F493399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1369 | 478 | 2738 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300031712|Ga0265342_10132770|Ga0265342_101327701 |
| Length | 245 |
| Sequence | MASAIARGRPDLPGMGGLLTPAPAAVTPLRYKTAIIRSRSQMPMQTLELFEKRMRLFERMIGRNFIRSWIEKPLSVGAVTPSGKVLARSMASYVDPNDDGPVIELGPGTGPVTEALVDHGVDPSRLVLVEFNPTFCQLLRQRYPQATVVQADAYRLREALTAYTRHQASAVVSGLPLMTKPRRTRLRLLGDALGLLKPDAPFVQFTYAMVPPIPKLAGLTVEASERIWLNLPPARVWVYRRPAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 167 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 168 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 169 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 170 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 257 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 289 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 300 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 301 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 309 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 310 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 311 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 312 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 313 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 314 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 315 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 316 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 317 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 318 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 319 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 449 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 460 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 465 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 466 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 468 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 470 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 472 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 475 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 477 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.41 |
| Nodule | 0 |
| Rhizoplane | 6.36 |
| Rhizosphere | 87.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265342_10132770 | 3300031712 | Bacteria | 1393 |
| 2 | 2214884096 | 2209111006 | Bacteria | 7174 |
| 3 | ARSoilYngRDRAFT_c00051 | 3300000042 | Bacteria | 18662 |
| 4 | ARcpr5yngRDRAFT_c000050 | 3300000043 | Bacteria | 18670 |
| 5 | ARSoilOldRDRAFT_c000022 | 3300000044 | Bacteria | 35130 |
| 6 | ARCol0oldRDRAFT_c01626 | 3300000045 | Bacteria | 1352 |
| 7 | ARCol0yngRDRAFT_1000073 | 3300000652 | Bacteria | 18682 |
| 8 | JGI24752J21851_1003853 | 3300001976 | Bacteria | 1976 |
| 9 | JGI24740J21852_10070600 | 3300001979 | Bacteria | 937 |
| 10 | JGI24739J22299_10000152 | 3300001989 | Bacteria | 22301 |
| 11 | JGI24737J22298_10002832 | 3300001990 | Bacteria | 6144 |
| 12 | JGI24737J22298_10004593 | 3300001990 | Bacteria | 4804 |
| 13 | JGI24743J22301_10034317 | 3300001991 | Unclassified | 1006 |
| 14 | JGI24750J21931_1000497 | 3300002070 | Bacteria | 6166 |
| 15 | JGI24745J21846_1000135 | 3300002073 | Bacteria | 5648 |
| 16 | JGI24748J21848_1016045 | 3300002074 | Unclassified | 894 |
| 17 | JGI24738J21930_10000005 | 3300002075 | Bacteria | 42207 |
| 18 | JGI24035J26624_1000104 | 3300002126 | Bacteria | 7174 |
| 19 | JGI24033J26618_1010213 | 3300002155 | Bacteria | 1103 |
| 20 | JGI24034J26672_10000212 | 3300002239 | Bacteria | 7728 |
| 21 | JGI24742J22300_10000282 | 3300002244 | Bacteria | 7682 |
| 22 | JGI25405J52794_10018036 | 3300003911 | Bacteria | 1407 |
| 23 | Ga0065717_1002242 | 3300005276 | Bacteria | 2400 |
| 24 | Ga0065716_1003090 | 3300005277 | Bacteria | 1355 |
| 25 | Ga0065704_10098357 | 3300005289 | Bacteria | 2356 |
| 26 | Ga0065715_10001162 | 3300005293 | Bacteria | 6917 |
| 27 | Ga0065707_10086712 | 3300005295 | Bacteria | 5342 |
| 28 | Ga0070658_10569310 | 3300005327 | Bacteria | 981 |
| 29 | Ga0070676_10000789 | 3300005328 | Bacteria | 15625 |
| 30 | Ga0070676_10181809 | 3300005328 | Bacteria | 1367 |
| 31 | Ga0070683_100000345 | 3300005329 | Bacteria | 31885 |
| 32 | Ga0070683_100037802 | 3300005329 | Bacteria | 4420 |
| 33 | Ga0070683_100543651 | 3300005329 | Bacteria | 1111 |
| 34 | Ga0070690_100007432 | 3300005330 | Bacteria | 6278 |
| 35 | Ga0070690_100009716 | 3300005330 | Bacteria | 5580 |
| 36 | Ga0070690_100029117 | 3300005330 | Bacteria | 3422 |
| 37 | Ga0070670_100002853 | 3300005331 | Bacteria | 14288 |
| 38 | Ga0070670_100016008 | 3300005331 | Bacteria | 6436 |
| 39 | Ga0070677_10000389 | 3300005333 | Bacteria | 15407 |
| 40 | Ga0068869_100001864 | 3300005334 | Bacteria | 12681 |
| 41 | Ga0070666_10003359 | 3300005335 | Bacteria | 9707 |
| 42 | Ga0070666_10083387 | 3300005335 | Bacteria | 2187 |
| 43 | Ga0070666_10112241 | 3300005335 | Bacteria | 1886 |
| 44 | Ga0070680_100005473 | 3300005336 | Bacteria | 9607 |
| 45 | Ga0070680_100045189 | 3300005336 | Bacteria | 3580 |
| 46 | Ga0070680_100057667 | 3300005336 | Bacteria | 3175 |
| 47 | Ga0070680_100103413 | 3300005336 | Bacteria | 2366 |
| 48 | Ga0070680_100561402 | 3300005336 | Unclassified | 979 |
| 49 | Ga0070682_100000458 | 3300005337 | Bacteria | 25727 |
| 50 | Ga0070682_100055671 | 3300005337 | Bacteria | 2485 |
| 51 | Ga0070682_100056130 | 3300005337 | Bacteria | 2476 |
| 52 | Ga0070682_100421419 | 3300005337 | Bacteria | 1015 |
| 53 | Ga0068868_100000376 | 3300005338 | Bacteria | 30404 |
| 54 | Ga0068868_100007862 | 3300005338 | Bacteria | 7613 |
| 55 | Ga0070660_100001420 | 3300005339 | Bacteria | 16311 |
| 56 | Ga0070660_100114704 | 3300005339 | Bacteria | 2146 |
| 57 | Ga0070660_100753926 | 3300005339 | Unclassified | 817 |
| 58 | Ga0070689_100001572 | 3300005340 | Bacteria | 14570 |
| 59 | Ga0070689_100047448 | 3300005340 | Bacteria | 3312 |
| 60 | Ga0070689_100071627 | 3300005340 | Bacteria | 2708 |
| 61 | Ga0070691_10000417 | 3300005341 | Bacteria | 15597 |
| 62 | Ga0070687_100002155 | 3300005343 | Bacteria | 7281 |
| 63 | Ga0070687_100026445 | 3300005343 | Bacteria | 2794 |
| 64 | Ga0070661_100001708 | 3300005344 | Bacteria | 15225 |
| 65 | Ga0070661_100069114 | 3300005344 | Bacteria | 2597 |
| 66 | Ga0070692_10000078 | 3300005345 | Bacteria | 20284 |
| 67 | Ga0070692_10190271 | 3300005345 | Bacteria | 1195 |
| 68 | Ga0070668_100001228 | 3300005347 | Bacteria | 18229 |
| 69 | Ga0070668_100043794 | 3300005347 | Bacteria | 3432 |
| 70 | Ga0070669_100184136 | 3300005353 | Bacteria | 1635 |
| 71 | Ga0070675_100014644 | 3300005354 | Bacteria | 6185 |
| 72 | Ga0070675_100033712 | 3300005354 | Bacteria | 4152 |
| 73 | Ga0070671_100000318 | 3300005355 | Bacteria | 32840 |
| 74 | Ga0070671_100030510 | 3300005355 | Bacteria | 4448 |
| 75 | Ga0070671_100136225 | 3300005355 | Bacteria | 2070 |
| 76 | Ga0070671_100321362 | 3300005355 | Bacteria | 1319 |
| 77 | Ga0070674_100001672 | 3300005356 | Bacteria | 11985 |
| 78 | Ga0070674_100050965 | 3300005356 | Bacteria | 2850 |
| 79 | Ga0070673_100002621 | 3300005364 | Bacteria | 10996 |
| 80 | Ga0070673_100029134 | 3300005364 | Bacteria | 4115 |
| 81 | Ga0070688_100032747 | 3300005365 | Bacteria | 3137 |
| 82 | Ga0070688_100092916 | 3300005365 | Bacteria | 1974 |
| 83 | Ga0070688_100201125 | 3300005365 | Bacteria | 1394 |
| 84 | Ga0070659_100001601 | 3300005366 | Bacteria | 16297 |
| 85 | Ga0070659_100019430 | 3300005366 | Bacteria | 5149 |
| 86 | Ga0070659_100280698 | 3300005366 | Bacteria | 1385 |
| 87 | Ga0070659_100669145 | 3300005366 | Bacteria | 896 |
| 88 | Ga0070667_100011757 | 3300005367 | Bacteria | 7233 |
| 89 | Ga0070667_100012018 | 3300005367 | Bacteria | 7168 |
| 90 | Ga0070667_100281795 | 3300005367 | Bacteria | 1492 |
| 91 | Ga0070703_10024965 | 3300005406 | Bacteria | 1770 |
| 92 | Ga0070709_10017222 | 3300005434 | Bacteria | 4140 |
| 93 | Ga0070709_10057723 | 3300005434 | Bacteria | 2459 |
| 94 | Ga0070709_10182503 | 3300005434 | Bacteria | 1475 |
| 95 | Ga0070709_10223477 | 3300005434 | Bacteria | 1344 |
| 96 | Ga0070714_100010126 | 3300005435 | Bacteria | 7443 |
| 97 | Ga0070714_100041394 | 3300005435 | Bacteria | 3887 |
| 98 | Ga0070714_100166251 | 3300005435 | Bacteria | 1999 |
| 99 | Ga0070714_100529146 | 3300005435 | Bacteria | 1127 |
| 100 | Ga0070713_100000710 | 3300005436 | Bacteria | 21366 |
| 101 | Ga0070713_100032534 | 3300005436 | Bacteria | 4166 |
| 102 | Ga0070713_100238191 | 3300005436 | Bacteria | 1656 |
| 103 | Ga0070713_100281561 | 3300005436 | Bacteria | 1526 |
| 104 | Ga0070713_100340695 | 3300005436 | Bacteria | 1389 |
| 105 | Ga0070713_101004187 | 3300005436 | Bacteria | 805 |
| 106 | Ga0070710_10027262 | 3300005437 | Bacteria | 3044 |
| 107 | Ga0070710_10034348 | 3300005437 | Bacteria | 2759 |
| 108 | Ga0070710_10107695 | 3300005437 | Bacteria | 1670 |
| 109 | Ga0070710_10109762 | 3300005437 | Bacteria | 1655 |
| 110 | Ga0070710_10632464 | 3300005437 | Bacteria | 748 |
| 111 | Ga0070701_10009667 | 3300005438 | Bacteria | 4231 |
| 112 | Ga0070711_100021291 | 3300005439 | Bacteria | 4190 |
| 113 | Ga0070711_100106124 | 3300005439 | Bacteria | 2053 |
| 114 | Ga0070711_100113273 | 3300005439 | Bacteria | 1994 |
| 115 | Ga0070711_100226304 | 3300005439 | Bacteria | 1456 |
| 116 | Ga0070711_100447281 | 3300005439 | Bacteria | 1057 |
| 117 | Ga0070711_100551017 | 3300005439 | Bacteria | 957 |
| 118 | Ga0070705_100036644 | 3300005440 | Bacteria | 2760 |
| 119 | Ga0070705_100275498 | 3300005440 | Bacteria | 1193 |
| 120 | Ga0070700_100000409 | 3300005441 | Bacteria | 21951 |
| 121 | Ga0070700_100009173 | 3300005441 | Bacteria | 5423 |
| 122 | Ga0070694_100000312 | 3300005444 | Bacteria | 26105 |
| 123 | Ga0070694_100018197 | 3300005444 | Bacteria | 4457 |
| 124 | Ga0070708_100008294 | 3300005445 | Bacteria | 8342 |
| 125 | Ga0070708_100059520 | 3300005445 | Bacteria | 3405 |
| 126 | Ga0070663_100003029 | 3300005455 | Bacteria | 9597 |
| 127 | Ga0070663_100062150 | 3300005455 | Bacteria | 2691 |
| 128 | Ga0070663_100163058 | 3300005455 | Bacteria | 1717 |
| 129 | Ga0070678_100000673 | 3300005456 | Bacteria | 16791 |
| 130 | Ga0070678_100004962 | 3300005456 | Bacteria | 7620 |
| 131 | Ga0070678_100161406 | 3300005456 | Bacteria | 1816 |
| 132 | Ga0070662_100007854 | 3300005457 | Bacteria | 6930 |
| 133 | Ga0070662_100011704 | 3300005457 | Bacteria | 5791 |
| 134 | Ga0070662_100016377 | 3300005457 | Bacteria | 4976 |
| 135 | Ga0070662_100140229 | 3300005457 | Bacteria | 1872 |
| 136 | Ga0070662_100152640 | 3300005457 | Bacteria | 1800 |
| 137 | Ga0070681_10001501 | 3300005458 | Bacteria | 20642 |
| 138 | Ga0070681_10075545 | 3300005458 | Bacteria | 3329 |
| 139 | Ga0070681_10191407 | 3300005458 | Bacteria | 1965 |
| 140 | Ga0068867_100002561 | 3300005459 | Bacteria | 12815 |
| 141 | Ga0068867_100144121 | 3300005459 | Bacteria | 1865 |
| 142 | Ga0070685_10005299 | 3300005466 | Bacteria | 6538 |
| 143 | Ga0070685_10015300 | 3300005466 | Bacteria | 4073 |
| 144 | Ga0074259_10502797 | 3300005507 | Bacteria | 1135 |
| 145 | Ga0070699_100195961 | 3300005518 | Bacteria | 1796 |
| 146 | Ga0070679_100013134 | 3300005530 | Bacteria | 7928 |
| 147 | Ga0070679_100052092 | 3300005530 | Bacteria | 4078 |
| 148 | Ga0070679_100083369 | 3300005530 | Bacteria | 3185 |
| 149 | Ga0070679_100087329 | 3300005530 | Bacteria | 3106 |
| 150 | Ga0070679_100271768 | 3300005530 | Bacteria | 1649 |
| 151 | Ga0070679_100442946 | 3300005530 | Bacteria | 1244 |
| 152 | Ga0070684_100004125 | 3300005535 | Bacteria | 10996 |
| 153 | Ga0070684_100077133 | 3300005535 | Bacteria | 2943 |
| 154 | Ga0070684_100146081 | 3300005535 | Bacteria | 2141 |
| 155 | Ga0070684_100926518 | 3300005535 | Bacteria | 817 |
| 156 | Ga0070697_100035629 | 3300005536 | Bacteria | 4015 |
| 157 | Ga0068853_100013239 | 3300005539 | Bacteria | 6732 |
| 158 | Ga0068853_100173362 | 3300005539 | Bacteria | 1953 |
| 159 | Ga0070672_100005118 | 3300005543 | Bacteria | 8651 |
| 160 | Ga0070672_100107284 | 3300005543 | Bacteria | 2273 |
| 161 | Ga0070672_100134976 | 3300005543 | Bacteria | 2032 |
| 162 | Ga0070672_100484006 | 3300005543 | Bacteria | 1069 |
| 163 | Ga0070686_100005340 | 3300005544 | Bacteria | 7107 |
| 164 | Ga0070686_100007239 | 3300005544 | Bacteria | 6182 |
| 165 | Ga0070686_100013534 | 3300005544 | Bacteria | 4676 |
| 166 | Ga0070686_100078762 | 3300005544 | Bacteria | 2177 |
| 167 | Ga0070695_100008421 | 3300005545 | Bacteria | 6123 |
| 168 | Ga0070695_100009792 | 3300005545 | Bacteria | 5708 |
| 169 | Ga0070695_100019616 | 3300005545 | Bacteria | 4119 |
| 170 | Ga0070696_100028030 | 3300005546 | Bacteria | 3841 |
| 171 | Ga0070693_100002738 | 3300005547 | Bacteria | 8120 |
| 172 | Ga0070693_100056356 | 3300005547 | Bacteria | 2268 |
| 173 | Ga0070693_100103731 | 3300005547 | Bacteria | 1737 |
| 174 | Ga0070693_100175811 | 3300005547 | Bacteria | 1375 |
| 175 | Ga0070665_100024095 | 3300005548 | Bacteria | 6128 |
| 176 | Ga0070665_100165269 | 3300005548 | Bacteria | 2215 |
| 177 | Ga0070665_100278670 | 3300005548 | Bacteria | 1674 |
| 178 | Ga0070704_100002142 | 3300005549 | Bacteria | 10996 |
| 179 | Ga0070704_100015966 | 3300005549 | Bacteria | 4733 |
| 180 | Ga0070704_100192421 | 3300005549 | Bacteria | 1641 |
| 181 | Ga0068855_100032409 | 3300005563 | Bacteria | 6240 |
| 182 | Ga0068855_100092936 | 3300005563 | Bacteria | 3478 |
| 183 | Ga0068855_100266048 | 3300005563 | Bacteria | 1908 |
| 184 | Ga0070664_100014278 | 3300005564 | Bacteria | 6478 |
| 185 | Ga0070664_100069690 | 3300005564 | Bacteria | 3009 |
| 186 | Ga0070664_100092508 | 3300005564 | Bacteria | 2619 |
| 187 | Ga0070664_100108267 | 3300005564 | Bacteria | 2423 |
| 188 | Ga0070664_100582705 | 3300005564 | Bacteria | 1036 |
| 189 | Ga0068857_100000914 | 3300005577 | Bacteria | 22274 |
| 190 | Ga0068854_100002267 | 3300005578 | Bacteria | 11836 |
| 191 | Ga0068854_100048079 | 3300005578 | Bacteria | 3042 |
| 192 | Ga0068854_100078547 | 3300005578 | Bacteria | 2432 |
| 193 | Ga0068854_100740311 | 3300005578 | Bacteria | 852 |
| 194 | Ga0068856_100007024 | 3300005614 | Bacteria | 10998 |
| 195 | Ga0068856_100523114 | 3300005614 | Bacteria | 1207 |
| 196 | Ga0070702_100000793 | 3300005615 | Bacteria | 12038 |
| 197 | Ga0070702_100002584 | 3300005615 | Bacteria | 7873 |
| 198 | Ga0068852_100001040 | 3300005616 | Bacteria | 18256 |
| 199 | Ga0068852_100262634 | 3300005616 | Bacteria | 1658 |
| 200 | Ga0068852_100381591 | 3300005616 | Bacteria | 1383 |
| 201 | Ga0068859_100023516 | 3300005617 | Bacteria | 6183 |
| 202 | Ga0068859_100030436 | 3300005617 | Bacteria | 5416 |
| 203 | Ga0068859_100135137 | 3300005617 | Bacteria | 2539 |
| 204 | Ga0068864_100278578 | 3300005618 | Bacteria | 1560 |
| 205 | Ga0068866_10000678 | 3300005718 | Bacteria | 15464 |
| 206 | Ga0068866_10018817 | 3300005718 | Bacteria | 3132 |
| 207 | Ga0068861_100008814 | 3300005719 | Bacteria | 6947 |
| 208 | Ga0068861_100155615 | 3300005719 | Bacteria | 1880 |
| 209 | Ga0068861_100273868 | 3300005719 | Bacteria | 1450 |
| 210 | Ga0068870_10000128 | 3300005840 | Bacteria | 26100 |
| 211 | Ga0068863_100006135 | 3300005841 | Bacteria | 11786 |
| 212 | Ga0068858_100007003 | 3300005842 | Bacteria | 10954 |
| 213 | Ga0068858_100047337 | 3300005842 | Bacteria | 3987 |
| 214 | Ga0068858_100118536 | 3300005842 | Bacteria | 2474 |
| 215 | Ga0068858_100693015 | 3300005842 | Bacteria | 991 |
| 216 | Ga0068860_100009283 | 3300005843 | Bacteria | 9773 |
| 217 | Ga0068860_100068439 | 3300005843 | Bacteria | 3373 |
| 218 | Ga0068860_100199942 | 3300005843 | Bacteria | 1936 |
| 219 | Ga0068860_100238943 | 3300005843 | Bacteria | 1767 |
| 220 | Ga0068862_100016288 | 3300005844 | Bacteria | 6185 |
| 221 | Ga0068862_100017378 | 3300005844 | Bacteria | 5990 |
| 222 | Ga0068862_100094435 | 3300005844 | Bacteria | 2609 |
| 223 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 224 | Ga0081539_10004600 | 3300005985 | Bacteria | 15057 |
| 225 | Ga0070717_10010516 | 3300006028 | Bacteria | 6991 |
| 226 | Ga0070717_10120647 | 3300006028 | Bacteria | 2246 |
| 227 | Ga0070717_10385584 | 3300006028 | Bacteria | 1257 |
| 228 | Ga0070717_10843028 | 3300006028 | Bacteria | 834 |
| 229 | Ga0075365_10023018 | 3300006038 | Bacteria | 3913 |
| 230 | Ga0075365_10077480 | 3300006038 | Bacteria | 2246 |
| 231 | Ga0075365_10153741 | 3300006038 | Bacteria | 1601 |
| 232 | Ga0075368_10030936 | 3300006042 | Bacteria | 2074 |
| 233 | Ga0075368_10074340 | 3300006042 | Bacteria | 1376 |
| 234 | Ga0075368_10197687 | 3300006042 | Bacteria | 850 |
| 235 | Ga0075363_100000153 | 3300006048 | Bacteria | 17191 |
| 236 | Ga0075363_100033492 | 3300006048 | Bacteria | 2676 |
| 237 | Ga0075363_100113245 | 3300006048 | Bacteria | 1509 |
| 238 | Ga0075364_10016915 | 3300006051 | Bacteria | 4544 |
| 239 | Ga0075364_10150300 | 3300006051 | Bacteria | 1569 |
| 240 | Ga0075364_10214845 | 3300006051 | Bacteria | 1304 |
| 241 | Ga0075432_10023026 | 3300006058 | Bacteria | 2133 |
| 242 | Ga0070715_10002587 | 3300006163 | Bacteria | 5587 |
| 243 | Ga0070715_10011751 | 3300006163 | Bacteria | 3162 |
| 244 | Ga0070716_100001066 | 3300006173 | Bacteria | 12003 |
| 245 | Ga0070716_100072370 | 3300006173 | Bacteria | 2030 |
| 246 | Ga0070716_100135383 | 3300006173 | Bacteria | 1564 |
| 247 | Ga0070716_100184281 | 3300006173 | Bacteria | 1373 |
| 248 | Ga0070712_100004156 | 3300006175 | Bacteria | 8897 |
| 249 | Ga0070712_100102761 | 3300006175 | Bacteria | 2117 |
| 250 | Ga0070712_100221273 | 3300006175 | Bacteria | 1499 |
| 251 | Ga0070712_100513202 | 3300006175 | Bacteria | 1006 |
| 252 | Ga0070712_100553397 | 3300006175 | Unclassified | 969 |
| 253 | Ga0070712_100556362 | 3300006175 | Bacteria | 967 |
| 254 | Ga0075362_10048986 | 3300006177 | Bacteria | 1886 |
| 255 | Ga0075362_10148314 | 3300006177 | Bacteria | 1124 |
| 256 | Ga0075367_10001743 | 3300006178 | Bacteria | 9540 |
| 257 | Ga0075367_10034925 | 3300006178 | Bacteria | 2907 |
| 258 | Ga0075367_10050268 | 3300006178 | Bacteria | 2461 |
| 259 | Ga0075367_10207935 | 3300006178 | Bacteria | 1223 |
| 260 | Ga0075369_10044202 | 3300006186 | Bacteria | 1913 |
| 261 | Ga0075369_10047165 | 3300006186 | Bacteria | 1857 |
| 262 | Ga0075369_10073228 | 3300006186 | Bacteria | 1510 |
| 263 | Ga0075366_10024680 | 3300006195 | Bacteria | 3507 |
| 264 | Ga0075366_10093845 | 3300006195 | Bacteria | 1798 |
| 265 | Ga0075366_10292852 | 3300006195 | Bacteria | 995 |
| 266 | Ga0097621_100000012 | 3300006237 | Bacteria | 105108 |
| 267 | Ga0097621_100028523 | 3300006237 | Bacteria | 4399 |
| 268 | Ga0075370_10045220 | 3300006353 | Bacteria | 2490 |
| 269 | Ga0068871_100000414 | 3300006358 | Bacteria | 29494 |
| 270 | Ga0068871_100005222 | 3300006358 | Bacteria | 9085 |
| 271 | Ga0068871_100285219 | 3300006358 | Bacteria | 1445 |
| 272 | Ga0075428_100022143 | 3300006844 | Bacteria | 7036 |
| 273 | Ga0075428_100067815 | 3300006844 | Bacteria | 3904 |
| 274 | Ga0075430_100002500 | 3300006846 | Bacteria | 15328 |
| 275 | Ga0075430_100220682 | 3300006846 | Bacteria | 1573 |
| 276 | Ga0075431_100002000 | 3300006847 | Bacteria | 19446 |
| 277 | Ga0075431_100084389 | 3300006847 | Bacteria | 3279 |
| 278 | Ga0075431_100212752 | 3300006847 | Bacteria | 1974 |
| 279 | Ga0075433_10000266 | 3300006852 | Bacteria | 30624 |
| 280 | Ga0075433_10018274 | 3300006852 | Bacteria | 5823 |
| 281 | Ga0075433_10042901 | 3300006852 | Bacteria | 3926 |
| 282 | Ga0075433_10206114 | 3300006852 | Bacteria | 1748 |
| 283 | Ga0075434_100001246 | 3300006871 | Bacteria | 21184 |
| 284 | Ga0075434_100112067 | 3300006871 | Bacteria | 2739 |
| 285 | Ga0075434_100146399 | 3300006871 | Bacteria | 2382 |
| 286 | Ga0075434_100822656 | 3300006871 | Bacteria | 945 |
| 287 | Ga0075429_100004558 | 3300006880 | Bacteria | 11911 |
| 288 | Ga0068865_100000908 | 3300006881 | Bacteria | 16791 |
| 289 | Ga0068865_100015582 | 3300006881 | Bacteria | 4849 |
| 290 | Ga0068865_100038460 | 3300006881 | Bacteria | 3239 |
| 291 | Ga0068865_100362440 | 3300006881 | Bacteria | 1177 |
| 292 | Ga0075436_100027941 | 3300006914 | Bacteria | 3884 |
| 293 | Ga0075436_100042615 | 3300006914 | Bacteria | 3131 |
| 294 | Ga0075436_100541502 | 3300006914 | Unclassified | 854 |
| 295 | Ga0097620_100023517 | 3300006931 | Bacteria | 6183 |
| 296 | Ga0097620_100030437 | 3300006931 | Bacteria | 5416 |
| 297 | Ga0097620_100135136 | 3300006931 | Bacteria | 2539 |
| 298 | Ga0075435_100113776 | 3300007076 | Bacteria | 2252 |
| 299 | Ga0099794_10052650 | 3300007265 | Bacteria | 1962 |
| 300 | Ga0099795_10000474 | 3300007788 | Bacteria | 7469 |
| 301 | Ga0099795_10001475 | 3300007788 | Bacteria | 5122 |
| 302 | Ga0099795_10044959 | 3300007788 | Bacteria | 1586 |
| 303 | Ga0105251_10012277 | 3300009011 | Bacteria | 4855 |
| 304 | Ga0105244_10046632 | 3300009036 | Bacteria | 2225 |
| 305 | Ga0105240_10355352 | 3300009093 | Bacteria | 1661 |
| 306 | Ga0111539_10000789 | 3300009094 | Bacteria | 41240 |
| 307 | Ga0111539_10003667 | 3300009094 | Bacteria | 20224 |
| 308 | Ga0111539_10007702 | 3300009094 | Bacteria | 13753 |
| 309 | Ga0111539_10847240 | 3300009094 | Bacteria | 1064 |
| 310 | Ga0105245_10000090 | 3300009098 | Bacteria | 90378 |
| 311 | Ga0105245_10036809 | 3300009098 | Bacteria | 4348 |
| 312 | Ga0105245_10125110 | 3300009098 | Bacteria | 2406 |
| 313 | Ga0105245_10270904 | 3300009098 | Bacteria | 1656 |
| 314 | Ga0105247_10019166 | 3300009101 | Bacteria | 4108 |
| 315 | Ga0105247_10028955 | 3300009101 | Bacteria | 3353 |
| 316 | Ga0105247_10351708 | 3300009101 | Bacteria | 1036 |
| 317 | Ga0114129_10000759 | 3300009147 | Bacteria | 41109 |
| 318 | Ga0114129_10000935 | 3300009147 | Bacteria | 38153 |
| 319 | Ga0114129_10001106 | 3300009147 | Bacteria | 35479 |
| 320 | Ga0114129_10012544 | 3300009147 | Bacteria | 12068 |
| 321 | Ga0114129_10327630 | 3300009147 | Bacteria | 2034 |
| 322 | Ga0105243_10012301 | 3300009148 | Bacteria | 6473 |
| 323 | Ga0105243_10024101 | 3300009148 | Bacteria | 4639 |
| 324 | Ga0105243_10096735 | 3300009148 | Bacteria | 2443 |
| 325 | Ga0105243_10164939 | 3300009148 | Bacteria | 1913 |
| 326 | Ga0105243_10246329 | 3300009148 | Bacteria | 1593 |
| 327 | Ga0105241_10000475 | 3300009174 | Bacteria | 30331 |
| 328 | Ga0105241_10041065 | 3300009174 | Bacteria | 3493 |
| 329 | Ga0105241_10261358 | 3300009174 | Bacteria | 1471 |
| 330 | Ga0105242_10001283 | 3300009176 | Bacteria | 19844 |
| 331 | Ga0105242_10088313 | 3300009176 | Bacteria | 2604 |
| 332 | Ga0105242_10195863 | 3300009176 | Bacteria | 1792 |
| 333 | Ga0105248_10003064 | 3300009177 | Bacteria | 18528 |
| 334 | Ga0105248_10004418 | 3300009177 | Bacteria | 15562 |
| 335 | Ga0105248_10052163 | 3300009177 | Bacteria | 4590 |
| 336 | Ga0105248_10054127 | 3300009177 | Bacteria | 4500 |
| 337 | Ga0105237_10002267 | 3300009545 | Bacteria | 23930 |
| 338 | Ga0105237_10063894 | 3300009545 | Bacteria | 3678 |
| 339 | Ga0105237_10256956 | 3300009545 | Bacteria | 1749 |
| 340 | Ga0105238_10014956 | 3300009551 | Bacteria | 7857 |
| 341 | Ga0105238_10135288 | 3300009551 | Bacteria | 2442 |
| 342 | Ga0105238_10169659 | 3300009551 | Bacteria | 2158 |
| 343 | Ga0105249_10001598 | 3300009553 | Bacteria | 19845 |
| 344 | Ga0105249_10006092 | 3300009553 | Bacteria | 10456 |
| 345 | Ga0099796_10008093 | 3300010159 | Bacteria | 2786 |
| 346 | Ga0099796_10009211 | 3300010159 | Bacteria | 2663 |
| 347 | Ga0099796_10116167 | 3300010159 | Bacteria | 1023 |
| 348 | Ga0105239_10040255 | 3300010375 | Bacteria | 5121 |
| 349 | Ga0105239_10075253 | 3300010375 | Bacteria | 3712 |
| 350 | Ga0105239_10086997 | 3300010375 | Bacteria | 3444 |
| 351 | Ga0105239_10334173 | 3300010375 | Bacteria | 1709 |
| 352 | Ga0105239_10345543 | 3300010375 | Bacteria | 1679 |
| 353 | Ga0105239_10645853 | 3300010375 | Bacteria | 1208 |
| 354 | Ga0105246_10000263 | 3300011119 | Bacteria | 27266 |
| 355 | Ga0105246_10006118 | 3300011119 | Bacteria | 7342 |
| 356 | Ga0105246_10377905 | 3300011119 | Bacteria | 1170 |
| 357 | Ga0105246_10551415 | 3300011119 | Bacteria | 988 |
| 358 | Ga0157336_1001178 | 3300012477 | Bacteria | 1318 |
| 359 | Ga0157338_1000265 | 3300012515 | Bacteria | 2823 |
| 360 | Ga0157338_1003263 | 3300012515 | Bacteria | 1333 |
| 361 | Ga0157373_10036753 | 3300013100 | Bacteria | 3513 |
| 362 | Ga0157373_10112782 | 3300013100 | Bacteria | 1911 |
| 363 | Ga0157373_10159106 | 3300013100 | Bacteria | 1589 |
| 364 | Ga0157370_10191223 | 3300013104 | Bacteria | 1900 |
| 365 | Ga0157370_11154039 | 3300013104 | Unclassified | 699 |
| 366 | Ga0157369_10090227 | 3300013105 | Bacteria | 3272 |
| 367 | Ga0157369_10654245 | 3300013105 | Bacteria | 1083 |
| 368 | Ga0157374_10001375 | 3300013296 | Bacteria | 20675 |
| 369 | Ga0157374_10039168 | 3300013296 | Bacteria | 4362 |
| 370 | Ga0157378_10002550 | 3300013297 | Bacteria | 16210 |
| 371 | Ga0157378_10163109 | 3300013297 | Bacteria | 2085 |
| 372 | Ga0157378_10343036 | 3300013297 | Bacteria | 1457 |
| 373 | Ga0157378_10381652 | 3300013297 | Bacteria | 1384 |
| 374 | Ga0163162_10003792 | 3300013306 | Bacteria | 14496 |
| 375 | Ga0163162_10124338 | 3300013306 | Bacteria | 2685 |
| 376 | Ga0163162_10258535 | 3300013306 | Bacteria | 1873 |
| 377 | Ga0163162_10345808 | 3300013306 | Bacteria | 1620 |
| 378 | Ga0157372_10002994 | 3300013307 | Bacteria | 18215 |
| 379 | Ga0157372_10723475 | 3300013307 | Bacteria | 1158 |
| 380 | Ga0157375_10002382 | 3300013308 | Bacteria | 16270 |
| 381 | Ga0157375_10049561 | 3300013308 | Bacteria | 4116 |
| 382 | Ga0157375_10257396 | 3300013308 | Bacteria | 1907 |
| 383 | Ga0157375_10376400 | 3300013308 | Bacteria | 1586 |
| 384 | Ga0163163_10005972 | 3300014325 | Bacteria | 10590 |
| 385 | Ga0163163_10012135 | 3300014325 | Bacteria | 7840 |
| 386 | Ga0163163_10060221 | 3300014325 | Bacteria | 3758 |
| 387 | Ga0163163_10238388 | 3300014325 | Bacteria | 1868 |
| 388 | Ga0163163_10249667 | 3300014325 | Bacteria | 1825 |
| 389 | Ga0157380_10000334 | 3300014326 | Bacteria | 28309 |
| 390 | Ga0157380_10256043 | 3300014326 | Bacteria | 1587 |
| 391 | Ga0157380_10634620 | 3300014326 | Unclassified | 1063 |
| 392 | Ga0182008_10089621 | 3300014497 | Bacteria | 1516 |
| 393 | Ga0182008_10137748 | 3300014497 | Bacteria | 1220 |
| 394 | Ga0157377_10000249 | 3300014745 | Bacteria | 26676 |
| 395 | Ga0157379_10002491 | 3300014968 | Bacteria | 15418 |
| 396 | Ga0157379_10004645 | 3300014968 | Bacteria | 11781 |
| 397 | Ga0157379_10032788 | 3300014968 | Bacteria | 4632 |
| 398 | Ga0157379_10080789 | 3300014968 | Bacteria | 2912 |
| 399 | Ga0157379_10366325 | 3300014968 | Bacteria | 1321 |
| 400 | Ga0157379_10903552 | 3300014968 | Bacteria | 838 |
| 401 | Ga0157376_10000709 | 3300014969 | Bacteria | 21576 |
| 402 | Ga0163161_10001471 | 3300017792 | Bacteria | 17429 |
| 403 | Ga0163161_10029438 | 3300017792 | Bacteria | 3905 |
| 404 | Ga0206356_11022321 | 3300020070 | Bacteria | 2243 |
| 405 | Ga0206354_10431128 | 3300020081 | Bacteria | 810 |
| 406 | Ga0206353_11650777 | 3300020082 | Bacteria | 1991 |
| 407 | Ga0213873_10051055 | 3300021358 | Bacteria | 1095 |
| 408 | Ga0213876_10012865 | 3300021384 | Bacteria | 4449 |
| 409 | Ga0213875_10001038 | 3300021388 | Bacteria | 19585 |
| 410 | Ga0213875_10126003 | 3300021388 | Bacteria | 1197 |
| 411 | Ga0224572_1008206 | 3300024225 | Bacteria | 1928 |
| 412 | Ga0207666_1000082 | 3300025271 | Bacteria | 15637 |
| 413 | Ga0207697_10000161 | 3300025315 | Bacteria | 33629 |
| 414 | Ga0207713_1041495 | 3300025735 | Bacteria | 1919 |
| 415 | Ga0207653_10001232 | 3300025885 | Bacteria | 8360 |
| 416 | Ga0207682_10000164 | 3300025893 | Bacteria | 30348 |
| 417 | Ga0207692_10042252 | 3300025898 | Bacteria | 2262 |
| 418 | Ga0207692_10059553 | 3300025898 | Bacteria | 1972 |
| 419 | Ga0207692_10147407 | 3300025898 | Bacteria | 1344 |
| 420 | Ga0207642_10019418 | 3300025899 | Bacteria | 2631 |
| 421 | Ga0207642_10021457 | 3300025899 | Bacteria | 2543 |
| 422 | Ga0207710_10002813 | 3300025900 | Bacteria | 7938 |
| 423 | Ga0207710_10018005 | 3300025900 | Bacteria | 3001 |
| 424 | Ga0207710_10031411 | 3300025900 | Bacteria | 2322 |
| 425 | Ga0207710_10050295 | 3300025900 | Bacteria | 1870 |
| 426 | Ga0207688_10000426 | 3300025901 | Bacteria | 19817 |
| 427 | Ga0207680_10014769 | 3300025903 | Bacteria | 4055 |
| 428 | Ga0207680_10060489 | 3300025903 | Bacteria | 2306 |
| 429 | Ga0207647_10011699 | 3300025904 | Bacteria | 6141 |
| 430 | Ga0207685_10001775 | 3300025905 | Bacteria | 4692 |
| 431 | Ga0207685_10013502 | 3300025905 | Bacteria | 2528 |
| 432 | Ga0207685_10355443 | 3300025905 | Bacteria | 740 |
| 433 | Ga0207699_10000275 | 3300025906 | Bacteria | 28286 |
| 434 | Ga0207699_10060094 | 3300025906 | Bacteria | 2280 |
| 435 | Ga0207699_10131654 | 3300025906 | Bacteria | 1632 |
| 436 | Ga0207645_10000040 | 3300025907 | Bacteria | 87876 |
| 437 | Ga0207645_10014304 | 3300025907 | Bacteria | 5314 |
| 438 | Ga0207643_10000082 | 3300025908 | Bacteria | 62322 |
| 439 | Ga0207643_10000750 | 3300025908 | Bacteria | 19910 |
| 440 | Ga0207684_10310295 | 3300025910 | Bacteria | 1360 |
| 441 | Ga0207654_10000364 | 3300025911 | Bacteria | 26734 |
| 442 | Ga0207654_10127504 | 3300025911 | Bacteria | 1606 |
| 443 | Ga0207707_10002424 | 3300025912 | Bacteria | 16786 |
| 444 | Ga0207707_10016579 | 3300025912 | Bacteria | 6422 |
| 445 | Ga0207707_10054633 | 3300025912 | Bacteria | 3476 |
| 446 | Ga0207707_10107336 | 3300025912 | Bacteria | 2441 |
| 447 | Ga0207671_10032680 | 3300025914 | Bacteria | 3871 |
| 448 | Ga0207671_10116273 | 3300025914 | Bacteria | 2040 |
| 449 | Ga0207671_10161800 | 3300025914 | Bacteria | 1734 |
| 450 | Ga0207693_10002367 | 3300025915 | Bacteria | 16372 |
| 451 | Ga0207693_10013224 | 3300025915 | Bacteria | 6660 |
| 452 | Ga0207693_10017977 | 3300025915 | Bacteria | 5635 |
| 453 | Ga0207693_10056924 | 3300025915 | Bacteria | 3065 |
| 454 | Ga0207693_10067970 | 3300025915 | Bacteria | 2789 |
| 455 | Ga0207693_10089041 | 3300025915 | Bacteria | 2419 |
| 456 | Ga0207693_10105425 | 3300025915 | Bacteria | 2211 |
| 457 | Ga0207693_10183144 | 3300025915 | Bacteria | 1649 |
| 458 | Ga0207693_10677103 | 3300025915 | Bacteria | 800 |
| 459 | Ga0207663_10074137 | 3300025916 | Bacteria | 2205 |
| 460 | Ga0207663_10099291 | 3300025916 | Bacteria | 1951 |
| 461 | Ga0207663_10362735 | 3300025916 | Bacteria | 1100 |
| 462 | Ga0207663_10424390 | 3300025916 | Bacteria | 1021 |
| 463 | Ga0207660_10000501 | 3300025917 | Bacteria | 26097 |
| 464 | Ga0207660_10127848 | 3300025917 | Bacteria | 1931 |
| 465 | Ga0207660_10167268 | 3300025917 | Bacteria | 1700 |
| 466 | Ga0207662_10017111 | 3300025918 | Bacteria | 4098 |
| 467 | Ga0207662_10023074 | 3300025918 | Bacteria | 3572 |
| 468 | Ga0207662_10180226 | 3300025918 | Bacteria | 1359 |
| 469 | Ga0207657_10002764 | 3300025919 | Bacteria | 18896 |
| 470 | Ga0207657_10010052 | 3300025919 | Bacteria | 9464 |
| 471 | Ga0207657_10077166 | 3300025919 | Bacteria | 2809 |
| 472 | Ga0207657_10739332 | 3300025919 | Bacteria | 763 |
| 473 | Ga0207649_10000788 | 3300025920 | Bacteria | 20473 |
| 474 | Ga0207649_10016023 | 3300025920 | Bacteria | 4220 |
| 475 | Ga0207649_10596315 | 3300025920 | Unclassified | 849 |
| 476 | Ga0207652_10001134 | 3300025921 | Bacteria | 23993 |
| 477 | Ga0207652_10133910 | 3300025921 | Bacteria | 2212 |
| 478 | Ga0207652_10143177 | 3300025921 | Bacteria | 2138 |
| 479 | Ga0207652_10195510 | 3300025921 | Bacteria | 1819 |
| 480 | Ga0207652_10232500 | 3300025921 | Bacteria | 1661 |
| 481 | Ga0207652_10403886 | 3300025921 | Bacteria | 1233 |
| 482 | Ga0207652_10633740 | 3300025921 | Bacteria | 957 |
| 483 | Ga0207681_10000539 | 3300025923 | Bacteria | 26052 |
| 484 | Ga0207681_10021987 | 3300025923 | Bacteria | 4062 |
| 485 | Ga0207681_10161404 | 3300025923 | Bacteria | 1690 |
| 486 | Ga0207694_10046184 | 3300025924 | Bacteria | 3366 |
| 487 | Ga0207694_10050997 | 3300025924 | Bacteria | 3207 |
| 488 | Ga0207650_10003116 | 3300025925 | Bacteria | 11424 |
| 489 | Ga0207650_10037200 | 3300025925 | Bacteria | 3545 |
| 490 | Ga0207659_10004978 | 3300025926 | Bacteria | 8051 |
| 491 | Ga0207659_10361746 | 3300025926 | Bacteria | 1206 |
| 492 | Ga0207687_10000063 | 3300025927 | Bacteria | 83105 |
| 493 | Ga0207687_10036981 | 3300025927 | Bacteria | 3328 |
| 494 | Ga0207687_10095015 | 3300025927 | Bacteria | 2183 |
| 495 | Ga0207700_10026176 | 3300025928 | Bacteria | 4064 |
| 496 | Ga0207700_10050726 | 3300025928 | Bacteria | 3093 |
| 497 | Ga0207664_10010544 | 3300025929 | Bacteria | 6528 |
| 498 | Ga0207664_10019573 | 3300025929 | Bacteria | 5005 |
| 499 | Ga0207664_10057615 | 3300025929 | Bacteria | 3089 |
| 500 | Ga0207664_10454080 | 3300025929 | Bacteria | 1144 |
| 501 | Ga0207664_10506287 | 3300025929 | Bacteria | 1081 |
| 502 | Ga0207664_10661178 | 3300025929 | Bacteria | 939 |
| 503 | Ga0207644_10000661 | 3300025931 | Bacteria | 21786 |
| 504 | Ga0207644_10020596 | 3300025931 | Bacteria | 4486 |
| 505 | Ga0207644_10030764 | 3300025931 | Bacteria | 3736 |
| 506 | Ga0207644_10294034 | 3300025931 | Bacteria | 1307 |
| 507 | Ga0207690_10000086 | 3300025932 | Bacteria | 77995 |
| 508 | Ga0207690_10212058 | 3300025932 | Bacteria | 1477 |
| 509 | Ga0207690_10256511 | 3300025932 | Bacteria | 1353 |
| 510 | Ga0207690_10842393 | 3300025932 | Bacteria | 759 |
| 511 | Ga0207706_10003958 | 3300025933 | Bacteria | 14038 |
| 512 | Ga0207706_10019107 | 3300025933 | Bacteria | 6164 |
| 513 | Ga0207706_10067950 | 3300025933 | Bacteria | 3136 |
| 514 | Ga0207706_10219645 | 3300025933 | Bacteria | 1664 |
| 515 | Ga0207686_10001237 | 3300025934 | Bacteria | 14782 |
| 516 | Ga0207686_10032689 | 3300025934 | Bacteria | 3099 |
| 517 | Ga0207686_10066692 | 3300025934 | Bacteria | 2299 |
| 518 | Ga0207709_10001095 | 3300025935 | Bacteria | 19865 |
| 519 | Ga0207709_10007340 | 3300025935 | Bacteria | 6144 |
| 520 | Ga0207709_10077073 | 3300025935 | Bacteria | 2136 |
| 521 | Ga0207709_10176057 | 3300025935 | Bacteria | 1506 |
| 522 | Ga0207709_10255942 | 3300025935 | Bacteria | 1281 |
| 523 | Ga0207670_10000264 | 3300025936 | Bacteria | 32854 |
| 524 | Ga0207670_10028387 | 3300025936 | Bacteria | 3552 |
| 525 | Ga0207670_10051836 | 3300025936 | Bacteria | 2757 |
| 526 | Ga0207670_10627693 | 3300025936 | Bacteria | 884 |
| 527 | Ga0207669_10000228 | 3300025937 | Bacteria | 25653 |
| 528 | Ga0207669_10319972 | 3300025937 | Bacteria | 1187 |
| 529 | Ga0207704_10000107 | 3300025938 | Bacteria | 45669 |
| 530 | Ga0207704_10514038 | 3300025938 | Unclassified | 967 |
| 531 | Ga0207704_10595501 | 3300025938 | Bacteria | 904 |
| 532 | Ga0207665_10001144 | 3300025939 | Bacteria | 17854 |
| 533 | Ga0207665_10025689 | 3300025939 | Bacteria | 3887 |
| 534 | Ga0207665_10075455 | 3300025939 | Bacteria | 2309 |
| 535 | Ga0207665_10105964 | 3300025939 | Bacteria | 1969 |
| 536 | Ga0207665_10162140 | 3300025939 | Bacteria | 1609 |
| 537 | Ga0207691_10001173 | 3300025940 | Bacteria | 26058 |
| 538 | Ga0207711_10004273 | 3300025941 | Bacteria | 12204 |
| 539 | Ga0207711_10010016 | 3300025941 | Bacteria | 7877 |
| 540 | Ga0207711_10012191 | 3300025941 | Bacteria | 7147 |
| 541 | Ga0207711_10121548 | 3300025941 | Bacteria | 2332 |
| 542 | Ga0207689_10001082 | 3300025942 | Bacteria | 26263 |
| 543 | Ga0207689_10006586 | 3300025942 | Bacteria | 10239 |
| 544 | Ga0207689_10056888 | 3300025942 | Bacteria | 3218 |
| 545 | Ga0207689_10292184 | 3300025942 | Bacteria | 1350 |
| 546 | Ga0207689_10710609 | 3300025942 | Unclassified | 848 |
| 547 | Ga0207661_10000427 | 3300025944 | Bacteria | 27219 |
| 548 | Ga0207661_10026073 | 3300025944 | Bacteria | 4450 |
| 549 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 550 | Ga0207679_10023259 | 3300025945 | Bacteria | 4234 |
| 551 | Ga0207679_10028536 | 3300025945 | Bacteria | 3874 |
| 552 | Ga0207679_10200275 | 3300025945 | Bacteria | 1667 |
| 553 | Ga0207667_10006928 | 3300025949 | Bacteria | 13696 |
| 554 | Ga0207667_10107291 | 3300025949 | Bacteria | 2881 |
| 555 | Ga0207667_10143339 | 3300025949 | Bacteria | 2459 |
| 556 | Ga0207651_10000081 | 3300025960 | Bacteria | 42817 |
| 557 | Ga0207651_10031143 | 3300025960 | Bacteria | 3406 |
| 558 | Ga0207651_10089598 | 3300025960 | Bacteria | 2246 |
| 559 | Ga0207712_10000587 | 3300025961 | Bacteria | 29197 |
| 560 | Ga0207712_10016688 | 3300025961 | Bacteria | 4758 |
| 561 | Ga0207712_10486848 | 3300025961 | Bacteria | 1052 |
| 562 | Ga0207668_10000171 | 3300025972 | Bacteria | 44795 |
| 563 | Ga0207668_10432370 | 3300025972 | Bacteria | 1119 |
| 564 | Ga0207640_10001295 | 3300025981 | Bacteria | 13585 |
| 565 | Ga0207640_10600266 | 3300025981 | Bacteria | 932 |
| 566 | Ga0207658_10000940 | 3300025986 | Bacteria | 24033 |
| 567 | Ga0207658_10280767 | 3300025986 | Bacteria | 1427 |
| 568 | Ga0207677_10000447 | 3300026023 | Bacteria | 27944 |
| 569 | Ga0207677_10159668 | 3300026023 | Bacteria | 1750 |
| 570 | Ga0207703_10006213 | 3300026035 | Bacteria | 9560 |
| 571 | Ga0207703_10046398 | 3300026035 | Bacteria | 3499 |
| 572 | Ga0207703_10103564 | 3300026035 | Bacteria | 2416 |
| 573 | Ga0207703_10150161 | 3300026035 | Bacteria | 2031 |
| 574 | Ga0207703_10272642 | 3300026035 | Bacteria | 1533 |
| 575 | Ga0207639_10002609 | 3300026041 | Bacteria | 12091 |
| 576 | Ga0207639_10174325 | 3300026041 | Bacteria | 1824 |
| 577 | Ga0207639_10300242 | 3300026041 | Bacteria | 1419 |
| 578 | Ga0207678_10001776 | 3300026067 | Bacteria | 19742 |
| 579 | Ga0207678_10005212 | 3300026067 | Bacteria | 11649 |
| 580 | Ga0207678_10028617 | 3300026067 | Bacteria | 4863 |
| 581 | Ga0207708_10016652 | 3300026075 | Bacteria | 5531 |
| 582 | Ga0207708_10095246 | 3300026075 | Bacteria | 2299 |
| 583 | Ga0207708_10150438 | 3300026075 | Bacteria | 1832 |
| 584 | Ga0207702_10006918 | 3300026078 | Bacteria | 9712 |
| 585 | Ga0207641_10001385 | 3300026088 | Bacteria | 23881 |
| 586 | Ga0207641_10043317 | 3300026088 | Bacteria | 3779 |
| 587 | Ga0207641_10408057 | 3300026088 | Bacteria | 1306 |
| 588 | Ga0207648_10009579 | 3300026089 | Bacteria | 9267 |
| 589 | Ga0207648_10033875 | 3300026089 | Bacteria | 4504 |
| 590 | Ga0207648_10150837 | 3300026089 | Bacteria | 2051 |
| 591 | Ga0207676_10321496 | 3300026095 | Bacteria | 1421 |
| 592 | Ga0207674_10001963 | 3300026116 | Bacteria | 26041 |
| 593 | Ga0207675_100002289 | 3300026118 | Bacteria | 19016 |
| 594 | Ga0207675_100135825 | 3300026118 | Bacteria | 2333 |
| 595 | Ga0207675_100216990 | 3300026118 | Bacteria | 1842 |
| 596 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 597 | Ga0207683_10002852 | 3300026121 | Bacteria | 15069 |
| 598 | Ga0207683_10011167 | 3300026121 | Bacteria | 7657 |
| 599 | Ga0207698_10002904 | 3300026142 | Bacteria | 10245 |
| 600 | Ga0207698_10125797 | 3300026142 | Bacteria | 2179 |
| 601 | Ga0209996_1020260 | 3300027395 | Bacteria | 932 |
| 602 | Ga0209179_1002173 | 3300027512 | Bacteria | 2598 |
| 603 | Ga0209970_1010235 | 3300027614 | Bacteria | 1533 |
| 604 | Ga0210002_1000477 | 3300027617 | Bacteria | 5435 |
| 605 | Ga0209983_1005766 | 3300027665 | Bacteria | 2556 |
| 606 | Ga0209971_1003482 | 3300027682 | Bacteria | 3732 |
| 607 | Ga0209966_1002279 | 3300027695 | Bacteria | 3199 |
| 608 | Ga0209998_10002493 | 3300027717 | Bacteria | 4198 |
| 609 | Ga0209998_10004176 | 3300027717 | Bacteria | 3079 |
| 610 | Ga0209813_10040428 | 3300027866 | Bacteria | 1418 |
| 611 | Ga0209974_10011302 | 3300027876 | Bacteria | 3003 |
| 612 | Ga0207428_10000374 | 3300027907 | Bacteria | 56990 |
| 613 | Ga0207428_10001279 | 3300027907 | Bacteria | 26927 |
| 614 | Ga0207428_10017457 | 3300027907 | Bacteria | 6159 |
| 615 | Ga0207428_10130847 | 3300027907 | Bacteria | 1920 |
| 616 | Ga0268266_10116643 | 3300028379 | Bacteria | 2371 |
| 617 | Ga0268266_10212572 | 3300028379 | Bacteria | 1774 |
| 618 | Ga0268266_10229055 | 3300028379 | Bacteria | 1711 |
| 619 | Ga0268266_10376224 | 3300028379 | Unclassified | 1339 |
| 620 | Ga0268265_10001152 | 3300028380 | Bacteria | 23269 |
| 621 | Ga0268265_10014239 | 3300028380 | Bacteria | 5417 |
| 622 | Ga0268264_10000886 | 3300028381 | Bacteria | 31552 |
| 623 | Ga0268264_10154596 | 3300028381 | Bacteria | 2060 |
| 624 | Ga0268264_10710467 | 3300028381 | Bacteria | 999 |
| 625 | Ga0265337_1001260 | 3300028556 | Bacteria | 12734 |
| 626 | Ga0265338_10153739 | 3300028800 | Bacteria | 1785 |
| 627 | Ga0265763_1000997 | 3300030763 | Bacteria | 1913 |
| 628 | Ga0265760_10019333 | 3300031090 | Bacteria | 1962 |
| 629 | Ga0265760_10021981 | 3300031090 | Bacteria | 1847 |
| 630 | Ga0265330_10038621 | 3300031235 | Bacteria | 2122 |
| 631 | Ga0265320_10053242 | 3300031240 | Bacteria | 1956 |
| 632 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 633 | Ga0265325_10002889 | 3300031241 | Bacteria | 11452 |
| 634 | Ga0265325_10004936 | 3300031241 | Bacteria | 8318 |
| 635 | Ga0265329_10042690 | 3300031242 | Bacteria | 1451 |
| 636 | Ga0265340_10061084 | 3300031247 | Bacteria | 1803 |
| 637 | Ga0265339_10002208 | 3300031249 | Bacteria | 14116 |
| 638 | Ga0265339_10055723 | 3300031249 | Bacteria | 2143 |
| 639 | Ga0265316_10209794 | 3300031344 | Bacteria | 1441 |
| 640 | Ga0265313_10000227 | 3300031595 | Bacteria | 60770 |
| 641 | Ga0265313_10002423 | 3300031595 | Bacteria | 16122 |
| 642 | Ga0265313_10007892 | 3300031595 | Bacteria | 7170 |
| 643 | Ga0265313_10052765 | 3300031595 | Bacteria | 1939 |
| 644 | Ga0265313_10057902 | 3300031595 | Bacteria | 1827 |
| 645 | Ga0265314_10020734 | 3300031711 | Bacteria | 5072 |
| 646 | Ga0265342_10138943 | 3300031712 | Bacteria | 1356 |
| 647 | Ga0307416_100396456 | 3300032002 | Bacteria | 1416 |
| 648 | Ga0307416_100954069 | 3300032002 | Bacteria | 960 |
| 649 | Ga0373930_0002579 | 3300034816 | Bacteria | 2811 |
| 650 | Ga0373930_0057112 | 3300034816 | Bacteria | 864 |
| 651 | Ga0373948_0001453 | 3300034817 | Bacteria | 3292 |
| 652 | Ga0373950_0000698 | 3300034818 | Bacteria | 4139 |
| 653 | Ga0373958_0000496 | 3300034819 | Bacteria | 4853 |
| 654 | Ga0373958_0004383 | 3300034819 | Bacteria | 2088 |
| 655 | Ga0373958_0004490 | 3300034819 | Bacteria | 2069 |
| 656 | Ga0373959_0000900 | 3300034820 | Bacteria | 5021 |
| 657 | Ga0373959_0006325 | 3300034820 | Bacteria | 1963 |
| 658 | Ga0373938_0000064 | 3300034957 | Bacteria | 13771 |
| 659 | Ga0373926_0015325 | 3300035083 | Bacteria | 2613 |
| 660 | Ga0373926_0060684 | 3300035083 | Bacteria | 1378 |
| 661 | Ga0373926_0140441 | 3300035083 | Bacteria | 917 |
| 662 | Ga0373928_0001083 | 3300035084 | Bacteria | 5383 |
| 663 | Ga0373928_0001329 | 3300035084 | Bacteria | 4849 |
| 664 | Ga0373929_0001708 | 3300035085 | Bacteria | 4126 |
| 665 | Ga0373929_0038124 | 3300035085 | Bacteria | 1056 |
| 666 | Ga0373934_0010064 | 3300035086 | Bacteria | 3550 |
| 667 | Ga0373934_0015074 | 3300035086 | Bacteria | 2931 |
| 668 | Ga0373934_0020229 | 3300035086 | Bacteria | 2558 |
| 669 | Ga0373940_0000741 | 3300035088 | Bacteria | 5323 |
| 670 | Ga0373940_0053493 | 3300035088 | Bacteria | 1139 |
| 671 | Ga0373944_0000426 | 3300035089 | Bacteria | 9637 |
| 672 | Ga0373949_0001039 | 3300035090 | Bacteria | 8489 |
| 673 | Ga0373949_0001645 | 3300035090 | Bacteria | 6231 |
| 674 | Ga0373951_0001036 | 3300035091 | Bacteria | 7473 |
| 675 | Ga0373951_0007532 | 3300035091 | Bacteria | 2470 |
| 676 | Ga0373952_0000019 | 3300035092 | Bacteria | 19182 |
| 677 | Ga0373923_0000926 | 3300035111 | Bacteria | 7838 |
| 678 | Ga0373923_0001563 | 3300035111 | Bacteria | 6636 |
| 679 | Ga0373923_0031870 | 3300035111 | Bacteria | 2127 |
| 680 | Ga0373923_0108990 | 3300035111 | Bacteria | 1228 |
| 681 | Ga0373923_0165073 | 3300035111 | Bacteria | 1012 |
| 682 | Ga0373932_0000203 | 3300035112 | Bacteria | 17502 |
| 683 | Ga0373932_0002660 | 3300035112 | Bacteria | 4449 |
| 684 | Ga0373932_0006928 | 3300035112 | Bacteria | 2692 |
| 685 | Ga0373936_0002444 | 3300035113 | Bacteria | 6950 |
| 686 | Ga0373936_0040063 | 3300035113 | Bacteria | 1876 |
| 687 | Ga0373936_0059016 | 3300035113 | Bacteria | 1563 |
| 688 | Ga0373936_0062037 | 3300035113 | Bacteria | 1528 |
| 689 | Ga0373936_0327149 | 3300035113 | Bacteria | 695 |
| 690 | Ga0373939_0000216 | 3300035114 | Bacteria | 15784 |
| 691 | Ga0373939_0000614 | 3300035114 | Bacteria | 8825 |
| 692 | Ga0373939_0001103 | 3300035114 | Bacteria | 6636 |
| 693 | Ga0373939_0051795 | 3300035114 | Bacteria | 1277 |
| 694 | Ga0373939_0125008 | 3300035114 | Bacteria | 912 |
| 695 | Ga0373941_0000089 | 3300035115 | Bacteria | 15092 |
| 696 | Ga0373941_0000816 | 3300035115 | Bacteria | 6394 |
| 697 | Ga0373945_0002033 | 3300035116 | Bacteria | 6293 |
| 698 | Ga0373945_0012501 | 3300035116 | Bacteria | 2821 |
| 699 | Ga0373945_0016756 | 3300035116 | Bacteria | 2476 |
| 700 | Ga0373945_0062139 | 3300035116 | Bacteria | 1396 |
| 701 | Ga0373945_0139161 | 3300035116 | Bacteria | 978 |
| 702 | Ga0373953_0000743 | 3300035117 | Bacteria | 9035 |
| 703 | Ga0373954_0003246 | 3300035118 | Bacteria | 6866 |
| 704 | Ga0373954_0045519 | 3300035118 | Bacteria | 2050 |
| 705 | Ga0373956_0016548 | 3300035119 | Bacteria | 3098 |
| 706 | Ga0373956_0025533 | 3300035119 | Bacteria | 2554 |
| 707 | Ga0373957_0001000 | 3300035120 | Bacteria | 7430 |
| 708 | Ga0373957_0048794 | 3300035120 | Bacteria | 1614 |
| 709 | Ga0373960_0000120 | 3300035121 | Bacteria | 12660 |
| 710 | Ga0373960_0003816 | 3300035121 | Bacteria | 3426 |
| 711 | Ga0373960_0046541 | 3300035121 | Bacteria | 1273 |
| 712 | Ga0373943_0003686 | 3300035170 | Bacteria | 6965 |
| 713 | Ga0373943_0005206 | 3300035170 | Bacteria | 5853 |
| 714 | Ga0373943_0005890 | 3300035170 | Bacteria | 5504 |
| 715 | Ga0373943_0016094 | 3300035170 | Bacteria | 3406 |
| 716 | Ga0373943_0282313 | 3300035170 | Bacteria | 939 |
| 717 | Ga0373943_0489836 | 3300035170 | Unclassified | 717 |
| 718 | Ga0373946_0000588 | 3300035171 | Bacteria | 12009 |
| 719 | Ga0373946_0009609 | 3300035171 | Bacteria | 3567 |
| 720 | Ga0373946_0033194 | 3300035171 | Bacteria | 2076 |
| 721 | Ga0373946_0048825 | 3300035171 | Bacteria | 1763 |
| 722 | Ga0373955_0000346 | 3300035172 | Bacteria | 19457 |
| 723 | Ga0373955_0008157 | 3300035172 | Bacteria | 4847 |
| 724 | Ga0373955_0010230 | 3300035172 | Bacteria | 4423 |
| 725 | Ga0373942_0000091 | 3300035207 | Bacteria | 19864 |
| 726 | Ga0373942_0006030 | 3300035207 | Bacteria | 2801 |
| 727 | Ga0373942_0007527 | 3300035207 | Bacteria | 2528 |
| 728 | Ga0373961_0002565 | 3300035241 | Bacteria | 4680 |
| 729 | Ga0373961_0009679 | 3300035241 | Bacteria | 2362 |
| 730 | Ga0373961_0036687 | 3300035241 | Bacteria | 1397 |
| 731 | Ga0373961_0045368 | 3300035241 | Bacteria | 1285 |
| 732 | Ga0373962_0001149 | 3300035242 | Bacteria | 6171 |
| 733 | Ga0373962_0001769 | 3300035242 | Bacteria | 5139 |
| 734 | Ga0373962_0017275 | 3300035242 | Bacteria | 1869 |
| 735 | Ga0373962_0032945 | 3300035242 | Bacteria | 1427 |
| 736 | Ga0373962_0085939 | 3300035242 | Bacteria | 962 |
| 737 | Ga0373924_0015064 | 3300035410 | Bacteria | 2931 |
| 738 | Ga0373924_0020705 | 3300035410 | Bacteria | 2559 |
| 739 | Ga0373924_0026419 | 3300035410 | Bacteria | 2303 |
| 740 | Ga0373924_0045388 | 3300035410 | Bacteria | 1807 |
| 741 | Ga0373924_0093103 | 3300035410 | Bacteria | 1291 |
| 742 | Ga0373931_0000168 | 3300035691 | Bacteria | 28567 |
| 743 | Ga0373931_0038386 | 3300035691 | Bacteria | 2504 |
| 744 | Ga0373931_0237170 | 3300035691 | Bacteria | 1104 |
| 745 | Ga0373935_0000056 | 3300035692 | Bacteria | 46025 |
| 746 | Ga0373935_0001750 | 3300035692 | Bacteria | 12184 |
| 747 | Ga0373935_0002094 | 3300035692 | Bacteria | 11328 |
| 748 | Ga0373935_0032978 | 3300035692 | Bacteria | 3221 |
| 749 | Ga0373927_0005062 | 3300035695 | Bacteria | 9123 |
| 750 | Ga0373927_0024702 | 3300035695 | Bacteria | 3926 |
| 751 | Ga0373927_0069714 | 3300035695 | Bacteria | 2275 |
| 752 | Ga0373927_0090568 | 3300035695 | Bacteria | 1986 |
| 753 | Ga0373927_0093348 | 3300035695 | Bacteria | 1955 |
| 754 | Ga0373927_0581643 | 3300035695 | Bacteria | 740 |
| 755 | Ga0373933_0001375 | 3300035724 | Bacteria | 14320 |
| 756 | Ga0373933_0017583 | 3300035724 | Bacteria | 4011 |
| 757 | Ga0373933_0028287 | 3300035724 | Bacteria | 3233 |
| 758 | Ga0373933_0052227 | 3300035724 | Bacteria | 2445 |
| 759 | Ga0373947_0006017 | 3300035725 | Bacteria | 7074 |
| 760 | Ga0373947_0007138 | 3300035725 | Bacteria | 6478 |
| 761 | Ga0373947_0040038 | 3300035725 | Bacteria | 2791 |
| 762 | Ga0373947_0073319 | 3300035725 | Bacteria | 2103 |
| 763 | Ga0373947_0090595 | 3300035725 | Bacteria | 1906 |
| 764 | Ga0373947_0144846 | 3300035725 | Bacteria | 1526 |
| 765 | Ga0373947_0375588 | 3300035725 | Bacteria | 956 |
| 766 | Ga0373947_0451118 | 3300035725 | Bacteria | 871 |
| 767 | Ga0373937_0000075 | 3300036401 | Bacteria | 89727 |
| 768 | Ga0373937_0003559 | 3300036401 | Bacteria | 13122 |
| 769 | Ga0373937_0039296 | 3300036401 | Bacteria | 4312 |
| 770 | Ga0373937_0039734 | 3300036401 | Bacteria | 4287 |
| 771 | Ga0373937_0245499 | 3300036401 | Bacteria | 1687 |
| 772 | Ga0373937_0471933 | 3300036401 | Bacteria | 1192 |
| 773 | Ga0373937_0948632 | 3300036401 | Bacteria | 809 |
| 774 | Ga0316582_0657727 | 3300036647 | Bacteria | 720 |
| 775 | Ga0373925_0000159 | 3300037068 | Bacteria | 72851 |
| 776 | Ga0373925_0005248 | 3300037068 | Bacteria | 9679 |
| 777 | Ga0373925_0020282 | 3300037068 | Bacteria | 4837 |
| 778 | Ga0373925_0105716 | 3300037068 | Bacteria | 2169 |
| 779 | Ga0373925_0170443 | 3300037068 | Bacteria | 1718 |
| 780 | Ga0373925_0263453 | 3300037068 | Bacteria | 1385 |
| 781 | Ga0373925_0395669 | 3300037068 | Bacteria | 1126 |
| 782 | Ga0395899_0002776 | 3300037312 | Bacteria | 14123 |
| 783 | Ga0395900_0013269 | 3300037418 | Bacteria | 8423 |
| 784 | Ga0395900_0159376 | 3300037418 | Bacteria | 2302 |
| 785 | Ga0395898_0050530 | 3300037466 | Bacteria | 4068 |
| 786 | Ga0395898_0116321 | 3300037466 | Bacteria | 2562 |
| 787 | Ga0316581_0069847 | 3300037588 | Bacteria | 1079 |
| 788 | Ga0436364_0886464 | 3300037853 | Bacteria | 3248 |
| 789 | Ga0436364_0997940 | 3300037853 | Bacteria | 9500 |
| 790 | Ga0395901_0057068 | 3300038443 | Bacteria | 4061 |
| 791 | Ga0395901_0265968 | 3300038443 | Bacteria | 1784 |
| 792 | Ga0395901_0469618 | 3300038443 | Bacteria | 1284 |
| 793 | Ga0395901_0713321 | 3300038443 | Unclassified | 999 |
| 794 | Ga0242419_000904 | 3300038698 | Bacteria | 1734 |
| 795 | Ga0436365_0079668 | 3300039437 | Bacteria | 3014 |
| 796 | Ga0436365_1050212 | 3300039437 | Bacteria | 962 |
| 797 | Ga0436365_1264309 | 3300039437 | Bacteria | 1340 |
| 798 | Ga0436365_1681640 | 3300039437 | Bacteria | 9732 |
| 799 | Ga0436365_1831839 | 3300039437 | Bacteria | 3044 |
| 800 | Ga0436362_0355750 | 3300039453 | Bacteria | 1798 |
| 801 | Ga0439453_0000098 | 3300041408 | Bacteria | 6835 |
| 802 | Ga0439441_025059 | 3300042001 | Bacteria | 1124 |
| 803 | Ga0439443_002753 | 3300042003 | Bacteria | 2139 |
| 804 | Ga0439459_0004853 | 3300042438 | Bacteria | 2184 |
| 805 | Ga0439464_0035635 | 3300042439 | Bacteria | 1406 |
| 806 | Ga0450893_0014891 | 3300042532 | Bacteria | 1308 |
| 807 | Ga0451577_0527500 | 3300042876 | Bacteria | 1072 |
| 808 | Ga0466966_0021960 | 3300044684 | Bacteria | 4190 |
| 809 | Ga0466966_0029521 | 3300044684 | Bacteria | 3567 |
| 810 | Ga0466963_0025471 | 3300044694 | Bacteria | 3773 |
| 811 | Ga0466957_0019160 | 3300044842 | Bacteria | 4024 |
| 812 | Ga0466957_0035351 | 3300044842 | Bacteria | 2998 |
| 813 | Ga0466957_0763336 | 3300044842 | Unclassified | 685 |
| 814 | Ga0466959_0078122 | 3300045049 | Bacteria | 2387 |
| 815 | Ga0466959_0494177 | 3300045049 | Bacteria | 827 |
| 816 | Ga0451576_0004687 | 3300045051 | Bacteria | 17589 |
| 817 | Ga0466958_0112429 | 3300045836 | Bacteria | 1700 |
| 818 | Ga0466958_0613596 | 3300045836 | Bacteria | 708 |
| 819 | Ga0466967_0752311 | 3300045976 | Bacteria | 967 |
| 820 | Ga0495617_030533 | 3300046452 | Bacteria | 1811 |
| 821 | Ga0495592_0000102 | 3300046454 | Bacteria | 75767 |
| 822 | Ga0495592_0002255 | 3300046454 | Bacteria | 13601 |
| 823 | Ga0495592_0016006 | 3300046454 | Bacteria | 5690 |
| 824 | Ga0495603_0015609 | 3300046455 | Bacteria | 4597 |
| 825 | Ga0495603_0143252 | 3300046455 | Bacteria | 1390 |
| 826 | Ga0495629_0002525 | 3300046459 | Bacteria | 14034 |
| 827 | Ga0495629_0080260 | 3300046459 | Bacteria | 2278 |
| 828 | Ga0495629_0094527 | 3300046459 | Bacteria | 2086 |
| 829 | Ga0495629_0210372 | 3300046459 | Bacteria | 1343 |
| 830 | Ga0495641_0011998 | 3300046461 | Bacteria | 4883 |
| 831 | Ga0495641_0052847 | 3300046461 | Bacteria | 1850 |
| 832 | Ga0495651_0002426 | 3300046462 | Bacteria | 14386 |
| 833 | Ga0495651_0008311 | 3300046462 | Bacteria | 7953 |
| 834 | Ga0495651_0017925 | 3300046462 | Bacteria | 5483 |
| 835 | Ga0495651_0072284 | 3300046462 | Bacteria | 2620 |
| 836 | Ga0495651_0248591 | 3300046462 | Bacteria | 1216 |
| 837 | Ga0495653_0000036 | 3300046463 | Bacteria | 129776 |
| 838 | Ga0495653_0003952 | 3300046463 | Bacteria | 11974 |
| 839 | Ga0495653_0052697 | 3300046463 | Bacteria | 3117 |
| 840 | Ga0495653_0074651 | 3300046463 | Bacteria | 2526 |
| 841 | Ga0495653_0237077 | 3300046463 | Bacteria | 1218 |
| 842 | Ga0495582_0023871 | 3300046473 | Bacteria | 3343 |
| 843 | Ga0495582_0044190 | 3300046473 | Bacteria | 2454 |
| 844 | Ga0495582_0163050 | 3300046473 | Bacteria | 1268 |
| 845 | Ga0495639_0103935 | 3300046475 | Bacteria | 1343 |
| 846 | Ga0495639_0314688 | 3300046475 | Bacteria | 782 |
| 847 | Ga0495662_0004822 | 3300046476 | Bacteria | 6761 |
| 848 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 849 | Ga0495664_0005777 | 3300046477 | Bacteria | 6808 |
| 850 | Ga0495664_0019048 | 3300046477 | Bacteria | 3941 |
| 851 | Ga0495664_0056167 | 3300046477 | Bacteria | 2342 |
| 852 | Ga0495664_0115721 | 3300046477 | Bacteria | 1620 |
| 853 | Ga0495584_0015063 | 3300046491 | Bacteria | 3941 |
| 854 | Ga0495585_0000942 | 3300046492 | Bacteria | 24532 |
| 855 | Ga0495594_0020125 | 3300046499 | Bacteria | 3553 |
| 856 | Ga0495594_0061382 | 3300046499 | Bacteria | 2080 |
| 857 | Ga0495594_0117293 | 3300046499 | Bacteria | 1504 |
| 858 | Ga0495594_0195566 | 3300046499 | Bacteria | 1152 |
| 859 | Ga0495596_0029807 | 3300046500 | Bacteria | 2186 |
| 860 | Ga0495607_0003642 | 3300046501 | Bacteria | 11691 |
| 861 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 862 | Ga0495608_0035566 | 3300046511 | Bacteria | 3358 |
| 863 | Ga0495608_0039938 | 3300046511 | Bacteria | 3144 |
| 864 | Ga0495618_0000057 | 3300046514 | Bacteria | 80298 |
| 865 | Ga0495618_0002927 | 3300046514 | Bacteria | 10815 |
| 866 | Ga0495618_0099320 | 3300046514 | Bacteria | 1862 |
| 867 | Ga0495618_0102720 | 3300046514 | Bacteria | 1830 |
| 868 | Ga0495618_0186483 | 3300046514 | Bacteria | 1317 |
| 869 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 870 | Ga0495628_0000249 | 3300046516 | Bacteria | 47492 |
| 871 | Ga0495628_0014559 | 3300046516 | Bacteria | 6587 |
| 872 | Ga0495628_0104111 | 3300046516 | Bacteria | 2188 |
| 873 | Ga0495630_0001707 | 3300046517 | Bacteria | 15337 |
| 874 | Ga0495630_0049852 | 3300046517 | Bacteria | 3133 |
| 875 | Ga0495631_0041216 | 3300046518 | Bacteria | 2044 |
| 876 | Ga0495644_0018613 | 3300046523 | Bacteria | 2653 |
| 877 | Ga0495644_0046857 | 3300046523 | Bacteria | 1624 |
| 878 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 879 | Ga0495652_0002812 | 3300046529 | Bacteria | 17543 |
| 880 | Ga0495652_0009180 | 3300046529 | Bacteria | 8992 |
| 881 | Ga0495652_0159452 | 3300046529 | Bacteria | 1753 |
| 882 | Ga0495665_0030633 | 3300046531 | Bacteria | 2880 |
| 883 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 884 | Ga0495640_0089236 | 3300046533 | Bacteria | 2036 |
| 885 | Ga0495640_0166213 | 3300046533 | Bacteria | 1411 |
| 886 | Ga0495640_0186394 | 3300046533 | Bacteria | 1320 |
| 887 | Ga0495586_0077330 | 3300046535 | Bacteria | 1824 |
| 888 | Ga0495586_0078797 | 3300046535 | Bacteria | 1808 |
| 889 | Ga0495587_0000043 | 3300046536 | Bacteria | 109717 |
| 890 | Ga0495587_0012089 | 3300046536 | Bacteria | 5450 |
| 891 | Ga0495587_0086700 | 3300046536 | Bacteria | 1812 |
| 892 | Ga0495587_0102643 | 3300046536 | Bacteria | 1646 |
| 893 | Ga0495598_0052538 | 3300046537 | Bacteria | 1232 |
| 894 | Ga0495609_0044373 | 3300046538 | Bacteria | 1994 |
| 895 | Ga0495609_0063914 | 3300046538 | Bacteria | 1624 |
| 896 | Ga0495621_0184312 | 3300046539 | Unclassified | 834 |
| 897 | Ga0495645_0000064 | 3300046543 | Bacteria | 74490 |
| 898 | Ga0495645_0002732 | 3300046543 | Bacteria | 11974 |
| 899 | Ga0495645_0030598 | 3300046543 | Bacteria | 3921 |
| 900 | Ga0495645_0175050 | 3300046543 | Bacteria | 1474 |
| 901 | Ga0495622_0001295 | 3300046557 | Bacteria | 12837 |
| 902 | Ga0495633_0004471 | 3300046558 | Bacteria | 8875 |
| 903 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 904 | Ga0495667_0001004 | 3300046559 | Bacteria | 18289 |
| 905 | Ga0495667_0008379 | 3300046559 | Bacteria | 7013 |
| 906 | Ga0495667_0026475 | 3300046559 | Bacteria | 3909 |
| 907 | Ga0495667_0096648 | 3300046559 | Bacteria | 1912 |
| 908 | Ga0495667_0208415 | 3300046559 | Unclassified | 1249 |
| 909 | Ga0495656_0000250 | 3300046615 | Bacteria | 18920 |
| 910 | Ga0495668_0053370 | 3300046616 | Bacteria | 2235 |
| 911 | Ga0495668_0110590 | 3300046616 | Bacteria | 1503 |
| 912 | Ga0495634_0000049 | 3300046642 | Bacteria | 95428 |
| 913 | Ga0495634_0070587 | 3300046642 | Bacteria | 2302 |
| 914 | Ga0495634_0082016 | 3300046642 | Bacteria | 2109 |
| 915 | Ga0495634_0288157 | 3300046642 | Bacteria | 996 |
| 916 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 917 | Ga0495635_0036447 | 3300046663 | Bacteria | 3409 |
| 918 | Ga0495635_0059659 | 3300046663 | Bacteria | 2623 |
| 919 | Ga0495635_0176175 | 3300046663 | Bacteria | 1454 |
| 920 | Ga0495659_0000752 | 3300046664 | Bacteria | 11618 |
| 921 | Ga0495588_0018063 | 3300046674 | Bacteria | 3435 |
| 922 | Ga0495588_0034826 | 3300046674 | Bacteria | 2548 |
| 923 | Ga0495588_0081897 | 3300046674 | Bacteria | 1685 |
| 924 | Ga0495657_0000063 | 3300046675 | Bacteria | 94380 |
| 925 | Ga0495657_0015263 | 3300046675 | Bacteria | 5623 |
| 926 | Ga0495657_0042230 | 3300046675 | Bacteria | 3115 |
| 927 | Ga0495657_0121060 | 3300046675 | Bacteria | 1648 |
| 928 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 929 | Ga0495599_0001983 | 3300046678 | Bacteria | 11852 |
| 930 | Ga0495599_0002159 | 3300046678 | Bacteria | 11427 |
| 931 | Ga0495623_0000056 | 3300046679 | Bacteria | 69307 |
| 932 | Ga0495623_0004071 | 3300046679 | Bacteria | 9626 |
| 933 | Ga0495623_0529622 | 3300046679 | Bacteria | 619 |
| 934 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 935 | Ga0495646_0001094 | 3300046680 | Bacteria | 15749 |
| 936 | Ga0495646_0038956 | 3300046680 | Bacteria | 2932 |
| 937 | Ga0495647_0002557 | 3300046681 | Bacteria | 5767 |
| 938 | Ga0495647_0005728 | 3300046681 | Bacteria | 4085 |
| 939 | Ga0495647_0010007 | 3300046681 | Bacteria | 3223 |
| 940 | Ga0495658_0003031 | 3300046683 | Bacteria | 8416 |
| 941 | Ga0495658_0056211 | 3300046683 | Bacteria | 2243 |
| 942 | Ga0495658_0076432 | 3300046683 | Bacteria | 1957 |
| 943 | Ga0495658_0255577 | 3300046683 | Bacteria | 1102 |
| 944 | Ga0495658_0317447 | 3300046683 | Bacteria | 987 |
| 945 | Ga0495669_0069895 | 3300046684 | Bacteria | 1599 |
| 946 | Ga0495613_0092810 | 3300046689 | Bacteria | 2185 |
| 947 | Ga0495613_0340618 | 3300046689 | Unclassified | 1031 |
| 948 | Ga0495624_0014420 | 3300046690 | Bacteria | 5363 |
| 949 | Ga0495624_0167583 | 3300046690 | Unclassified | 1340 |
| 950 | Ga0495670_0013601 | 3300046691 | Bacteria | 4001 |
| 951 | Ga0495671_0047424 | 3300046692 | Bacteria | 2147 |
| 952 | Ga0495589_0024843 | 3300046794 | Bacteria | 3043 |
| 953 | Ga0495600_0000047 | 3300046809 | Bacteria | 71546 |
| 954 | Ga0495600_0005271 | 3300046809 | Bacteria | 7784 |
| 955 | Ga0495600_0007955 | 3300046809 | Bacteria | 6496 |
| 956 | Ga0495600_0061175 | 3300046809 | Bacteria | 2459 |
| 957 | Ga0495600_0066971 | 3300046809 | Bacteria | 2348 |
| 958 | Ga0495600_0125448 | 3300046809 | Bacteria | 1670 |
| 959 | Ga0495581_0005315 | 3300047315 | Bacteria | 7450 |
| 960 | Ga0495581_0471817 | 3300047315 | Bacteria | 730 |
| 961 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 962 | Ga0495604_0002860 | 3300047317 | Bacteria | 13842 |
| 963 | Ga0495604_0019689 | 3300047317 | Bacteria | 5399 |
| 964 | Ga0495604_0020290 | 3300047317 | Bacteria | 5311 |
| 965 | Ga0495604_0026478 | 3300047317 | Bacteria | 4616 |
| 966 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 967 | Ga0495674_0020761 | 3300047319 | Bacteria | 6081 |
| 968 | Ga0495674_0041589 | 3300047319 | Bacteria | 4105 |
| 969 | Ga0495674_0099531 | 3300047319 | Bacteria | 2475 |
| 970 | Ga0495674_0107360 | 3300047319 | Bacteria | 2370 |
| 971 | Ga0495674_0126338 | 3300047319 | Bacteria | 2157 |
| 972 | Ga0495674_0192917 | 3300047319 | Unclassified | 1692 |
| 973 | Ga0495676_0083050 | 3300047321 | Bacteria | 2422 |
| 974 | Ga0495676_0086661 | 3300047321 | Bacteria | 2355 |
| 975 | Ga0495676_0117897 | 3300047321 | Bacteria | 1936 |
| 976 | Ga0495676_0138968 | 3300047321 | Bacteria | 1743 |
| 977 | Ga0495680_0000744 | 3300047322 | Bacteria | 36481 |
| 978 | Ga0495680_0004614 | 3300047322 | Bacteria | 13127 |
| 979 | Ga0495680_0007483 | 3300047322 | Bacteria | 10005 |
| 980 | Ga0495680_0015155 | 3300047322 | Bacteria | 6656 |
| 981 | Ga0495680_0111656 | 3300047322 | Bacteria | 2025 |
| 982 | Ga0495675_0000819 | 3300047444 | Bacteria | 19126 |
| 983 | Ga0495675_0000940 | 3300047444 | Bacteria | 17639 |
| 984 | Ga0495675_0015252 | 3300047444 | Bacteria | 4858 |
| 985 | Ga0495679_035192 | 3300047446 | Bacteria | 1589 |
| 986 | Ga0495685_031018 | 3300047447 | Bacteria | 1838 |
| 987 | Ga0495684_0000757 | 3300047471 | Bacteria | 26052 |
| 988 | Ga0495684_0047628 | 3300047471 | Bacteria | 3278 |
| 989 | Ga0495684_0195157 | 3300047471 | Bacteria | 1495 |
| 990 | Ga0495593_0001967 | 3300047673 | Bacteria | 12237 |
| 991 | Ga0495593_0017135 | 3300047673 | Bacteria | 4077 |
| 992 | Ga0495593_0060655 | 3300047673 | Bacteria | 1980 |
| 993 | Ga0495593_0060803 | 3300047673 | Bacteria | 1977 |
| 994 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 995 | Ga0495602_0003833 | 3300048088 | Bacteria | 15645 |
| 996 | Ga0496100_0000503 | 3300048903 | Bacteria | 18785 |
| 997 | Ga0496100_0020825 | 3300048903 | Bacteria | 3939 |
| 998 | Ga0496100_0021327 | 3300048903 | Bacteria | 3898 |
| 999 | Ga0496101_0000510 | 3300048904 | Bacteria | 24389 |
| 1000 | Ga0496101_0001758 | 3300048904 | Bacteria | 12992 |
| 1001 | Ga0496101_0092988 | 3300048904 | Bacteria | 2246 |
| 1002 | Ga0496102_0003114 | 3300048905 | Bacteria | 14069 |
| 1003 | Ga0496102_0039249 | 3300048905 | Bacteria | 4277 |
| 1004 | Ga0496102_0040466 | 3300048905 | Bacteria | 4216 |
| 1005 | Ga0496102_0151063 | 3300048905 | Bacteria | 2182 |
| 1006 | Ga0496102_0247296 | 3300048905 | Bacteria | 1681 |
| 1007 | Ga0496103_0002544 | 3300048906 | Bacteria | 11424 |
| 1008 | Ga0496103_0018730 | 3300048906 | Bacteria | 4154 |
| 1009 | Ga0496103_0065264 | 3300048906 | Bacteria | 2270 |
| 1010 | Ga0496103_0395675 | 3300048906 | Bacteria | 887 |
| 1011 | Ga0496104_0000232 | 3300048907 | Bacteria | 49094 |
| 1012 | Ga0496104_0017224 | 3300048907 | Bacteria | 6575 |
| 1013 | Ga0496104_0029835 | 3300048907 | Bacteria | 5062 |
| 1014 | Ga0496104_0155041 | 3300048907 | Bacteria | 2198 |
| 1015 | Ga0496104_0953143 | 3300048907 | Unclassified | 762 |
| 1016 | Ga0496105_0000238 | 3300048908 | Bacteria | 37100 |
| 1017 | Ga0496105_0000539 | 3300048908 | Bacteria | 24970 |
| 1018 | Ga0496105_0001838 | 3300048908 | Bacteria | 15207 |
| 1019 | Ga0496105_0015132 | 3300048908 | Bacteria | 6140 |
| 1020 | Ga0496105_0140656 | 3300048908 | Bacteria | 1986 |
| 1021 | Ga0496105_0162921 | 3300048908 | Bacteria | 1830 |
| 1022 | Ga0496106_0000327 | 3300048909 | Bacteria | 33634 |
| 1023 | Ga0496106_0012909 | 3300048909 | Bacteria | 6164 |
| 1024 | Ga0496106_0016509 | 3300048909 | Bacteria | 5464 |
| 1025 | Ga0496106_0069998 | 3300048909 | Bacteria | 2679 |
| 1026 | Ga0496106_0210441 | 3300048909 | Bacteria | 1549 |
| 1027 | Ga0496107_0000143 | 3300048910 | Bacteria | 35680 |
| 1028 | Ga0496107_0032474 | 3300048910 | Bacteria | 3731 |
| 1029 | Ga0496107_0070876 | 3300048910 | Bacteria | 2531 |
| 1030 | Ga0496107_0096841 | 3300048910 | Bacteria | 2159 |
| 1031 | Ga0496107_0139722 | 3300048910 | Bacteria | 1790 |
| 1032 | Ga0496107_0305769 | 3300048910 | Bacteria | 1183 |
| 1033 | Ga0496107_0313027 | 3300048910 | Bacteria | 1168 |
| 1034 | Ga0496108_0002170 | 3300048911 | Bacteria | 15738 |
| 1035 | Ga0496108_0004957 | 3300048911 | Bacteria | 10756 |
| 1036 | Ga0496108_0037339 | 3300048911 | Bacteria | 4045 |
| 1037 | Ga0496108_0472488 | 3300048911 | Bacteria | 1095 |
| 1038 | Ga0496108_0718729 | 3300048911 | Bacteria | 865 |
| 1039 | Ga0496108_1075104 | 3300048911 | Bacteria | 684 |
| 1040 | Ga0496109_0000372 | 3300048912 | Bacteria | 40804 |
| 1041 | Ga0496109_0001114 | 3300048912 | Bacteria | 22296 |
| 1042 | Ga0496109_0002579 | 3300048912 | Bacteria | 15178 |
| 1043 | Ga0496109_0028420 | 3300048912 | Bacteria | 5000 |
| 1044 | Ga0496109_0235058 | 3300048912 | Bacteria | 1724 |
| 1045 | Ga0496109_0278861 | 3300048912 | Unclassified | 1575 |
| 1046 | Ga0496109_0503311 | 3300048912 | Bacteria | 1143 |
| 1047 | Ga0496109_0658085 | 3300048912 | Bacteria | 984 |
| 1048 | Ga0496109_1217425 | 3300048912 | Bacteria | 689 |
| 1049 | Ga0496110_0010802 | 3300048913 | Bacteria | 7444 |
| 1050 | Ga0496110_0037707 | 3300048913 | Bacteria | 4202 |
| 1051 | Ga0496110_0040292 | 3300048913 | Bacteria | 4071 |
| 1052 | Ga0496110_0098336 | 3300048913 | Bacteria | 2622 |
| 1053 | Ga0496110_0221888 | 3300048913 | Bacteria | 1719 |
| 1054 | Ga0496111_0001119 | 3300048914 | Bacteria | 14845 |
| 1055 | Ga0496111_0015406 | 3300048914 | Bacteria | 5246 |
| 1056 | Ga0496111_0028676 | 3300048914 | Bacteria | 3945 |
| 1057 | Ga0496111_0058890 | 3300048914 | Bacteria | 2782 |
| 1058 | Ga0496111_0076556 | 3300048914 | Bacteria | 2439 |
| 1059 | Ga0496111_0083111 | 3300048914 | Bacteria | 2339 |
| 1060 | Ga0496111_0316056 | 3300048914 | Unclassified | 1157 |
| 1061 | Ga0496112_0025093 | 3300048915 | Bacteria | 5719 |
| 1062 | Ga0496112_0031634 | 3300048915 | Bacteria | 5134 |
| 1063 | Ga0496112_0160371 | 3300048915 | Bacteria | 2215 |
| 1064 | Ga0496112_0236716 | 3300048915 | Bacteria | 1779 |
| 1065 | Ga0496112_0459464 | 3300048915 | Bacteria | 1211 |
| 1066 | Ga0496112_0772265 | 3300048915 | Bacteria | 886 |
| 1067 | Ga0496113_0011659 | 3300048916 | Bacteria | 5878 |
| 1068 | Ga0496113_0016164 | 3300048916 | Bacteria | 5150 |
| 1069 | Ga0496113_0039566 | 3300048916 | Bacteria | 3471 |
| 1070 | Ga0496113_0052053 | 3300048916 | Bacteria | 3056 |
| 1071 | Ga0496113_0156408 | 3300048916 | Bacteria | 1800 |
| 1072 | Ga0496113_0586832 | 3300048916 | Bacteria | 893 |
| 1073 | Ga0496114_0002293 | 3300048917 | Bacteria | 14586 |
| 1074 | Ga0496114_0025869 | 3300048917 | Bacteria | 4800 |
| 1075 | Ga0496114_0073119 | 3300048917 | Bacteria | 2885 |
| 1076 | Ga0496114_0098043 | 3300048917 | Bacteria | 2498 |
| 1077 | Ga0496114_0140291 | 3300048917 | Bacteria | 2092 |
| 1078 | Ga0496114_0316710 | 3300048917 | Unclassified | 1378 |
| 1079 | Ga0496114_0416582 | 3300048917 | Bacteria | 1190 |
| 1080 | Ga0496115_0000555 | 3300048918 | Bacteria | 28955 |
| 1081 | Ga0496115_0621896 | 3300048918 | Bacteria | 856 |
| 1082 | Ga0496115_0893869 | 3300048918 | Bacteria | 685 |
| 1083 | Ga0496121_0311994 | 3300048924 | Bacteria | 1063 |
| 1084 | Ga0496125_0070269 | 3300048928 | Bacteria | 2742 |
| 1085 | Ga0496126_0189842 | 3300048929 | Bacteria | 1741 |
| 1086 | Ga0501031_0176940 | 3300049568 | Bacteria | 1394 |
| 1087 | Ga0501031_0586636 | 3300049568 | Bacteria | 717 |
| 1088 | Ga0501032_0018358 | 3300049569 | Bacteria | 4901 |
| 1089 | Ga0501032_0022007 | 3300049569 | Bacteria | 4426 |
| 1090 | Ga0501032_0049179 | 3300049569 | Bacteria | 2845 |
| 1091 | Ga0501033_0043369 | 3300049570 | Bacteria | 3350 |
| 1092 | Ga0501033_0076636 | 3300049570 | Bacteria | 2454 |
| 1093 | Ga0501033_0105466 | 3300049570 | Bacteria | 2054 |
| 1094 | Ga0501033_0107356 | 3300049570 | Bacteria | 2033 |
| 1095 | Ga0501034_0013752 | 3300049571 | Bacteria | 8326 |
| 1096 | Ga0501034_0014156 | 3300049571 | Bacteria | 8221 |
| 1097 | Ga0501034_0117488 | 3300049571 | Bacteria | 2647 |
| 1098 | Ga0501034_0150606 | 3300049571 | Bacteria | 2302 |
| 1099 | Ga0501034_0222268 | 3300049571 | Bacteria | 1840 |
| 1100 | Ga0501034_0482236 | 3300049571 | Bacteria | 1155 |
| 1101 | Ga0501034_0681585 | 3300049571 | Bacteria | 927 |
| 1102 | Ga0501034_0799641 | 3300049571 | Bacteria | 836 |
| 1103 | Ga0501036_0010028 | 3300049572 | Bacteria | 7802 |
| 1104 | Ga0501036_0013440 | 3300049572 | Bacteria | 6803 |
| 1105 | Ga0501036_0019626 | 3300049572 | Bacteria | 5675 |
| 1106 | Ga0501036_0049311 | 3300049572 | Bacteria | 3565 |
| 1107 | Ga0501036_0065466 | 3300049572 | Bacteria | 3076 |
| 1108 | Ga0501036_0071369 | 3300049572 | Bacteria | 2936 |
| 1109 | Ga0501036_0086486 | 3300049572 | Bacteria | 2650 |
| 1110 | Ga0501036_0384233 | 3300049572 | Bacteria | 1171 |
| 1111 | Ga0501037_0001321 | 3300049573 | Bacteria | 18192 |
| 1112 | Ga0501037_0019708 | 3300049573 | Bacteria | 4975 |
| 1113 | Ga0501037_0069437 | 3300049573 | Bacteria | 2564 |
| 1114 | Ga0501037_0074084 | 3300049573 | Bacteria | 2474 |
| 1115 | Ga0501037_0081635 | 3300049573 | Bacteria | 2344 |
| 1116 | Ga0501037_0142083 | 3300049573 | Bacteria | 1717 |
| 1117 | Ga0501037_0232957 | 3300049573 | Bacteria | 1292 |
| 1118 | Ga0501038_0029854 | 3300049574 | Bacteria | 4829 |
| 1119 | Ga0501038_0038701 | 3300049574 | Bacteria | 4174 |
| 1120 | Ga0501038_0044940 | 3300049574 | Bacteria | 3835 |
| 1121 | Ga0501038_0111059 | 3300049574 | Bacteria | 2271 |
| 1122 | Ga0501038_0112471 | 3300049574 | Bacteria | 2254 |
| 1123 | Ga0501039_0001190 | 3300049575 | Bacteria | 19064 |
| 1124 | Ga0501039_0032632 | 3300049575 | Bacteria | 4015 |
| 1125 | Ga0501039_0044353 | 3300049575 | Bacteria | 3434 |
| 1126 | Ga0501039_0301854 | 3300049575 | Bacteria | 1259 |
| 1127 | Ga0501039_0482747 | 3300049575 | Bacteria | 973 |
| 1128 | Ga0501040_0154142 | 3300049576 | Bacteria | 1622 |
| 1129 | Ga0501040_0281254 | 3300049576 | Bacteria | 1188 |
| 1130 | Ga0501042_0051482 | 3300049578 | Bacteria | 2937 |
| 1131 | Ga0501043_0020670 | 3300049579 | Bacteria | 5164 |
| 1132 | Ga0501043_0047204 | 3300049579 | Bacteria | 3385 |
| 1133 | Ga0501043_0072857 | 3300049579 | Bacteria | 2698 |
| 1134 | Ga0501043_0104619 | 3300049579 | Bacteria | 2224 |
| 1135 | Ga0501043_0242311 | 3300049579 | Bacteria | 1390 |
| 1136 | Ga0501043_0543218 | 3300049579 | Bacteria | 864 |
| 1137 | Ga0501046_0001578 | 3300049580 | Bacteria | 21792 |
| 1138 | Ga0501046_0027771 | 3300049580 | Bacteria | 4614 |
| 1139 | Ga0501046_0031041 | 3300049580 | Bacteria | 4334 |
| 1140 | Ga0501046_0081896 | 3300049580 | Bacteria | 2493 |
| 1141 | Ga0501046_0178630 | 3300049580 | Bacteria | 1588 |
| 1142 | Ga0501047_0000097 | 3300049581 | Bacteria | 107310 |
| 1143 | Ga0501047_0016170 | 3300049581 | Bacteria | 7118 |
| 1144 | Ga0501047_0045497 | 3300049581 | Bacteria | 4244 |
| 1145 | Ga0501047_0089601 | 3300049581 | Bacteria | 2953 |
| 1146 | Ga0501047_0095548 | 3300049581 | Bacteria | 2851 |
| 1147 | Ga0501047_0104932 | 3300049581 | Bacteria | 2706 |
| 1148 | Ga0501047_0149076 | 3300049581 | Bacteria | 2215 |
| 1149 | Ga0501047_0759037 | 3300049581 | Bacteria | 786 |
| 1150 | Ga0501048_0004769 | 3300049582 | Bacteria | 10329 |
| 1151 | Ga0501048_0046977 | 3300049582 | Bacteria | 3081 |
| 1152 | Ga0501067_0030473 | 3300049583 | Bacteria | 2991 |
| 1153 | Ga0501067_0096206 | 3300049583 | Bacteria | 1644 |
| 1154 | Ga0501067_0195824 | 3300049583 | Bacteria | 1126 |
| 1155 | Ga0501067_0390500 | 3300049583 | Bacteria | 776 |
| 1156 | Ga0501068_0006872 | 3300049584 | Bacteria | 6290 |
| 1157 | Ga0501068_0049496 | 3300049584 | Bacteria | 2538 |
| 1158 | Ga0501068_0104129 | 3300049584 | Bacteria | 1760 |
| 1159 | Ga0501068_0121072 | 3300049584 | Bacteria | 1631 |
| 1160 | Ga0501069_0003295 | 3300049585 | Bacteria | 8283 |
| 1161 | Ga0501069_0011315 | 3300049585 | Bacteria | 4731 |
| 1162 | Ga0501069_0036424 | 3300049585 | Bacteria | 2713 |
| 1163 | Ga0501069_0044176 | 3300049585 | Bacteria | 2467 |
| 1164 | Ga0501069_0226999 | 3300049585 | Unclassified | 1086 |
| 1165 | Ga0501069_0324384 | 3300049585 | Bacteria | 905 |
| 1166 | Ga0501069_0511928 | 3300049585 | Bacteria | 716 |
| 1167 | Ga0501070_0002462 | 3300049586 | Bacteria | 16213 |
| 1168 | Ga0501070_0003261 | 3300049586 | Bacteria | 14076 |
| 1169 | Ga0501070_0017576 | 3300049586 | Bacteria | 6003 |
| 1170 | Ga0501070_0022871 | 3300049586 | Bacteria | 5232 |
| 1171 | Ga0501070_0060925 | 3300049586 | Bacteria | 3127 |
| 1172 | Ga0501070_0072668 | 3300049586 | Bacteria | 2847 |
| 1173 | Ga0501070_0081092 | 3300049586 | Bacteria | 2684 |
| 1174 | Ga0501070_0088575 | 3300049586 | Bacteria | 2561 |
| 1175 | Ga0501070_0199558 | 3300049586 | Bacteria | 1643 |
| 1176 | Ga0501070_0215957 | 3300049586 | Bacteria | 1573 |
| 1177 | Ga0501070_0318836 | 3300049586 | Bacteria | 1264 |
| 1178 | Ga0501071_0260194 | 3300049587 | Bacteria | 1310 |
| 1179 | Ga0501071_0326601 | 3300049587 | Bacteria | 1165 |
| 1180 | Ga0501072_0006089 | 3300049588 | Bacteria | 9204 |
| 1181 | Ga0501072_0072799 | 3300049588 | Bacteria | 2716 |
| 1182 | Ga0501072_0154996 | 3300049588 | Bacteria | 1827 |
| 1183 | Ga0501072_0232157 | 3300049588 | Bacteria | 1470 |
| 1184 | Ga0501072_0232199 | 3300049588 | Bacteria | 1469 |
| 1185 | Ga0501072_0323976 | 3300049588 | Bacteria | 1224 |
| 1186 | Ga0501073_0003934 | 3300049589 | Bacteria | 11142 |
| 1187 | Ga0501073_0022549 | 3300049589 | Bacteria | 4533 |
| 1188 | Ga0501073_0100936 | 3300049589 | Bacteria | 2003 |
| 1189 | Ga0501073_0104943 | 3300049589 | Bacteria | 1961 |
| 1190 | Ga0501073_0352479 | 3300049589 | Bacteria | 1016 |
| 1191 | Ga0501074_0001331 | 3300049590 | Bacteria | 16408 |
| 1192 | Ga0501074_0023893 | 3300049590 | Bacteria | 4441 |
| 1193 | Ga0501074_0229832 | 3300049590 | Bacteria | 1320 |
| 1194 | Ga0501074_0500580 | 3300049590 | Bacteria | 861 |
| 1195 | Ga0501074_0522756 | 3300049590 | Bacteria | 840 |
| 1196 | Ga0501074_0639260 | 3300049590 | Bacteria | 752 |
| 1197 | Ga0501075_0008104 | 3300049591 | Bacteria | 7308 |
| 1198 | Ga0501075_0412490 | 3300049591 | Bacteria | 1030 |
| 1199 | Ga0501076_0155075 | 3300049592 | Bacteria | 1864 |
| 1200 | Ga0501076_0176411 | 3300049592 | Bacteria | 1742 |
| 1201 | Ga0501076_0189720 | 3300049592 | Bacteria | 1677 |
| 1202 | Ga0501079_0010726 | 3300049741 | Bacteria | 6978 |
| 1203 | Ga0501079_0042958 | 3300049741 | Bacteria | 3489 |
| 1204 | Ga0501079_0127267 | 3300049741 | Bacteria | 1981 |
| 1205 | Ga0501079_0442615 | 3300049741 | Unclassified | 1020 |
| 1206 | Ga0501079_0783190 | 3300049741 | Bacteria | 751 |
| 1207 | Ga0501080_0002313 | 3300049742 | Bacteria | 16617 |
| 1208 | Ga0501080_0004411 | 3300049742 | Bacteria | 12507 |
| 1209 | Ga0501080_0010619 | 3300049742 | Bacteria | 8430 |
| 1210 | Ga0501080_0048533 | 3300049742 | Bacteria | 3951 |
| 1211 | Ga0501080_0134115 | 3300049742 | Bacteria | 2292 |
| 1212 | Ga0501080_0231106 | 3300049742 | Bacteria | 1690 |
| 1213 | Ga0501080_0763816 | 3300049742 | Bacteria | 849 |
| 1214 | Ga0501081_0080095 | 3300049743 | Bacteria | 2285 |
| 1215 | Ga0501083_0001106 | 3300049744 | Bacteria | 18055 |
| 1216 | Ga0501083_0006013 | 3300049744 | Bacteria | 8597 |
| 1217 | Ga0501083_0038410 | 3300049744 | Bacteria | 3255 |
| 1218 | Ga0501083_0045011 | 3300049744 | Bacteria | 2986 |
| 1219 | Ga0501083_0084581 | 3300049744 | Bacteria | 2100 |
| 1220 | Ga0501083_0092017 | 3300049744 | Bacteria | 2002 |
| 1221 | Ga0501083_0125462 | 3300049744 | Bacteria | 1683 |
| 1222 | Ga0501083_0220191 | 3300049744 | Bacteria | 1236 |
| 1223 | Ga0501083_0359423 | 3300049744 | Bacteria | 947 |
| 1224 | Ga0501035_0001208 | 3300049822 | Bacteria | 26922 |
| 1225 | Ga0501035_0068855 | 3300049822 | Bacteria | 3137 |
| 1226 | Ga0501035_0076330 | 3300049822 | Bacteria | 2963 |
| 1227 | Ga0501035_0089267 | 3300049822 | Bacteria | 2715 |
| 1228 | Ga0501035_0089650 | 3300049822 | Bacteria | 2708 |
| 1229 | Ga0501035_0095223 | 3300049822 | Bacteria | 2617 |
| 1230 | Ga0501035_0230473 | 3300049822 | Bacteria | 1578 |
| 1231 | Ga0501035_0507891 | 3300049822 | Bacteria | 992 |
| 1232 | Ga0501035_0612997 | 3300049822 | Unclassified | 886 |
| 1233 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 1234 | Ga0501044_0014471 | 3300049823 | Bacteria | 8515 |
| 1235 | Ga0501044_0015096 | 3300049823 | Bacteria | 8322 |
| 1236 | Ga0501044_0035639 | 3300049823 | Bacteria | 5209 |
| 1237 | Ga0501044_0160705 | 3300049823 | Bacteria | 2223 |
| 1238 | Ga0501044_0175894 | 3300049823 | Bacteria | 2109 |
| 1239 | Ga0501044_0203472 | 3300049823 | Bacteria | 1937 |
| 1240 | Ga0501044_0217052 | 3300049823 | Bacteria | 1864 |
| 1241 | Ga0501044_0221172 | 3300049823 | Bacteria | 1844 |
| 1242 | Ga0501044_0250283 | 3300049823 | Bacteria | 1713 |
| 1243 | Ga0501044_0255903 | 3300049823 | Bacteria | 1690 |
| 1244 | Ga0501044_0294724 | 3300049823 | Bacteria | 1553 |
| 1245 | Ga0501044_0335274 | 3300049823 | Bacteria | 1434 |
| 1246 | Ga0501044_0485728 | 3300049823 | Bacteria | 1137 |
| 1247 | Ga0501045_0300344 | 3300049824 | Bacteria | 1195 |
| 1248 | Ga0501045_0462292 | 3300049824 | Bacteria | 943 |
| 1249 | nmdc:mga03683_25708_c1 | 3300050489 | Bacteria | 2316 |
| 1250 | nmdc:mga03683_273157_c1 | 3300050489 | Bacteria | 789 |
| 1251 | nmdc:mga03683_290967_c1 | 3300050489 | Bacteria | 764 |
| 1252 | nmdc:mga03n38_197333_c1 | 3300050490 | Bacteria | 1040 |
| 1253 | nmdc:mga03n38_53308_c1 | 3300050490 | Bacteria | 1813 |
| 1254 | nmdc:mga03n38_92489_c1 | 3300050490 | Bacteria | 1443 |
| 1255 | nmdc:mga00v17_15479_c1 | 3300050491 | Bacteria | 4282 |
| 1256 | nmdc:mga00v17_194348_c1 | 3300050491 | Bacteria | 1311 |
| 1257 | nmdc:mga00v17_83871_c1 | 3300050491 | Bacteria | 1994 |
| 1258 | nmdc:mga0yw44_108357_c1 | 3300050492 | Bacteria | 1778 |
| 1259 | nmdc:mga0yw44_130963_c1 | 3300050492 | Bacteria | 1624 |
| 1260 | nmdc:mga0yw44_152501_c1 | 3300050492 | Bacteria | 1508 |
| 1261 | nmdc:mga0yw44_317650_c1 | 3300050492 | Bacteria | 1045 |
| 1262 | nmdc:mga0yw44_510539_c1 | 3300050492 | Bacteria | 816 |
| 1263 | nmdc:mga0yw44_627327_c1 | 3300050492 | Bacteria | 730 |
| 1264 | nmdc:mga0k408_183297_c1 | 3300050493 | Bacteria | 1249 |
| 1265 | nmdc:mga0k408_233645_c1 | 3300050493 | Bacteria | 1098 |
| 1266 | nmdc:mga0k408_35923_c1 | 3300050493 | Bacteria | 2842 |
| 1267 | nmdc:mga0k408_379677_c1 | 3300050493 | Unclassified | 842 |
| 1268 | nmdc:mga0k408_71818_c1 | 3300050493 | Bacteria | 2021 |
| 1269 | nmdc:mga0k408_79238_c1 | 3300050493 | Bacteria | 1922 |
| 1270 | nmdc:mga06z11_165746_c1 | 3300050494 | Bacteria | 1266 |
| 1271 | nmdc:mga06z11_35278_c1 | 3300050494 | Bacteria | 2461 |
| 1272 | nmdc:mga06z11_99859_c1 | 3300050494 | Bacteria | 1591 |
| 1273 | nmdc:mga04h51_126951_c1 | 3300050495 | Bacteria | 955 |
| 1274 | nmdc:mga04h51_91424_c1 | 3300050495 | Bacteria | 1096 |
| 1275 | nmdc:mga07m45_186668_c1 | 3300050496 | Unclassified | 1205 |
| 1276 | nmdc:mga07m45_42771_c1 | 3300050496 | Bacteria | 2540 |
| 1277 | nmdc:mga07m45_70339_c1 | 3300050496 | Bacteria | 1991 |
| 1278 | nmdc:mga07m45_88441_c1 | 3300050496 | Bacteria | 1773 |
| 1279 | nmdc:mga05p37_1161_c1 | 3300050507 | Bacteria | 30365 |
| 1280 | nmdc:mga05p37_24243_c1 | 3300050507 | Bacteria | 7372 |
| 1281 | nmdc:mga05p37_297_c2 | 3300050507 | Bacteria | 49814 |
| 1282 | nmdc:mga05p37_8484_c1 | 3300050507 | Bacteria | 12148 |
| 1283 | nmdc:mga05p37_887865_c1 | 3300050507 | Bacteria | 963 |
| 1284 | nmdc:mga09592_491832_c1 | 3300050508 | Bacteria | 1056 |
| 1285 | nmdc:mga09592_6161_c1 | 3300050508 | Bacteria | 9763 |
| 1286 | nmdc:mga0qj67_107823_c1 | 3300050509 | Bacteria | 2247 |
| 1287 | nmdc:mga0qj67_147863_c1 | 3300050509 | Bacteria | 1905 |
| 1288 | nmdc:mga0qj67_179542_c1 | 3300050509 | Bacteria | 1719 |
| 1289 | nmdc:mga0qj67_253_c1 | 3300050509 | Bacteria | 36631 |
| 1290 | nmdc:mga06r32_291_c1 | 3300050510 | Bacteria | 41746 |
| 1291 | nmdc:mga06r32_312135_c1 | 3300050510 | Bacteria | 1558 |
| 1292 | nmdc:mga06r32_62617_c1 | 3300050510 | Bacteria | 2687 |
| 1293 | nmdc:mga08y16_25205_c1 | 3300050511 | Bacteria | 6271 |
| 1294 | nmdc:mga08y16_3663_c1 | 3300050511 | Bacteria | 15989 |
| 1295 | nmdc:mga08y16_4177_c1 | 3300050511 | Bacteria | 15086 |
| 1296 | nmdc:mga0n895_414_c1 | 3300050512 | Bacteria | 28665 |
| 1297 | nmdc:mga0n895_55_c1 | 3300050512 | Bacteria | 66529 |
| 1298 | nmdc:mga0n895_65821_c1 | 3300050512 | Bacteria | 3588 |
| 1299 | nmdc:mga0n895_671972_c1 | 3300050512 | Bacteria | 1033 |
| 1300 | nmdc:mga0n895_6736_c1 | 3300050512 | Bacteria | 9799 |
| 1301 | nmdc:mga0rr50_102904_c1 | 3300050513 | Bacteria | 2247 |
| 1302 | nmdc:mga0rr50_287_c1 | 3300050513 | Bacteria | 27364 |
| 1303 | nmdc:mga0rr50_361054_c1 | 3300050513 | Bacteria | 1223 |
| 1304 | nmdc:mga0rr50_737643_c1 | 3300050513 | Bacteria | 841 |
| 1305 | nmdc:mga08x19_174640_c1 | 3300050514 | Bacteria | 1464 |
| 1306 | nmdc:mga08x19_193347_c1 | 3300050514 | Bacteria | 1393 |
| 1307 | nmdc:mga08x19_386789_c1 | 3300050514 | Unclassified | 980 |
| 1308 | nmdc:mga08x19_48177_c1 | 3300050514 | Bacteria | 2729 |
| 1309 | nmdc:mga0a205_12033_c1 | 3300050515 | Bacteria | 7992 |
| 1310 | nmdc:mga0a205_270738_c1 | 3300050515 | Bacteria | 1575 |
| 1311 | nmdc:mga0a205_5630_c2 | 3300050515 | Bacteria | 8326 |
| 1312 | nmdc:mga0a205_56970_c1 | 3300050515 | Bacteria | 3773 |
| 1313 | nmdc:mga0a205_751_c1 | 3300050515 | Bacteria | 26130 |
| 1314 | nmdc:mga0a205_854221_c1 | 3300050515 | Bacteria | 757 |
| 1315 | nmdc:mga0sz30_126332_c1 | 3300050516 | Bacteria | 1125 |
| 1316 | nmdc:mga0sz30_91382_c1 | 3300050516 | Bacteria | 1325 |
| 1317 | nmdc:mga0sz30_98813_c1 | 3300050516 | Bacteria | 1274 |
| 1318 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 1319 | Ga0495601_0001960 | 3300053077 | Bacteria | 11506 |
| 1320 | Ga0495601_0002392 | 3300053077 | Bacteria | 10646 |
| 1321 | Ga0495601_0029794 | 3300053077 | Bacteria | 3387 |
| 1322 | Ga0495601_0041192 | 3300053077 | Bacteria | 2894 |
| 1323 | Ga0495601_0145097 | 3300053077 | Bacteria | 1549 |
| 1324 | Ga0495612_0000035 | 3300053078 | Bacteria | 69194 |
| 1325 | Ga0495612_0002457 | 3300053078 | Bacteria | 7633 |
| 1326 | Ga0495612_0003876 | 3300053078 | Bacteria | 6204 |
| 1327 | Ga0495612_0083875 | 3300053078 | Bacteria | 1341 |
| 1328 | Ga0495612_0160152 | 3300053078 | Bacteria | 982 |
| 1329 | Ga0495595_0000032 | 3300053084 | Bacteria | 87066 |
| 1330 | Ga0495595_0002840 | 3300053084 | Bacteria | 6816 |
| 1331 | Ga0495595_0002854 | 3300053084 | Bacteria | 6807 |
| 1332 | Ga0495595_0003855 | 3300053084 | Bacteria | 5978 |
| 1333 | Ga0495595_0008849 | 3300053084 | Bacteria | 4146 |
| 1334 | Ga0495595_0009164 | 3300053084 | Bacteria | 4089 |
| 1335 | Ga0495619_0000033 | 3300053085 | Bacteria | 138925 |
| 1336 | Ga0495619_0000251 | 3300053085 | Bacteria | 38995 |
| 1337 | Ga0495619_0000387 | 3300053085 | Bacteria | 30124 |
| 1338 | Ga0495619_0003120 | 3300053085 | Bacteria | 10750 |
| 1339 | Ga0495619_0008062 | 3300053085 | Bacteria | 6667 |
| 1340 | Ga0495619_0013938 | 3300053085 | Bacteria | 5071 |
| 1341 | Ga0495619_0020105 | 3300053085 | Bacteria | 4248 |
| 1342 | Ga0495619_0102775 | 3300053085 | Bacteria | 1946 |
| 1343 | Ga0495619_0205035 | 3300053085 | Bacteria | 1365 |
| 1344 | Ga0500646_0041392 | 3300053090 | Bacteria | 1298 |
| 1345 | Ga0500651_0194553 | 3300053093 | Bacteria | 1199 |
| 1346 | Ga0500566_0062109 | 3300053094 | Bacteria | 2113 |
| 1347 | Ga0500641_0004241 | 3300053096 | Bacteria | 5059 |
| 1348 | Ga0500650_0091089 | 3300053098 | Bacteria | 1427 |
| 1349 | Ga0500650_0105665 | 3300053098 | Bacteria | 1316 |
| 1350 | Ga0500593_028759 | 3300053117 | Bacteria | 2484 |
| 1351 | Ga0500595_019470 | 3300053119 | Bacteria | 2462 |
| 1352 | Ga0500597_102659 | 3300053120 | Bacteria | 1243 |
| 1353 | Ga0500618_015665 | 3300053125 | Bacteria | 1911 |
| 1354 | Ga0500658_0036209 | 3300053134 | Bacteria | 1957 |
| 1355 | Ga0500658_0107998 | 3300053134 | Bacteria | 1222 |
| 1356 | Ga0500589_125727 | 3300053147 | Bacteria | 1079 |
| 1357 | Ga0500604_0005756 | 3300053151 | Bacteria | 3273 |
| 1358 | Ga0500639_122711 | 3300053163 | Bacteria | 1245 |
| 1359 | Ga0501084_0022961 | 3300054114 | Bacteria | 5207 |
| 1360 | Ga0501084_0041580 | 3300054114 | Bacteria | 3846 |
| 1361 | Ga0501084_0182986 | 3300054114 | Bacteria | 1769 |
| 1362 | Ga0501084_0553993 | 3300054114 | Bacteria | 971 |
| 1363 | Ga0501084_0751771 | 3300054114 | Bacteria | 821 |
| 1364 | Ga0501082_0000099 | 3300060353 | Bacteria | 66846 |
| 1365 | Ga0501082_0083620 | 3300060353 | Bacteria | 2753 |
| 1366 | Ga0501082_0086774 | 3300060353 | Bacteria | 2699 |
| 1367 | Ga0501082_0123872 | 3300060353 | Bacteria | 2241 |
| 1368 | Ga0501082_0202346 | 3300060353 | Bacteria | 1728 |
| 1369 | Ga0501082_0387569 | 3300060353 | Bacteria | 1219 |
| 1370 | Ga0265342_10132770 | |||
| 1371 | 2214884096 | |||
| 1372 | ARSoilYngRDRAFT_c00051 | |||
| 1373 | ARcpr5yngRDRAFT_c000050 | |||
| 1374 | ARSoilOldRDRAFT_c000022 | |||
| 1375 | ARCol0oldRDRAFT_c01626 | |||
| 1376 | ARCol0yngRDRAFT_1000073 | |||
| 1377 | JGI24752J21851_1003853 | |||
| 1378 | JGI24740J21852_10070600 | |||
| 1379 | JGI24739J22299_10000152 | |||
| 1380 | JGI24737J22298_10002832 | |||
| 1381 | JGI24737J22298_10004593 | |||
| 1382 | JGI24743J22301_10034317 | |||
| 1383 | JGI24750J21931_1000497 | |||
| 1384 | JGI24745J21846_1000135 | |||
| 1385 | JGI24748J21848_1016045 | |||
| 1386 | JGI24738J21930_10000005 | |||
| 1387 | JGI24035J26624_1000104 | |||
| 1388 | JGI24033J26618_1010213 | |||
| 1389 | JGI24034J26672_10000212 | |||
| 1390 | JGI24742J22300_10000282 | |||
| 1391 | JGI25405J52794_10018036 | |||
| 1392 | Ga0065717_1002242 | |||
| 1393 | Ga0065716_1003090 | |||
| 1394 | Ga0065704_10098357 | |||
| 1395 | Ga0065715_10001162 | |||
| 1396 | Ga0065707_10086712 | |||
| 1397 | Ga0070658_10569310 | |||
| 1398 | Ga0070676_10000789 | |||
| 1399 | Ga0070676_10181809 | |||
| 1400 | Ga0070683_100000345 | |||
| 1401 | Ga0070683_100037802 | |||
| 1402 | Ga0070683_100543651 | |||
| 1403 | Ga0070690_100007432 | |||
| 1404 | Ga0070690_100009716 | |||
| 1405 | Ga0070690_100029117 | |||
| 1406 | Ga0070670_100002853 | |||
| 1407 | Ga0070670_100016008 | |||
| 1408 | Ga0070677_10000389 | |||
| 1409 | Ga0068869_100001864 | |||
| 1410 | Ga0070666_10003359 | |||
| 1411 | Ga0070666_10083387 | |||
| 1412 | Ga0070666_10112241 | |||
| 1413 | Ga0070680_100005473 | |||
| 1414 | Ga0070680_100045189 | |||
| 1415 | Ga0070680_100057667 | |||
| 1416 | Ga0070680_100103413 | |||
| 1417 | Ga0070680_100561402 | |||
| 1418 | Ga0070682_100000458 | |||
| 1419 | Ga0070682_100055671 | |||
| 1420 | Ga0070682_100056130 | |||
| 1421 | Ga0070682_100421419 | |||
| 1422 | Ga0068868_100000376 | |||
| 1423 | Ga0068868_100007862 | |||
| 1424 | Ga0070660_100001420 | |||
| 1425 | Ga0070660_100114704 | |||
| 1426 | Ga0070660_100753926 | |||
| 1427 | Ga0070689_100001572 | |||
| 1428 | Ga0070689_100047448 | |||
| 1429 | Ga0070689_100071627 | |||
| 1430 | Ga0070691_10000417 | |||
| 1431 | Ga0070687_100002155 | |||
| 1432 | Ga0070687_100026445 | |||
| 1433 | Ga0070661_100001708 | |||
| 1434 | Ga0070661_100069114 | |||
| 1435 | Ga0070692_10000078 | |||
| 1436 | Ga0070692_10190271 | |||
| 1437 | Ga0070668_100001228 | |||
| 1438 | Ga0070668_100043794 | |||
| 1439 | Ga0070669_100184136 | |||
| 1440 | Ga0070675_100014644 | |||
| 1441 | Ga0070675_100033712 | |||
| 1442 | Ga0070671_100000318 | |||
| 1443 | Ga0070671_100030510 | |||
| 1444 | Ga0070671_100136225 | |||
| 1445 | Ga0070671_100321362 | |||
| 1446 | Ga0070674_100001672 | |||
| 1447 | Ga0070674_100050965 | |||
| 1448 | Ga0070673_100002621 | |||
| 1449 | Ga0070673_100029134 | |||
| 1450 | Ga0070688_100032747 | |||
| 1451 | Ga0070688_100092916 | |||
| 1452 | Ga0070688_100201125 | |||
| 1453 | Ga0070659_100001601 | |||
| 1454 | Ga0070659_100019430 | |||
| 1455 | Ga0070659_100280698 | |||
| 1456 | Ga0070659_100669145 | |||
| 1457 | Ga0070667_100011757 | |||
| 1458 | Ga0070667_100012018 | |||
| 1459 | Ga0070667_100281795 | |||
| 1460 | Ga0070703_10024965 | |||
| 1461 | Ga0070709_10017222 | |||
| 1462 | Ga0070709_10057723 | |||
| 1463 | Ga0070709_10182503 | |||
| 1464 | Ga0070709_10223477 | |||
| 1465 | Ga0070714_100010126 | |||
| 1466 | Ga0070714_100041394 | |||
| 1467 | Ga0070714_100166251 | |||
| 1468 | Ga0070714_100529146 | |||
| 1469 | Ga0070713_100000710 | |||
| 1470 | Ga0070713_100032534 | |||
| 1471 | Ga0070713_100238191 | |||
| 1472 | Ga0070713_100281561 | |||
| 1473 | Ga0070713_100340695 | |||
| 1474 | Ga0070713_101004187 | |||
| 1475 | Ga0070710_10027262 | |||
| 1476 | Ga0070710_10034348 | |||
| 1477 | Ga0070710_10107695 | |||
| 1478 | Ga0070710_10109762 | |||
| 1479 | Ga0070710_10632464 | |||
| 1480 | Ga0070701_10009667 | |||
| 1481 | Ga0070711_100021291 | |||
| 1482 | Ga0070711_100106124 | |||
| 1483 | Ga0070711_100113273 | |||
| 1484 | Ga0070711_100226304 | |||
| 1485 | Ga0070711_100447281 | |||
| 1486 | Ga0070711_100551017 | |||
| 1487 | Ga0070705_100036644 | |||
| 1488 | Ga0070705_100275498 | |||
| 1489 | Ga0070700_100000409 | |||
| 1490 | Ga0070700_100009173 | |||
| 1491 | Ga0070694_100000312 | |||
| 1492 | Ga0070694_100018197 | |||
| 1493 | Ga0070708_100008294 | |||
| 1494 | Ga0070708_100059520 | |||
| 1495 | Ga0070663_100003029 | |||
| 1496 | Ga0070663_100062150 | |||
| 1497 | Ga0070663_100163058 | |||
| 1498 | Ga0070678_100000673 | |||
| 1499 | Ga0070678_100004962 | |||
| 1500 | Ga0070678_100161406 | |||
| 1501 | Ga0070662_100007854 | |||
| 1502 | Ga0070662_100011704 | |||
| 1503 | Ga0070662_100016377 | |||
| 1504 | Ga0070662_100140229 | |||
| 1505 | Ga0070662_100152640 | |||
| 1506 | Ga0070681_10001501 | |||
| 1507 | Ga0070681_10075545 | |||
| 1508 | Ga0070681_10191407 | |||
| 1509 | Ga0068867_100002561 | |||
| 1510 | Ga0068867_100144121 | |||
| 1511 | Ga0070685_10005299 | |||
| 1512 | Ga0070685_10015300 | |||
| 1513 | Ga0074259_10502797 | |||
| 1514 | Ga0070699_100195961 | |||
| 1515 | Ga0070679_100013134 | |||
| 1516 | Ga0070679_100052092 | |||
| 1517 | Ga0070679_100083369 | |||
| 1518 | Ga0070679_100087329 | |||
| 1519 | Ga0070679_100271768 | |||
| 1520 | Ga0070679_100442946 | |||
| 1521 | Ga0070684_100004125 | |||
| 1522 | Ga0070684_100077133 | |||
| 1523 | Ga0070684_100146081 | |||
| 1524 | Ga0070684_100926518 | |||
| 1525 | Ga0070697_100035629 | |||
| 1526 | Ga0068853_100013239 | |||
| 1527 | Ga0068853_100173362 | |||
| 1528 | Ga0070672_100005118 | |||
| 1529 | Ga0070672_100107284 | |||
| 1530 | Ga0070672_100134976 | |||
| 1531 | Ga0070672_100484006 | |||
| 1532 | Ga0070686_100005340 | |||
| 1533 | Ga0070686_100007239 | |||
| 1534 | Ga0070686_100013534 | |||
| 1535 | Ga0070686_100078762 | |||
| 1536 | Ga0070695_100008421 | |||
| 1537 | Ga0070695_100009792 | |||
| 1538 | Ga0070695_100019616 | |||
| 1539 | Ga0070696_100028030 | |||
| 1540 | Ga0070693_100002738 | |||
| 1541 | Ga0070693_100056356 | |||
| 1542 | Ga0070693_100103731 | |||
| 1543 | Ga0070693_100175811 | |||
| 1544 | Ga0070665_100024095 | |||
| 1545 | Ga0070665_100165269 | |||
| 1546 | Ga0070665_100278670 | |||
| 1547 | Ga0070704_100002142 | |||
| 1548 | Ga0070704_100015966 | |||
| 1549 | Ga0070704_100192421 | |||
| 1550 | Ga0068855_100032409 | |||
| 1551 | Ga0068855_100092936 | |||
| 1552 | Ga0068855_100266048 | |||
| 1553 | Ga0070664_100014278 | |||
| 1554 | Ga0070664_100069690 | |||
| 1555 | Ga0070664_100092508 | |||
| 1556 | Ga0070664_100108267 | |||
| 1557 | Ga0070664_100582705 | |||
| 1558 | Ga0068857_100000914 | |||
| 1559 | Ga0068854_100002267 | |||
| 1560 | Ga0068854_100048079 | |||
| 1561 | Ga0068854_100078547 | |||
| 1562 | Ga0068854_100740311 | |||
| 1563 | Ga0068856_100007024 | |||
| 1564 | Ga0068856_100523114 | |||
| 1565 | Ga0070702_100000793 | |||
| 1566 | Ga0070702_100002584 | |||
| 1567 | Ga0068852_100001040 | |||
| 1568 | Ga0068852_100262634 | |||
| 1569 | Ga0068852_100381591 | |||
| 1570 | Ga0068859_100023516 | |||
| 1571 | Ga0068859_100030436 | |||
| 1572 | Ga0068859_100135137 | |||
| 1573 | Ga0068864_100278578 | |||
| 1574 | Ga0068866_10000678 | |||
| 1575 | Ga0068866_10018817 | |||
| 1576 | Ga0068861_100008814 | |||
| 1577 | Ga0068861_100155615 | |||
| 1578 | Ga0068861_100273868 | |||
| 1579 | Ga0068870_10000128 | |||
| 1580 | Ga0068863_100006135 | |||
| 1581 | Ga0068858_100007003 | |||
| 1582 | Ga0068858_100047337 | |||
| 1583 | Ga0068858_100118536 | |||
| 1584 | Ga0068858_100693015 | |||
| 1585 | Ga0068860_100009283 | |||
| 1586 | Ga0068860_100068439 | |||
| 1587 | Ga0068860_100199942 | |||
| 1588 | Ga0068860_100238943 | |||
| 1589 | Ga0068862_100016288 | |||
| 1590 | Ga0068862_100017378 | |||
| 1591 | Ga0068862_100094435 | |||
| 1592 | Ga0081455_10000002 | |||
| 1593 | Ga0081539_10004600 | |||
| 1594 | Ga0070717_10010516 | |||
| 1595 | Ga0070717_10120647 | |||
| 1596 | Ga0070717_10385584 | |||
| 1597 | Ga0070717_10843028 | |||
| 1598 | Ga0075365_10023018 | |||
| 1599 | Ga0075365_10077480 | |||
| 1600 | Ga0075365_10153741 | |||
| 1601 | Ga0075368_10030936 | |||
| 1602 | Ga0075368_10074340 | |||
| 1603 | Ga0075368_10197687 | |||
| 1604 | Ga0075363_100000153 | |||
| 1605 | Ga0075363_100033492 | |||
| 1606 | Ga0075363_100113245 | |||
| 1607 | Ga0075364_10016915 | |||
| 1608 | Ga0075364_10150300 | |||
| 1609 | Ga0075364_10214845 | |||
| 1610 | Ga0075432_10023026 | |||
| 1611 | Ga0070715_10002587 | |||
| 1612 | Ga0070715_10011751 | |||
| 1613 | Ga0070716_100001066 | |||
| 1614 | Ga0070716_100072370 | |||
| 1615 | Ga0070716_100135383 | |||
| 1616 | Ga0070716_100184281 | |||
| 1617 | Ga0070712_100004156 | |||
| 1618 | Ga0070712_100102761 | |||
| 1619 | Ga0070712_100221273 | |||
| 1620 | Ga0070712_100513202 | |||
| 1621 | Ga0070712_100553397 | |||
| 1622 | Ga0070712_100556362 | |||
| 1623 | Ga0075362_10048986 | |||
| 1624 | Ga0075362_10148314 | |||
| 1625 | Ga0075367_10001743 | |||
| 1626 | Ga0075367_10034925 | |||
| 1627 | Ga0075367_10050268 | |||
| 1628 | Ga0075367_10207935 | |||
| 1629 | Ga0075369_10044202 | |||
| 1630 | Ga0075369_10047165 | |||
| 1631 | Ga0075369_10073228 | |||
| 1632 | Ga0075366_10024680 | |||
| 1633 | Ga0075366_10093845 | |||
| 1634 | Ga0075366_10292852 | |||
| 1635 | Ga0097621_100000012 | |||
| 1636 | Ga0097621_100028523 | |||
| 1637 | Ga0075370_10045220 | |||
| 1638 | Ga0068871_100000414 | |||
| 1639 | Ga0068871_100005222 | |||
| 1640 | Ga0068871_100285219 | |||
| 1641 | Ga0075428_100022143 | |||
| 1642 | Ga0075428_100067815 | |||
| 1643 | Ga0075430_100002500 | |||
| 1644 | Ga0075430_100220682 | |||
| 1645 | Ga0075431_100002000 | |||
| 1646 | Ga0075431_100084389 | |||
| 1647 | Ga0075431_100212752 | |||
| 1648 | Ga0075433_10000266 | |||
| 1649 | Ga0075433_10018274 | |||
| 1650 | Ga0075433_10042901 | |||
| 1651 | Ga0075433_10206114 | |||
| 1652 | Ga0075434_100001246 | |||
| 1653 | Ga0075434_100112067 | |||
| 1654 | Ga0075434_100146399 | |||
| 1655 | Ga0075434_100822656 | |||
| 1656 | Ga0075429_100004558 | |||
| 1657 | Ga0068865_100000908 | |||
| 1658 | Ga0068865_100015582 | |||
| 1659 | Ga0068865_100038460 | |||
| 1660 | Ga0068865_100362440 | |||
| 1661 | Ga0075436_100027941 | |||
| 1662 | Ga0075436_100042615 | |||
| 1663 | Ga0075436_100541502 | |||
| 1664 | Ga0097620_100023517 | |||
| 1665 | Ga0097620_100030437 | |||
| 1666 | Ga0097620_100135136 | |||
| 1667 | Ga0075435_100113776 | |||
| 1668 | Ga0099794_10052650 | |||
| 1669 | Ga0099795_10000474 | |||
| 1670 | Ga0099795_10001475 | |||
| 1671 | Ga0099795_10044959 | |||
| 1672 | Ga0105251_10012277 | |||
| 1673 | Ga0105244_10046632 | |||
| 1674 | Ga0105240_10355352 | |||
| 1675 | Ga0111539_10000789 | |||
| 1676 | Ga0111539_10003667 | |||
| 1677 | Ga0111539_10007702 | |||
| 1678 | Ga0111539_10847240 | |||
| 1679 | Ga0105245_10000090 | |||
| 1680 | Ga0105245_10036809 | |||
| 1681 | Ga0105245_10125110 | |||
| 1682 | Ga0105245_10270904 | |||
| 1683 | Ga0105247_10019166 | |||
| 1684 | Ga0105247_10028955 | |||
| 1685 | Ga0105247_10351708 | |||
| 1686 | Ga0114129_10000759 | |||
| 1687 | Ga0114129_10000935 | |||
| 1688 | Ga0114129_10001106 | |||
| 1689 | Ga0114129_10012544 | |||
| 1690 | Ga0114129_10327630 | |||
| 1691 | Ga0105243_10012301 | |||
| 1692 | Ga0105243_10024101 | |||
| 1693 | Ga0105243_10096735 | |||
| 1694 | Ga0105243_10164939 | |||
| 1695 | Ga0105243_10246329 | |||
| 1696 | Ga0105241_10000475 | |||
| 1697 | Ga0105241_10041065 | |||
| 1698 | Ga0105241_10261358 | |||
| 1699 | Ga0105242_10001283 | |||
| 1700 | Ga0105242_10088313 | |||
| 1701 | Ga0105242_10195863 | |||
| 1702 | Ga0105248_10003064 | |||
| 1703 | Ga0105248_10004418 | |||
| 1704 | Ga0105248_10052163 | |||
| 1705 | Ga0105248_10054127 | |||
| 1706 | Ga0105237_10002267 | |||
| 1707 | Ga0105237_10063894 | |||
| 1708 | Ga0105237_10256956 | |||
| 1709 | Ga0105238_10014956 | |||
| 1710 | Ga0105238_10135288 | |||
| 1711 | Ga0105238_10169659 | |||
| 1712 | Ga0105249_10001598 | |||
| 1713 | Ga0105249_10006092 | |||
| 1714 | Ga0099796_10008093 | |||
| 1715 | Ga0099796_10009211 | |||
| 1716 | Ga0099796_10116167 | |||
| 1717 | Ga0105239_10040255 | |||
| 1718 | Ga0105239_10075253 | |||
| 1719 | Ga0105239_10086997 | |||
| 1720 | Ga0105239_10334173 | |||
| 1721 | Ga0105239_10345543 | |||
| 1722 | Ga0105239_10645853 | |||
| 1723 | Ga0105246_10000263 | |||
| 1724 | Ga0105246_10006118 | |||
| 1725 | Ga0105246_10377905 | |||
| 1726 | Ga0105246_10551415 | |||
| 1727 | Ga0157336_1001178 | |||
| 1728 | Ga0157338_1000265 | |||
| 1729 | Ga0157338_1003263 | |||
| 1730 | Ga0157373_10036753 | |||
| 1731 | Ga0157373_10112782 | |||
| 1732 | Ga0157373_10159106 | |||
| 1733 | Ga0157370_10191223 | |||
| 1734 | Ga0157370_11154039 | |||
| 1735 | Ga0157369_10090227 | |||
| 1736 | Ga0157369_10654245 | |||
| 1737 | Ga0157374_10001375 | |||
| 1738 | Ga0157374_10039168 | |||
| 1739 | Ga0157378_10002550 | |||
| 1740 | Ga0157378_10163109 | |||
| 1741 | Ga0157378_10343036 | |||
| 1742 | Ga0157378_10381652 | |||
| 1743 | Ga0163162_10003792 | |||
| 1744 | Ga0163162_10124338 | |||
| 1745 | Ga0163162_10258535 | |||
| 1746 | Ga0163162_10345808 | |||
| 1747 | Ga0157372_10002994 | |||
| 1748 | Ga0157372_10723475 | |||
| 1749 | Ga0157375_10002382 | |||
| 1750 | Ga0157375_10049561 | |||
| 1751 | Ga0157375_10257396 | |||
| 1752 | Ga0157375_10376400 | |||
| 1753 | Ga0163163_10005972 | |||
| 1754 | Ga0163163_10012135 | |||
| 1755 | Ga0163163_10060221 | |||
| 1756 | Ga0163163_10238388 | |||
| 1757 | Ga0163163_10249667 | |||
| 1758 | Ga0157380_10000334 | |||
| 1759 | Ga0157380_10256043 | |||
| 1760 | Ga0157380_10634620 | |||
| 1761 | Ga0182008_10089621 | |||
| 1762 | Ga0182008_10137748 | |||
| 1763 | Ga0157377_10000249 | |||
| 1764 | Ga0157379_10002491 | |||
| 1765 | Ga0157379_10004645 | |||
| 1766 | Ga0157379_10032788 | |||
| 1767 | Ga0157379_10080789 | |||
| 1768 | Ga0157379_10366325 | |||
| 1769 | Ga0157379_10903552 | |||
| 1770 | Ga0157376_10000709 | |||
| 1771 | Ga0163161_10001471 | |||
| 1772 | Ga0163161_10029438 | |||
| 1773 | Ga0206356_11022321 | |||
| 1774 | Ga0206354_10431128 | |||
| 1775 | Ga0206353_11650777 | |||
| 1776 | Ga0213873_10051055 | |||
| 1777 | Ga0213876_10012865 | |||
| 1778 | Ga0213875_10001038 | |||
| 1779 | Ga0213875_10126003 | |||
| 1780 | Ga0224572_1008206 | |||
| 1781 | Ga0207666_1000082 | |||
| 1782 | Ga0207697_10000161 | |||
| 1783 | Ga0207713_1041495 | |||
| 1784 | Ga0207653_10001232 | |||
| 1785 | Ga0207682_10000164 | |||
| 1786 | Ga0207692_10042252 | |||
| 1787 | Ga0207692_10059553 | |||
| 1788 | Ga0207692_10147407 | |||
| 1789 | Ga0207642_10019418 | |||
| 1790 | Ga0207642_10021457 | |||
| 1791 | Ga0207710_10002813 | |||
| 1792 | Ga0207710_10018005 | |||
| 1793 | Ga0207710_10031411 | |||
| 1794 | Ga0207710_10050295 | |||
| 1795 | Ga0207688_10000426 | |||
| 1796 | Ga0207680_10014769 | |||
| 1797 | Ga0207680_10060489 | |||
| 1798 | Ga0207647_10011699 | |||
| 1799 | Ga0207685_10001775 | |||
| 1800 | Ga0207685_10013502 | |||
| 1801 | Ga0207685_10355443 | |||
| 1802 | Ga0207699_10000275 | |||
| 1803 | Ga0207699_10060094 | |||
| 1804 | Ga0207699_10131654 | |||
| 1805 | Ga0207645_10000040 | |||
| 1806 | Ga0207645_10014304 | |||
| 1807 | Ga0207643_10000082 | |||
| 1808 | Ga0207643_10000750 | |||
| 1809 | Ga0207684_10310295 | |||
| 1810 | Ga0207654_10000364 | |||
| 1811 | Ga0207654_10127504 | |||
| 1812 | Ga0207707_10002424 | |||
| 1813 | Ga0207707_10016579 | |||
| 1814 | Ga0207707_10054633 | |||
| 1815 | Ga0207707_10107336 | |||
| 1816 | Ga0207671_10032680 | |||
| 1817 | Ga0207671_10116273 | |||
| 1818 | Ga0207671_10161800 | |||
| 1819 | Ga0207693_10002367 | |||
| 1820 | Ga0207693_10013224 | |||
| 1821 | Ga0207693_10017977 | |||
| 1822 | Ga0207693_10056924 | |||
| 1823 | Ga0207693_10067970 | |||
| 1824 | Ga0207693_10089041 | |||
| 1825 | Ga0207693_10105425 | |||
| 1826 | Ga0207693_10183144 | |||
| 1827 | Ga0207693_10677103 | |||
| 1828 | Ga0207663_10074137 | |||
| 1829 | Ga0207663_10099291 | |||
| 1830 | Ga0207663_10362735 | |||
| 1831 | Ga0207663_10424390 | |||
| 1832 | Ga0207660_10000501 | |||
| 1833 | Ga0207660_10127848 | |||
| 1834 | Ga0207660_10167268 | |||
| 1835 | Ga0207662_10017111 | |||
| 1836 | Ga0207662_10023074 | |||
| 1837 | Ga0207662_10180226 | |||
| 1838 | Ga0207657_10002764 | |||
| 1839 | Ga0207657_10010052 | |||
| 1840 | Ga0207657_10077166 | |||
| 1841 | Ga0207657_10739332 | |||
| 1842 | Ga0207649_10000788 | |||
| 1843 | Ga0207649_10016023 | |||
| 1844 | Ga0207649_10596315 | |||
| 1845 | Ga0207652_10001134 | |||
| 1846 | Ga0207652_10133910 | |||
| 1847 | Ga0207652_10143177 | |||
| 1848 | Ga0207652_10195510 | |||
| 1849 | Ga0207652_10232500 | |||
| 1850 | Ga0207652_10403886 | |||
| 1851 | Ga0207652_10633740 | |||
| 1852 | Ga0207681_10000539 | |||
| 1853 | Ga0207681_10021987 | |||
| 1854 | Ga0207681_10161404 | |||
| 1855 | Ga0207694_10046184 | |||
| 1856 | Ga0207694_10050997 | |||
| 1857 | Ga0207650_10003116 | |||
| 1858 | Ga0207650_10037200 | |||
| 1859 | Ga0207659_10004978 | |||
| 1860 | Ga0207659_10361746 | |||
| 1861 | Ga0207687_10000063 | |||
| 1862 | Ga0207687_10036981 | |||
| 1863 | Ga0207687_10095015 | |||
| 1864 | Ga0207700_10026176 | |||
| 1865 | Ga0207700_10050726 | |||
| 1866 | Ga0207664_10010544 | |||
| 1867 | Ga0207664_10019573 | |||
| 1868 | Ga0207664_10057615 | |||
| 1869 | Ga0207664_10454080 | |||
| 1870 | Ga0207664_10506287 | |||
| 1871 | Ga0207664_10661178 | |||
| 1872 | Ga0207644_10000661 | |||
| 1873 | Ga0207644_10020596 | |||
| 1874 | Ga0207644_10030764 | |||
| 1875 | Ga0207644_10294034 | |||
| 1876 | Ga0207690_10000086 | |||
| 1877 | Ga0207690_10212058 | |||
| 1878 | Ga0207690_10256511 | |||
| 1879 | Ga0207690_10842393 | |||
| 1880 | Ga0207706_10003958 | |||
| 1881 | Ga0207706_10019107 | |||
| 1882 | Ga0207706_10067950 | |||
| 1883 | Ga0207706_10219645 | |||
| 1884 | Ga0207686_10001237 | |||
| 1885 | Ga0207686_10032689 | |||
| 1886 | Ga0207686_10066692 | |||
| 1887 | Ga0207709_10001095 | |||
| 1888 | Ga0207709_10007340 | |||
| 1889 | Ga0207709_10077073 | |||
| 1890 | Ga0207709_10176057 | |||
| 1891 | Ga0207709_10255942 | |||
| 1892 | Ga0207670_10000264 | |||
| 1893 | Ga0207670_10028387 | |||
| 1894 | Ga0207670_10051836 | |||
| 1895 | Ga0207670_10627693 | |||
| 1896 | Ga0207669_10000228 | |||
| 1897 | Ga0207669_10319972 | |||
| 1898 | Ga0207704_10000107 | |||
| 1899 | Ga0207704_10514038 | |||
| 1900 | Ga0207704_10595501 | |||
| 1901 | Ga0207665_10001144 | |||
| 1902 | Ga0207665_10025689 | |||
| 1903 | Ga0207665_10075455 | |||
| 1904 | Ga0207665_10105964 | |||
| 1905 | Ga0207665_10162140 | |||
| 1906 | Ga0207691_10001173 | |||
| 1907 | Ga0207711_10004273 | |||
| 1908 | Ga0207711_10010016 | |||
| 1909 | Ga0207711_10012191 | |||
| 1910 | Ga0207711_10121548 | |||
| 1911 | Ga0207689_10001082 | |||
| 1912 | Ga0207689_10006586 | |||
| 1913 | Ga0207689_10056888 | |||
| 1914 | Ga0207689_10292184 | |||
| 1915 | Ga0207689_10710609 | |||
| 1916 | Ga0207661_10000427 | |||
| 1917 | Ga0207661_10026073 | |||
| 1918 | Ga0207679_10000025 | |||
| 1919 | Ga0207679_10023259 | |||
| 1920 | Ga0207679_10028536 | |||
| 1921 | Ga0207679_10200275 | |||
| 1922 | Ga0207667_10006928 | |||
| 1923 | Ga0207667_10107291 | |||
| 1924 | Ga0207667_10143339 | |||
| 1925 | Ga0207651_10000081 | |||
| 1926 | Ga0207651_10031143 | |||
| 1927 | Ga0207651_10089598 | |||
| 1928 | Ga0207712_10000587 | |||
| 1929 | Ga0207712_10016688 | |||
| 1930 | Ga0207712_10486848 | |||
| 1931 | Ga0207668_10000171 | |||
| 1932 | Ga0207668_10432370 | |||
| 1933 | Ga0207640_10001295 | |||
| 1934 | Ga0207640_10600266 | |||
| 1935 | Ga0207658_10000940 | |||
| 1936 | Ga0207658_10280767 | |||
| 1937 | Ga0207677_10000447 | |||
| 1938 | Ga0207677_10159668 | |||
| 1939 | Ga0207703_10006213 | |||
| 1940 | Ga0207703_10046398 | |||
| 1941 | Ga0207703_10103564 | |||
| 1942 | Ga0207703_10150161 | |||
| 1943 | Ga0207703_10272642 | |||
| 1944 | Ga0207639_10002609 | |||
| 1945 | Ga0207639_10174325 | |||
| 1946 | Ga0207639_10300242 | |||
| 1947 | Ga0207678_10001776 | |||
| 1948 | Ga0207678_10005212 | |||
| 1949 | Ga0207678_10028617 | |||
| 1950 | Ga0207708_10016652 | |||
| 1951 | Ga0207708_10095246 | |||
| 1952 | Ga0207708_10150438 | |||
| 1953 | Ga0207702_10006918 | |||
| 1954 | Ga0207641_10001385 | |||
| 1955 | Ga0207641_10043317 | |||
| 1956 | Ga0207641_10408057 | |||
| 1957 | Ga0207648_10009579 | |||
| 1958 | Ga0207648_10033875 | |||
| 1959 | Ga0207648_10150837 | |||
| 1960 | Ga0207676_10321496 | |||
| 1961 | Ga0207674_10001963 | |||
| 1962 | Ga0207675_100002289 | |||
| 1963 | Ga0207675_100135825 | |||
| 1964 | Ga0207675_100216990 | |||
| 1965 | Ga0207683_10000001 | |||
| 1966 | Ga0207683_10002852 | |||
| 1967 | Ga0207683_10011167 | |||
| 1968 | Ga0207698_10002904 | |||
| 1969 | Ga0207698_10125797 | |||
| 1970 | Ga0209996_1020260 | |||
| 1971 | Ga0209179_1002173 | |||
| 1972 | Ga0209970_1010235 | |||
| 1973 | Ga0210002_1000477 | |||
| 1974 | Ga0209983_1005766 | |||
| 1975 | Ga0209971_1003482 | |||
| 1976 | Ga0209966_1002279 | |||
| 1977 | Ga0209998_10002493 | |||
| 1978 | Ga0209998_10004176 | |||
| 1979 | Ga0209813_10040428 | |||
| 1980 | Ga0209974_10011302 | |||
| 1981 | Ga0207428_10000374 | |||
| 1982 | Ga0207428_10001279 | |||
| 1983 | Ga0207428_10017457 | |||
| 1984 | Ga0207428_10130847 | |||
| 1985 | Ga0268266_10116643 | |||
| 1986 | Ga0268266_10212572 | |||
| 1987 | Ga0268266_10229055 | |||
| 1988 | Ga0268266_10376224 | |||
| 1989 | Ga0268265_10001152 | |||
| 1990 | Ga0268265_10014239 | |||
| 1991 | Ga0268264_10000886 | |||
| 1992 | Ga0268264_10154596 | |||
| 1993 | Ga0268264_10710467 | |||
| 1994 | Ga0265337_1001260 | |||
| 1995 | Ga0265338_10153739 | |||
| 1996 | Ga0265763_1000997 | |||
| 1997 | Ga0265760_10019333 | |||
| 1998 | Ga0265760_10021981 | |||
| 1999 | Ga0265330_10038621 | |||
| 2000 | Ga0265320_10053242 | |||
| 2001 | Ga0265325_10000011 | |||
| 2002 | Ga0265325_10002889 | |||
| 2003 | Ga0265325_10004936 | |||
| 2004 | Ga0265329_10042690 | |||
| 2005 | Ga0265340_10061084 | |||
| 2006 | Ga0265339_10002208 | |||
| 2007 | Ga0265339_10055723 | |||
| 2008 | Ga0265316_10209794 | |||
| 2009 | Ga0265313_10000227 | |||
| 2010 | Ga0265313_10002423 | |||
| 2011 | Ga0265313_10007892 | |||
| 2012 | Ga0265313_10052765 | |||
| 2013 | Ga0265313_10057902 | |||
| 2014 | Ga0265314_10020734 | |||
| 2015 | Ga0265342_10138943 | |||
| 2016 | Ga0307416_100396456 | |||
| 2017 | Ga0307416_100954069 | |||
| 2018 | Ga0373930_0002579 | |||
| 2019 | Ga0373930_0057112 | |||
| 2020 | Ga0373948_0001453 | |||
| 2021 | Ga0373950_0000698 | |||
| 2022 | Ga0373958_0000496 | |||
| 2023 | Ga0373958_0004383 | |||
| 2024 | Ga0373958_0004490 | |||
| 2025 | Ga0373959_0000900 | |||
| 2026 | Ga0373959_0006325 | |||
| 2027 | Ga0373938_0000064 | |||
| 2028 | Ga0373926_0015325 | |||
| 2029 | Ga0373926_0060684 | |||
| 2030 | Ga0373926_0140441 | |||
| 2031 | Ga0373928_0001083 | |||
| 2032 | Ga0373928_0001329 | |||
| 2033 | Ga0373929_0001708 | |||
| 2034 | Ga0373929_0038124 | |||
| 2035 | Ga0373934_0010064 | |||
| 2036 | Ga0373934_0015074 | |||
| 2037 | Ga0373934_0020229 | |||
| 2038 | Ga0373940_0000741 | |||
| 2039 | Ga0373940_0053493 | |||
| 2040 | Ga0373944_0000426 | |||
| 2041 | Ga0373949_0001039 | |||
| 2042 | Ga0373949_0001645 | |||
| 2043 | Ga0373951_0001036 | |||
| 2044 | Ga0373951_0007532 | |||
| 2045 | Ga0373952_0000019 | |||
| 2046 | Ga0373923_0000926 | |||
| 2047 | Ga0373923_0001563 | |||
| 2048 | Ga0373923_0031870 | |||
| 2049 | Ga0373923_0108990 | |||
| 2050 | Ga0373923_0165073 | |||
| 2051 | Ga0373932_0000203 | |||
| 2052 | Ga0373932_0002660 | |||
| 2053 | Ga0373932_0006928 | |||
| 2054 | Ga0373936_0002444 | |||
| 2055 | Ga0373936_0040063 | |||
| 2056 | Ga0373936_0059016 | |||
| 2057 | Ga0373936_0062037 | |||
| 2058 | Ga0373936_0327149 | |||
| 2059 | Ga0373939_0000216 | |||
| 2060 | Ga0373939_0000614 | |||
| 2061 | Ga0373939_0001103 | |||
| 2062 | Ga0373939_0051795 | |||
| 2063 | Ga0373939_0125008 | |||
| 2064 | Ga0373941_0000089 | |||
| 2065 | Ga0373941_0000816 | |||
| 2066 | Ga0373945_0002033 | |||
| 2067 | Ga0373945_0012501 | |||
| 2068 | Ga0373945_0016756 | |||
| 2069 | Ga0373945_0062139 | |||
| 2070 | Ga0373945_0139161 | |||
| 2071 | Ga0373953_0000743 | |||
| 2072 | Ga0373954_0003246 | |||
| 2073 | Ga0373954_0045519 | |||
| 2074 | Ga0373956_0016548 | |||
| 2075 | Ga0373956_0025533 | |||
| 2076 | Ga0373957_0001000 | |||
| 2077 | Ga0373957_0048794 | |||
| 2078 | Ga0373960_0000120 | |||
| 2079 | Ga0373960_0003816 | |||
| 2080 | Ga0373960_0046541 | |||
| 2081 | Ga0373943_0003686 | |||
| 2082 | Ga0373943_0005206 | |||
| 2083 | Ga0373943_0005890 | |||
| 2084 | Ga0373943_0016094 | |||
| 2085 | Ga0373943_0282313 | |||
| 2086 | Ga0373943_0489836 | |||
| 2087 | Ga0373946_0000588 | |||
| 2088 | Ga0373946_0009609 | |||
| 2089 | Ga0373946_0033194 | |||
| 2090 | Ga0373946_0048825 | |||
| 2091 | Ga0373955_0000346 | |||
| 2092 | Ga0373955_0008157 | |||
| 2093 | Ga0373955_0010230 | |||
| 2094 | Ga0373942_0000091 | |||
| 2095 | Ga0373942_0006030 | |||
| 2096 | Ga0373942_0007527 | |||
| 2097 | Ga0373961_0002565 | |||
| 2098 | Ga0373961_0009679 | |||
| 2099 | Ga0373961_0036687 | |||
| 2100 | Ga0373961_0045368 | |||
| 2101 | Ga0373962_0001149 | |||
| 2102 | Ga0373962_0001769 | |||
| 2103 | Ga0373962_0017275 | |||
| 2104 | Ga0373962_0032945 | |||
| 2105 | Ga0373962_0085939 | |||
| 2106 | Ga0373924_0015064 | |||
| 2107 | Ga0373924_0020705 | |||
| 2108 | Ga0373924_0026419 | |||
| 2109 | Ga0373924_0045388 | |||
| 2110 | Ga0373924_0093103 | |||
| 2111 | Ga0373931_0000168 | |||
| 2112 | Ga0373931_0038386 | |||
| 2113 | Ga0373931_0237170 | |||
| 2114 | Ga0373935_0000056 | |||
| 2115 | Ga0373935_0001750 | |||
| 2116 | Ga0373935_0002094 | |||
| 2117 | Ga0373935_0032978 | |||
| 2118 | Ga0373927_0005062 | |||
| 2119 | Ga0373927_0024702 | |||
| 2120 | Ga0373927_0069714 | |||
| 2121 | Ga0373927_0090568 | |||
| 2122 | Ga0373927_0093348 | |||
| 2123 | Ga0373927_0581643 | |||
| 2124 | Ga0373933_0001375 | |||
| 2125 | Ga0373933_0017583 | |||
| 2126 | Ga0373933_0028287 | |||
| 2127 | Ga0373933_0052227 | |||
| 2128 | Ga0373947_0006017 | |||
| 2129 | Ga0373947_0007138 | |||
| 2130 | Ga0373947_0040038 | |||
| 2131 | Ga0373947_0073319 | |||
| 2132 | Ga0373947_0090595 | |||
| 2133 | Ga0373947_0144846 | |||
| 2134 | Ga0373947_0375588 | |||
| 2135 | Ga0373947_0451118 | |||
| 2136 | Ga0373937_0000075 | |||
| 2137 | Ga0373937_0003559 | |||
| 2138 | Ga0373937_0039296 | |||
| 2139 | Ga0373937_0039734 | |||
| 2140 | Ga0373937_0245499 | |||
| 2141 | Ga0373937_0471933 | |||
| 2142 | Ga0373937_0948632 | |||
| 2143 | Ga0316582_0657727 | |||
| 2144 | Ga0373925_0000159 | |||
| 2145 | Ga0373925_0005248 | |||
| 2146 | Ga0373925_0020282 | |||
| 2147 | Ga0373925_0105716 | |||
| 2148 | Ga0373925_0170443 | |||
| 2149 | Ga0373925_0263453 | |||
| 2150 | Ga0373925_0395669 | |||
| 2151 | Ga0395899_0002776 | |||
| 2152 | Ga0395900_0013269 | |||
| 2153 | Ga0395900_0159376 | |||
| 2154 | Ga0395898_0050530 | |||
| 2155 | Ga0395898_0116321 | |||
| 2156 | Ga0316581_0069847 | |||
| 2157 | Ga0436364_0886464 | |||
| 2158 | Ga0436364_0997940 | |||
| 2159 | Ga0395901_0057068 | |||
| 2160 | Ga0395901_0265968 | |||
| 2161 | Ga0395901_0469618 | |||
| 2162 | Ga0395901_0713321 | |||
| 2163 | Ga0242419_000904 | |||
| 2164 | Ga0436365_0079668 | |||
| 2165 | Ga0436365_1050212 | |||
| 2166 | Ga0436365_1264309 | |||
| 2167 | Ga0436365_1681640 | |||
| 2168 | Ga0436365_1831839 | |||
| 2169 | Ga0436362_0355750 | |||
| 2170 | Ga0439453_0000098 | |||
| 2171 | Ga0439441_025059 | |||
| 2172 | Ga0439443_002753 | |||
| 2173 | Ga0439459_0004853 | |||
| 2174 | Ga0439464_0035635 | |||
| 2175 | Ga0450893_0014891 | |||
| 2176 | Ga0451577_0527500 | |||
| 2177 | Ga0466966_0021960 | |||
| 2178 | Ga0466966_0029521 | |||
| 2179 | Ga0466963_0025471 | |||
| 2180 | Ga0466957_0019160 | |||
| 2181 | Ga0466957_0035351 | |||
| 2182 | Ga0466957_0763336 | |||
| 2183 | Ga0466959_0078122 | |||
| 2184 | Ga0466959_0494177 | |||
| 2185 | Ga0451576_0004687 | |||
| 2186 | Ga0466958_0112429 | |||
| 2187 | Ga0466958_0613596 | |||
| 2188 | Ga0466967_0752311 | |||
| 2189 | Ga0495617_030533 | |||
| 2190 | Ga0495592_0000102 | |||
| 2191 | Ga0495592_0002255 | |||
| 2192 | Ga0495592_0016006 | |||
| 2193 | Ga0495603_0015609 | |||
| 2194 | Ga0495603_0143252 | |||
| 2195 | Ga0495629_0002525 | |||
| 2196 | Ga0495629_0080260 | |||
| 2197 | Ga0495629_0094527 | |||
| 2198 | Ga0495629_0210372 | |||
| 2199 | Ga0495641_0011998 | |||
| 2200 | Ga0495641_0052847 | |||
| 2201 | Ga0495651_0002426 | |||
| 2202 | Ga0495651_0008311 | |||
| 2203 | Ga0495651_0017925 | |||
| 2204 | Ga0495651_0072284 | |||
| 2205 | Ga0495651_0248591 | |||
| 2206 | Ga0495653_0000036 | |||
| 2207 | Ga0495653_0003952 | |||
| 2208 | Ga0495653_0052697 | |||
| 2209 | Ga0495653_0074651 | |||
| 2210 | Ga0495653_0237077 | |||
| 2211 | Ga0495582_0023871 | |||
| 2212 | Ga0495582_0044190 | |||
| 2213 | Ga0495582_0163050 | |||
| 2214 | Ga0495639_0103935 | |||
| 2215 | Ga0495639_0314688 | |||
| 2216 | Ga0495662_0004822 | |||
| 2217 | Ga0495664_0000016 | |||
| 2218 | Ga0495664_0005777 | |||
| 2219 | Ga0495664_0019048 | |||
| 2220 | Ga0495664_0056167 | |||
| 2221 | Ga0495664_0115721 | |||
| 2222 | Ga0495584_0015063 | |||
| 2223 | Ga0495585_0000942 | |||
| 2224 | Ga0495594_0020125 | |||
| 2225 | Ga0495594_0061382 | |||
| 2226 | Ga0495594_0117293 | |||
| 2227 | Ga0495594_0195566 | |||
| 2228 | Ga0495596_0029807 | |||
| 2229 | Ga0495607_0003642 | |||
| 2230 | Ga0495608_0000006 | |||
| 2231 | Ga0495608_0035566 | |||
| 2232 | Ga0495608_0039938 | |||
| 2233 | Ga0495618_0000057 | |||
| 2234 | Ga0495618_0002927 | |||
| 2235 | Ga0495618_0099320 | |||
| 2236 | Ga0495618_0102720 | |||
| 2237 | Ga0495618_0186483 | |||
| 2238 | Ga0495628_0000018 | |||
| 2239 | Ga0495628_0000249 | |||
| 2240 | Ga0495628_0014559 | |||
| 2241 | Ga0495628_0104111 | |||
| 2242 | Ga0495630_0001707 | |||
| 2243 | Ga0495630_0049852 | |||
| 2244 | Ga0495631_0041216 | |||
| 2245 | Ga0495644_0018613 | |||
| 2246 | Ga0495644_0046857 | |||
| 2247 | Ga0495652_0000005 | |||
| 2248 | Ga0495652_0002812 | |||
| 2249 | Ga0495652_0009180 | |||
| 2250 | Ga0495652_0159452 | |||
| 2251 | Ga0495665_0030633 | |||
| 2252 | Ga0495640_0000007 | |||
| 2253 | Ga0495640_0089236 | |||
| 2254 | Ga0495640_0166213 | |||
| 2255 | Ga0495640_0186394 | |||
| 2256 | Ga0495586_0077330 | |||
| 2257 | Ga0495586_0078797 | |||
| 2258 | Ga0495587_0000043 | |||
| 2259 | Ga0495587_0012089 | |||
| 2260 | Ga0495587_0086700 | |||
| 2261 | Ga0495587_0102643 | |||
| 2262 | Ga0495598_0052538 | |||
| 2263 | Ga0495609_0044373 | |||
| 2264 | Ga0495609_0063914 | |||
| 2265 | Ga0495621_0184312 | |||
| 2266 | Ga0495645_0000064 | |||
| 2267 | Ga0495645_0002732 | |||
| 2268 | Ga0495645_0030598 | |||
| 2269 | Ga0495645_0175050 | |||
| 2270 | Ga0495622_0001295 | |||
| 2271 | Ga0495633_0004471 | |||
| 2272 | Ga0495667_0000023 | |||
| 2273 | Ga0495667_0001004 | |||
| 2274 | Ga0495667_0008379 | |||
| 2275 | Ga0495667_0026475 | |||
| 2276 | Ga0495667_0096648 | |||
| 2277 | Ga0495667_0208415 | |||
| 2278 | Ga0495656_0000250 | |||
| 2279 | Ga0495668_0053370 | |||
| 2280 | Ga0495668_0110590 | |||
| 2281 | Ga0495634_0000049 | |||
| 2282 | Ga0495634_0070587 | |||
| 2283 | Ga0495634_0082016 | |||
| 2284 | Ga0495634_0288157 | |||
| 2285 | Ga0495635_0000021 | |||
| 2286 | Ga0495635_0036447 | |||
| 2287 | Ga0495635_0059659 | |||
| 2288 | Ga0495635_0176175 | |||
| 2289 | Ga0495659_0000752 | |||
| 2290 | Ga0495588_0018063 | |||
| 2291 | Ga0495588_0034826 | |||
| 2292 | Ga0495588_0081897 | |||
| 2293 | Ga0495657_0000063 | |||
| 2294 | Ga0495657_0015263 | |||
| 2295 | Ga0495657_0042230 | |||
| 2296 | Ga0495657_0121060 | |||
| 2297 | Ga0495599_0000001 | |||
| 2298 | Ga0495599_0001983 | |||
| 2299 | Ga0495599_0002159 | |||
| 2300 | Ga0495623_0000056 | |||
| 2301 | Ga0495623_0004071 | |||
| 2302 | Ga0495623_0529622 | |||
| 2303 | Ga0495646_0000007 | |||
| 2304 | Ga0495646_0001094 | |||
| 2305 | Ga0495646_0038956 | |||
| 2306 | Ga0495647_0002557 | |||
| 2307 | Ga0495647_0005728 | |||
| 2308 | Ga0495647_0010007 | |||
| 2309 | Ga0495658_0003031 | |||
| 2310 | Ga0495658_0056211 | |||
| 2311 | Ga0495658_0076432 | |||
| 2312 | Ga0495658_0255577 | |||
| 2313 | Ga0495658_0317447 | |||
| 2314 | Ga0495669_0069895 | |||
| 2315 | Ga0495613_0092810 | |||
| 2316 | Ga0495613_0340618 | |||
| 2317 | Ga0495624_0014420 | |||
| 2318 | Ga0495624_0167583 | |||
| 2319 | Ga0495670_0013601 | |||
| 2320 | Ga0495671_0047424 | |||
| 2321 | Ga0495589_0024843 | |||
| 2322 | Ga0495600_0000047 | |||
| 2323 | Ga0495600_0005271 | |||
| 2324 | Ga0495600_0007955 | |||
| 2325 | Ga0495600_0061175 | |||
| 2326 | Ga0495600_0066971 | |||
| 2327 | Ga0495600_0125448 | |||
| 2328 | Ga0495581_0005315 | |||
| 2329 | Ga0495581_0471817 | |||
| 2330 | Ga0495604_0000014 | |||
| 2331 | Ga0495604_0002860 | |||
| 2332 | Ga0495604_0019689 | |||
| 2333 | Ga0495604_0020290 | |||
| 2334 | Ga0495604_0026478 | |||
| 2335 | Ga0495674_0000014 | |||
| 2336 | Ga0495674_0020761 | |||
| 2337 | Ga0495674_0041589 | |||
| 2338 | Ga0495674_0099531 | |||
| 2339 | Ga0495674_0107360 | |||
| 2340 | Ga0495674_0126338 | |||
| 2341 | Ga0495674_0192917 | |||
| 2342 | Ga0495676_0083050 | |||
| 2343 | Ga0495676_0086661 | |||
| 2344 | Ga0495676_0117897 | |||
| 2345 | Ga0495676_0138968 | |||
| 2346 | Ga0495680_0000744 | |||
| 2347 | Ga0495680_0004614 | |||
| 2348 | Ga0495680_0007483 | |||
| 2349 | Ga0495680_0015155 | |||
| 2350 | Ga0495680_0111656 | |||
| 2351 | Ga0495675_0000819 | |||
| 2352 | Ga0495675_0000940 | |||
| 2353 | Ga0495675_0015252 | |||
| 2354 | Ga0495679_035192 | |||
| 2355 | Ga0495685_031018 | |||
| 2356 | Ga0495684_0000757 | |||
| 2357 | Ga0495684_0047628 | |||
| 2358 | Ga0495684_0195157 | |||
| 2359 | Ga0495593_0001967 | |||
| 2360 | Ga0495593_0017135 | |||
| 2361 | Ga0495593_0060655 | |||
| 2362 | Ga0495593_0060803 | |||
| 2363 | Ga0495602_0000017 | |||
| 2364 | Ga0495602_0003833 | |||
| 2365 | Ga0496100_0000503 | |||
| 2366 | Ga0496100_0020825 | |||
| 2367 | Ga0496100_0021327 | |||
| 2368 | Ga0496101_0000510 | |||
| 2369 | Ga0496101_0001758 | |||
| 2370 | Ga0496101_0092988 | |||
| 2371 | Ga0496102_0003114 | |||
| 2372 | Ga0496102_0039249 | |||
| 2373 | Ga0496102_0040466 | |||
| 2374 | Ga0496102_0151063 | |||
| 2375 | Ga0496102_0247296 | |||
| 2376 | Ga0496103_0002544 | |||
| 2377 | Ga0496103_0018730 | |||
| 2378 | Ga0496103_0065264 | |||
| 2379 | Ga0496103_0395675 | |||
| 2380 | Ga0496104_0000232 | |||
| 2381 | Ga0496104_0017224 | |||
| 2382 | Ga0496104_0029835 | |||
| 2383 | Ga0496104_0155041 | |||
| 2384 | Ga0496104_0953143 | |||
| 2385 | Ga0496105_0000238 | |||
| 2386 | Ga0496105_0000539 | |||
| 2387 | Ga0496105_0001838 | |||
| 2388 | Ga0496105_0015132 | |||
| 2389 | Ga0496105_0140656 | |||
| 2390 | Ga0496105_0162921 | |||
| 2391 | Ga0496106_0000327 | |||
| 2392 | Ga0496106_0012909 | |||
| 2393 | Ga0496106_0016509 | |||
| 2394 | Ga0496106_0069998 | |||
| 2395 | Ga0496106_0210441 | |||
| 2396 | Ga0496107_0000143 | |||
| 2397 | Ga0496107_0032474 | |||
| 2398 | Ga0496107_0070876 | |||
| 2399 | Ga0496107_0096841 | |||
| 2400 | Ga0496107_0139722 | |||
| 2401 | Ga0496107_0305769 | |||
| 2402 | Ga0496107_0313027 | |||
| 2403 | Ga0496108_0002170 | |||
| 2404 | Ga0496108_0004957 | |||
| 2405 | Ga0496108_0037339 | |||
| 2406 | Ga0496108_0472488 | |||
| 2407 | Ga0496108_0718729 | |||
| 2408 | Ga0496108_1075104 | |||
| 2409 | Ga0496109_0000372 | |||
| 2410 | Ga0496109_0001114 | |||
| 2411 | Ga0496109_0002579 | |||
| 2412 | Ga0496109_0028420 | |||
| 2413 | Ga0496109_0235058 | |||
| 2414 | Ga0496109_0278861 | |||
| 2415 | Ga0496109_0503311 | |||
| 2416 | Ga0496109_0658085 | |||
| 2417 | Ga0496109_1217425 | |||
| 2418 | Ga0496110_0010802 | |||
| 2419 | Ga0496110_0037707 | |||
| 2420 | Ga0496110_0040292 | |||
| 2421 | Ga0496110_0098336 | |||
| 2422 | Ga0496110_0221888 | |||
| 2423 | Ga0496111_0001119 | |||
| 2424 | Ga0496111_0015406 | |||
| 2425 | Ga0496111_0028676 | |||
| 2426 | Ga0496111_0058890 | |||
| 2427 | Ga0496111_0076556 | |||
| 2428 | Ga0496111_0083111 | |||
| 2429 | Ga0496111_0316056 | |||
| 2430 | Ga0496112_0025093 | |||
| 2431 | Ga0496112_0031634 | |||
| 2432 | Ga0496112_0160371 | |||
| 2433 | Ga0496112_0236716 | |||
| 2434 | Ga0496112_0459464 | |||
| 2435 | Ga0496112_0772265 | |||
| 2436 | Ga0496113_0011659 | |||
| 2437 | Ga0496113_0016164 | |||
| 2438 | Ga0496113_0039566 | |||
| 2439 | Ga0496113_0052053 | |||
| 2440 | Ga0496113_0156408 | |||
| 2441 | Ga0496113_0586832 | |||
| 2442 | Ga0496114_0002293 | |||
| 2443 | Ga0496114_0025869 | |||
| 2444 | Ga0496114_0073119 | |||
| 2445 | Ga0496114_0098043 | |||
| 2446 | Ga0496114_0140291 | |||
| 2447 | Ga0496114_0316710 | |||
| 2448 | Ga0496114_0416582 | |||
| 2449 | Ga0496115_0000555 | |||
| 2450 | Ga0496115_0621896 | |||
| 2451 | Ga0496115_0893869 | |||
| 2452 | Ga0496121_0311994 | |||
| 2453 | Ga0496125_0070269 | |||
| 2454 | Ga0496126_0189842 | |||
| 2455 | Ga0501031_0176940 | |||
| 2456 | Ga0501031_0586636 | |||
| 2457 | Ga0501032_0018358 | |||
| 2458 | Ga0501032_0022007 | |||
| 2459 | Ga0501032_0049179 | |||
| 2460 | Ga0501033_0043369 | |||
| 2461 | Ga0501033_0076636 | |||
| 2462 | Ga0501033_0105466 | |||
| 2463 | Ga0501033_0107356 | |||
| 2464 | Ga0501034_0013752 | |||
| 2465 | Ga0501034_0014156 | |||
| 2466 | Ga0501034_0117488 | |||
| 2467 | Ga0501034_0150606 | |||
| 2468 | Ga0501034_0222268 | |||
| 2469 | Ga0501034_0482236 | |||
| 2470 | Ga0501034_0681585 | |||
| 2471 | Ga0501034_0799641 | |||
| 2472 | Ga0501036_0010028 | |||
| 2473 | Ga0501036_0013440 | |||
| 2474 | Ga0501036_0019626 | |||
| 2475 | Ga0501036_0049311 | |||
| 2476 | Ga0501036_0065466 | |||
| 2477 | Ga0501036_0071369 | |||
| 2478 | Ga0501036_0086486 | |||
| 2479 | Ga0501036_0384233 | |||
| 2480 | Ga0501037_0001321 | |||
| 2481 | Ga0501037_0019708 | |||
| 2482 | Ga0501037_0069437 | |||
| 2483 | Ga0501037_0074084 | |||
| 2484 | Ga0501037_0081635 | |||
| 2485 | Ga0501037_0142083 | |||
| 2486 | Ga0501037_0232957 | |||
| 2487 | Ga0501038_0029854 | |||
| 2488 | Ga0501038_0038701 | |||
| 2489 | Ga0501038_0044940 | |||
| 2490 | Ga0501038_0111059 | |||
| 2491 | Ga0501038_0112471 | |||
| 2492 | Ga0501039_0001190 | |||
| 2493 | Ga0501039_0032632 | |||
| 2494 | Ga0501039_0044353 | |||
| 2495 | Ga0501039_0301854 | |||
| 2496 | Ga0501039_0482747 | |||
| 2497 | Ga0501040_0154142 | |||
| 2498 | Ga0501040_0281254 | |||
| 2499 | Ga0501042_0051482 | |||
| 2500 | Ga0501043_0020670 | |||
| 2501 | Ga0501043_0047204 | |||
| 2502 | Ga0501043_0072857 | |||
| 2503 | Ga0501043_0104619 | |||
| 2504 | Ga0501043_0242311 | |||
| 2505 | Ga0501043_0543218 | |||
| 2506 | Ga0501046_0001578 | |||
| 2507 | Ga0501046_0027771 | |||
| 2508 | Ga0501046_0031041 | |||
| 2509 | Ga0501046_0081896 | |||
| 2510 | Ga0501046_0178630 | |||
| 2511 | Ga0501047_0000097 | |||
| 2512 | Ga0501047_0016170 | |||
| 2513 | Ga0501047_0045497 | |||
| 2514 | Ga0501047_0089601 | |||
| 2515 | Ga0501047_0095548 | |||
| 2516 | Ga0501047_0104932 | |||
| 2517 | Ga0501047_0149076 | |||
| 2518 | Ga0501047_0759037 | |||
| 2519 | Ga0501048_0004769 | |||
| 2520 | Ga0501048_0046977 | |||
| 2521 | Ga0501067_0030473 | |||
| 2522 | Ga0501067_0096206 | |||
| 2523 | Ga0501067_0195824 | |||
| 2524 | Ga0501067_0390500 | |||
| 2525 | Ga0501068_0006872 | |||
| 2526 | Ga0501068_0049496 | |||
| 2527 | Ga0501068_0104129 | |||
| 2528 | Ga0501068_0121072 | |||
| 2529 | Ga0501069_0003295 | |||
| 2530 | Ga0501069_0011315 | |||
| 2531 | Ga0501069_0036424 | |||
| 2532 | Ga0501069_0044176 | |||
| 2533 | Ga0501069_0226999 | |||
| 2534 | Ga0501069_0324384 | |||
| 2535 | Ga0501069_0511928 | |||
| 2536 | Ga0501070_0002462 | |||
| 2537 | Ga0501070_0003261 | |||
| 2538 | Ga0501070_0017576 | |||
| 2539 | Ga0501070_0022871 | |||
| 2540 | Ga0501070_0060925 | |||
| 2541 | Ga0501070_0072668 | |||
| 2542 | Ga0501070_0081092 | |||
| 2543 | Ga0501070_0088575 | |||
| 2544 | Ga0501070_0199558 | |||
| 2545 | Ga0501070_0215957 | |||
| 2546 | Ga0501070_0318836 | |||
| 2547 | Ga0501071_0260194 | |||
| 2548 | Ga0501071_0326601 | |||
| 2549 | Ga0501072_0006089 | |||
| 2550 | Ga0501072_0072799 | |||
| 2551 | Ga0501072_0154996 | |||
| 2552 | Ga0501072_0232157 | |||
| 2553 | Ga0501072_0232199 | |||
| 2554 | Ga0501072_0323976 | |||
| 2555 | Ga0501073_0003934 | |||
| 2556 | Ga0501073_0022549 | |||
| 2557 | Ga0501073_0100936 | |||
| 2558 | Ga0501073_0104943 | |||
| 2559 | Ga0501073_0352479 | |||
| 2560 | Ga0501074_0001331 | |||
| 2561 | Ga0501074_0023893 | |||
| 2562 | Ga0501074_0229832 | |||
| 2563 | Ga0501074_0500580 | |||
| 2564 | Ga0501074_0522756 | |||
| 2565 | Ga0501074_0639260 | |||
| 2566 | Ga0501075_0008104 | |||
| 2567 | Ga0501075_0412490 | |||
| 2568 | Ga0501076_0155075 | |||
| 2569 | Ga0501076_0176411 | |||
| 2570 | Ga0501076_0189720 | |||
| 2571 | Ga0501079_0010726 | |||
| 2572 | Ga0501079_0042958 | |||
| 2573 | Ga0501079_0127267 | |||
| 2574 | Ga0501079_0442615 | |||
| 2575 | Ga0501079_0783190 | |||
| 2576 | Ga0501080_0002313 | |||
| 2577 | Ga0501080_0004411 | |||
| 2578 | Ga0501080_0010619 | |||
| 2579 | Ga0501080_0048533 | |||
| 2580 | Ga0501080_0134115 | |||
| 2581 | Ga0501080_0231106 | |||
| 2582 | Ga0501080_0763816 | |||
| 2583 | Ga0501081_0080095 | |||
| 2584 | Ga0501083_0001106 | |||
| 2585 | Ga0501083_0006013 | |||
| 2586 | Ga0501083_0038410 | |||
| 2587 | Ga0501083_0045011 | |||
| 2588 | Ga0501083_0084581 | |||
| 2589 | Ga0501083_0092017 | |||
| 2590 | Ga0501083_0125462 | |||
| 2591 | Ga0501083_0220191 | |||
| 2592 | Ga0501083_0359423 | |||
| 2593 | Ga0501035_0001208 | |||
| 2594 | Ga0501035_0068855 | |||
| 2595 | Ga0501035_0076330 | |||
| 2596 | Ga0501035_0089267 | |||
| 2597 | Ga0501035_0089650 | |||
| 2598 | Ga0501035_0095223 | |||
| 2599 | Ga0501035_0230473 | |||
| 2600 | Ga0501035_0507891 | |||
| 2601 | Ga0501035_0612997 | |||
| 2602 | Ga0501044_0000122 | |||
| 2603 | Ga0501044_0014471 | |||
| 2604 | Ga0501044_0015096 | |||
| 2605 | Ga0501044_0035639 | |||
| 2606 | Ga0501044_0160705 | |||
| 2607 | Ga0501044_0175894 | |||
| 2608 | Ga0501044_0203472 | |||
| 2609 | Ga0501044_0217052 | |||
| 2610 | Ga0501044_0221172 | |||
| 2611 | Ga0501044_0250283 | |||
| 2612 | Ga0501044_0255903 | |||
| 2613 | Ga0501044_0294724 | |||
| 2614 | Ga0501044_0335274 | |||
| 2615 | Ga0501044_0485728 | |||
| 2616 | Ga0501045_0300344 | |||
| 2617 | Ga0501045_0462292 | |||
| 2618 | nmdc:mga03683_25708_c1 | |||
| 2619 | nmdc:mga03683_273157_c1 | |||
| 2620 | nmdc:mga03683_290967_c1 | |||
| 2621 | nmdc:mga03n38_197333_c1 | |||
| 2622 | nmdc:mga03n38_53308_c1 | |||
| 2623 | nmdc:mga03n38_92489_c1 | |||
| 2624 | nmdc:mga00v17_15479_c1 | |||
| 2625 | nmdc:mga00v17_194348_c1 | |||
| 2626 | nmdc:mga00v17_83871_c1 | |||
| 2627 | nmdc:mga0yw44_108357_c1 | |||
| 2628 | nmdc:mga0yw44_130963_c1 | |||
| 2629 | nmdc:mga0yw44_152501_c1 | |||
| 2630 | nmdc:mga0yw44_317650_c1 | |||
| 2631 | nmdc:mga0yw44_510539_c1 | |||
| 2632 | nmdc:mga0yw44_627327_c1 | |||
| 2633 | nmdc:mga0k408_183297_c1 | |||
| 2634 | nmdc:mga0k408_233645_c1 | |||
| 2635 | nmdc:mga0k408_35923_c1 | |||
| 2636 | nmdc:mga0k408_379677_c1 | |||
| 2637 | nmdc:mga0k408_71818_c1 | |||
| 2638 | nmdc:mga0k408_79238_c1 | |||
| 2639 | nmdc:mga06z11_165746_c1 | |||
| 2640 | nmdc:mga06z11_35278_c1 | |||
| 2641 | nmdc:mga06z11_99859_c1 | |||
| 2642 | nmdc:mga04h51_126951_c1 | |||
| 2643 | nmdc:mga04h51_91424_c1 | |||
| 2644 | nmdc:mga07m45_186668_c1 | |||
| 2645 | nmdc:mga07m45_42771_c1 | |||
| 2646 | nmdc:mga07m45_70339_c1 | |||
| 2647 | nmdc:mga07m45_88441_c1 | |||
| 2648 | nmdc:mga05p37_1161_c1 | |||
| 2649 | nmdc:mga05p37_24243_c1 | |||
| 2650 | nmdc:mga05p37_297_c2 | |||
| 2651 | nmdc:mga05p37_8484_c1 | |||
| 2652 | nmdc:mga05p37_887865_c1 | |||
| 2653 | nmdc:mga09592_491832_c1 | |||
| 2654 | nmdc:mga09592_6161_c1 | |||
| 2655 | nmdc:mga0qj67_107823_c1 | |||
| 2656 | nmdc:mga0qj67_147863_c1 | |||
| 2657 | nmdc:mga0qj67_179542_c1 | |||
| 2658 | nmdc:mga0qj67_253_c1 | |||
| 2659 | nmdc:mga06r32_291_c1 | |||
| 2660 | nmdc:mga06r32_312135_c1 | |||
| 2661 | nmdc:mga06r32_62617_c1 | |||
| 2662 | nmdc:mga08y16_25205_c1 | |||
| 2663 | nmdc:mga08y16_3663_c1 | |||
| 2664 | nmdc:mga08y16_4177_c1 | |||
| 2665 | nmdc:mga0n895_414_c1 | |||
| 2666 | nmdc:mga0n895_55_c1 | |||
| 2667 | nmdc:mga0n895_65821_c1 | |||
| 2668 | nmdc:mga0n895_671972_c1 | |||
| 2669 | nmdc:mga0n895_6736_c1 | |||
| 2670 | nmdc:mga0rr50_102904_c1 | |||
| 2671 | nmdc:mga0rr50_287_c1 | |||
| 2672 | nmdc:mga0rr50_361054_c1 | |||
| 2673 | nmdc:mga0rr50_737643_c1 | |||
| 2674 | nmdc:mga08x19_174640_c1 | |||
| 2675 | nmdc:mga08x19_193347_c1 | |||
| 2676 | nmdc:mga08x19_386789_c1 | |||
| 2677 | nmdc:mga08x19_48177_c1 | |||
| 2678 | nmdc:mga0a205_12033_c1 | |||
| 2679 | nmdc:mga0a205_270738_c1 | |||
| 2680 | nmdc:mga0a205_5630_c2 | |||
| 2681 | nmdc:mga0a205_56970_c1 | |||
| 2682 | nmdc:mga0a205_751_c1 | |||
| 2683 | nmdc:mga0a205_854221_c1 | |||
| 2684 | nmdc:mga0sz30_126332_c1 | |||
| 2685 | nmdc:mga0sz30_91382_c1 | |||
| 2686 | nmdc:mga0sz30_98813_c1 | |||
| 2687 | Ga0495601_0000016 | |||
| 2688 | Ga0495601_0001960 | |||
| 2689 | Ga0495601_0002392 | |||
| 2690 | Ga0495601_0029794 | |||
| 2691 | Ga0495601_0041192 | |||
| 2692 | Ga0495601_0145097 | |||
| 2693 | Ga0495612_0000035 | |||
| 2694 | Ga0495612_0002457 | |||
| 2695 | Ga0495612_0003876 | |||
| 2696 | Ga0495612_0083875 | |||
| 2697 | Ga0495612_0160152 | |||
| 2698 | Ga0495595_0000032 | |||
| 2699 | Ga0495595_0002840 | |||
| 2700 | Ga0495595_0002854 | |||
| 2701 | Ga0495595_0003855 | |||
| 2702 | Ga0495595_0008849 | |||
| 2703 | Ga0495595_0009164 | |||
| 2704 | Ga0495619_0000033 | |||
| 2705 | Ga0495619_0000251 | |||
| 2706 | Ga0495619_0000387 | |||
| 2707 | Ga0495619_0003120 | |||
| 2708 | Ga0495619_0008062 | |||
| 2709 | Ga0495619_0013938 | |||
| 2710 | Ga0495619_0020105 | |||
| 2711 | Ga0495619_0102775 | |||
| 2712 | Ga0495619_0205035 | |||
| 2713 | Ga0500646_0041392 | |||
| 2714 | Ga0500651_0194553 | |||
| 2715 | Ga0500566_0062109 | |||
| 2716 | Ga0500641_0004241 | |||
| 2717 | Ga0500650_0091089 | |||
| 2718 | Ga0500650_0105665 | |||
| 2719 | Ga0500593_028759 | |||
| 2720 | Ga0500595_019470 | |||
| 2721 | Ga0500597_102659 | |||
| 2722 | Ga0500618_015665 | |||
| 2723 | Ga0500658_0036209 | |||
| 2724 | Ga0500658_0107998 | |||
| 2725 | Ga0500589_125727 | |||
| 2726 | Ga0500604_0005756 | |||
| 2727 | Ga0500639_122711 | |||
| 2728 | Ga0501084_0022961 | |||
| 2729 | Ga0501084_0041580 | |||
| 2730 | Ga0501084_0182986 | |||
| 2731 | Ga0501084_0553993 | |||
| 2732 | Ga0501084_0751771 | |||
| 2733 | Ga0501082_0000099 | |||
| 2734 | Ga0501082_0083620 | |||
| 2735 | Ga0501082_0086774 | |||
| 2736 | Ga0501082_0123872 | |||
| 2737 | Ga0501082_0202346 | |||
| 2738 | Ga0501082_0387569 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tpy-assembly1.cif.gz_A | structure of the cyclopropane synthase mmaa2 from mycobacterium tuberculosis | 0.8135 | 42 | 163 |
| 7q2g-assembly1.cif.gz_A | mycolic acid methyltransferase hma (mmaa4) from mycobac-terium tuberculosis in complex with zt726 | 0.804 | 42 | 163 |
| 3ccf-assembly1.cif.gz_A | crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution | 0.8037 | 45 | 162 |
| 3dtn-assembly1.cif.gz_B | crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . | 0.8014 | 44 | 160 |
| 3ha7-assembly1.cif.gz_A | crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosyl-n-decyl-aminoethyl (sadae) | 0.798 | 42 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q50584_122_315_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8028 | 42 | 159 | 3.40.50.150 |
| 1l1eB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.792 | 42 | 162 | 3.40.50.150 |
| af_Q54QG2_134_419_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7844 | 44 | 162 | 3.40.50.150 |
| af_I1M9Q5_102_417_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7803 | 55 | 166 | 3.40.50.150 |
| af_Q10170_125_355_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7794 | 36 | 160 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522GTG4-F1-model_v4 | Methyltransferase domain-containing protein | 0.9796 | 47 | 199 |
GO:0000179
|
| AF-A0A4Q2U7T3-F1-model_v4 | Methyltransferase domain-containing protein | 0.9773 | 48 | 200 |
GO:0000179
|
| AF-A0A2G8MF81-F1-model_v4 | deleted | 0.9759 | 63 | 200 |
|
| AF-A0A2G8MF81-F1-model_v4 | deleted | 0.969 | 63 | 200 |
|
| AF-A0A7R7YGN8-F1-model_v4 | Methyltransferase | 0.9677 | 29 | 200 |
GO:0000179
|