ga0495649_0006919 | 3300046694 | Bacteria | 7013 |
| 891 | Ga0495649_0018829 | 3300046694 | Bacteria | 3878 |
| 892 | Ga0495649_0036409 | 3300046694 | Bacteria | 2703 |
| 893 | Ga0495649_0040217 | 3300046694 | Bacteria | 2561 |
| 894 | Ga0495649_0094493 | 3300046694 | Bacteria | 1591 |
| 895 | Ga0495649_0108147 | 3300046694 | Bacteria | 1475 |
| 896 | Ga0495649_0114905 | 3300046694 | Bacteria | 1425 |
| 897 | Ga0495649_0173710 | 3300046694 | Bacteria | 1126 |
| 898 | Ga0495649_0309852 | 3300046694 | Bacteria | 802 |
| 899 | Ga0495649_0470577 | 3300046694 | Bacteria | 626 |
| 900 | Ga0495589_0001387 | 3300046794 | Bacteria | 14093 |
| 901 | Ga0495589_0002692 | 3300046794 | Bacteria | 9827 |
| 902 | Ga0495589_0025557 | 3300046794 | Bacteria | 2996 |
| 903 | Ga0495589_0039061 | 3300046794 | Bacteria | 2373 |
| 904 | Ga0495589_0070269 | 3300046794 | Bacteria | 1711 |
| 905 | Ga0495589_0101696 | 3300046794 | Bacteria | 1390 |
| 906 | Ga0495589_0113862 | 3300046794 | Bacteria | 1304 |
| 907 | Ga0495600_0013204 | 3300046809 | Bacteria | 5184 |
| 908 | Ga0495600_0046174 | 3300046809 | Bacteria | 2842 |
| 909 | Ga0495660_0008107 | 3300046810 | Bacteria | 6170 |
| 910 | Ga0495660_0008496 | 3300046810 | Bacteria | 6012 |
| 911 | Ga0495660_0010776 | 3300046810 | Bacteria | 5308 |
| 912 | Ga0495660_0012391 | 3300046810 | Bacteria | 4948 |
| 913 | Ga0495660_0013889 | 3300046810 | Bacteria | 4667 |
| 914 | Ga0495660_0017046 | 3300046810 | Bacteria | 4183 |
| 915 | Ga0495660_0023416 | 3300046810 | Bacteria | 3521 |
| 916 | Ga0495660_0024828 | 3300046810 | Bacteria | 3411 |
| 917 | Ga0495660_0030875 | 3300046810 | Bacteria | 3016 |
| 918 | Ga0495660_0104043 | 3300046810 | Bacteria | 1457 |
| 919 | Ga0495660_0154462 | 3300046810 | Bacteria | 1130 |
| 920 | Ga0495660_0156446 | 3300046810 | Bacteria | 1121 |
| 921 | Ga0495660_0293352 | 3300046810 | Bacteria | 739 |
| 922 | Ga0495660_0333350 | 3300046810 | Bacteria | 678 |
| 923 | Ga0495660_0373705 | 3300046810 | Bacteria | 629 |
| 924 | Ga0495581_0044784 | 3300047315 | Bacteria | 2558 |
| 925 | Ga0495604_0001368 | 3300047317 | Bacteria | 19962 |
| 926 | Ga0495604_0116686 | 3300047317 | Bacteria | 1937 |
| 927 | Ga0495636_0015593 | 3300047318 | Bacteria | 3028 |
| 928 | Ga0495636_0109318 | 3300047318 | Bacteria | 1215 |
| 929 | Ga0495636_0403435 | 3300047318 | Bacteria | 651 |
| 930 | Ga0495674_0066383 | 3300047319 | Bacteria | 3130 |
| 931 | Ga0495672_0001137 | 3300047320 | Bacteria | 26897 |
| 932 | Ga0495672_0004893 | 3300047320 | Bacteria | 10762 |
| 933 | Ga0495672_0005914 | 3300047320 | Bacteria | 9587 |
| 934 | Ga0495672_0006401 | 3300047320 | Bacteria | 9138 |
| 935 | Ga0495672_0011467 | 3300047320 | Bacteria | 6253 |
| 936 | Ga0495672_0053598 | 3300047320 | Bacteria | 2362 |
| 937 | Ga0495672_0061661 | 3300047320 | Bacteria | 2160 |
| 938 | Ga0495672_0068328 | 3300047320 | Bacteria | 2020 |
| 939 | Ga0495672_0070544 | 3300047320 | Bacteria | 1979 |
| 940 | Ga0495672_0091148 | 3300047320 | Bacteria | 1673 |
| 941 | Ga0495672_0145302 | 3300047320 | Bacteria | 1234 |
| 942 | Ga0495672_0157217 | 3300047320 | Bacteria | 1172 |
| 943 | Ga0495672_0257142 | 3300047320 | Bacteria | 844 |
| 944 | Ga0495672_0321635 | 3300047320 | Bacteria | 726 |
| 945 | Ga0495676_0000012 | 3300047321 | Bacteria | 230043 |
| 946 | Ga0495676_0009827 | 3300047321 | Bacteria | 8692 |
| 947 | Ga0495676_0026663 | 3300047321 | Bacteria | 4970 |
| 948 | Ga0495680_0001940 | 3300047322 | Bacteria | 21762 |
| 949 | Ga0495680_0041000 | 3300047322 | Bacteria | 3683 |
| 950 | Ga0495680_0105231 | 3300047322 | Bacteria | 2098 |
| 951 | Ga0495683_0000016 | 3300047323 | Bacteria | 191396 |
| 952 | Ga0495683_0000032 | 3300047323 | Bacteria | 149612 |
| 953 | Ga0495683_0001989 | 3300047323 | Bacteria | 12726 |
| 954 | Ga0495683_0007876 | 3300047323 | Bacteria | 5716 |
| 955 | Ga0495683_0011212 | 3300047323 | Bacteria | 4722 |
| 956 | Ga0495683_0019006 | 3300047323 | Bacteria | 3547 |
| 957 | Ga0495683_0024672 | 3300047323 | Bacteria | 3085 |
| 958 | Ga0495683_0047405 | 3300047323 | Bacteria | 2156 |
| 959 | Ga0495683_0166558 | 3300047323 | Bacteria | 1015 |
| 960 | Ga0495683_0255315 | 3300047323 | Bacteria | 767 |
| 961 | Ga0495687_006199 | 3300047443 | Bacteria | 7389 |
| 962 | Ga0495675_0003583 | 3300047444 | Bacteria | 9361 |
| 963 | Ga0495675_0167742 | 3300047444 | Bacteria | 1349 |
| 964 | Ga0495677_0005074 | 3300047445 | Bacteria | 5013 |
| 965 | Ga0495679_000070 | 3300047446 | Bacteria | 98402 |
| 966 | Ga0495679_002094 | 3300047446 | Bacteria | 10521 |
| 967 | Ga0495679_006718 | 3300047446 | Bacteria | 4908 |
| 968 | Ga0495679_025342 | 3300047446 | Bacteria | 1984 |
| 969 | Ga0495679_042746 | 3300047446 | Bacteria | 1396 |
| 970 | Ga0495679_048884 | 3300047446 | Bacteria | 1277 |
| 971 | Ga0495679_183355 | 3300047446 | Bacteria | 554 |
| 972 | Ga0495685_031685 | 3300047447 | Bacteria | 1816 |
| 973 | Ga0495685_263765 | 3300047447 | Bacteria | 545 |
| 974 | Ga0495673_0000544 | 3300047469 | Bacteria | 38535 |
| 975 | Ga0495673_0001906 | 3300047469 | Bacteria | 15579 |
| 976 | Ga0495673_0004289 | 3300047469 | Bacteria | 8993 |
| 977 | Ga0495673_0006079 | 3300047469 | Bacteria | 7168 |
| 978 | Ga0495673_0007426 | 3300047469 | Bacteria | 6302 |
| 979 | Ga0495673_0011635 | 3300047469 | Bacteria | 4720 |
| 980 | Ga0495673_0012744 | 3300047469 | Bacteria | 4440 |
| 981 | Ga0495673_0016125 | 3300047469 | Bacteria | 3828 |
| 982 | Ga0495673_0021138 | 3300047469 | Bacteria | 3221 |
| 983 | Ga0495673_0025441 | 3300047469 | Bacteria | 2841 |
| 984 | Ga0495673_0026484 | 3300047469 | Bacteria | 2771 |
| 985 | Ga0495673_0034216 | 3300047469 | Bacteria | 2350 |
| 986 | Ga0495673_0053403 | 3300047469 | Bacteria | 1761 |
| 987 | Ga0495673_0053407 | 3300047469 | Bacteria | 1761 |
| 988 | Ga0495673_0058651 | 3300047469 | Bacteria | 1657 |
| 989 | Ga0495673_0070490 | 3300047469 | Bacteria | 1471 |
| 990 | Ga0495673_0111908 | 3300047469 | Bacteria | 1090 |
| 991 | Ga0495681_0001948 | 3300047470 | Bacteria | 15112 |
| 992 | Ga0495681_0009739 | 3300047470 | Bacteria | 5886 |
| 993 | Ga0495681_0014724 | 3300047470 | Bacteria | 4466 |
| 994 | Ga0495681_0019130 | 3300047470 | Bacteria | 3748 |
| 995 | Ga0495681_0020491 | 3300047470 | Bacteria | 3587 |
| 996 | Ga0495681_0023146 | 3300047470 | Bacteria | 3306 |
| 997 | Ga0495681_0030912 | 3300047470 | Bacteria | 2720 |
| 998 | Ga0495681_0032164 | 3300047470 | Bacteria | 2644 |
| 999 | Ga0495681_0052739 | 3300047470 | Bacteria | 1906 |
| 1000 | Ga0495681_0083046 | 3300047470 | Bacteria | 1426 |
| 1001 | Ga0495681_0103410 | 3300047470 | Bacteria | 1242 |
| 1002 | Ga0495681_0151749 | 3300047470 | Bacteria | 971 |
| 1003 | Ga0495681_0169919 | 3300047470 | Bacteria | 902 |
| 1004 | Ga0495681_0250017 | 3300047470 | Bacteria | 700 |
| 1005 | Ga0495684_0114485 | 3300047471 | Bacteria | 2033 |
| 1006 | Ga0495686_0007758 | 3300047472 | Bacteria | 7994 |
| 1007 | Ga0495686_0012175 | 3300047472 | Bacteria | 6030 |
| 1008 | Ga0495686_0016954 | 3300047472 | Bacteria | 4920 |
| 1009 | Ga0495686_0096706 | 3300047472 | Bacteria | 1786 |
| 1010 | Ga0495686_0123672 | 3300047472 | Bacteria | 1539 |
| 1011 | Ga0495686_0241934 | 3300047472 | Bacteria | 1017 |
| 1012 | Ga0495686_0295276 | 3300047472 | Bacteria | 896 |
| 1013 | Ga0495593_0016753 | 3300047673 | Bacteria | 4128 |
| 1014 | Ga0495593_0141563 | 3300047673 | Bacteria | 1218 |
| 1015 | Ga0495593_0188074 | 3300047673 | Bacteria | 1039 |
| 1016 | Ga0495614_0097548 | 3300048089 | Bacteria | 1282 |
| 1017 | Ga0495626_0000109 | 3300048091 | Bacteria | 107703 |
| 1018 | Ga0495626_0000391 | 3300048091 | Bacteria | 45354 |
| 1019 | Ga0495626_0000562 | 3300048091 | Bacteria | 36865 |
| 1020 | Ga0495626_0004473 | 3300048091 | Bacteria | 8570 |
| 1021 | Ga0495626_0005845 | 3300048091 | Bacteria | 7095 |
| 1022 | Ga0495626_0016923 | 3300048091 | Bacteria | 3693 |
| 1023 | Ga0495626_0022129 | 3300048091 | Bacteria | 3142 |
| 1024 | Ga0495626_0038816 | 3300048091 | Bacteria | 2255 |
| 1025 | Ga0496102_0010153 | 3300048905 | Bacteria | 8095 |
| 1026 | Ga0496102_1267083 | 3300048905 | Bacteria | 656 |
| 1027 | Ga0496103_0028057 | 3300048906 | Bacteria | 3414 |
| 1028 | Ga0496106_0164393 | 3300048909 | Bacteria | 1756 |
| 1029 | Ga0496110_0100035 | 3300048913 | Bacteria | 2599 |
| 1030 | Ga0496110_0247009 | 3300048913 | Bacteria | 1624 |
| 1031 | Ga0496111_0310192 | 3300048914 | Bacteria | 1169 |
| 1032 | Ga0496111_0357337 | 3300048914 | Bacteria | 1081 |
| 1033 | Ga0496112_0127244 | 3300048915 | Bacteria | 2518 |
| 1034 | Ga0496112_0334460 | 3300048915 | Bacteria | 1458 |
| 1035 | Ga0496113_0058849 | 3300048916 | Bacteria | 2893 |
| 1036 | Ga0496113_1055552 | 3300048916 | Bacteria | 638 |
| 1037 | Ga0496114_0144704 | 3300048917 | Bacteria | 2060 |
| 1038 | Ga0496115_0077785 | 3300048918 | Bacteria | 2698 |
| 1039 | Ga0496116_0000376 | 3300048919 | Bacteria | 66696 |
| 1040 | Ga0496116_0004285 | 3300048919 | Bacteria | 13677 |
| 1041 | Ga0496116_0007000 | 3300048919 | Bacteria | 10099 |
| 1042 | Ga0496116_0018000 | 3300048919 | Bacteria | 5463 |
| 1043 | Ga0496116_0026828 | 3300048919 | Bacteria | 4202 |
| 1044 | Ga0496116_0046355 | 3300048919 | Bacteria | 2934 |
| 1045 | Ga0496116_0098026 | 3300048919 | Bacteria | 1760 |
| 1046 | Ga0496117_0001205 | 3300048920 | Bacteria | 38844 |
| 1047 | Ga0496117_0009929 | 3300048920 | Bacteria | 8757 |
| 1048 | Ga0496117_0019325 | 3300048920 | Bacteria | 5602 |
| 1049 | Ga0496117_0027087 | 3300048920 | Bacteria | 4472 |
| 1050 | Ga0496117_0040972 | 3300048920 | Bacteria | 3400 |
| 1051 | Ga0496117_0058215 | 3300048920 | Bacteria | 2678 |
| 1052 | Ga0496117_0078148 | 3300048920 | Bacteria | 2186 |
| 1053 | Ga0496117_0099735 | 3300048920 | Bacteria | 1841 |
| 1054 | Ga0496117_0118767 | 3300048920 | Bacteria | 1629 |
| 1055 | Ga0496118_0016422 | 3300048921 | Bacteria | 6792 |
| 1056 | Ga0496118_0049479 | 3300048921 | Bacteria | 3236 |
| 1057 | Ga0496118_0061716 | 3300048921 | Bacteria | 2773 |
| 1058 | Ga0496118_0065299 | 3300048921 | Bacteria | 2663 |
| 1059 | Ga0496118_0065818 | 3300048921 | Bacteria | 2649 |
| 1060 | Ga0496118_0085714 | 3300048921 | Bacteria | 2192 |
| 1061 | Ga0496118_0106344 | 3300048921 | Bacteria | 1877 |
| 1062 | Ga0496119_0263586 | 3300048922 | Bacteria | 863 |
| 1063 | Ga0496120_0015093 | 3300048923 | Bacteria | 5111 |
| 1064 | Ga0496121_0001119 | 3300048924 | Bacteria | 47137 |
| 1065 | Ga0496121_0003154 | 3300048924 | Bacteria | 23776 |
| 1066 | Ga0496121_0019282 | 3300048924 | Bacteria | 6826 |
| 1067 | Ga0496121_0065351 | 3300048924 | Bacteria | 2960 |
| 1068 | Ga0496121_0153993 | 3300048924 | Bacteria | 1688 |
| 1069 | Ga0496121_0224181 | 3300048924 | Bacteria | 1321 |
| 1070 | Ga0496122_0000370 | 3300048925 | Bacteria | 96422 |
| 1071 | Ga0496122_0007502 | 3300048925 | Bacteria | 12099 |
| 1072 | Ga0496122_0015044 | 3300048925 | Bacteria | 7427 |
| 1073 | Ga0496122_0034982 | 3300048925 | Bacteria | 4099 |
| 1074 | Ga0496122_0042694 | 3300048925 | Bacteria | 3563 |
| 1075 | Ga0496122_0069921 | 3300048925 | Bacteria | 2511 |
| 1076 | Ga0496123_0000135 | 3300048926 | Bacteria | 153056 |
| 1077 | Ga0496123_0013136 | 3300048926 | Bacteria | 6983 |
| 1078 | Ga0496123_0026302 | 3300048926 | Bacteria | 4362 |
| 1079 | Ga0496123_0072213 | 3300048926 | Bacteria | 2148 |
| 1080 | Ga0496123_0079250 | 3300048926 | Bacteria | 2008 |
| 1081 | Ga0496124_0000144 | 3300048927 | Bacteria | 146921 |
| 1082 | Ga0496124_0004511 | 3300048927 | Bacteria | 16234 |
| 1083 | Ga0496124_0006811 | 3300048927 | Bacteria | 12335 |
| 1084 | Ga0496124_0018634 | 3300048927 | Bacteria | 6494 |
| 1085 | Ga0496124_0019657 | 3300048927 | Bacteria | 6275 |
| 1086 | Ga0496124_0073583 | 3300048927 | Bacteria | 2827 |
| 1087 | Ga0496124_0080571 | 3300048927 | Bacteria | 2678 |
| 1088 | Ga0496124_0192955 | 3300048927 | Bacteria | 1556 |
| 1089 | Ga0496124_0225019 | 3300048927 | Bacteria | 1407 |
| 1090 | Ga0496124_0551735 | 3300048927 | Bacteria | 760 |
| 1091 | Ga0496124_0946870 | 3300048927 | Bacteria | 518 |
| 1092 | Ga0496125_0000799 | 3300048928 | Bacteria | 51395 |
| 1093 | Ga0496125_0012276 | 3300048928 | Bacteria | 8516 |
| 1094 | Ga0496125_0017798 | 3300048928 | Bacteria | 6763 |
| 1095 | Ga0496125_0021016 | 3300048928 | Bacteria | 6102 |
| 1096 | Ga0496125_0036004 | 3300048928 | Bacteria | 4329 |
| 1097 | Ga0496125_0050448 | 3300048928 | Bacteria | 3445 |
| 1098 | Ga0496125_0088020 | 3300048928 | Bacteria | 2343 |
| 1099 | Ga0496125_0092569 | 3300048928 | Bacteria | 2260 |
| 1100 | Ga0496126_0118230 | 3300048929 | Bacteria | 2301 |
| 1101 | Ga0495678_000046 | 3300049459 | Bacteria | 171703 |
| 1102 | Ga0495678_000541 | 3300049459 | Bacteria | 36468 |
| 1103 | Ga0495678_002320 | 3300049459 | Bacteria | 13112 |
| 1104 | Ga0495678_002808 | 3300049459 | Bacteria | 11313 |
| 1105 | Ga0495678_004317 | 3300049459 | Bacteria | 8279 |
| 1106 | Ga0495678_008726 | 3300049459 | Bacteria | 5084 |
| 1107 | Ga0495678_013649 | 3300049459 | Bacteria | 3804 |
| 1108 | Ga0495678_014372 | 3300049459 | Bacteria | 3682 |
| 1109 | Ga0495678_025094 | 3300049459 | Bacteria | 2564 |
| 1110 | Ga0495678_026997 | 3300049459 | Bacteria | 2441 |
| 1111 | Ga0495678_038204 | 3300049459 | Bacteria | 1944 |
| 1112 | Ga0495678_065095 | 3300049459 | Bacteria | 1354 |
| 1113 | Ga0495678_079283 | 3300049459 | Bacteria | 1183 |
| 1114 | Ga0495678_108298 | 3300049459 | Bacteria | 951 |
| 1115 | Ga0495678_173468 | 3300049459 | Bacteria | 680 |
| 1116 | Ga0495678_186784 | 3300049459 | Bacteria | 646 |
| 1117 | Ga0495682_0000950 | 3300049460 | Bacteria | 17548 |
| 1118 | Ga0495682_0001501 | 3300049460 | Bacteria | 12430 |
| 1119 | Ga0495682_0004416 | 3300049460 | Bacteria | 6018 |
| 1120 | Ga0495682_0008647 | 3300049460 | Bacteria | 4007 |
| 1121 | Ga0495682_0011088 | 3300049460 | Bacteria | 3473 |
| 1122 | Ga0495682_0037056 | 3300049460 | Bacteria | 1794 |
| 1123 | Ga0501337_014743 | 3300049553 | Bacteria | 599 |
| 1124 | Ga0501222_003989 | 3300049662 | Bacteria | 2000 |
| 1125 | Ga0501240_007437 | 3300049673 | Bacteria | 1377 |
| 1126 | Ga0501241_001558 | 3300049758 | Bacteria | 4602 |
| 1127 | Ga0501269_003946 | 3300049766 | Bacteria | 1786 |
| 1128 | Ga0501226_016510 | 3300049853 | Bacteria | 813 |
| 1129 | nmdc:mga00v17_62391_c1 | 3300050491 | Bacteria | 2293 |
| 1130 | nmdc:mga00v17_634423_c1 | 3300050491 | Bacteria | 688 |
| 1131 | nmdc:mga00v17_64581_c1 | 3300050491 | Bacteria | 2256 |
| 1132 | nmdc:mga07m45_228933_c1 | 3300050496 | Bacteria | 1081 |
| 1133 | nmdc:mga08x19_210434_c1 | 3300050514 | Bacteria | 1335 |
| 1134 | nmdc:mga08x19_315177_c1 | 3300050514 | Bacteria | 1088 |
| 1135 | Ga0500618_001506 | 3300053125 | Bacteria | 10255 |
| 1136 | Ga0500618_013949 | 3300053125 | Bacteria | 2066 |
| 1137 | Ga0500621_293908 | 3300053126 | Bacteria | 523 |
| 1138 | Ga0500573_0072185 | 3300053140 | Bacteria | 1968 |
| 1139 | Ga0500586_186758 | 3300053145 | Bacteria | 688 |
| 1140 | 2511256415 | 2511231004 | Bacteria | 6669789 |
| 1141 | 2511266090 | 2511231006 | Bacteria | 6794709 |
| 1142 | 2511271057 | 2511231007 | Bacteria | 6306603 |
| 1143 | 2511278963 | 2511231008 | Bacteria | 6624100 |
| 1144 | 2511288768 | 2511231010 | Bacteria | 6373152 |
| 1145 | 2511297363 | 2511231011 | Bacteria | 6149768 |
| 1146 | 2511300160 | 2511231012 | Bacteria | 6738011 |
| 1147 | 2511311173 | 2511231014 | Bacteria | 6462302 |
| 1148 | 2511319906 | 2511231015 | Bacteria | 6598026 |
| 1149 | 2511326008 | 2511231016 | Bacteria | 6704427 |
| 1150 | 2511330972 | 2511231017 | Bacteria | 6503007 |
| 1151 | 2511336306 | 2511231018 | Bacteria | 6436256 |
| 1152 | 2511345844 | 2511231019 | Bacteria | 6520662 |
| 1153 | 2511349131 | 2511231020 | Bacteria | 6115223 |
| 1154 | 2511356005 | 2511231021 | Bacteria | 7302637 |
| 1155 | 2511362611 | 2511231022 | Bacteria | 6719296 |
| 1156 | 2511366811 | 2511231023 | Bacteria | 6808468 |
| 1157 | 2511372972 | 2511231024 | Bacteria | 5835885 |
| 1158 | 2511411333 | 2511231031 | Bacteria | 6558529 |
| 1159 | 2511822476 | 2511231156 | Bacteria | 6845832 |
| 1160 | 2512325974 | 2512047018 | Bacteria | 6663241 |
| 1161 | 2555247027 | 2554235231 | Bacteria | 5215788 |
| 1162 | 2555667438 | 2554235341 | Bacteria | 6867980 |
| 1163 | 2583789786 | 2582580891 | Bacteria | 6800976 |
| 1164 | 2597855680 | 2597489887 | Bacteria | 6666321 |
| 1165 | 2597861683 | 2597489888 | Bacteria | 6179543 |
| 1166 | 2597867407 | 2597489889 | Bacteria | 6297495 |
| 1167 | 2599330746 | 2599185155 | Bacteria | 5827168 |
| 1168 | 2599356661 | 2599185160 | Bacteria | 6844013 |
| 1169 | 2599363307 | 2599185161 | Bacteria | 6960462 |
| 1170 | 2599369741 | 2599185162 | Bacteria | 6957254 |
| 1171 | 2599376416 | 2599185163 | Bacteria | 6995158 |
| 1172 | 2599381766 | 2599185164 | Bacteria | 6841688 |
| 1173 | 2599388090 | 2599185165 | Bacteria | 6843250 |
| 1174 | 2599395386 | 2599185166 | Bacteria | 6959206 |
| 1175 | 2599398833 | 2599185167 | Bacteria | 6353609 |
| 1176 | 2599407151 | 2599185168 | Bacteria | 6997636 |
| 1177 | 2599450888 | 2599185179 | Bacteria | 6611171 |
| 1178 | 2599463494 | 2599185181 | Bacteria | 6844519 |
| 1179 | 2599469156 | 2599185182 | Bacteria | 6883168 |
| 1180 | 2599485582 | 2599185185 | Bacteria | 6652270 |
| 1181 | 2599492513 | 2599185186 | Bacteria | 6831633 |
| 1182 | 2599500090 | 2599185188 | Bacteria | 6164180 |
| 1183 | 2599506448 | 2599185189 | Bacteria | 5862825 |
| 1184 | 2599514166 | 2599185190 | Bacteria | 6285678 |
| 1185 | 2599518767 | 2599185191 | Bacteria | 6297582 |
| 1186 | 2599614619 | 2599185212 | Bacteria | 6765997 |
| 1187 | 2599769433 | 2599185248 | Bacteria | 6696816 |
| 1188 | 2599806711 | 2599185257 | Bacteria | 6492581 |
| 1189 | 2599882682 | 2599185288 | Bacteria | 6666191 |
| 1190 | 2599886853 | 2599185289 | Bacteria | 6778765 |
| 1191 | 2599893499 | 2599185290 | Bacteria | 6289611 |
| 1192 | 2599898182 | 2599185291 | Bacteria | 6775623 |
| 1193 | 2599930914 | 2599185300 | Bacteria | 6062622 |
| 1194 | 2599944703 | 2599185302 | Bacteria | 5954930 |
| 1195 | 2599950742 | 2599185303 | Bacteria | 6512725 |
| 1196 | 2599957323 | 2599185304 | Bacteria | 5951361 |
| 1197 | 2599962020 | 2599185305 | Bacteria | 6748700 |
| 1198 | 2599964569 | 2599185306 | Bacteria | 6637356 |
| 1199 | 2599975142 | 2599185307 | Bacteria | 6194719 |
| 1200 | 2599978890 | 2599185308 | Bacteria | 6621546 |
| 1201 | 2599983274 | 2599185309 | Bacteria | 5969593 |
| 1202 | 2599991661 | 2599185310 | Bacteria | 6014457 |
| 1203 | 2599994822 | 2599185311 | Bacteria | 6354990 |
| 1204 | 2600000916 | 2599185312 | Bacteria | 5912071 |
| 1205 | 2600004883 | 2599185313 | Bacteria | 6658188 |
| 1206 | 2600012850 | 2599185314 | Bacteria | 6621749 |
| 1207 | 2600018954 | 2599185315 | Bacteria | 6771107 |
| 1208 | 2600023997 | 2599185316 | Bacteria | 6320029 |
| 1209 | 2600030964 | 2599185317 | Bacteria | 6435722 |
| 1210 | 2600034639 | 2599185318 | Bacteria | 6961590 |
| 1211 | 2600043445 | 2599185319 | Bacteria | 6637840 |
| 1212 | 2600048281 | 2599185320 | Bacteria | 5963263 |
| 1213 | 2600053345 | 2599185321 | Bacteria | 6764560 |
| 1214 | 2600061355 | 2599185322 | Bacteria | 6763055 |
| 1215 | 2600067598 | 2599185323 | Bacteria | 6688755 |
| 1216 | 2600071812 | 2599185324 | Bacteria | 6590677 |
| 1217 | 2600077690 | 2599185325 | Bacteria | 6324919 |
| 1218 | 2600216123 | 2599185356 | Bacteria | 6843884 |
| 1219 | 2600360855 | 2600254930 | Bacteria | 6431253 |
| 1220 | 2600364865 | 2600254931 | Bacteria | 6734225 |
| 1221 | 2601628441 | 2600255283 | Bacteria | 6061572 |
| 1222 | 2601692367 | 2600255296 | Bacteria | 5784754 |
| 1223 | 2601776290 | 2600255313 | Bacteria | 6842543 |
| 1224 | 2601797852 | 2600255318 | Bacteria | 6383414 |
| 1225 | 2606076665 | 2603880185 | Bacteria | 6379190 |
| 1226 | 2606128921 | 2603880199 | Bacteria | 6377649 |
| 1227 | 2621302160 | 2619619299 | Bacteria | 6649820 |
| 1228 | 2624478239 | 2623620443 | Bacteria | 6427864 |
| 1229 | 2624489780 | 2623620446 | Bacteria | 6500345 |
| 1230 | 2643872599 | 2643221571 | Bacteria | 6228673 |
| 1231 | 2643954886 | 2643221589 | Bacteria | 6250934 |
| 1232 | 2644024526 | 2643221602 | Bacteria | 6249926 |
| 1233 | 2644186139 | 2643221633 | Bacteria | 6733554 |
| 1234 | 2644282051 | 2643221650 | Bacteria | 7029547 |
| 1235 | 2644619666 | 2643221713 | Bacteria | 6554480 |
| 1236 | 2652543401 | 2651869719 | Bacteria | 6047974 |
| 1237 | 2671090779 | 2667528170 | Bacteria | 6786960 |
| 1238 | 2671099949 | 2667528171 | Bacteria | 6900659 |
| 1239 | 2671127367 | 2667528176 | Bacteria | 6724917 |
| 1240 | 2671772362 | 2671180172 | Bacteria | 6495783 |
| 1241 | 2677898936 | 2675903420 | Bacteria | 6247433 |
| 1242 | 2678261013 | 2675903515 | Bacteria | 6580491 |
| 1243 | 2715749226 | 2713897148 | Bacteria | 5883533 |
| 1244 | 2715755496 | 2713897149 | Bacteria | 6506249 |
| 1245 | 2718632177 | 2718217725 | Bacteria | 5758958 |
| 1246 | 2723246580 | 2721755607 | Bacteria | 5841722 |
| 1247 | 2738674105 | 2738541265 | Bacteria | 6594665 |
| 1248 | 2738690233 | 2738541271 | Bacteria | 5657310 |
| 1249 | 2738752498 | 2738541282 | Bacteria | 6593925 |
| 1250 | 2738807888 | 2738541294 | Bacteria | 6925949 |
| 1251 | 2738861539 | 2738541303 | Bacteria | 6591772 |
| 1252 | 2738895248 | 2738541309 | Bacteria | 6926455 |
| 1253 | 2739198046 | 2738543004 | Bacteria | 6381073 |
| 1254 | 2739260278 | 2738543015 | Bacteria | 6750701 |
| 1255 | 2739266007 | 2738543016 | Bacteria | 5657564 |
| 1256 | 2739311299 | 2738543025 | Bacteria | 6600348 |
| 1257 | 2743735097 | 2740892503 | Bacteria | 6855563 |
| 1258 | 2745006324 | 2744054620 | Bacteria | 6551379 |
| 1259 | 2765586443 | 2765235841 | Bacteria | 6137024 |
| 1260 | 2774119541 | 2773857670 | Bacteria | 6407454 |
| 1261 | 2774134755 | 2773857673 | Bacteria | 6513460 |
| 1262 | 2784261029 | 2784132063 | Bacteria | 6262788 |
| 1263 | 2784315952 | 2784132072 | Bacteria | 6596533 |
| 1264 | 2794594001 | 2791355520 | Bacteria | 5948615 |
| 1265 | 2807406137 | 2806310737 | Bacteria | 5751088 |
| 1266 | 2807454489 | 2806310745 | Bacteria | 5742165 |
| 1267 | 2808855964 | 2808606361 | Bacteria | 6136259 |
| 1268 | 2808922721 | 2808606376 | Bacteria | 6248667 |
| 1269 | 2808932193 | 2808606377 | Bacteria | 6646337 |
| 1270 | 2808936044 | 2808606378 | Bacteria | 6177535 |
| 1271 | 2808944408 | 2808606380 | Bacteria | 6248705 |
| 1272 | 2808954206 | 2808606381 | Bacteria | 6646461 |
| 1273 | 2808955888 | 2808606382 | Bacteria | 6841132 |
| 1274 | 2808964459 | 2808606383 | Bacteria | 6138645 |
| 1275 | 2808976640 | 2808606385 | Bacteria | 6711065 |
| 1276 | 2808991922 | 2808606388 | Bacteria | 6706662 |
| 1277 | 2808999347 | 2808606389 | Bacteria | 6138126 |
| 1278 | 2809217996 | 2808606445 | Bacteria | 6057339 |
| 1279 | 2817488430 | 2816332298 | Bacteria | 6852809 |
| 1280 | 2819657250 | 2818991456 | Bacteria | 6123676 |
| 1281 | 2819705235 | 2818991464 | Bacteria | 6907494 |
| 1282 | 2825654245 | 2825651385 | Bacteria | 6715909 |
| 1283 | 2826586148 | 2826581358 | Bacteria | 5963467 |
| 1284 | 2834032193 | 2834028612 | Bacteria | 6354979 |
| 1285 | 2842817783 | 2842815866 | Bacteria | 5947510 |
| 1286 | 2842830562 | 2842826826 | Bacteria | 5974129 |
| 1287 | 2842834178 | 2842832357 | Bacteria | 5959113 |
| 1288 | 2842838655 | 2842837860 | Bacteria | 6066181 |
| 1289 | 2842846345 | 2842843487 | Bacteria | 6004777 |
| 1290 | 2842851732 | 2842849001 | Bacteria | 5924277 |
| 1291 | 2842858705 | 2842854478 | Bacteria | 6143501 |
| 1292 | 2844667918 | 2844665904 | Bacteria | 6817974 |
| 1293 | 2852617094 | 2852612431 | Bacteria | 6885235 |
| 1294 | 2852660435 | 2852657418 | Bacteria | 6472974 |
| 1295 | 2852671917 | 2852667396 | Bacteria | 6885555 |
| 1296 | 2860343624 | 2860339153 | Bacteria | 6846989 |
| 1297 | 2860868456 | 2860867994 | Bacteria | 5645326 |
| 1298 | 2878030184 | 2878029506 | Bacteria | 6418441 |
| 1299 | 2880231130 | 2880230671 | Bacteria | 6140320 |
| 1300 | 2904519588 | 2904518522 | Bacteria | 6068986 |
| 1301 | 2904552139 | 2904550169 | Bacteria | 6221258 |
| 1302 | 2908447048 | 2908446538 | Bacteria | 6829095 |
| 1303 | 2912968716 | 2912963787 | Bacteria | 5646108 |
| 1304 | 2917071189 | 2917070673 | Bacteria | 6868303 |
| 1305 | 2919066136 | 2919063839 | Bacteria | 6302690 |
| 1306 | 2919155751 | 2919155634 | Bacteria | 4860545 |
| 1307 | 2919389758 | 2919385768 | Bacteria | 5897293 |
| 1308 | 2919460001 | 2919456309 | Bacteria | 6586567 |
| 1309 | 2919486921 | 2919481497 | Bacteria | 6907839 |
| 1310 | 2919488685 | 2919487758 | Bacteria | 5929766 |
| 1311 | 2919698943 | 2919697872 | Bacteria | 6553725 |
| 1312 | 2923154092 | 2923153595 | Bacteria | 6870622 |
| 1313 | 2923589808 | 2923586266 | Bacteria | 6565975 |
| 1314 | 2929144838 | 2929144301 | Bacteria | 6622272 |
| 1315 | 2929190317 | 2929189879 | Bacteria | 5930554 |
| 1316 | 2931371825 | 2931369376 | Bacteria | 6847892 |
| 1317 | 2931391398 | 2931390751 | Bacteria | 6273349 |
| 1318 | 2931398857 | 2931396565 | Bacteria | 7251677 |
| 1319 | 2935359017 | 2935353572 | Unclassified | 6955622 |
| 1320 | 2939641130 | 2939636861 | Bacteria | 6297853 |
| 1321 | 2939654054 | 2939651529 | Bacteria | 5895393 |
| 1322 | 2945930149 | 2945928738 | Bacteria | 6053221 |
| 1323 | 2945967609 | 2945961074 | Bacteria | 7342064 |
| 1324 | 2946012493 | 2946006987 | Bacteria | 6705746 |
| 1325 | 2946028663 | 2946027586 | Bacteria | 6049274 |
| 1326 | 2947235190 | 2947233263 | Bacteria | 6439278 |
| 1327 | 2969304977 | 2969304461 | Bacteria | 6601805 |
| 1328 | 2974293332 | 2974289157 | Bacteria | 6080362 |
| 1329 | 2984291967 | 2984286254 | Bacteria | 6702062 |
| 1330 | 2988732225 | 2988728565 | Bacteria | 6124362 |
| 1331 | 2998140480 | 2998139840 | Bacteria | 6073514 |
| 1332 | 3007399644 | 3007395558 | Bacteria | 6755444 |
| 1333 | 3007517925 | 3007511990 | Bacteria | 6481491 |
| 1334 | 3007618638 | 3007614139 | Bacteria | 6053559 |
| 1335 | 3007624970 | 3007619802 | Bacteria | 6411688 |
| 1336 | 3007721239 | 3007718800 | Bacteria | 5971527 |
| 1337 | 3007805355 | 3007803356 | Bacteria | 5931491 |
| 1338 | 3007859718 | 3007855910 | Bacteria | 5637581 |
| 1339 | 3007872140 | 3007866637 | Bacteria | 5899198 |
| 1340 | 3007873472 | 3007872151 | Bacteria | 5268868 |
| 1341 | 637317835 | 637000220 | Bacteria | 7074893 |
| 1342 | 8015688341 | 8015687852 | Bacteria | 6613826 |
| 1343 | 8019770326 | 8019769354 | Bacteria | 6924660 |
| 1344 | 8019777353 | 8019775933 | Bacteria | 6858656 |
| 1345 | 8030000258 | 8029995093 | Bacteria | 5990776 |
| 1346 | 8052499647 | 8052494512 | Bacteria | 5765634 |
| 1347 | 8054286928 | 8054285046 | Bacteria | 6919322 |
| 1348 | 8054350112 | 8054347763 | Bacteria | 5901107 |
| 1349 | 8054503983 | 8054503363 | Bacteria | 6101651 |
| 1350 | 8054934177 | 8054929484 | Bacteria | 5599761 |
| 1351 | 8055771438 | 8055770955 | Bacteria | 6827675 |
| 1352 | 8055818381 | 8055817908 | Bacteria | 6609162 |
| 1353 | 8055882479 | 8055878733 | Bacteria | 5907058 |
| 1354 | 8056115968 | 8056115690 | Bacteria | 5527654 |
| 1355 | 8056121074 | 8056120720 | Bacteria | 5758328 |
| 1356 | 8056126490 | 8056125926 | Bacteria | 6228218 |
| 1357 | 8056132354 | 8056131705 | Bacteria | 6107031 |
| 1358 | 8056137785 | 8056137416 | Bacteria | 6147080 |
| 1359 | 8056143760 | 8056143049 | Bacteria | 6307666 |
| 1360 | 8056152497 | 8056148874 | Bacteria | 6479865 |
| 1361 | 8056158532 | 8056155041 | Bacteria | 6486948 |
| 1362 | 8056164363 | 8056161164 | Bacteria | 6106669 |
| 1363 | 8056170571 | 8056166840 | Bacteria | 5820959 |
| 1364 | 8056176686 | 8056172158 | Bacteria | 6133900 |
| 1365 | 8056183023 | 8056177738 | Bacteria | 6748268 |
| 1366 | 8056572337 | 8056569372 | Bacteria | 5997322 |
| 1367 | 8057802728 | 8057798959 | Bacteria | 6713499 |
| 1368 | Ga0105251_10153483 | |||
| 1369 | MRS2a_Contig_1202 | |||
| 1370 | MRS2a_Contig_12030 | |||
| 1371 | MRS2a_Contig_261 | |||
| 1372 | SwRhRL2b_contig_2895489 | |||
| 1373 | SwRhRL2b_contig_3371764 | |||
| 1374 | SwRhRL2b_contig_3606189 | |||
| 1375 | MRS1b_contig_8627672 | |||
| 1376 | JGI24741J21665_1008600 | |||
| 1377 | JGI24741J21665_1025949 | |||
| 1378 | JGI25155J39150_1002704 | |||
| 1379 | JGI25156J39149_1030158 | |||
| 1380 | JGI25162J39368_1000140 | |||
| 1381 | JGI25162J39368_1000181 | |||
| 1382 | JGI25154J39366_1008058 | |||
| 1383 | JGI25163J39215_1000705 | |||
| 1384 | JGI25163J39215_1001334 | |||
| 1385 | JGI25164J39214_1000110 | |||
| 1386 | JGI25164J39214_1000146 | |||
| 1387 | JGI25165J46597_1000228 | |||
| 1388 | JGI25165J46597_1000267 | |||
| 1389 | Ga0055538_1000037 | |||
| 1390 | Ga0055539_1000048 | |||
| 1391 | Ga0055533_1000059 | |||
| 1392 | Ga0055532_1000096 | |||
| 1393 | Ga0055525_1000128 | |||
| 1394 | Ga0055536_1000783 | |||
| 1395 | Ga0055536_1003636 | |||
| 1396 | Ga0055536_1034266 | |||
| 1397 | Ga0055530_10000098 | |||
| 1398 | Ga0055530_10000333 | |||
| 1399 | Ga0055540_1000138 | |||
| 1400 | Ga0055540_1000586 | |||
| 1401 | Ga0055541_1000035 | |||
| 1402 | Ga0058859_10063450 | |||
| 1403 | Ga0065714_10002564 | |||
| 1404 | Ga0065714_10011292 | |||
| 1405 | Ga0065714_10013869 | |||
| 1406 | Ga0065714_10017780 | |||
| 1407 | Ga0065714_10039436 | |||
| 1408 | Ga0065714_10042967 | |||
| 1409 | Ga0065714_10064847 | |||
| 1410 | Ga0065714_10079634 | |||
| 1411 | Ga0065714_10113182 | |||
| 1412 | Ga0065714_10156250 | |||
| 1413 | Ga0065714_10230683 | |||
| 1414 | Ga0065704_10000971 | |||
| 1415 | Ga0065704_10017175 | |||
| 1416 | Ga0065704_10035179 | |||
| 1417 | Ga0065704_10037598 | |||
| 1418 | Ga0065704_10084746 | |||
| 1419 | Ga0065704_10097649 | |||
| 1420 | Ga0065704_10121382 | |||
| 1421 | Ga0065704_10231969 | |||
| 1422 | Ga0065704_10362676 | |||
| 1423 | Ga0065712_10000856 | |||
| 1424 | Ga0065712_10070791 | |||
| 1425 | Ga0065712_10081097 | |||
| 1426 | Ga0065715_10024528 | |||
| 1427 | Ga0070676_10106676 | |||
| 1428 | Ga0070670_100002334 | |||
| 1429 | Ga0070661_100000078 | |||
| 1430 | Ga0070669_100005413 | |||
| 1431 | Ga0070669_100119689 | |||
| 1432 | Ga0070663_100392322 | |||
| 1433 | Ga0070662_100000095 | |||
| 1434 | Ga0070662_100010267 | |||
| 1435 | Ga0070706_102121994 | |||
| 1436 | Ga0068853_100000089 | |||
| 1437 | Ga0070665_100032153 | |||
| 1438 | Ga0070665_100187316 | |||
| 1439 | Ga0070664_100001480 | |||
| 1440 | Ga0070664_100012404 | |||
| 1441 | Ga0068857_101626977 | |||
| 1442 | Ga0068854_100014211 | |||
| 1443 | Ga0068851_10000024 | |||
| 1444 | Ga0075363_100090844 | |||
| 1445 | Ga0075364_10175931 | |||
| 1446 | Ga0075364_10213932 | |||
| 1447 | Ga0075364_10254883 | |||
| 1448 | Ga0075364_10330929 | |||
| 1449 | Ga0075432_10002453 | |||
| 1450 | Ga0075432_10004245 | |||
| 1451 | Ga0075432_10015082 | |||
| 1452 | Ga0075432_10028993 | |||
| 1453 | Ga0075432_10031036 | |||
| 1454 | Ga0075432_10284271 | |||
| 1455 | Ga0075362_10084396 | |||
| 1456 | Ga0075362_10332350 | |||
| 1457 | Ga0075362_10336752 | |||
| 1458 | Ga0075370_10611028 | |||
| 1459 | Ga0075436_100088086 | |||
| 1460 | Ga0075436_100496148 | |||
| 1461 | Ga0075436_100746880 | |||
| 1462 | Ga0075436_100981421 | |||
| 1463 | Ga0075436_101152415 | |||
| 1464 | Ga0075436_101184160 | |||
| 1465 | Ga0079104_1000229 | |||
| 1466 | Ga0079104_1000296 | |||
| 1467 | Ga0079104_1036795 | |||
| 1468 | Ga0099826_10005189 | |||
| 1469 | Ga0105251_10000019 | |||
| 1470 | Ga0105251_10000087 | |||
| 1471 | Ga0105251_10001365 | |||
| 1472 | Ga0105251_10001500 | |||
| 1473 | Ga0105251_10004756 | |||
| 1474 | Ga0105251_10007074 | |||
| 1475 | Ga0105251_10024639 | |||
| 1476 | Ga0105251_10039229 | |||
| 1477 | Ga0105244_10000150 | |||
| 1478 | Ga0105244_10003392 | |||
| 1479 | Ga0105244_10006033 | |||
| 1480 | Ga0105244_10015928 | |||
| 1481 | Ga0105244_10025579 | |||
| 1482 | Ga0105244_10032137 | |||
| 1483 | Ga0105244_10072005 | |||
| 1484 | Ga0105244_10137465 | |||
| 1485 | Ga0105244_10140739 | |||
| 1486 | Ga0105244_10162711 | |||
| 1487 | Ga0105244_10235346 | |||
| 1488 | Ga0105244_10257747 | |||
| 1489 | Ga0105244_10268191 | |||
| 1490 | Ga0105244_10347310 | |||
| 1491 | Ga0105250_10000189 | |||
| 1492 | Ga0105250_10000563 | |||
| 1493 | Ga0105250_10003375 | |||
| 1494 | Ga0105250_10011966 | |||
| 1495 | Ga0105250_10012895 | |||
| 1496 | Ga0105250_10022989 | |||
| 1497 | Ga0105250_10035736 | |||
| 1498 | Ga0105250_10112493 | |||
| 1499 | Ga0105250_10113245 | |||
| 1500 | Ga0105250_10275142 | |||
| 1501 | Ga0105245_10865035 | |||
| 1502 | Ga0105243_10005012 | |||
| 1503 | Ga0105243_10006596 | |||
| 1504 | Ga0105243_10140269 | |||
| 1505 | Ga0105243_10279483 | |||
| 1506 | Ga0105242_10000136 | |||
| 1507 | Ga0105242_10040113 | |||
| 1508 | Ga0105242_12054315 | |||
| 1509 | Ga0105248_10082623 | |||
| 1510 | Ga0105237_10001470 | |||
| 1511 | Ga0105237_10262504 | |||
| 1512 | Ga0105249_10015383 | |||
| 1513 | Ga0105239_11280485 | |||
| 1514 | Ga0105246_10000042 | |||
| 1515 | Ga0105246_10008921 | |||
| 1516 | Ga0105246_10023172 | |||
| 1517 | Ga0105246_10096915 | |||
| 1518 | Ga0105246_11691895 | |||
| 1519 | Ga0157319_1012460 | |||
| 1520 | Ga0157345_1000150 | |||
| 1521 | Ga0157345_1001360 | |||
| 1522 | Ga0157347_1003012 | |||
| 1523 | Ga0157347_1017063 | |||
| 1524 | Ga0157373_10006406 | |||
| 1525 | Ga0157373_10009306 | |||
| 1526 | Ga0157373_10018548 | |||
| 1527 | Ga0157373_10020368 | |||
| 1528 | Ga0157373_10030338 | |||
| 1529 | Ga0157373_10051111 | |||
| 1530 | Ga0157373_10084064 | |||
| 1531 | Ga0157373_10126206 | |||
| 1532 | Ga0157373_10505065 | |||
| 1533 | Ga0157373_10989018 | |||
| 1534 | Ga0157371_10000233 | |||
| 1535 | Ga0157371_10006166 | |||
| 1536 | Ga0157371_10006436 | |||
| 1537 | Ga0157371_10017734 | |||
| 1538 | Ga0157371_10071084 | |||
| 1539 | Ga0157371_10434187 | |||
| 1540 | Ga0157370_10024235 | |||
| 1541 | Ga0157370_10072622 | |||
| 1542 | Ga0157370_10111146 | |||
| 1543 | Ga0157370_10536650 | |||
| 1544 | Ga0157370_10568183 | |||
| 1545 | Ga0157370_11631393 | |||
| 1546 | Ga0157369_10015281 | |||
| 1547 | Ga0157369_10015630 | |||
| 1548 | Ga0157369_10029826 | |||
| 1549 | Ga0157369_10049867 | |||
| 1550 | Ga0157369_10599537 | |||
| 1551 | Ga0157369_10857660 | |||
| 1552 | Ga0163162_10004175 | |||
| 1553 | Ga0163162_10603127 | |||
| 1554 | Ga0163162_12786312 | |||
| 1555 | Ga0157372_10006718 | |||
| 1556 | Ga0157372_10017841 | |||
| 1557 | Ga0157372_11580379 | |||
| 1558 | Ga0157375_10010484 | |||
| 1559 | Ga0157375_10061058 | |||
| 1560 | Ga0157375_10078787 | |||
| 1561 | Ga0157375_10506430 | |||
| 1562 | Ga0182008_10007521 | |||
| 1563 | Ga0182008_10021797 | |||
| 1564 | Ga0182008_10022595 | |||
| 1565 | Ga0182008_10023689 | |||
| 1566 | Ga0182008_10043259 | |||
| 1567 | Ga0182008_10071170 | |||
| 1568 | Ga0182008_10091340 | |||
| 1569 | Ga0182008_10265757 | |||
| 1570 | Ga0182008_10453331 | |||
| 1571 | Ga0182006_1000380 | |||
| 1572 | Ga0182006_1001500 | |||
| 1573 | Ga0182006_1002034 | |||
| 1574 | Ga0182006_1024996 | |||
| 1575 | Ga0182006_1078140 | |||
| 1576 | Ga0182006_1080600 | |||
| 1577 | Ga0182006_1140704 | |||
| 1578 | Ga0182007_10000194 | |||
| 1579 | Ga0182007_10011603 | |||
| 1580 | Ga0182005_1001882 | |||
| 1581 | Ga0182005_1009562 | |||
| 1582 | Ga0182005_1009677 | |||
| 1583 | Ga0182005_1043094 | |||
| 1584 | Ga0163161_10010163 | |||
| 1585 | Ga0163161_10013821 | |||
| 1586 | Ga0163161_10020284 | |||
| 1587 | Ga0163161_10144766 | |||
| 1588 | Ga0163161_10244012 | |||
| 1589 | Ga0163161_10402568 | |||
| 1590 | Ga0163161_10465147 | |||
| 1591 | Ga0163161_10474558 | |||
| 1592 | Ga0163161_10962900 | |||
| 1593 | Ga0163161_11469852 | |||
| 1594 | Ga0209435_107630 | |||
| 1595 | Ga0209760_100037 | |||
| 1596 | Ga0209760_100128 | |||
| 1597 | Ga0209784_100028 | |||
| 1598 | Ga0209566_100028 | |||
| 1599 | Ga0209674_100047 | |||
| 1600 | Ga0209147_100031 | |||
| 1601 | Ga0209563_100050 | |||
| 1602 | Ga0209563_101918 | |||
| 1603 | Ga0207427_100014 | |||
| 1604 | Ga0207427_100016 | |||
| 1605 | Ga0209437_100011 | |||
| 1606 | Ga0209437_100016 | |||
| 1607 | Ga0209258_100150 | |||
| 1608 | Ga0209646_1002644 | |||
| 1609 | Ga0209677_100029 | |||
| 1610 | Ga0209759_1004406 | |||
| 1611 | Ga0209759_1006221 | |||
| 1612 | Ga0209233_1000019 | |||
| 1613 | Ga0209233_1000036 | |||
| 1614 | Ga0209675_1013183 | |||
| 1615 | Ga0209676_1000032 | |||
| 1616 | Ga0209676_1000318 | |||
| 1617 | Ga0209676_1000917 | |||
| 1618 | Ga0209676_1007187 | |||
| 1619 | Ga0209676_1018639 | |||
| 1620 | Ga0209050_1000025 | |||
| 1621 | Ga0209050_1000028 | |||
| 1622 | Ga0209050_1018157 | |||
| 1623 | Ga0209051_1000080 | |||
| 1624 | Ga0209051_1000334 | |||
| 1625 | Ga0209051_1028205 | |||
| 1626 | Ga0209257_1003931 | |||
| 1627 | Ga0207656_10000007 | |||
| 1628 | Ga0207696_1000057 | |||
| 1629 | Ga0207696_1000084 | |||
| 1630 | Ga0207696_1000094 | |||
| 1631 | Ga0207696_1001227 | |||
| 1632 | Ga0207696_1008849 | |||
| 1633 | Ga0207696_1022518 | |||
| 1634 | Ga0207696_1022870 | |||
| 1635 | Ga0207696_1027622 | |||
| 1636 | Ga0207696_1041058 | |||
| 1637 | Ga0207655_1000326 | |||
| 1638 | Ga0207655_1001453 | |||
| 1639 | Ga0207655_1001564 | |||
| 1640 | Ga0207655_1002818 | |||
| 1641 | Ga0207655_1003190 | |||
| 1642 | Ga0207655_1004885 | |||
| 1643 | Ga0207655_1005690 | |||
| 1644 | Ga0207655_1030358 | |||
| 1645 | Ga0207655_1032538 | |||
| 1646 | Ga0207655_1059076 | |||
| 1647 | Ga0207655_1069941 | |||
| 1648 | Ga0207655_1085012 | |||
| 1649 | Ga0207655_1085532 | |||
| 1650 | Ga0207655_1195513 | |||
| 1651 | Ga0207713_1000010 | |||
| 1652 | Ga0207713_1000081 | |||
| 1653 | Ga0207713_1000331 | |||
| 1654 | Ga0207713_1000434 | |||
| 1655 | Ga0207713_1001155 | |||
| 1656 | Ga0207713_1001511 | |||
| 1657 | Ga0207713_1001867 | |||
| 1658 | Ga0207713_1003673 | |||
| 1659 | Ga0207713_1023716 | |||
| 1660 | Ga0207713_1035648 | |||
| 1661 | Ga0207713_1037064 | |||
| 1662 | Ga0207671_10000015 | |||
| 1663 | Ga0207671_10190917 | |||
| 1664 | Ga0207649_10000001 | |||
| 1665 | Ga0207681_10000236 | |||
| 1666 | Ga0207681_10601043 | |||
| 1667 | Ga0207650_10000273 | |||
| 1668 | Ga0207650_10001191 | |||
| 1669 | Ga0207706_10000069 | |||
| 1670 | Ga0207706_10016749 | |||
| 1671 | Ga0207686_10018937 | |||
| 1672 | Ga0207686_10199424 | |||
| 1673 | Ga0207709_10000164 | |||
| 1674 | Ga0207709_10003988 | |||
| 1675 | Ga0207709_10182663 | |||
| 1676 | Ga0207711_10192508 | |||
| 1677 | Ga0207679_10000011 | |||
| 1678 | Ga0207679_10201276 | |||
| 1679 | Ga0207712_10088941 | |||
| 1680 | Ga0207640_10018682 | |||
| 1681 | Ga0207639_10001938 | |||
| 1682 | Ga0207678_10396408 | |||
| 1683 | Ga0209281_1000026 | |||
| 1684 | Ga0209281_1000033 | |||
| 1685 | Ga0209281_1010165 | |||
| 1686 | Ga0209281_1013711 | |||
| 1687 | Ga0209371_1003572 | |||
| 1688 | Ga0209967_1015633 | |||
| 1689 | Ga0209999_1016517 | |||
| 1690 | Ga0210002_1026310 | |||
| 1691 | Ga0209282_1055635 | |||
| 1692 | Ga0209974_10149544 | |||
| 1693 | Ga0209974_10229996 | |||
| 1694 | Ga0207428_10010522 | |||
| 1695 | Ga0207428_10037461 | |||
| 1696 | Ga0207428_10041265 | |||
| 1697 | Ga0207428_10054765 | |||
| 1698 | Ga0207428_10107138 | |||
| 1699 | Ga0207428_10210799 | |||
| 1700 | Ga0207428_10301035 | |||
| 1701 | Ga0207428_10438070 | |||
| 1702 | Ga0207428_10652450 | |||
| 1703 | Ga0207428_11310930 | |||
| 1704 | Ga0268266_10190656 | |||
| 1705 | Ga0268266_11291082 | |||
| 1706 | Ga0307517_10273045 | |||
| 1707 | Ga0268256_1003564 | |||
| 1708 | Ga0307511_10168437 | |||
| 1709 | Ga0314311_1052920 | |||
| 1710 | Ga0316179_1119071 | |||
| 1711 | Ga0316178_1039458 | |||
| 1712 | Ga0316183_1008127 | |||
| 1713 | Ga0316183_1136437 | |||
| 1714 | Ga0316183_1174722 | |||
| 1715 | Ga0316181_1167159 | |||
| 1716 | Ga0265316_10244112 | |||
| 1717 | Ga0307509_10313682 | |||
| 1718 | Ga0307408_100003159 | |||
| 1719 | Ga0307408_100008950 | |||
| 1720 | Ga0307408_100009139 | |||
| 1721 | Ga0307408_100029957 | |||
| 1722 | Ga0307514_10556022 | |||
| 1723 | Ga0307516_10277155 | |||
| 1724 | Ga0307516_10318467 | |||
| 1725 | Ga0307516_10694635 | |||
| 1726 | Ga0307405_10002831 | |||
| 1727 | Ga0307405_10013908 | |||
| 1728 | Ga0307405_11212027 | |||
| 1729 | Ga0307413_10067790 | |||
| 1730 | Ga0307413_10181364 | |||
| 1731 | Ga0307406_10006076 | |||
| 1732 | Ga0307406_10167042 | |||
| 1733 | Ga0307407_10131949 | |||
| 1734 | Ga0307407_10743082 | |||
| 1735 | Ga0307412_10005224 | |||
| 1736 | Ga0307412_10017377 | |||
| 1737 | Ga0307412_10019891 | |||
| 1738 | Ga0307412_10143806 | |||
| 1739 | Ga0307412_10288616 | |||
| 1740 | Ga0307412_11230588 | |||
| 1741 | Ga0307409_100003250 | |||
| 1742 | Ga0307409_100025053 | |||
| 1743 | Ga0307416_100161931 | |||
| 1744 | Ga0307414_10028481 | |||
| 1745 | Ga0307414_10036860 | |||
| 1746 | Ga0307414_10218747 | |||
| 1747 | Ga0307414_10342963 | |||
| 1748 | Ga0307411_10003995 | |||
| 1749 | Ga0307411_10091971 | |||
| 1750 | Ga0307411_10164009 | |||
| 1751 | Ga0307411_11934714 | |||
| 1752 | Ga0307510_10008778 | |||
| 1753 | Ga0307510_10209008 | |||
| 1754 | Ga0439438_000895 | |||
| 1755 | Ga0439438_000943 | |||
| 1756 | Ga0439438_001610 | |||
| 1757 | Ga0439438_001695 | |||
| 1758 | Ga0439438_007573 | |||
| 1759 | Ga0439438_008436 | |||
| 1760 | Ga0439438_043599 | |||
| 1761 | Ga0439438_062669 | |||
| 1762 | Ga0439447_000594 | |||
| 1763 | Ga0439447_001937 | |||
| 1764 | Ga0439447_009105 | |||
| 1765 | Ga0439447_010596 | |||
| 1766 | Ga0439447_014384 | |||
| 1767 | Ga0439447_016669 | |||
| 1768 | Ga0439447_019275 | |||
| 1769 | Ga0439461_0132493 | |||
| 1770 | Ga0439466_0001027 | |||
| 1771 | Ga0439466_0003876 | |||
| 1772 | Ga0439466_0011287 | |||
| 1773 | Ga0439466_0022289 | |||
| 1774 | Ga0439466_0026737 | |||
| 1775 | Ga0439466_0029296 | |||
| 1776 | Ga0439465_0025755 | |||
| 1777 | Ga0451797_0245844 | |||
| 1778 | Ga0451800_1202188 | |||
| 1779 | Ga0451839_1515046 | |||
| 1780 | Ga0451843_0348190 | |||
| 1781 | Ga0439431_0007158 | |||
| 1782 | Ga0439437_040551 | |||
| 1783 | Ga0439445_0005035 | |||
| 1784 | Ga0439445_0070018 | |||
| 1785 | Ga0439432_001591 | |||
| 1786 | Ga0439432_001979 | |||
| 1787 | Ga0439432_003888 | |||
| 1788 | Ga0439432_005422 | |||
| 1789 | Ga0439432_008732 | |||
| 1790 | Ga0439432_029115 | |||
| 1791 | Ga0439451_000295 | |||
| 1792 | Ga0439451_001271 | |||
| 1793 | Ga0439451_002836 | |||
| 1794 | Ga0439451_009844 | |||
| 1795 | Ga0439451_021672 | |||
| 1796 | Ga0439451_027034 | |||
| 1797 | Ga0439451_047915 | |||
| 1798 | Ga0439452_000245 | |||
| 1799 | Ga0439452_000916 | |||
| 1800 | Ga0439452_002389 | |||
| 1801 | Ga0439452_003442 | |||
| 1802 | Ga0439452_008811 | |||
| 1803 | Ga0439452_011602 | |||
| 1804 | Ga0439452_011979 | |||
| 1805 | Ga0439452_015522 | |||
| 1806 | Ga0439456_000068 | |||
| 1807 | Ga0439456_001604 | |||
| 1808 | Ga0439456_005484 | |||
| 1809 | Ga0439456_006247 | |||
| 1810 | Ga0439456_014350 | |||
| 1811 | Ga0439456_039327 | |||
| 1812 | Ga0439456_045928 | |||
| 1813 | Ga0439456_114566 | |||
| 1814 | Ga0439463_001959 | |||
| 1815 | Ga0439463_002347 | |||
| 1816 | Ga0439463_009395 | |||
| 1817 | Ga0439463_011578 | |||
| 1818 | Ga0439463_023609 | |||
| 1819 | Ga0439463_029459 | |||
| 1820 | Ga0450911_000931 | |||
| 1821 | Ga0450911_007407 | |||
| 1822 | Ga0450919_000254 | |||
| 1823 | Ga0450920_000169 | |||
| 1824 | Ga0450922_000220 | |||
| 1825 | Ga0450922_000469 | |||
| 1826 | Ga0450890_000360 | |||
| 1827 | Ga0450902_002273 | |||
| 1828 | Ga0450902_005477 | |||
| 1829 | Ga0450903_000405 | |||
| 1830 | Ga0450903_000944 | |||
| 1831 | Ga0450903_003293 | |||
| 1832 | Ga0450903_018666 | |||
| 1833 | Ga0450904_001729 | |||
| 1834 | Ga0450904_002969 | |||
| 1835 | Ga0450906_001172 | |||
| 1836 | Ga0450906_001316 | |||
| 1837 | Ga0450906_007193 | |||
| 1838 | Ga0450907_000396 | |||
| 1839 | Ga0450907_001068 | |||
| 1840 | Ga0450907_006889 | |||
| 1841 | Ga0450910_005651 | |||
| 1842 | Ga0450910_014634 | |||
| 1843 | Ga0439446_0001252 | |||
| 1844 | Ga0439446_0010469 | |||
| 1845 | Ga0439446_0352807 | |||
| 1846 | Ga0450908_000362 | |||
| 1847 | Ga0450908_010904 | |||
| 1848 | Ga0450908_033253 | |||
| 1849 | Ga0450909_000403 | |||
| 1850 | Ga0450909_025204 | |||
| 1851 | Ga0439434_0001038 | |||
| 1852 | Ga0439464_0011426 | |||
| 1853 | Ga0439460_0000843 | |||
| 1854 | Ga0439460_0001275 | |||
| 1855 | Ga0439460_0011869 | |||
| 1856 | Ga0439460_0175187 | |||
| 1857 | Ga0450893_0116644 | |||
| 1858 | Ga0450901_001516 | |||
| 1859 | Ga0439440_0007592 | |||
| 1860 | Ga0439440_0010898 | |||
| 1861 | Ga0439440_0015543 | |||
| 1862 | Ga0495617_001252 | |||
| 1863 | Ga0495617_002036 | |||
| 1864 | Ga0495617_009461 | |||
| 1865 | Ga0495617_016040 | |||
| 1866 | Ga0495617_025538 | |||
| 1867 | Ga0495617_035712 | |||
| 1868 | Ga0495617_039006 | |||
| 1869 | Ga0495617_067035 | |||
| 1870 | Ga0495617_130402 | |||
| 1871 | Ga0495617_192372 | |||
| 1872 | Ga0495617_196449 | |||
| 1873 | Ga0495627_000023 | |||
| 1874 | Ga0495627_002567 | |||
| 1875 | Ga0495627_002595 | |||
| 1876 | Ga0495627_002735 | |||
| 1877 | Ga0495627_003498 | |||
| 1878 | Ga0495627_006230 | |||
| 1879 | Ga0495627_055006 | |||
| 1880 | Ga0495627_070778 | |||
| 1881 | Ga0495627_086507 | |||
| 1882 | Ga0495627_130841 | |||
| 1883 | Ga0495603_0002137 | |||
| 1884 | Ga0495603_0014300 | |||
| 1885 | Ga0495590_0002152 | |||
| 1886 | Ga0495590_0003297 | |||
| 1887 | Ga0495590_0008119 | |||
| 1888 | Ga0495590_0047060 | |||
| 1889 | Ga0495590_0070298 | |||
| 1890 | Ga0495590_0112100 | |||
| 1891 | Ga0495591_000025 | |||
| 1892 | Ga0495591_000244 | |||
| 1893 | Ga0495591_001373 | |||
| 1894 | Ga0495591_003017 | |||
| 1895 | Ga0495591_004206 | |||
| 1896 | Ga0495591_005508 | |||
| 1897 | Ga0495591_005520 | |||
| 1898 | Ga0495591_005940 | |||
| 1899 | Ga0495591_006499 | |||
| 1900 | Ga0495591_007664 | |||
| 1901 | Ga0495591_015706 | |||
| 1902 | Ga0495591_026961 | |||
| 1903 | Ga0495629_0122911 | |||
| 1904 | Ga0495638_0003976 | |||
| 1905 | Ga0495638_0024770 | |||
| 1906 | Ga0495638_0028408 | |||
| 1907 | Ga0495638_0040944 | |||
| 1908 | Ga0495638_0045473 | |||
| 1909 | Ga0495638_0052331 | |||
| 1910 | Ga0495638_0077130 | |||
| 1911 | Ga0495638_0175252 | |||
| 1912 | Ga0495638_0180132 | |||
| 1913 | Ga0495638_0214706 | |||
| 1914 | Ga0495638_0251377 | |||
| 1915 | Ga0495638_0362105 | |||
| 1916 | Ga0495653_0012150 | |||
| 1917 | Ga0495653_0015283 | |||
| 1918 | Ga0495653_0117071 | |||
| 1919 | Ga0495650_0001139 | |||
| 1920 | Ga0495650_0005815 | |||
| 1921 | Ga0495650_0013469 | |||
| 1922 | Ga0495650_0035876 | |||
| 1923 | Ga0495650_0100235 | |||
| 1924 | Ga0495650_0147655 | |||
| 1925 | Ga0495580_0215592 | |||
| 1926 | Ga0495582_0003045 | |||
| 1927 | Ga0495605_0000019 | |||
| 1928 | Ga0495605_0000590 | |||
| 1929 | Ga0495605_0001401 | |||
| 1930 | Ga0495605_0002078 | |||
| 1931 | Ga0495605_0004708 | |||
| 1932 | Ga0495605_0013797 | |||
| 1933 | Ga0495605_0014665 | |||
| 1934 | Ga0495605_0015980 | |||
| 1935 | Ga0495605_0028743 | |||
| 1936 | Ga0495605_0032698 | |||
| 1937 | Ga0495605_0053149 | |||
| 1938 | Ga0495605_0074953 | |||
| 1939 | Ga0495605_0122104 | |||
| 1940 | Ga0495639_0000839 | |||
| 1941 | Ga0495584_0001559 | |||
| 1942 | Ga0495584_0003862 | |||
| 1943 | Ga0495584_0008899 | |||
| 1944 | Ga0495584_0013034 | |||
| 1945 | Ga0495584_0013406 | |||
| 1946 | Ga0495584_0014901 | |||
| 1947 | Ga0495584_0016932 | |||
| 1948 | Ga0495584_0030067 | |||
| 1949 | Ga0495584_0045569 | |||
| 1950 | Ga0495584_0171292 | |||
| 1951 | Ga0495584_0193554 | |||
| 1952 | Ga0495584_0355969 | |||
| 1953 | Ga0495585_0000279 | |||
| 1954 | Ga0495585_0004049 | |||
| 1955 | Ga0495585_0006058 | |||
| 1956 | Ga0495585_0008285 | |||
| 1957 | Ga0495585_0017741 | |||
| 1958 | Ga0495585_0039667 | |||
| 1959 | Ga0495585_0069924 | |||
| 1960 | Ga0495585_0082562 | |||
| 1961 | Ga0495585_0134041 | |||
| 1962 | Ga0495585_0159267 | |||
| 1963 | Ga0495585_0412471 | |||
| 1964 | Ga0495594_0003858 | |||
| 1965 | Ga0495594_0164820 | |||
| 1966 | Ga0495596_0000273 | |||
| 1967 | Ga0495596_0006975 | |||
| 1968 | Ga0495596_0007429 | |||
| 1969 | Ga0495607_0000069 | |||
| 1970 | Ga0495607_0001773 | |||
| 1971 | Ga0495607_0005339 | |||
| 1972 | Ga0495607_0006721 | |||
| 1973 | Ga0495607_0010685 | |||
| 1974 | Ga0495607_0012678 | |||
| 1975 | Ga0495607_0014232 | |||
| 1976 | Ga0495607_0015050 | |||
| 1977 | Ga0495607_0020866 | |||
| 1978 | Ga0495607_0020932 | |||
| 1979 | Ga0495607_0021828 | |||
| 1980 | Ga0495607_0028371 | |||
| 1981 | Ga0495607_0029331 | |||
| 1982 | Ga0495607_0029336 | |||
| 1983 | Ga0495607_0042096 | |||
| 1984 | Ga0495607_0042171 | |||
| 1985 | Ga0495607_0048570 | |||
| 1986 | Ga0495607_0051269 | |||
| 1987 | Ga0495607_0057366 | |||
| 1988 | Ga0495607_0058053 | |||
| 1989 | Ga0495607_0059245 | |||
| 1990 | Ga0495607_0106124 | |||
| 1991 | Ga0495607_0168836 | |||
| 1992 | Ga0495607_0252192 | |||
| 1993 | Ga0495607_0334228 | |||
| 1994 | Ga0495607_0521332 | |||
| 1995 | Ga0495583_0000097 | |||
| 1996 | Ga0495583_0002661 | |||
| 1997 | Ga0495583_0005952 | |||
| 1998 | Ga0495583_0007988 | |||
| 1999 | Ga0495583_0016635 | |||
| 2000 | Ga0495583_0027385 | |||
| 2001 | Ga0495583_0034029 | |||
| 2002 | Ga0495583_0034553 | |||
| 2003 | Ga0495583_0037392 | |||
| 2004 | Ga0495583_0041212 | |||
| 2005 | Ga0495606_0000237 | |||
| 2006 | Ga0495606_0002076 | |||
| 2007 | Ga0495606_0004691 | |||
| 2008 | Ga0495606_0009720 | |||
| 2009 | Ga0495606_0017306 | |||
| 2010 | Ga0495606_0020279 | |||
| 2011 | Ga0495606_0023807 | |||
| 2012 | Ga0495606_0026099 | |||
| 2013 | Ga0495606_0036618 | |||
| 2014 | Ga0495606_0039526 | |||
| 2015 | Ga0495606_0133160 | |||
| 2016 | Ga0495606_0159045 | |||
| 2017 | Ga0495606_0257321 | |||
| 2018 | Ga0495606_0403815 | |||
| 2019 | Ga0495610_0006632 | |||
| 2020 | Ga0495610_0007628 | |||
| 2021 | Ga0495610_0010780 | |||
| 2022 | Ga0495610_0014248 | |||
| 2023 | Ga0495610_0015247 | |||
| 2024 | Ga0495610_0020165 | |||
| 2025 | Ga0495610_0029109 | |||
| 2026 | Ga0495610_0039557 | |||
| 2027 | Ga0495610_0133919 | |||
| 2028 | Ga0495610_0189861 | |||
| 2029 | Ga0495610_0209132 | |||
| 2030 | Ga0495610_0297949 | |||
| 2031 | Ga0495610_0322549 | |||
| 2032 | Ga0495616_0003539 | |||
| 2033 | Ga0495616_0008647 | |||
| 2034 | Ga0495616_0010889 | |||
| 2035 | Ga0495616_0018172 | |||
| 2036 | Ga0495616_0023109 | |||
| 2037 | Ga0495616_0029138 | |||
| 2038 | Ga0495616_0070581 | |||
| 2039 | Ga0495616_0097104 | |||
| 2040 | Ga0495616_0295219 | |||
| 2041 | Ga0495616_0470255 | |||
| 2042 | Ga0495620_0000199 | |||
| 2043 | Ga0495620_0000798 | |||
| 2044 | Ga0495620_0003430 | |||
| 2045 | Ga0495620_0015499 | |||
| 2046 | Ga0495620_0018305 | |||
| 2047 | Ga0495620_0018686 | |||
| 2048 | Ga0495620_0031579 | |||
| 2049 | Ga0495620_0039954 | |||
| 2050 | Ga0495620_0044178 | |||
| 2051 | Ga0495620_0048867 | |||
| 2052 | Ga0495630_0065616 | |||
| 2053 | Ga0495630_0150193 | |||
| 2054 | Ga0495631_0000772 | |||
| 2055 | Ga0495631_0003335 | |||
| 2056 | Ga0495631_0006752 | |||
| 2057 | Ga0495631_0015542 | |||
| 2058 | Ga0495631_0020507 | |||
| 2059 | Ga0495631_0043333 | |||
| 2060 | Ga0495631_0057746 | |||
| 2061 | Ga0495631_0060810 | |||
| 2062 | Ga0495631_0102190 | |||
| 2063 | Ga0495631_0112900 | |||
| 2064 | Ga0495631_0114209 | |||
| 2065 | Ga0495631_0189058 | |||
| 2066 | Ga0495632_0003630 | |||
| 2067 | Ga0495632_0003904 | |||
| 2068 | Ga0495632_0003917 | |||
| 2069 | Ga0495632_0007161 | |||
| 2070 | Ga0495632_0012468 | |||
| 2071 | Ga0495632_0014516 | |||
| 2072 | Ga0495632_0019146 | |||
| 2073 | Ga0495632_0025863 | |||
| 2074 | Ga0495632_0032297 | |||
| 2075 | Ga0495632_0072565 | |||
| 2076 | Ga0495632_0123316 | |||
| 2077 | Ga0495632_0203366 | |||
| 2078 | Ga0495632_0225021 | |||
| 2079 | Ga0495632_0242218 | |||
| 2080 | Ga0495632_0277529 | |||
| 2081 | Ga0495632_0349209 | |||
| 2082 | Ga0495632_0378422 | |||
| 2083 | Ga0495637_0000333 | |||
| 2084 | Ga0495637_0001859 | |||
| 2085 | Ga0495637_0002804 | |||
| 2086 | Ga0495637_0003493 | |||
| 2087 | Ga0495637_0003851 | |||
| 2088 | Ga0495637_0004813 | |||
| 2089 | Ga0495637_0009864 | |||
| 2090 | Ga0495637_0015007 | |||
| 2091 | Ga0495637_0016477 | |||
| 2092 | Ga0495637_0020565 | |||
| 2093 | Ga0495637_0021554 | |||
| 2094 | Ga0495637_0025432 | |||
| 2095 | Ga0495637_0026362 | |||
| 2096 | Ga0495637_0043095 | |||
| 2097 | Ga0495637_0047846 | |||
| 2098 | Ga0495637_0063188 | |||
| 2099 | Ga0495637_0067211 | |||
| 2100 | Ga0495637_0086913 | |||
| 2101 | Ga0495637_0120707 | |||
| 2102 | Ga0495637_0366454 | |||
| 2103 | Ga0495643_0030417 | |||
| 2104 | Ga0495643_0036762 | |||
| 2105 | Ga0495643_0037350 | |||
| 2106 | Ga0495643_0057689 | |||
| 2107 | Ga0495643_0082163 | |||
| 2108 | Ga0495644_0001079 | |||
| 2109 | Ga0495644_0002667 | |||
| 2110 | Ga0495644_0019228 | |||
| 2111 | Ga0495644_0107319 | |||
| 2112 | Ga0495644_0310905 | |||
| 2113 | Ga0495648_0004484 | |||
| 2114 | Ga0495648_0007362 | |||
| 2115 | Ga0495648_0010745 | |||
| 2116 | Ga0495648_0012344 | |||
| 2117 | Ga0495648_0020594 | |||
| 2118 | Ga0495648_0025399 | |||
| 2119 | Ga0495648_0032368 | |||
| 2120 | Ga0495648_0038504 | |||
| 2121 | Ga0495648_0061353 | |||
| 2122 | Ga0495648_0095615 | |||
| 2123 | Ga0495648_0096639 | |||
| 2124 | Ga0495648_0158710 | |||
| 2125 | Ga0495648_0203612 | |||
| 2126 | Ga0495666_0020494 | |||
| 2127 | Ga0495666_0025496 | |||
| 2128 | Ga0495666_0295167 | |||
| 2129 | Ga0495642_0000088 | |||
| 2130 | Ga0495642_0002833 | |||
| 2131 | Ga0495642_0006336 | |||
| 2132 | Ga0495652_0918076 | |||
| 2133 | Ga0495654_0003162 | |||
| 2134 | Ga0495654_0005006 | |||
| 2135 | Ga0495654_0007765 | |||
| 2136 | Ga0495654_0008006 | |||
| 2137 | Ga0495654_0013905 | |||
| 2138 | Ga0495654_0014278 | |||
| 2139 | Ga0495654_0015695 | |||
| 2140 | Ga0495654_0024480 | |||
| 2141 | Ga0495654_0029209 | |||
| 2142 | Ga0495654_0032489 | |||
| 2143 | Ga0495654_0034708 | |||
| 2144 | Ga0495654_0036733 | |||
| 2145 | Ga0495654_0047465 | |||
| 2146 | Ga0495654_0068708 | |||
| 2147 | Ga0495654_0163503 | |||
| 2148 | Ga0495586_0093975 | |||
| 2149 | Ga0495587_0020259 | |||
| 2150 | Ga0495587_0084461 | |||
| 2151 | Ga0495587_0245911 | |||
| 2152 | Ga0495609_0000023 | |||
| 2153 | Ga0495609_0000057 | |||
| 2154 | Ga0495609_0000223 | |||
| 2155 | Ga0495609_0003348 | |||
| 2156 | Ga0495609_0009468 | |||
| 2157 | Ga0495609_0022218 | |||
| 2158 | Ga0495609_0409236 | |||
| 2159 | Ga0495597_0000068 | |||
| 2160 | Ga0495597_0003733 | |||
| 2161 | Ga0495597_0005108 | |||
| 2162 | Ga0495597_0006159 | |||
| 2163 | Ga0495597_0015117 | |||
| 2164 | Ga0495597_0015539 | |||
| 2165 | Ga0495597_0022429 | |||
| 2166 | Ga0495597_0028744 | |||
| 2167 | Ga0495597_0043844 | |||
| 2168 | Ga0495597_0105257 | |||
| 2169 | Ga0495622_0001129 | |||
| 2170 | Ga0495622_0001853 | |||
| 2171 | Ga0495622_0003426 | |||
| 2172 | Ga0495622_0009910 | |||
| 2173 | Ga0495622_0016619 | |||
| 2174 | Ga0495622_0125520 | |||
| 2175 | Ga0495622_0372424 | |||
| 2176 | Ga0495633_0000038 | |||
| 2177 | Ga0495633_0007155 | |||
| 2178 | Ga0495633_0327738 | |||
| 2179 | Ga0495656_0138879 | |||
| 2180 | Ga0495656_0192773 | |||
| 2181 | Ga0495656_0622416 | |||
| 2182 | Ga0495668_0008897 | |||
| 2183 | Ga0495668_0013745 | |||
| 2184 | Ga0495668_0021876 | |||
| 2185 | Ga0495668_0085301 | |||
| 2186 | Ga0495668_0118823 | |||
| 2187 | Ga0495668_0212029 | |||
| 2188 | Ga0495668_0230338 | |||
| 2189 | Ga0495668_0251049 | |||
| 2190 | Ga0495634_0002154 | |||
| 2191 | Ga0495611_0001347 | |||
| 2192 | Ga0495611_0001666 | |||
| 2193 | Ga0495611_0007468 | |||
| 2194 | Ga0495611_0008270 | |||
| 2195 | Ga0495611_0129438 | |||
| 2196 | Ga0495611_0153660 | |||
| 2197 | Ga0495611_0349589 | |||
| 2198 | Ga0495625_0000027 | |||
| 2199 | Ga0495625_0006192 | |||
| 2200 | Ga0495625_0023688 | |||
| 2201 | Ga0495625_0043629 | |||
| 2202 | Ga0495625_0114443 | |||
| 2203 | Ga0495625_0240886 | |||
| 2204 | Ga0495625_0484612 | |||
| 2205 | Ga0495635_0002064 | |||
| 2206 | Ga0495635_0048295 | |||
| 2207 | Ga0495659_0000084 | |||
| 2208 | Ga0495659_0011412 | |||
| 2209 | Ga0495661_0000079 | |||
| 2210 | Ga0495661_0000174 | |||
| 2211 | Ga0495661_0000605 | |||
| 2212 | Ga0495661_0003371 | |||
| 2213 | Ga0495661_0008638 | |||
| 2214 | Ga0495661_0012878 | |||
| 2215 | Ga0495661_0034417 | |||
| 2216 | Ga0495661_0051015 | |||
| 2217 | Ga0495661_0081179 | |||
| 2218 | Ga0495661_0138820 | |||
| 2219 | Ga0495661_0164656 | |||
| 2220 | Ga0495661_0288527 | |||
| 2221 | Ga0495661_0315930 | |||
| 2222 | Ga0495661_0351744 | |||
| 2223 | Ga0495657_0083417 | |||
| 2224 | Ga0495599_0324178 | |||
| 2225 | Ga0495623_0018100 | |||
| 2226 | Ga0495623_0029091 | |||
| 2227 | Ga0495646_0034891 | |||
| 2228 | Ga0495646_0048135 | |||
| 2229 | Ga0495669_0092214 | |||
| 2230 | Ga0495613_0267246 | |||
| 2231 | Ga0495670_0001330 | |||
| 2232 | Ga0495670_0001845 | |||
| 2233 | Ga0495670_0028455 | |||
| 2234 | Ga0495670_0049620 | |||
| 2235 | Ga0495670_0124297 | |||
| 2236 | Ga0495671_0000157 | |||
| 2237 | Ga0495671_0003172 | |||
| 2238 | Ga0495671_0008732 | |||
| 2239 | Ga0495671_0009522 | |||
| 2240 | Ga0495671_0020056 | |||
| 2241 | Ga0495671_0020261 | |||
| 2242 | Ga0495671_0023491 | |||
| 2243 | Ga0495671_0036229 | |||
| 2244 | Ga0495671_0036976 | |||
| 2245 | Ga0495671_0044620 | |||
| 2246 | Ga0495671_0110184 | |||
| 2247 | Ga0495671_0124046 | |||
| 2248 | Ga0495671_0137802 | |||
| 2249 | Ga0495671_0171835 | |||
| 2250 | Ga0495671_0373810 | |||
| 2251 | Ga0495671_0410960 | |||
| 2252 | Ga0495649_0001274 | |||
| 2253 | Ga0495649_0005977 | |||
| 2254 | Ga0495649_0006800 | |||
| 2255 | Ga0495649_0006831 | |||
| 2256 | Ga0495649_0006917 | |||
| 2257 | Ga0495649_0006919 | |||
| 2258 | Ga0495649_0018829 | |||
| 2259 | Ga0495649_0036409 | |||
| 2260 | Ga0495649_0040217 | |||
| 2261 | Ga0495649_0094493 | |||
| 2262 | Ga0495649_0108147 | |||
| 2263 | Ga0495649_0114905 | |||
| 2264 | Ga0495649_0173710 | |||
| 2265 | Ga0495649_0309852 | |||
| 2266 | Ga0495649_0470577 | |||
| 2267 | Ga0495589_0001387 | |||
| 2268 | Ga0495589_0002692 | |||
| 2269 | Ga0495589_0025557 | |||
| 2270 | Ga0495589_0039061 | |||
| 2271 | Ga0495589_0070269 | |||
| 2272 | Ga0495589_0101696 | |||
| 2273 | Ga0495589_0113862 | |||
| 2274 | Ga0495600_0013204 | |||
| 2275 | Ga0495600_0046174 | |||
| 2276 | Ga0495660_0008107 | |||
| 2277 | Ga0495660_0008496 | |||
| 2278 | Ga0495660_0010776 | |||
| 2279 | Ga0495660_0012391 | |||
| 2280 | Ga0495660_0013889 | |||
| 2281 | Ga0495660_0017046 | |||
| 2282 | Ga0495660_0023416 | |||
| 2283 | Ga0495660_0024828 | |||
| 2284 | Ga0495660_0030875 | |||
| 2285 | Ga0495660_0104043 | |||
| 2286 | Ga0495660_0154462 | |||
| 2287 | Ga0495660_0156446 | |||
| 2288 | Ga0495660_0293352 | |||
| 2289 | Ga0495660_0333350 | |||
| 2290 | Ga0495660_0373705 | |||
| 2291 | Ga0495581_0044784 | |||
| 2292 | Ga0495604_0001368 | |||
| 2293 | Ga0495604_0116686 | |||
| 2294 | Ga0495636_0015593 | |||
| 2295 | Ga0495636_0109318 | |||
| 2296 | Ga0495636_0403435 | |||
| 2297 | Ga0495674_0066383 | |||
| 2298 | Ga0495672_0001137 | |||
| 2299 | Ga0495672_0004893 | |||
| 2300 | Ga0495672_0005914 | |||
| 2301 | Ga0495672_0006401 | |||
| 2302 | Ga0495672_0011467 | |||
| 2303 | Ga0495672_0053598 | |||
| 2304 | Ga0495672_0061661 | |||
| 2305 | Ga0495672_0068328 | |||
| 2306 | Ga0495672_0070544 | |||
| 2307 | Ga0495672_0091148 | |||
| 2308 | Ga0495672_0145302 | |||
| 2309 | Ga0495672_0157217 | |||
| 2310 | Ga0495672_0257142 | |||
| 2311 | Ga0495672_0321635 | |||
| 2312 | Ga0495676_0000012 | |||
| 2313 | Ga0495676_0009827 | |||
| 2314 | Ga0495676_0026663 | |||
| 2315 | Ga0495680_0001940 | |||
| 2316 | Ga0495680_0041000 | |||
| 2317 | Ga0495680_0105231 | |||
| 2318 | Ga0495683_0000016 | |||
| 2319 | Ga0495683_0000032 | |||
| 2320 | Ga0495683_0001989 | |||
| 2321 | Ga0495683_0007876 | |||
| 2322 | Ga0495683_0011212 | |||
| 2323 | Ga0495683_0019006 | |||
| 2324 | Ga0495683_0024672 | |||
| 2325 | Ga0495683_0047405 | |||
| 2326 | Ga0495683_0166558 | |||
| 2327 | Ga0495683_0255315 | |||
| 2328 | Ga0495687_006199 | |||
| 2329 | Ga0495675_0003583 | |||
| 2330 | Ga0495675_0167742 | |||
| 2331 | Ga0495677_0005074 | |||
| 2332 | Ga0495679_000070 | |||
| 2333 | Ga0495679_002094 | |||
| 2334 | Ga0495679_006718 | |||
| 2335 | Ga0495679_025342 | |||
| 2336 | Ga0495679_042746 | |||
| 2337 | Ga0495679_048884 | |||
| 2338 | Ga0495679_183355 | |||
| 2339 | Ga0495685_031685 | |||
| 2340 | Ga0495685_263765 | |||
| 2341 | Ga0495673_0000544 | |||
| 2342 | Ga0495673_0001906 | |||
| 2343 | Ga0495673_0004289 | |||
| 2344 | Ga0495673_0006079 | |||
| 2345 | Ga0495673_0007426 | |||
| 2346 | Ga0495673_0011635 | |||
| 2347 | Ga0495673_0012744 | |||
| 2348 | Ga0495673_0016125 | |||
| 2349 | Ga0495673_0021138 | |||
| 2350 | Ga0495673_0025441 | |||
| 2351 | Ga0495673_0026484 | |||
| 2352 | Ga0495673_0034216 | |||
| 2353 | Ga0495673_0053403 | |||
| 2354 | Ga0495673_0053407 | |||
| 2355 | Ga0495673_0058651 | |||
| 2356 | Ga0495673_0070490 | |||
| 2357 | Ga0495673_0111908 | |||
| 2358 | Ga0495681_0001948 | |||
| 2359 | Ga0495681_0009739 | |||
| 2360 | Ga0495681_0014724 | |||
| 2361 | Ga0495681_0019130 | |||
| 2362 | Ga0495681_0020491 | |||
| 2363 | Ga0495681_0023146 | |||
| 2364 | Ga0495681_0030912 | |||
| 2365 | Ga0495681_0032164 | |||
| 2366 | Ga0495681_0052739 | |||
| 2367 | Ga0495681_0083046 | |||
| 2368 | Ga0495681_0103410 | |||
| 2369 | Ga0495681_0151749 | |||
| 2370 | Ga0495681_0169919 | |||
| 2371 | Ga0495681_0250017 | |||
| 2372 | Ga0495684_0114485 | |||
| 2373 | Ga0495686_0007758 | |||
| 2374 | Ga0495686_0012175 | |||
| 2375 | Ga0495686_0016954 | |||
| 2376 | Ga0495686_0096706 | |||
| 2377 | Ga0495686_0123672 | |||
| 2378 | Ga0495686_0241934 | |||
| 2379 | Ga0495686_0295276 | |||
| 2380 | Ga0495593_0016753 | |||
| 2381 | Ga0495593_0141563 | |||
| 2382 | Ga0495593_0188074 | |||
| 2383 | Ga0495614_0097548 | |||
| 2384 | Ga0495626_0000109 | |||
| 2385 | Ga0495626_0000391 | |||
| 2386 | Ga0495626_0000562 | |||
| 2387 | Ga0495626_0004473 | |||
| 2388 | Ga0495626_0005845 | |||
| 2389 | Ga0495626_0016923 | |||
| 2390 | Ga0495626_0022129 | |||
| 2391 | Ga0495626_0038816 | |||
| 2392 | Ga0496102_0010153 | |||
| 2393 | Ga0496102_1267083 | |||
| 2394 | Ga0496103_0028057 | |||
| 2395 | Ga0496106_0164393 | |||
| 2396 | Ga0496110_0100035 | |||
| 2397 | Ga0496110_0247009 | |||
| 2398 | Ga0496111_0310192 | |||
| 2399 | Ga0496111_0357337 | |||
| 2400 | Ga0496112_0127244 | |||
| 2401 | Ga0496112_0334460 | |||
| 2402 | Ga0496113_0058849 | |||
| 2403 | Ga0496113_1055552 | |||
| 2404 | Ga0496114_0144704 | |||
| 2405 | Ga0496115_0077785 | |||
| 2406 | Ga0496116_0000376 | |||
| 2407 | Ga0496116_0004285 | |||
| 2408 | Ga0496116_0007000 | |||
| 2409 | Ga0496116_0018000 | |||
| 2410 | Ga0496116_0026828 | |||
| 2411 | Ga0496116_0046355 | |||
| 2412 | Ga0496116_0098026 | |||
| 2413 | Ga0496117_0001205 | |||
| 2414 | Ga0496117_0009929 | |||
| 2415 | Ga0496117_0019325 | |||
| 2416 | Ga0496117_0027087 | |||
| 2417 | Ga0496117_0040972 | |||
| 2418 | Ga0496117_0058215 | |||
| 2419 | Ga0496117_0078148 | |||
| 2420 | Ga0496117_0099735 | |||
| 2421 | Ga0496117_0118767 | |||
| 2422 | Ga0496118_0016422 | |||
| 2423 | Ga0496118_0049479 | |||
| 2424 | Ga0496118_0061716 | |||
| 2425 | Ga0496118_0065299 | |||
| 2426 | Ga0496118_0065818 | |||
| 2427 | Ga0496118_0085714 | |||
| 2428 | Ga0496118_0106344 | |||
| 2429 | Ga0496119_0263586 | |||
| 2430 | Ga0496120_0015093 | |||
| 2431 | Ga0496121_0001119 | |||
| 2432 | Ga0496121_0003154 | |||
| 2433 | Ga0496121_0019282 | |||
| 2434 | Ga0496121_0065351 | |||
| 2435 | Ga0496121_0153993 | |||
| 2436 | Ga0496121_0224181 | |||
| 2437 | Ga0496122_0000370 | |||
| 2438 | Ga0496122_0007502 | |||
| 2439 | Ga0496122_0015044 | |||
| 2440 | Ga0496122_0034982 | |||
| 2441 | Ga0496122_0042694 | |||
| 2442 | Ga0496122_0069921 | |||
| 2443 | Ga0496123_0000135 | |||
| 2444 | Ga0496123_0013136 | |||
| 2445 | Ga0496123_0026302 | |||
| 2446 | Ga0496123_0072213 | |||
| 2447 | Ga0496123_0079250 | |||
| 2448 | Ga0496124_0000144 | |||
| 2449 | Ga0496124_0004511 | |||
| 2450 | Ga0496124_0006811 | |||
| 2451 | Ga0496124_0018634 | |||
| 2452 | Ga0496124_0019657 | |||
| 2453 | Ga0496124_0073583 | |||
| 2454 | Ga0496124_0080571 | |||
| 2455 | Ga0496124_0192955 | |||
| 2456 | Ga0496124_0225019 | |||
| 2457 | Ga0496124_0551735 | |||
| 2458 | Ga0496124_0946870 | |||
| 2459 | Ga0496125_0000799 | |||
| 2460 | Ga0496125_0012276 | |||
| 2461 | Ga0496125_0017798 | |||
| 2462 | Ga0496125_0021016 | |||
| 2463 | Ga0496125_0036004 | |||
| 2464 | Ga0496125_0050448 | |||
| 2465 | Ga0496125_0088020 | |||
| 2466 | Ga0496125_0092569 | |||
| 2467 | Ga0496126_0118230 | |||
| 2468 | Ga0495678_000046 | |||
| 2469 | Ga0495678_000541 | |||
| 2470 | Ga0495678_002320 | |||
| 2471 | Ga0495678_002808 | |||
| 2472 | Ga0495678_004317 | |||
| 2473 | Ga0495678_008726 | |||
| 2474 | Ga0495678_013649 | |||
| 2475 | Ga0495678_014372 | |||
| 2476 | Ga0495678_025094 | |||
| 2477 | Ga0495678_026997 | |||
| 2478 | Ga0495678_038204 | |||
| 2479 | Ga0495678_065095 | |||
| 2480 | Ga0495678_079283 | |||
| 2481 | Ga0495678_108298 | |||
| 2482 | Ga0495678_173468 | |||
| 2483 | Ga0495678_186784 | |||
| 2484 | Ga0495682_0000950 | |||
| 2485 | Ga0495682_0001501 | |||
| 2486 | Ga0495682_0004416 | |||
| 2487 | Ga0495682_0008647 | |||
| 2488 | Ga0495682_0011088 | |||
| 2489 | Ga0495682_0037056 | |||
| 2490 | Ga0501337_014743 | |||
| 2491 | Ga0501222_003989 | |||
| 2492 | Ga0501240_007437 | |||
| 2493 | Ga0501241_001558 | |||
| 2494 | Ga0501269_003946 | |||
| 2495 | Ga0501226_016510 | |||
| 2496 | nmdc:mga00v17_62391_c1 | |||
| 2497 | nmdc:mga00v17_634423_c1 | |||
| 2498 | nmdc:mga00v17_64581_c1 | |||
| 2499 | nmdc:mga07m45_228933_c1 | |||
| 2500 | nmdc:mga08x19_210434_c1 | |||
| 2501 | nmdc:mga08x19_315177_c1 | |||
| 2502 | Ga0500618_001506 | |||
| 2503 | Ga0500618_013949 | |||
| 2504 | Ga0500621_293908 | |||
| 2505 | Ga0500573_0072185 | |||
| 2506 | Ga0500586_186758 | |||
| 2507 | 2511256415 | |||
| 2508 | 2511266090 | |||
| 2509 | 2511271057 | |||
| 2510 | 2511278963 | |||
| 2511 | 2511288768 | |||
| 2512 | 2511297363 | |||
| 2513 | 2511300160 | |||
| 2514 | 2511311173 | |||
| 2515 | 2511319906 | |||
| 2516 | 2511326008 | |||
| 2517 | 2511330972 | |||
| 2518 | 2511336306 | |||
| 2519 | 2511345844 | |||
| 2520 | 2511349131 | |||
| 2521 | 2511356005 | |||
| 2522 | 2511362611 | |||
| 2523 | 2511366811 | |||
| 2524 | 2511372972 | |||
| 2525 | 2511411333 | |||
| 2526 | 2511822476 | |||
| 2527 | 2512325974 | |||
| 2528 | 2555247027 | |||
| 2529 | 2555667438 | |||
| 2530 | 2583789786 | |||
| 2531 | 2597855680 | |||
| 2532 | 2597861683 | |||
| 2533 | 2597867407 | |||
| 2534 | 2599330746 | |||
| 2535 | 2599356661 | |||
| 2536 | 2599363307 | |||
| 2537 | 2599369741 | |||
| 2538 | 2599376416 | |||
| 2539 | 2599381766 | |||
| 2540 | 2599388090 | |||
| 2541 | 2599395386 | |||
| 2542 | 2599398833 | |||
| 2543 | 2599407151 | |||
| 2544 | 2599450888 | |||
| 2545 | 2599463494 | |||
| 2546 | 2599469156 | |||
| 2547 | 2599485582 | |||
| 2548 | 2599492513 | |||
| 2549 | 2599500090 | |||
| 2550 | 2599506448 | |||
| 2551 | 2599514166 | |||
| 2552 | 2599518767 | |||
| 2553 | 2599614619 | |||
| 2554 | 2599769433 | |||
| 2555 | 2599806711 | |||
| 2556 | 2599882682 | |||
| 2557 | 2599886853 | |||
| 2558 | 2599893499 | |||
| 2559 | 2599898182 | |||
| 2560 | 2599930914 | |||
| 2561 | 2599944703 | |||
| 2562 | 2599950742 | |||
| 2563 | 2599957323 | |||
| 2564 | 2599962020 | |||
| 2565 | 2599964569 | |||
| 2566 | 2599975142 | |||
| 2567 | 2599978890 | |||
| 2568 | 2599983274 | |||
| 2569 | 2599991661 | |||
| 2570 | 2599994822 | |||
| 2571 | 2600000916 | |||
| 2572 | 2600004883 | |||
| 2573 | 2600012850 | |||
| 2574 | 2600018954 | |||
| 2575 | 2600023997 | |||
| 2576 | 2600030964 | |||
| 2577 | 2600034639 | |||
| 2578 | 2600043445 | |||
| 2579 | 2600048281 | |||
| 2580 | 2600053345 | |||
| 2581 | 2600061355 | |||
| 2582 | 2600067598 | |||
| 2583 | 2600071812 | |||
| 2584 | 2600077690 | |||
| 2585 | 2600216123 | |||
| 2586 | 2600360855 | |||
| 2587 | 2600364865 | |||
| 2588 | 2601628441 | |||
| 2589 | 2601692367 | |||
| 2590 | 2601776290 | |||
| 2591 | 2601797852 | |||
| 2592 | 2606076665 | |||
| 2593 | 2606128921 | |||
| 2594 | 2621302160 | |||
| 2595 | 2624478239 | |||
| 2596 | 2624489780 | |||
| 2597 | 2643872599 | |||
| 2598 | 2643954886 | |||
| 2599 | 2644024526 | |||
| 2600 | 2644186139 | |||
| 2601 | 2644282051 | |||
| 2602 | 2644619666 | |||
| 2603 | 2652543401 | |||
| 2604 | 2671090779 | |||
| 2605 | 2671099949 | |||
| 2606 | 2671127367 | |||
| 2607 | 2671772362 | |||
| 2608 | 2677898936 | |||
| 2609 | 2678261013 | |||
| 2610 | 2715749226 | |||
| 2611 | 2715755496 | |||
| 2612 | 2718632177 | |||
| 2613 | 2723246580 | |||
| 2614 | 2738674105 | |||
| 2615 | 2738690233 | |||
| 2616 | 2738752498 | |||
| 2617 | 2738807888 | |||
| 2618 | 2738861539 | |||
| 2619 | 2738895248 | |||
| 2620 | 2739198046 | |||
| 2621 | 2739260278 | |||
| 2622 | 2739266007 | |||
| 2623 | 2739311299 | |||
| 2624 | 2743735097 | |||
| 2625 | 2745006324 | |||
| 2626 | 2765586443 | |||
| 2627 | 2774119541 | |||
| 2628 | 2774134755 | |||
| 2629 | 2784261029 | |||
| 2630 | 2784315952 | |||
| 2631 | 2794594001 | |||
| 2632 | 2807406137 | |||
| 2633 | 2807454489 | |||
| 2634 | 2808855964 | |||
| 2635 | 2808922721 | |||
| 2636 | 2808932193 | |||
| 2637 | 2808936044 | |||
| 2638 | 2808944408 | |||
| 2639 | 2808954206 | |||
| 2640 | 2808955888 | |||
| 2641 | 2808964459 | |||
| 2642 | 2808976640 | |||
| 2643 | 2808991922 | |||
| 2644 | 2808999347 | |||
| 2645 | 2809217996 | |||
| 2646 | 2817488430 | |||
| 2647 | 2819657250 | |||
| 2648 | 2819705235 | |||
| 2649 | 2825654245 | |||
| 2650 | 2826586148 | |||
| 2651 | 2834032193 | |||
| 2652 | 2842817783 | |||
| 2653 | 2842830562 | |||
| 2654 | 2842834178 | |||
| 2655 | 2842838655 | |||
| 2656 | 2842846345 | |||
| 2657 | 2842851732 | |||
| 2658 | 2842858705 | |||
| 2659 | 2844667918 | |||
| 2660 | 2852617094 | |||
| 2661 | 2852660435 | |||
| 2662 | 2852671917 | |||
| 2663 | 2860343624 | |||
| 2664 | 2860868456 | |||
| 2665 | 2878030184 | |||
| 2666 | 2880231130 | |||
| 2667 | 2904519588 | |||
| 2668 | 2904552139 | |||
| 2669 | 2908447048 | |||
| 2670 | 2912968716 | |||
| 2671 | 2917071189 | |||
| 2672 | 2919066136 | |||
| 2673 | 2919155751 | |||
| 2674 | 2919389758 | |||
| 2675 | 2919460001 | |||
| 2676 | 2919486921 | |||
| 2677 | 2919488685 | |||
| 2678 | 2919698943 | |||
| 2679 | 2923154092 | |||
| 2680 | 2923589808 | |||
| 2681 | 2929144838 | |||
| 2682 | 2929190317 | |||
| 2683 | 2931371825 | |||
| 2684 | 2931391398 | |||
| 2685 | 2931398857 | |||
| 2686 | 2935359017 | |||
| 2687 | 2939641130 | |||
| 2688 | 2939654054 | |||
| 2689 | 2945930149 | |||
| 2690 | 2945967609 | |||
| 2691 | 2946012493 | |||
| 2692 | 2946028663 | |||
| 2693 | 2947235190 | |||
| 2694 | 2969304977 | |||
| 2695 | 2974293332 | |||
| 2696 | 2984291967 | |||
| 2697 | 2988732225 | |||
| 2698 | 2998140480 | |||
| 2699 | 3007399644 | |||
| 2700 | 3007517925 | |||
| 2701 | 3007618638 | |||
| 2702 | 3007624970 | |||
| 2703 | 3007721239 | |||
| 2704 | 3007805355 | |||
| 2705 | 3007859718 | |||
| 2706 | 3007872140 | |||
| 2707 | 3007873472 | |||
| 2708 | 637317835 | |||
| 2709 | 8015688341 | |||
| 2710 | 8019770326 | |||
| 2711 | 8019777353 | |||
| 2712 | 8030000258 | |||
| 2713 | 8052499647 | |||
| 2714 | 8054286928 | |||
| 2715 | 8054350112 | |||
| 2716 | 8054503983 | |||
| 2717 | 8054934177 | |||
| 2718 | 8055771438 | |||
| 2719 | 8055818381 | |||
| 2720 | 8055882479 | |||
| 2721 | 8056115968 | |||
| 2722 | 8056121074 | |||
| 2723 | 8056126490 | |||
| 2724 | 8056132354 | |||
| 2725 | 8056137785 | |||
| 2726 | 8056143760 | |||
| 2727 | 8056152497 | |||
| 2728 | 8056158532 | |||
| 2729 | 8056164363 | |||
| 2730 | 8056170571 | |||
| 2731 | 8056176686 | |||
| 2732 | 8056183023 | |||
| 2733 | 8056572337 | |||
| 2734 | 8057802728 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fcv-assembly1.cif.gz_A | crystal structure of bee venom hyaluronidase in complex with hyaluronic acid tetramer | 0.8703 | 32 | 60 |
| 7ouf-assembly1.cif.gz_E | structure of the stlv intasome:b56 complex bound to the strand-transfer inhibitor xz450 | 0.754 | 20 | 60 |
| 6buw-assembly1.cif.gz_R1 | thermus thermophilus 70s complex containing 16s g299a ram mutation and empty a site. | 0.7365 | 7 | 35 |
| 4p1m-assembly1.cif.gz_B-2 | the structure of escherichia coli zapa | 0.6827 | 5 | 97 |
| 7pel-assembly1.cif.gz_E | cryoem structure of simian t-cell lymphotropic virus intasome in complex with pp2a regulatory subunit b56 gamma | 0.6813 | 26 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p1mB01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain | 0.8702 | 5 | 47 | 3.30.160.880 |
| 4p1mB01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain | 0.8201 | 5 | 47 | 3.30.160.880 |
| af_Q9H9J2_55_186_1.10.1520.10 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.8008 | 23 | 62 | 1.10.1520.10 |
| 1t3uB01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain | 0.8006 | 8 | 51 | 3.30.160.880 |
| 1t3uD01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain | 0.7997 | 7 | 51 | 3.30.160.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1WLS3-F1-model_v4 | deleted | 0.9566 | 8 | 58 |
|
| AF-E7RTW8-F1-model_v4 | Cell division protein ZapA (Z ring-associated protein ZapA) | 0.9342 | 8 | 65 |
GO:0000917
GO:0000921 GO:0005829 GO:0030428 GO:0032153 GO:0043093 |
| AF-H5SAI2-F1-model_v4 | Cell division protein ZapA (Z ring-associated protein ZapA) | 0.9244 | 8 | 98 |
GO:0000917
GO:0000921 GO:0005829 GO:0030428 GO:0032153 GO:0043093 |
| AF-A0A3M5BV77-F1-model_v4 | deleted | 0.9237 | 1 | 97 |
|
| AF-A0A077DIQ9-F1-model_v4 | Cell division protein ZapA (Z ring-associated protein ZapA) | 0.9222 | 8 | 67 |
GO:0000917
GO:0000921 GO:0005829 GO:0030428 GO:0032153 GO:0043093 |