F493402

General Info

Members Datasets Scaffolds Average Seq Length
1370 526 2740 136

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1012054|Ga0055543_10120542
Length 157
Sequence MIAVDSSVLIDLLGDAPGADAAEAALRLALSTGPVVLCDVVLSEVTAGLGHGSEVMDALEEMGLGFSPIDQRAAIRAGEMQRKFKQRLLEAGTRPSGKPQAKTVAADTPGASRAIADFLVGAHAMLQCDGLITRDHGFFRDYFKGLKVIVPEGASPR

Samples

Sample ID Description Type Environment
1 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
230 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
233 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
234 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
235 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
238 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
266 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
281 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
284 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
285 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
286 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
289 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
290 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
291 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
292 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
293 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
294 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
297 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
298 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
299 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
300 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
301 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
306 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
310 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
311 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
312 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
313 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
314 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
315 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
316 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
317 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
318 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
319 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
341 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
401 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
402 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
403 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
404 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
426 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
427 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
428 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
429 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
430 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
431 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
432 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
433 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
434 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
435 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
436 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
437 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
438 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
439 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
440 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
441 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
444 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
445 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
446 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
447 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
448 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
449 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
450 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
454 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
463 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
464 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
465 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
466 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
467 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
468 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
469 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
470 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
471 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
476 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
477 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
478 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
479 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
480 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
481 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
482 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
483 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
484 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
485 2643221695 Lysobacter sp. Root494 Isolate Unclassified
486 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
487 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
488 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
489 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
490 2818991457 Xanthomonas translucens 569 Isolate Unclassified
491 2831864461 Roseateles noduli HZ7 Isolate Nodule
492 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
493 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
494 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
495 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
496 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
497 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
498 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
499 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
500 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
501 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
502 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
503 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
504 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
505 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
506 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
507 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
508 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
509 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
510 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
511 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
512 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
513 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
514 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
515 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
516 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
517 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
518 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
519 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
520 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
521 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
522 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
523 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
524 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
525 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
526 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 1.17
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 10.36
Nodule 0.36
Rhizoplane 5.62
Rhizosphere 72.19
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055543_1012054 3300004625 Bacteria 1750
2 SwRhRL2b_contig_2733011 2162886007 Bacteria 3098
3 SwRhRL2b_contig_3886549 2162886007 Bacteria 1068
4 JGI25156J39149_1002197 3300002705 Bacteria 7254
5 JGI25156J39149_1006806 3300002705 Bacteria 3078
6 JGI25154J39366_1001260 3300002738 Bacteria 9490
7 JGI25157J39369_1000491 3300002741 Bacteria 24512
8 JGI25164J39214_1009409 3300002772 Bacteria 961
9 Ga0006778J45830_1039144 3300003162 Bacteria 3623
10 rootH1_10002740 3300003316 Bacteria 3767
11 rootH1_10002744 3300003316 Bacteria 2748
12 rootH1_10017987 3300003316 Bacteria 2116
13 rootH2_10019340 3300003320 Bacteria 4011
14 rootH2_10083712 3300003320 Bacteria 2181
15 rootH2_10187889 3300003320 Bacteria 1336
16 rootL2_10002046 3300003322 Bacteria 4121
17 rootL2_10047399 3300003322 Bacteria 3286
18 rootL2_10049164 3300003322 Bacteria 5122
19 rootL2_10136592 3300003322 Bacteria 1066
20 rootL2_10197176 3300003322 Bacteria 1229
21 rootL2_10256599 3300003322 Bacteria 1968
22 rootH1_10038473 3300003323 Bacteria 4146
23 rootH1_10058276 3300003323 Bacteria 4017
24 rootH1_10061833 3300003323 Bacteria 2662
25 rootH1_10072793 3300003323 Bacteria 1181
26 rootH1_10143584 3300003323 Bacteria 1595
27 rootH1_10235777 3300003323 Bacteria 1878
28 Ga0055539_1000279 3300003752 Bacteria 29490
29 Ga0055539_1002101 3300003752 Bacteria 3240
30 Ga0055539_1023488 3300003752 Bacteria 724
31 Ga0055533_1000025 3300003756 Bacteria 332208
32 Ga0055525_1000046 3300003759 Bacteria 261587
33 Ga0055525_1001306 3300003759 Bacteria 5049
34 Ga0055535_1000122 3300003761 Bacteria 83657
35 Ga0055535_1016001 3300003761 Bacteria 1036
36 Ga0055529_1000199 3300003763 Bacteria 80950
37 Ga0055526_1000101 3300003771 Bacteria 76352
38 Ga0055526_1003565 3300003771 Bacteria 9799
39 Ga0055526_1006205 3300003771 Bacteria 6565
40 Ga0055537_1000091 3300003773 Bacteria 66379
41 Ga0055537_1000459 3300003773 Bacteria 25642
42 Ga0055537_1000560 3300003773 Bacteria 21020
43 Ga0055524_1000574 3300003775 Bacteria 27115
44 Ga0055524_1001859 3300003775 Bacteria 11558
45 Ga0055524_1012111 3300003775 Bacteria 3329
46 Ga0055524_1032069 3300003775 Bacteria 1498
47 Ga0055524_1032769 3300003775 Bacteria 1466
48 Ga0055536_1001901 3300003781 Bacteria 12114
49 Ga0055536_1003184 3300003781 Bacteria 8895
50 Ga0055536_1005396 3300003781 Bacteria 6263
51 Ga0055536_1014378 3300003781 Bacteria 2784
52 Ga0055534_1000043 3300003784 Bacteria 99338
53 Ga0055534_1000078 3300003784 Bacteria 75996
54 Ga0055528_1000075 3300003790 Bacteria 76054
55 Ga0055528_1000087 3300003790 Bacteria 72896
56 Ga0055530_10001911 3300003791 Bacteria 14253
57 Ga0055530_10007441 3300003791 Bacteria 4607
58 Ga0055530_10008282 3300003791 Bacteria 4197
59 Ga0055530_10010812 3300003791 Bacteria 3334
60 Ga0055530_10030449 3300003791 Bacteria 1429
61 Ga0055530_10053491 3300003791 Bacteria 927
62 Ga0055540_1000004 3300003792 Bacteria 395545
63 Ga0055540_1000035 3300003792 Bacteria 166843
64 Ga0055540_1014970 3300003792 Bacteria 2283
65 Ga0055540_1028470 3300003792 Bacteria 1321
66 Ga0055540_1046447 3300003792 Bacteria 913
67 Ga0055531_10010928 3300003794 Bacteria 4448
68 Ga0055531_10012582 3300003794 Bacteria 3969
69 Ga0055531_10020086 3300003794 Bacteria 2662
70 Ga0055531_10025346 3300003794 Bacteria 2157
71 Ga0055531_10028318 3300003794 Bacteria 1936
72 Ga0058692_1000060 3300003856 Bacteria 98866
73 Ga0058692_1000555 3300003856 Bacteria 15940
74 Ga0055543_1003835 3300004625 Bacteria 4268
75 Ga0065165_1000239 3300005262 Bacteria 94061
76 Ga0065165_1000401 3300005262 Bacteria 69929
77 Ga0065165_1076663 3300005262 Bacteria 876
78 Ga0065704_10000521 3300005289 Bacteria 27858
79 Ga0065704_10078724 3300005289 Bacteria 4350
80 Ga0065704_10138923 3300005289 Bacteria 1539
81 Ga0065704_10193942 3300005289 Bacteria 1165
82 Ga0065715_10160732 3300005293 Bacteria 1632
83 Ga0070658_10005332 3300005327 Bacteria 10439
84 Ga0070658_10138163 3300005327 Bacteria 2034
85 Ga0070658_10166330 3300005327 Bacteria 1851
86 Ga0070658_10501468 3300005327 Bacteria 1048
87 Ga0070676_10116453 3300005328 Bacteria 1671
88 Ga0070676_10163474 3300005328 Bacteria 1434
89 Ga0070676_10232491 3300005328 Bacteria 1222
90 Ga0070676_10271029 3300005328 Bacteria 1140
91 Ga0070676_10301012 3300005328 Bacteria 1087
92 Ga0070676_10812898 3300005328 Bacteria 690
93 Ga0070683_100159377 3300005329 Bacteria 2141
94 Ga0070683_100239841 3300005329 Bacteria 1724
95 Ga0070690_100019205 3300005330 Bacteria 4143
96 Ga0070690_100028644 3300005330 Bacteria 3451
97 Ga0070690_100143883 3300005330 Bacteria 1620
98 Ga0070690_100273359 3300005330 Bacteria 1203
99 Ga0070670_100003584 3300005331 Bacteria 12922
100 Ga0070670_100034566 3300005331 Bacteria 4350
101 Ga0070670_100117018 3300005331 Bacteria 2298
102 Ga0070670_100150580 3300005331 Bacteria 2013
103 Ga0070670_100164485 3300005331 Bacteria 1923
104 Ga0070670_100202876 3300005331 Bacteria 1723
105 Ga0070670_100265353 3300005331 Bacteria 1497
106 Ga0070670_101077045 3300005331 Bacteria 732
107 Ga0070670_101916629 3300005331 Bacteria 546
108 Ga0070677_10025590 3300005333 Bacteria 2204
109 Ga0070677_10052737 3300005333 Bacteria 1651
110 Ga0070677_10084279 3300005333 Bacteria 1367
111 Ga0070677_10125290 3300005333 Bacteria 1165
112 Ga0070677_10291543 3300005333 Bacteria 826
113 Ga0068869_100083709 3300005334 Bacteria 2386
114 Ga0068869_100092019 3300005334 Bacteria 2282
115 Ga0068869_100113189 3300005334 Bacteria 2066
116 Ga0068869_100133862 3300005334 Bacteria 1908
117 Ga0068869_100805593 3300005334 Bacteria 807
118 Ga0070666_10022849 3300005335 Bacteria 4065
119 Ga0070666_10033683 3300005335 Bacteria 3391
120 Ga0070666_10725171 3300005335 Bacteria 730
121 Ga0070680_100200755 3300005336 Bacteria 1682
122 Ga0070682_100319171 3300005337 Bacteria 1147
123 Ga0070682_100366638 3300005337 Bacteria 1079
124 Ga0070682_100441809 3300005337 Bacteria 994
125 Ga0068868_100010923 3300005338 Bacteria 6591
126 Ga0068868_100105165 3300005338 Bacteria 2288
127 Ga0068868_100625760 3300005338 Bacteria 956
128 Ga0068868_100627545 3300005338 Bacteria 955
129 Ga0068868_100628643 3300005338 Bacteria 954
130 Ga0068868_101225452 3300005338 Bacteria 695
131 Ga0070660_100177344 3300005339 Bacteria 1724
132 Ga0070660_100258905 3300005339 Bacteria 1420
133 Ga0070660_100415469 3300005339 Bacteria 1113
134 Ga0070660_100441923 3300005339 Bacteria 1078
135 Ga0070689_100080869 3300005340 Bacteria 2550
136 Ga0070689_100221359 3300005340 Bacteria 1553
137 Ga0070689_100240708 3300005340 Bacteria 1490
138 Ga0070689_100383657 3300005340 Bacteria 1185
139 Ga0070687_100008132 3300005343 Bacteria 4421
140 Ga0070687_100317632 3300005343 Bacteria 994
141 Ga0070687_100331125 3300005343 Bacteria 976
142 Ga0070687_100603233 3300005343 Bacteria 754
143 Ga0070661_100084736 3300005344 Bacteria 2341
144 Ga0070661_100230417 3300005344 Bacteria 1423
145 Ga0070661_100254344 3300005344 Bacteria 1356
146 Ga0070692_10275966 3300005345 Bacteria 1017
147 Ga0070668_100065280 3300005347 Bacteria 2823
148 Ga0070668_100106945 3300005347 Bacteria 2223
149 Ga0070668_100149654 3300005347 Bacteria 1887
150 Ga0070668_100436334 3300005347 Bacteria 1123
151 Ga0070668_101435490 3300005347 Bacteria 630
152 Ga0070669_100001896 3300005353 Bacteria 15091
153 Ga0070669_100021831 3300005353 Bacteria 4577
154 Ga0070669_100095163 3300005353 Bacteria 2239
155 Ga0070669_100497763 3300005353 Bacteria 1010
156 Ga0070669_100709599 3300005353 Bacteria 850
157 Ga0070669_100843272 3300005353 Bacteria 781
158 Ga0070675_100001199 3300005354 Bacteria 18865
159 Ga0070675_100027333 3300005354 Bacteria 4583
160 Ga0070675_100038320 3300005354 Bacteria 3906
161 Ga0070675_100262615 3300005354 Bacteria 1513
162 Ga0070675_100562965 3300005354 Bacteria 1032
163 Ga0070675_100633071 3300005354 Bacteria 971
164 Ga0070675_101151747 3300005354 Bacteria 714
165 Ga0070671_100009616 3300005355 Bacteria 7767
166 Ga0070671_100069035 3300005355 Bacteria 2947
167 Ga0070671_100121757 3300005355 Bacteria 2196
168 Ga0070671_100134304 3300005355 Bacteria 2085
169 Ga0070671_100158250 3300005355 Bacteria 1914
170 Ga0070671_100401989 3300005355 Bacteria 1172
171 Ga0070671_100437577 3300005355 Bacteria 1121
172 Ga0070671_100737062 3300005355 Bacteria 856
173 Ga0070671_100878486 3300005355 Bacteria 783
174 Ga0070674_100003764 3300005356 Bacteria 8562
175 Ga0070674_100187003 3300005356 Bacteria 1590
176 Ga0070674_100271492 3300005356 Bacteria 1340
177 Ga0070674_100588240 3300005356 Bacteria 939
178 Ga0070674_101091653 3300005356 Bacteria 704
179 Ga0070673_100073367 3300005364 Bacteria 2754
180 Ga0070673_100205364 3300005364 Bacteria 1698
181 Ga0070673_100227369 3300005364 Bacteria 1617
182 Ga0070673_100236454 3300005364 Bacteria 1586
183 Ga0070673_100366647 3300005364 Bacteria 1281
184 Ga0070673_100708241 3300005364 Bacteria 925
185 Ga0070673_100724620 3300005364 Bacteria 914
186 Ga0070688_100075599 3300005365 Bacteria 2165
187 Ga0070688_100114079 3300005365 Bacteria 1801
188 Ga0070659_100000336 3300005366 Bacteria 36297
189 Ga0070659_100090132 3300005366 Bacteria 2457
190 Ga0070659_100209986 3300005366 Bacteria 1604
191 Ga0070659_100377472 3300005366 Bacteria 1194
192 Ga0070659_101023812 3300005366 Bacteria 725
193 Ga0070667_100005446 3300005367 Bacteria 10632
194 Ga0070667_100016792 3300005367 Bacteria 6056
195 Ga0070667_100318288 3300005367 Bacteria 1403
196 Ga0070667_101317883 3300005367 Bacteria 677
197 Ga0070714_100259131 3300005435 Bacteria 1610
198 Ga0070701_10374466 3300005438 Bacteria 896
199 Ga0070701_10432580 3300005438 Bacteria 841
200 Ga0070663_100007308 3300005455 Bacteria 6715
201 Ga0070663_100130980 3300005455 Bacteria 1904
202 Ga0070663_100318737 3300005455 Bacteria 1249
203 Ga0070663_100549137 3300005455 Bacteria 965
204 Ga0070663_101180864 3300005455 Unclassified 672
205 Ga0070678_100010070 3300005456 Bacteria 5754
206 Ga0070678_100043335 3300005456 Bacteria 3204
207 Ga0070678_100160790 3300005456 Bacteria 1819
208 Ga0070678_100170193 3300005456 Bacteria 1773
209 Ga0070678_100174108 3300005456 Bacteria 1755
210 Ga0070678_100266817 3300005456 Bacteria 1442
211 Ga0070678_100310449 3300005456 Bacteria 1343
212 Ga0070678_101194906 3300005456 Bacteria 705
213 Ga0070662_100000867 3300005457 Bacteria 18517
214 Ga0070662_100178485 3300005457 Bacteria 1672
215 Ga0070662_100273071 3300005457 Bacteria 1365
216 Ga0070662_100313493 3300005457 Bacteria 1277
217 Ga0070662_100479368 3300005457 Bacteria 1035
218 Ga0070681_10464008 3300005458 Bacteria 1179
219 Ga0068867_100000005 3300005459 Bacteria 174097
220 Ga0068867_100082817 3300005459 Bacteria 2421
221 Ga0068867_100178603 3300005459 Bacteria 1686
222 Ga0068867_100398158 3300005459 Bacteria 1160
223 Ga0068867_100399280 3300005459 Bacteria 1159
224 Ga0068867_101466082 3300005459 Bacteria 635
225 Ga0070685_10554750 3300005466 Bacteria 821
226 Ga0070679_100003038 3300005530 Bacteria 15334
227 Ga0070684_100313579 3300005535 Bacteria 1440
228 Ga0070684_101159476 3300005535 Bacteria 727
229 Ga0068853_100264449 3300005539 Bacteria 1582
230 Ga0068853_100347810 3300005539 Bacteria 1378
231 Ga0068853_100371292 3300005539 Bacteria 1334
232 Ga0068853_100371500 3300005539 Bacteria 1334
233 Ga0068853_100417599 3300005539 Bacteria 1258
234 Ga0068853_100664387 3300005539 Bacteria 992
235 Ga0070672_100003244 3300005543 Bacteria 10530
236 Ga0070672_100220039 3300005543 Bacteria 1592
237 Ga0070672_100429558 3300005543 Bacteria 1136
238 Ga0070672_100438744 3300005543 Bacteria 1123
239 Ga0070672_100548588 3300005543 Bacteria 1003
240 Ga0070672_101241383 3300005543 Bacteria 664
241 Ga0070686_100208664 3300005544 Bacteria 1405
242 Ga0070686_100319526 3300005544 Bacteria 1157
243 Ga0070693_100218418 3300005547 Bacteria 1247
244 Ga0070693_100364409 3300005547 Bacteria 993
245 Ga0070665_100439011 3300005548 Bacteria 1315
246 Ga0070665_102536391 3300005548 Bacteria 514
247 Ga0068855_100035623 3300005563 Bacteria 5928
248 Ga0068855_100063395 3300005563 Bacteria 4313
249 Ga0068855_100065258 3300005563 Bacteria 4244
250 Ga0068855_100187491 3300005563 Bacteria 2335
251 Ga0068855_100288889 3300005563 Bacteria 1818
252 Ga0068855_101509026 3300005563 Bacteria 690
253 Ga0070664_100014426 3300005564 Bacteria 6443
254 Ga0070664_100266060 3300005564 Bacteria 1543
255 Ga0070664_100309246 3300005564 Bacteria 1430
256 Ga0070664_100517141 3300005564 Bacteria 1101
257 Ga0068857_100002880 3300005577 Bacteria 14152
258 Ga0068857_100643149 3300005577 Bacteria 1005
259 Ga0068857_100653711 3300005577 Bacteria 996
260 Ga0068857_100788733 3300005577 Bacteria 907
261 Ga0068857_101622759 3300005577 Bacteria 631
262 Ga0068854_100032823 3300005578 Bacteria 3615
263 Ga0068854_100188620 3300005578 Bacteria 1614
264 Ga0068854_100296805 3300005578 Bacteria 1306
265 Ga0068854_100342447 3300005578 Bacteria 1221
266 Ga0068856_100004237 3300005614 Bacteria 14324
267 Ga0068856_100287717 3300005614 Bacteria 1660
268 Ga0068856_100566739 3300005614 Bacteria 1157
269 Ga0070702_100266700 3300005615 Bacteria 1169
270 Ga0068852_100023003 3300005616 Bacteria 5008
271 Ga0068852_100051582 3300005616 Bacteria 3531
272 Ga0068852_100125132 3300005616 Bacteria 2359
273 Ga0068852_100173703 3300005616 Bacteria 2022
274 Ga0068852_100201955 3300005616 Bacteria 1881
275 Ga0068852_100228622 3300005616 Bacteria 1772
276 Ga0068852_100344478 3300005616 Bacteria 1453
277 Ga0068852_100927121 3300005616 Bacteria 888
278 Ga0068859_100010529 3300005617 Bacteria 9307
279 Ga0068859_100966507 3300005617 Bacteria 935
280 Ga0068864_100002556 3300005618 Bacteria 15030
281 Ga0068864_100010811 3300005618 Bacteria 7541
282 Ga0068864_100074072 3300005618 Bacteria 2970
283 Ga0068864_100219843 3300005618 Bacteria 1752
284 Ga0068864_100287767 3300005618 Bacteria 1535
285 Ga0068864_100311152 3300005618 Bacteria 1477
286 Ga0068864_100407153 3300005618 Bacteria 1294
287 Ga0068866_10022477 3300005718 Bacteria 2919
288 Ga0068866_10451577 3300005718 Bacteria 841
289 Ga0068866_10454602 3300005718 Bacteria 838
290 Ga0068861_100001169 3300005719 Bacteria 16352
291 Ga0068861_100003364 3300005719 Bacteria 10598
292 Ga0068861_100020439 3300005719 Bacteria 4743
293 Ga0068861_100637374 3300005719 Bacteria 983
294 Ga0068861_101175683 3300005719 Bacteria 741
295 Ga0068851_10107935 3300005834 Bacteria 1483
296 Ga0068851_10149319 3300005834 Bacteria 1276
297 Ga0068851_10170888 3300005834 Bacteria 1200
298 Ga0068851_10742335 3300005834 Bacteria 607
299 Ga0068870_10112703 3300005840 Bacteria 1556
300 Ga0068870_10198304 3300005840 Bacteria 1216
301 Ga0068870_10238358 3300005840 Bacteria 1122
302 Ga0068870_10561730 3300005840 Bacteria 770
303 Ga0068863_100019332 3300005841 Bacteria 6514
304 Ga0068863_100075179 3300005841 Bacteria 3196
305 Ga0068863_100185591 3300005841 Bacteria 1997
306 Ga0068863_100222829 3300005841 Bacteria 1817
307 Ga0068863_100511302 3300005841 Bacteria 1183
308 Ga0068858_100015946 3300005842 Bacteria 7058
309 Ga0068858_100201227 3300005842 Bacteria 1883
310 Ga0068858_100761124 3300005842 Bacteria 944
311 Ga0068860_100170425 3300005843 Bacteria 2102
312 Ga0068862_100112008 3300005844 Bacteria 2396
313 Ga0068862_100208709 3300005844 Bacteria 1764
314 Ga0068862_100707168 3300005844 Bacteria 977
315 Ga0068862_100758516 3300005844 Bacteria 945
316 Ga0081539_10083917 3300005985 Bacteria 1666
317 Ga0070717_10529892 3300006028 Bacteria 1066
318 Ga0075365_10065199 3300006038 Bacteria 2441
319 Ga0075365_10618794 3300006038 Bacteria 766
320 Ga0075363_100215076 3300006048 Bacteria 1101
321 Ga0075364_10001093 3300006051 Bacteria 14489
322 Ga0075364_10279616 3300006051 Bacteria 1135
323 Ga0075367_10153877 3300006178 Bacteria 1428
324 Ga0075369_10027960 3300006186 Bacteria 2361
325 Ga0075366_10055725 3300006195 Bacteria 2348
326 Ga0075366_10113036 3300006195 Bacteria 1635
327 Ga0075366_10155524 3300006195 Bacteria 1385
328 Ga0075366_10200893 3300006195 Bacteria 1213
329 Ga0097621_100009661 3300006237 Bacteria 7014
330 Ga0097621_100010826 3300006237 Bacteria 6691
331 Ga0097621_100017103 3300006237 Bacteria 5500
332 Ga0097621_100113913 3300006237 Bacteria 2287
333 Ga0097621_100230556 3300006237 Bacteria 1616
334 Ga0097621_100603380 3300006237 Bacteria 1003
335 Ga0075370_10002692 3300006353 Bacteria 8312
336 Ga0075370_10037091 3300006353 Bacteria 2740
337 Ga0075370_10166025 3300006353 Bacteria 1297
338 Ga0068871_100005809 3300006358 Bacteria 8669
339 Ga0068871_100057753 3300006358 Bacteria 3158
340 Ga0068871_100067624 3300006358 Bacteria 2932
341 Ga0068871_100141284 3300006358 Bacteria 2047
342 Ga0068871_100223359 3300006358 Bacteria 1633
343 Ga0068871_100550890 3300006358 Bacteria 1044
344 Ga0068871_101054900 3300006358 Bacteria 759
345 Ga0075429_100815997 3300006880 Bacteria 817
346 Ga0068865_100094158 3300006881 Bacteria 2179
347 Ga0068865_100166194 3300006881 Bacteria 1687
348 Ga0068865_100277296 3300006881 Bacteria 1333
349 Ga0068865_100536179 3300006881 Bacteria 981
350 Ga0097620_100010529 3300006931 Bacteria 9307
351 Ga0097620_100966531 3300006931 Bacteria 935
352 Ga0079104_1000352 3300006946 Bacteria 55479
353 Ga0099826_10560233 3300006948 Bacteria 525
354 Ga0105251_10000364 3300009011 Bacteria 44484
355 Ga0105244_10041838 3300009036 Bacteria 2373
356 Ga0105240_10055942 3300009093 Bacteria 4938
357 Ga0105240_10212788 3300009093 Bacteria 2258
358 Ga0105240_10654346 3300009093 Bacteria 1151
359 Ga0105240_11006023 3300009093 Bacteria 891
360 Ga0105240_11068556 3300009093 Bacteria 860
361 Ga0111539_10951431 3300009094 Bacteria 999
362 Ga0111539_11239148 3300009094 Bacteria 866
363 Ga0111539_11565602 3300009094 Bacteria 764
364 Ga0105245_10048722 3300009098 Bacteria 3790
365 Ga0105245_10502295 3300009098 Bacteria 1229
366 Ga0105245_10662157 3300009098 Bacteria 1075
367 Ga0105245_10732566 3300009098 Bacteria 1024
368 Ga0105243_10006867 3300009148 Bacteria 8775
369 Ga0105243_10013725 3300009148 Bacteria 6129
370 Ga0105243_10102698 3300009148 Bacteria 2376
371 Ga0105243_10433572 3300009148 Bacteria 1229
372 Ga0105243_11468364 3300009148 Bacteria 705
373 Ga0105243_11806122 3300009148 Bacteria 642
374 Ga0105243_11870583 3300009148 Bacteria 632
375 Ga0105243_12001301 3300009148 Bacteria 614
376 Ga0105241_10119752 3300009174 Bacteria 2118
377 Ga0105241_11523244 3300009174 Bacteria 644
378 Ga0105242_10330985 3300009176 Bacteria 1400
379 Ga0105242_10335390 3300009176 Bacteria 1392
380 Ga0105242_10912657 3300009176 Bacteria 879
381 Ga0105242_11028492 3300009176 Bacteria 833
382 Ga0105248_10014945 3300009177 Bacteria 8546
383 Ga0105248_10039291 3300009177 Bacteria 5299
384 Ga0105248_10105222 3300009177 Bacteria 3181
385 Ga0105248_10500405 3300009177 Bacteria 1370
386 Ga0105248_10585797 3300009177 Bacteria 1258
387 Ga0105248_10682446 3300009177 Bacteria 1159
388 Ga0105248_12289127 3300009177 Unclassified 615
389 Ga0105237_10043493 3300009545 Bacteria 4523
390 Ga0105237_10078237 3300009545 Bacteria 3297
391 Ga0105237_10332526 3300009545 Bacteria 1523
392 Ga0105238_10035279 3300009551 Bacteria 5085
393 Ga0105249_10060727 3300009553 Bacteria 3468
394 Ga0105249_10163245 3300009553 Bacteria 2154
395 Ga0105249_11447828 3300009553 Bacteria 759
396 Ga0105249_13359061 3300009553 Unclassified 515
397 Ga0105148_121146 3300009978 Bacteria 523
398 Ga0105239_10056095 3300010375 Bacteria 4321
399 Ga0105239_10320005 3300010375 Bacteria 1749
400 Ga0105239_10390603 3300010375 Bacteria 1574
401 Ga0105246_10055307 3300011119 Bacteria 2738
402 Ga0157319_1000031 3300012497 Bacteria 48442
403 Ga0157373_10613361 3300013100 Bacteria 793
404 Ga0157373_10815433 3300013100 Bacteria 689
405 Ga0157371_10002369 3300013102 Bacteria 18037
406 Ga0157371_10062945 3300013102 Bacteria 2630
407 Ga0157371_10079985 3300013102 Bacteria 2315
408 Ga0157371_10160203 3300013102 Bacteria 1607
409 Ga0157371_10162109 3300013102 Bacteria 1597
410 Ga0157371_10287601 3300013102 Bacteria 1188
411 Ga0157370_10102494 3300013104 Bacteria 2680
412 Ga0157370_10452984 3300013104 Bacteria 1180
413 Ga0157370_10487444 3300013104 Bacteria 1133
414 Ga0157370_11918103 3300013104 Bacteria 531
415 Ga0157369_10049772 3300013105 Bacteria 4541
416 Ga0157369_10227086 3300013105 Bacteria 1953
417 Ga0157369_10445204 3300013105 Bacteria 1342
418 Ga0157374_10105010 3300013296 Bacteria 2712
419 Ga0157374_10171153 3300013296 Bacteria 2119
420 Ga0157374_10330567 3300013296 Bacteria 1512
421 Ga0157374_10344207 3300013296 Bacteria 1480
422 Ga0157378_10152828 3300013297 Bacteria 2151
423 Ga0157378_10180200 3300013297 Bacteria 1987
424 Ga0157378_10578450 3300013297 Bacteria 1132
425 Ga0157378_12775830 3300013297 Bacteria 542
426 Ga0163162_10007486 3300013306 Bacteria 10624
427 Ga0163162_10025364 3300013306 Bacteria 5857
428 Ga0163162_10181423 3300013306 Bacteria 2231
429 Ga0163162_10265698 3300013306 Bacteria 1847
430 Ga0163162_10486191 3300013306 Bacteria 1366
431 Ga0163162_10674271 3300013306 Bacteria 1157
432 Ga0163162_10747585 3300013306 Bacteria 1097
433 Ga0163162_11074816 3300013306 Bacteria 911
434 Ga0157372_10243948 3300013307 Bacteria 2085
435 Ga0157372_11149127 3300013307 Bacteria 898
436 Ga0157375_10034088 3300013308 Bacteria 4846
437 Ga0157375_10109446 3300013308 Bacteria 2859
438 Ga0157375_10353768 3300013308 Bacteria 1635
439 Ga0157375_10408446 3300013308 Bacteria 1524
440 Ga0157375_10494459 3300013308 Bacteria 1388
441 Ga0157375_11009048 3300013308 Bacteria 972
442 Ga0157375_11513579 3300013308 Unclassified 792
443 Ga0157375_12642963 3300013308 Bacteria 600
444 Ga0163163_10010139 3300014325 Bacteria 8453
445 Ga0163163_10240216 3300014325 Bacteria 1861
446 Ga0163163_10329833 3300014325 Bacteria 1580
447 Ga0163163_10600868 3300014325 Bacteria 1163
448 Ga0163163_11222756 3300014325 Bacteria 814
449 Ga0163163_11443248 3300014325 Bacteria 750
450 Ga0157380_10153834 3300014326 Bacteria 1991
451 Ga0157380_10198110 3300014326 Bacteria 1779
452 Ga0157380_10316828 3300014326 Bacteria 1444
453 Ga0157380_10424330 3300014326 Bacteria 1269
454 Ga0157380_10449479 3300014326 Bacteria 1237
455 Ga0157380_10636066 3300014326 Bacteria 1062
456 Ga0157380_13027101 3300014326 Bacteria 536
457 Ga0182008_10010987 3300014497 Bacteria 4829
458 Ga0182008_10067339 3300014497 Bacteria 1762
459 Ga0182008_10495581 3300014497 Bacteria 671
460 Ga0157377_10000022 3300014745 Bacteria 146702
461 Ga0157377_10062240 3300014745 Bacteria 2135
462 Ga0157377_10336995 3300014745 Bacteria 1007
463 Ga0157379_10011032 3300014968 Bacteria 7876
464 Ga0157379_10018910 3300014968 Bacteria 6079
465 Ga0157379_10066973 3300014968 Bacteria 3211
466 Ga0157379_10183696 3300014968 Bacteria 1889
467 Ga0157379_10326475 3300014968 Bacteria 1401
468 Ga0157379_10568848 3300014968 Bacteria 1056
469 Ga0157379_10633969 3300014968 Bacteria 999
470 Ga0157376_10028517 3300014969 Bacteria 4438
471 Ga0157376_10129467 3300014969 Bacteria 2250
472 Ga0157376_10186237 3300014969 Bacteria 1901
473 Ga0157376_10210298 3300014969 Bacteria 1795
474 Ga0157376_10223886 3300014969 Bacteria 1744
475 Ga0157376_10360829 3300014969 Bacteria 1393
476 Ga0157376_10379663 3300014969 Bacteria 1361
477 Ga0157376_10670491 3300014969 Bacteria 1039
478 Ga0182006_1033096 3300015261 Bacteria 2073
479 Ga0182006_1064426 3300015261 Bacteria 1374
480 Ga0182006_1080302 3300015261 Bacteria 1191
481 Ga0182006_1081085 3300015261 Bacteria 1183
482 Ga0182006_1180587 3300015261 Bacteria 704
483 Ga0182007_10000236 3300015262 Bacteria 37233
484 Ga0182007_10173386 3300015262 Bacteria 743
485 Ga0182005_1001886 3300015265 Bacteria 7941
486 Ga0183360_10001 3300015689 Bacteria 3943671
487 Ga0163161_10033566 3300017792 Bacteria 3667
488 Ga0163161_10036693 3300017792 Bacteria 3511
489 Ga0163161_10059326 3300017792 Bacteria 2782
490 Ga0163161_10092187 3300017792 Bacteria 2243
491 Ga0163161_10094277 3300017792 Bacteria 2219
492 Ga0163161_10128293 3300017792 Bacteria 1911
493 Ga0163161_10263008 3300017792 Bacteria 1348
494 Ga0163161_10369432 3300017792 Bacteria 1144
495 Ga0163161_10799188 3300017792 Bacteria 793
496 Ga0206349_1304419 3300020075 Bacteria 3262
497 Ga0213872_10000029 3300021361 Bacteria 145850
498 Ga0213872_10000049 3300021361 Bacteria 109094
499 Ga0213872_10077224 3300021361 Bacteria 1497
500 Ga0213872_10092646 3300021361 Bacteria 1351
501 Ga0209674_100007 3300025226 Bacteria 1077082
502 Ga0209674_113028 3300025226 Bacteria 787
503 Ga0209563_100005 3300025230 Bacteria 1774893
504 Ga0209563_100052 3300025230 Bacteria 334307
505 Ga0207427_100516 3300025231 Bacteria 20429
506 Ga0209258_100284 3300025242 Bacteria 83713
507 Ga0209258_100957 3300025242 Bacteria 13752
508 Ga0207425_1023502 3300025245 Bacteria 1289
509 Ga0209646_1000245 3300025246 Bacteria 55317
510 Ga0209026_1000021 3300025250 Bacteria 375165
511 Ga0209026_1009092 3300025250 Bacteria 1992
512 Ga0209026_1035437 3300025250 Bacteria 732
513 Ga0209677_100015 3300025253 Bacteria 532137
514 Ga0209677_100477 3300025253 Bacteria 22940
515 Ga0209677_103158 3300025253 Bacteria 5562
516 Ga0209759_1000244 3300025256 Bacteria 80962
517 Ga0209759_1000382 3300025256 Bacteria 55345
518 Ga0209759_1002244 3300025256 Bacteria 8800
519 Ga0209759_1012333 3300025256 Bacteria 2373
520 Ga0209759_1027317 3300025256 Bacteria 1181
521 Ga0209759_1030695 3300025256 Bacteria 1058
522 Ga0209565_1000001 3300025263 Bacteria 2950419
523 Ga0209565_1000063 3300025263 Bacteria 183711
524 Ga0209565_1025074 3300025263 Bacteria 1208
525 Ga0209455_1000207 3300025272 Bacteria 83713
526 Ga0209673_1000001 3300025273 Bacteria 3176258
527 Ga0209673_1000065 3300025273 Bacteria 252799
528 Ga0209673_1005175 3300025273 Bacteria 6664
529 Ga0209130_1005935 3300025284 Bacteria 4096
530 Ga0209675_1000001 3300025291 Bacteria 2950293
531 Ga0209675_1000011 3300025291 Bacteria 520597
532 Ga0209676_1000011 3300025292 Bacteria 860463
533 Ga0209676_1000068 3300025292 Bacteria 314068
534 Ga0209676_1000086 3300025292 Bacteria 264155
535 Ga0209676_1001200 3300025292 Bacteria 27709
536 Ga0209676_1017012 3300025292 Bacteria 2593
537 Ga0209025_1137416 3300025294 Bacteria 698
538 Ga0209564_1000001 3300025295 Bacteria 3176258
539 Ga0209564_1000003 3300025295 Bacteria 1585848
540 Ga0209564_1002163 3300025295 Bacteria 16562
541 Ga0209050_1000239 3300025298 Bacteria 119530
542 Ga0209050_1000351 3300025298 Bacteria 88847
543 Ga0209050_1002510 3300025298 Bacteria 15448
544 Ga0209050_1004369 3300025298 Bacteria 9597
545 Ga0209050_1015764 3300025298 Bacteria 3148
546 Ga0209050_1018889 3300025298 Bacteria 2652
547 Ga0209256_1000002 3300025299 Bacteria 1906740
548 Ga0209256_1000011 3300025299 Bacteria 865309
549 Ga0209256_1004910 3300025299 Bacteria 8023
550 Ga0209256_1007888 3300025299 Bacteria 5100
551 Ga0209256_1009066 3300025299 Bacteria 4443
552 Ga0209256_1012612 3300025299 Bacteria 3210
553 Ga0209256_1016602 3300025299 Bacteria 2498
554 Ga0209256_1024840 3300025299 Bacteria 1757
555 Ga0209051_1000016 3300025303 Bacteria 541891
556 Ga0209051_1001060 3300025303 Bacteria 25669
557 Ga0209051_1001316 3300025303 Bacteria 21740
558 Ga0209051_1003382 3300025303 Bacteria 10483
559 Ga0209051_1008580 3300025303 Bacteria 5392
560 Ga0209257_1000014 3300025304 Bacteria 946850
561 Ga0209257_1000102 3300025304 Bacteria 251074
562 Ga0209257_1000121 3300025304 Bacteria 222588
563 Ga0209257_1000145 3300025304 Bacteria 195152
564 Ga0209257_1002604 3300025304 Bacteria 17480
565 Ga0209257_1002862 3300025304 Bacteria 16106
566 Ga0209257_1008078 3300025304 Bacteria 6124
567 Ga0209257_1111993 3300025304 Bacteria 650
568 Ga0209257_1139366 3300025304 Bacteria 546
569 Ga0207697_10023431 3300025315 Bacteria 2528
570 Ga0207697_10030415 3300025315 Bacteria 2210
571 Ga0207697_10152396 3300025315 Bacteria 1006
572 Ga0207656_10036941 3300025321 Bacteria 2052
573 Ga0207656_10070817 3300025321 Bacteria 1549
574 Ga0207656_10147624 3300025321 Bacteria 1112
575 Ga0207656_10269235 3300025321 Bacteria 838
576 Ga0207656_10295258 3300025321 Bacteria 801
577 Ga0207713_1000422 3300025735 Bacteria 44963
578 Ga0207682_10003227 3300025893 Bacteria 7131
579 Ga0207682_10037412 3300025893 Bacteria 1966
580 Ga0207682_10053884 3300025893 Bacteria 1669
581 Ga0207682_10164565 3300025893 Bacteria 1007
582 Ga0207682_10256053 3300025893 Bacteria 816
583 Ga0207682_10387567 3300025893 Bacteria 660
584 Ga0207642_10068647 3300025899 Bacteria 1678
585 Ga0207642_10211202 3300025899 Bacteria 1078
586 Ga0207642_10597097 3300025899 Bacteria 687
587 Ga0207680_10022332 3300025903 Bacteria 3439
588 Ga0207680_10321960 3300025903 Bacteria 1081
589 Ga0207685_10241477 3300025905 Bacteria 869
590 Ga0207645_10032610 3300025907 Bacteria 3348
591 Ga0207645_10067590 3300025907 Bacteria 2284
592 Ga0207645_10087967 3300025907 Bacteria 1997
593 Ga0207645_10297927 3300025907 Bacteria 1073
594 Ga0207645_10734092 3300025907 Bacteria 671
595 Ga0207643_10089513 3300025908 Bacteria 1793
596 Ga0207643_10178962 3300025908 Bacteria 1282
597 Ga0207643_10277041 3300025908 Bacteria 1039
598 Ga0207643_10937672 3300025908 Bacteria 561
599 Ga0207705_10024971 3300025909 Bacteria 4265
600 Ga0207705_10180438 3300025909 Bacteria 1593
601 Ga0207705_10322919 3300025909 Bacteria 1186
602 Ga0207705_10419583 3300025909 Bacteria 1036
603 Ga0207705_10422010 3300025909 Bacteria 1033
604 Ga0207705_10571654 3300025909 Bacteria 879
605 Ga0207705_11026422 3300025909 Bacteria 637
606 Ga0207654_10019747 3300025911 Bacteria 3562
607 Ga0207707_10396994 3300025912 Bacteria 1184
608 Ga0207695_10014006 3300025913 Bacteria 9524
609 Ga0207695_10180477 3300025913 Bacteria 2032
610 Ga0207695_10245272 3300025913 Bacteria 1691
611 Ga0207695_11249396 3300025913 Bacteria 623
612 Ga0207671_10040649 3300025914 Bacteria 3442
613 Ga0207671_10054875 3300025914 Bacteria 2952
614 Ga0207671_10779050 3300025914 Bacteria 759
615 Ga0207660_10008701 3300025917 Bacteria 6565
616 Ga0207662_10027872 3300025918 Bacteria 3262
617 Ga0207662_10644355 3300025918 Bacteria 740
618 Ga0207657_10048889 3300025919 Bacteria 3690
619 Ga0207657_10161733 3300025919 Bacteria 1818
620 Ga0207657_10193071 3300025919 Bacteria 1642
621 Ga0207649_10000854 3300025920 Bacteria 19496
622 Ga0207649_10185766 3300025920 Bacteria 1458
623 Ga0207649_10459151 3300025920 Bacteria 963
624 Ga0207649_10894139 3300025920 Bacteria 696
625 Ga0207652_10047333 3300025921 Bacteria 3673
626 Ga0207681_10000205 3300025923 Bacteria 47034
627 Ga0207681_10039158 3300025923 Bacteria 3145
628 Ga0207681_10102057 3300025923 Bacteria 2071
629 Ga0207681_10633531 3300025923 Bacteria 885
630 Ga0207694_10031573 3300025924 Bacteria 4047
631 Ga0207694_10272978 3300025924 Bacteria 1387
632 Ga0207650_10012226 3300025925 Bacteria 5923
633 Ga0207650_10012959 3300025925 Bacteria 5764
634 Ga0207650_10044672 3300025925 Bacteria 3256
635 Ga0207650_10103917 3300025925 Bacteria 2191
636 Ga0207650_10458750 3300025925 Bacteria 1061
637 Ga0207650_10796895 3300025925 Bacteria 801
638 Ga0207659_10016801 3300025926 Bacteria 4771
639 Ga0207659_10019506 3300025926 Bacteria 4466
640 Ga0207659_10019707 3300025926 Bacteria 4446
641 Ga0207659_10253328 3300025926 Bacteria 1429
642 Ga0207687_10322174 3300025927 Bacteria 1251
643 Ga0207687_11003990 3300025927 Bacteria 716
644 Ga0207644_10003106 3300025931 Bacteria 10690
645 Ga0207644_10009861 3300025931 Bacteria 6282
646 Ga0207644_10027264 3300025931 Bacteria 3946
647 Ga0207644_10042654 3300025931 Bacteria 3216
648 Ga0207644_10258571 3300025931 Bacteria 1391
649 Ga0207644_10491634 3300025931 Bacteria 1011
650 Ga0207644_10602757 3300025931 Bacteria 912
651 Ga0207644_10833212 3300025931 Bacteria 772
652 Ga0207644_11807705 3300025931 Bacteria 511
653 Ga0207690_10000647 3300025932 Bacteria 22356
654 Ga0207690_10032066 3300025932 Bacteria 3368
655 Ga0207690_10185032 3300025932 Bacteria 1571
656 Ga0207690_10624365 3300025932 Bacteria 881
657 Ga0207690_11109829 3300025932 Bacteria 659
658 Ga0207690_11203010 3300025932 Bacteria 633
659 Ga0207706_10000933 3300025933 Bacteria 29885
660 Ga0207706_10112176 3300025933 Bacteria 2399
661 Ga0207706_10126484 3300025933 Bacteria 2248
662 Ga0207706_10146781 3300025933 Bacteria 2075
663 Ga0207706_10484308 3300025933 Bacteria 1069
664 Ga0207706_10951065 3300025933 Bacteria 724
665 Ga0207686_10623790 3300025934 Bacteria 851
666 Ga0207709_10001039 3300025935 Bacteria 20507
667 Ga0207709_10001336 3300025935 Bacteria 17405
668 Ga0207709_10009154 3300025935 Bacteria 5454
669 Ga0207709_10045943 3300025935 Bacteria 2647
670 Ga0207709_10191960 3300025935 Bacteria 1452
671 Ga0207670_10283587 3300025936 Bacteria 1292
672 Ga0207670_10574333 3300025936 Bacteria 923
673 Ga0207669_10255865 3300025937 Bacteria 1307
674 Ga0207669_10398681 3300025937 Bacteria 1077
675 Ga0207669_10920399 3300025937 Bacteria 731
676 Ga0207704_10012031 3300025938 Bacteria 4282
677 Ga0207704_10013827 3300025938 Bacteria 4055
678 Ga0207704_10686111 3300025938 Bacteria 847
679 Ga0207704_10976203 3300025938 Bacteria 715
680 Ga0207691_10150581 3300025940 Bacteria 2046
681 Ga0207691_10167907 3300025940 Bacteria 1923
682 Ga0207691_10203561 3300025940 Bacteria 1722
683 Ga0207691_10215368 3300025940 Bacteria 1667
684 Ga0207691_10222523 3300025940 Bacteria 1636
685 Ga0207691_10237160 3300025940 Bacteria 1578
686 Ga0207691_10237716 3300025940 Bacteria 1576
687 Ga0207691_10422560 3300025940 Bacteria 1136
688 Ga0207691_10596866 3300025940 Bacteria 935
689 Ga0207711_10005887 3300025941 Bacteria 10351
690 Ga0207711_10017744 3300025941 Bacteria 5913
691 Ga0207711_10098799 3300025941 Bacteria 2579
692 Ga0207711_10161734 3300025941 Bacteria 2027
693 Ga0207711_10163673 3300025941 Bacteria 2015
694 Ga0207711_10620217 3300025941 Bacteria 1009
695 Ga0207689_10000150 3300025942 Bacteria 60037
696 Ga0207689_10004063 3300025942 Bacteria 13296
697 Ga0207689_10039825 3300025942 Bacteria 3890
698 Ga0207689_10092876 3300025942 Bacteria 2479
699 Ga0207661_10223625 3300025944 Bacteria 1664
700 Ga0207661_10251383 3300025944 Bacteria 1571
701 Ga0207679_10000526 3300025945 Bacteria 25924
702 Ga0207679_10376029 3300025945 Bacteria 1244
703 Ga0207679_10735391 3300025945 Bacteria 897
704 Ga0207679_11091027 3300025945 Bacteria 732
705 Ga0207667_10017670 3300025949 Bacteria 8024
706 Ga0207667_10051278 3300025949 Bacteria 4351
707 Ga0207667_10058792 3300025949 Bacteria 4030
708 Ga0207667_10365980 3300025949 Bacteria 1470
709 Ga0207667_10422799 3300025949 Bacteria 1356
710 Ga0207667_10947305 3300025949 Bacteria 850
711 Ga0207651_10024727 3300025960 Bacteria 3720
712 Ga0207651_10054500 3300025960 Bacteria 2740
713 Ga0207651_10070213 3300025960 Bacteria 2477
714 Ga0207651_10139322 3300025960 Bacteria 1871
715 Ga0207651_10250820 3300025960 Bacteria 1448
716 Ga0207651_10368328 3300025960 Bacteria 1215
717 Ga0207651_10667556 3300025960 Bacteria 913
718 Ga0207651_10915573 3300025960 Bacteria 781
719 Ga0207651_11025210 3300025960 Bacteria 738
720 Ga0207712_10005810 3300025961 Bacteria 7776
721 Ga0207712_10235612 3300025961 Bacteria 1472
722 Ga0207712_11092450 3300025961 Bacteria 710
723 Ga0207712_11125984 3300025961 Bacteria 699
724 Ga0207712_12025538 3300025961 Unclassified 515
725 Ga0207668_10011424 3300025972 Bacteria 5395
726 Ga0207668_10122135 3300025972 Bacteria 1974
727 Ga0207668_10562435 3300025972 Bacteria 989
728 Ga0207668_10722312 3300025972 Bacteria 877
729 Ga0207668_10824186 3300025972 Bacteria 822
730 Ga0207668_11066805 3300025972 Bacteria 723
731 Ga0207640_10028981 3300025981 Bacteria 3392
732 Ga0207640_10171123 3300025981 Bacteria 1619
733 Ga0207640_10997769 3300025981 Bacteria 736
734 Ga0207658_10214471 3300025986 Bacteria 1615
735 Ga0207658_10309228 3300025986 Bacteria 1364
736 Ga0207658_11228038 3300025986 Bacteria 685
737 Ga0207677_10004048 3300026023 Bacteria 7828
738 Ga0207677_10005813 3300026023 Bacteria 6713
739 Ga0207677_10324355 3300026023 Bacteria 1281
740 Ga0207677_10327566 3300026023 Bacteria 1275
741 Ga0207677_10428668 3300026023 Bacteria 1128
742 Ga0207677_10552653 3300026023 Bacteria 1004
743 Ga0207703_10004632 3300026035 Bacteria 11238
744 Ga0207703_10229407 3300026035 Bacteria 1664
745 Ga0207703_10433776 3300026035 Bacteria 1225
746 Ga0207639_10103548 3300026041 Bacteria 2306
747 Ga0207639_10168705 3300026041 Bacteria 1851
748 Ga0207639_10351030 3300026041 Bacteria 1317
749 Ga0207639_10615356 3300026041 Bacteria 1002
750 Ga0207639_10793875 3300026041 Bacteria 882
751 Ga0207639_11221784 3300026041 Bacteria 705
752 Ga0207678_10002944 3300026067 Bacteria 15425
753 Ga0207678_10019447 3300026067 Bacteria 5967
754 Ga0207678_10173833 3300026067 Bacteria 1839
755 Ga0207678_10342410 3300026067 Bacteria 1289
756 Ga0207708_10353375 3300026075 Bacteria 1206
757 Ga0207702_10000858 3300026078 Bacteria 31796
758 Ga0207702_10092086 3300026078 Bacteria 2656
759 Ga0207702_11283335 3300026078 Bacteria 726
760 Ga0207641_10023323 3300026088 Bacteria 5099
761 Ga0207641_10112740 3300026088 Bacteria 2413
762 Ga0207641_10115736 3300026088 Bacteria 2384
763 Ga0207641_10422615 3300026088 Bacteria 1283
764 Ga0207641_10494474 3300026088 Bacteria 1187
765 Ga0207641_11894274 3300026088 Bacteria 598
766 Ga0207648_10000032 3300026089 Bacteria 128009
767 Ga0207648_10046240 3300026089 Bacteria 3816
768 Ga0207648_10190457 3300026089 Bacteria 1817
769 Ga0207648_10201201 3300026089 Bacteria 1766
770 Ga0207648_10283704 3300026089 Bacteria 1481
771 Ga0207648_10343108 3300026089 Bacteria 1345
772 Ga0207648_10416284 3300026089 Bacteria 1220
773 Ga0207648_10478695 3300026089 Bacteria 1137
774 Ga0207648_11494378 3300026089 Bacteria 635
775 Ga0207676_10001384 3300026095 Bacteria 18052
776 Ga0207676_10041627 3300026095 Bacteria 3528
777 Ga0207676_10049899 3300026095 Bacteria 3259
778 Ga0207676_10076457 3300026095 Bacteria 2705
779 Ga0207676_10101156 3300026095 Bacteria 2389
780 Ga0207676_10270744 3300026095 Bacteria 1538
781 Ga0207676_10657058 3300026095 Bacteria 1012
782 Ga0207674_10026390 3300026116 Bacteria 6172
783 Ga0207674_10399920 3300026116 Bacteria 1327
784 Ga0207674_10640577 3300026116 Bacteria 1026
785 Ga0207675_100007544 3300026118 Bacteria 10277
786 Ga0207675_100019975 3300026118 Bacteria 6251
787 Ga0207675_100024771 3300026118 Bacteria 5583
788 Ga0207675_100276646 3300026118 Bacteria 1630
789 Ga0207675_100344070 3300026118 Bacteria 1460
790 Ga0207675_100512014 3300026118 Bacteria 1196
791 Ga0207675_102088726 3300026118 Bacteria 583
792 Ga0207683_10071385 3300026121 Bacteria 3069
793 Ga0207683_10087371 3300026121 Bacteria 2773
794 Ga0207683_10139849 3300026121 Bacteria 2181
795 Ga0207683_10203248 3300026121 Bacteria 1801
796 Ga0207683_10216018 3300026121 Bacteria 1746
797 Ga0207683_10222535 3300026121 Bacteria 1720
798 Ga0207683_10241093 3300026121 Bacteria 1649
799 Ga0207683_10264170 3300026121 Bacteria 1572
800 Ga0207683_10368754 3300026121 Bacteria 1319
801 Ga0207683_10657540 3300026121 Bacteria 971
802 Ga0207683_11426343 3300026121 Bacteria 640
803 Ga0207698_10017650 3300026142 Bacteria 4848
804 Ga0207698_10113841 3300026142 Bacteria 2274
805 Ga0207698_10222604 3300026142 Bacteria 1706
806 Ga0207698_10341704 3300026142 Bacteria 1410
807 Ga0207698_10616022 3300026142 Bacteria 1072
808 Ga0207698_11153163 3300026142 Bacteria 788
809 Ga0207698_11189237 3300026142 Bacteria 776
810 Ga0207698_11391276 3300026142 Bacteria 717
811 Ga0209281_1000454 3300027111 Bacteria 58234
812 Ga0209371_1000004 3300027312 Bacteria 1098197
813 Ga0209371_1000139 3300027312 Bacteria 120350
814 Ga0209371_1012163 3300027312 Bacteria 2510
815 Ga0209981_1033683 3300027378 Bacteria 755
816 Ga0209995_1000673 3300027471 Bacteria 5247
817 Ga0209968_1004004 3300027526 Bacteria 2211
818 Ga0209999_1006384 3300027543 Bacteria 2119
819 Ga0209966_1000013 3300027695 Bacteria 83121
820 Ga0209974_10127120 3300027876 Bacteria 907
821 Ga0268266_10500541 3300028379 Bacteria 1160
822 Ga0268266_10557448 3300028379 Bacteria 1098
823 Ga0268266_10943343 3300028379 Bacteria 835
824 Ga0268265_10184817 3300028380 Bacteria 1794
825 Ga0268265_10943258 3300028380 Bacteria 850
826 Ga0268265_11436131 3300028380 Bacteria 692
827 Ga0268265_11956048 3300028380 Bacteria 593
828 Ga0268264_10003680 3300028381 Bacteria 13159
829 Ga0268264_10184062 3300028381 Bacteria 1899
830 Ga0268264_11163655 3300028381 Bacteria 780
831 Ga0265334_10068616 3300028573 Bacteria 1324
832 Ga0265336_10000048 3300028666 Bacteria 121572
833 Ga0307515_10031544 3300028794 Bacteria 8829
834 Ga0307515_10094450 3300028794 Bacteria 3694
835 Ga0268256_1000109 3300030500 Bacteria 120350
836 Ga0268256_1001254 3300030500 Bacteria 15855
837 Ga0268256_1014691 3300030500 Bacteria 2312
838 Ga0307511_10226617 3300030521 Bacteria 931
839 Ga0316177_1050317 3300030731 Bacteria 3595
840 Ga0314311_1227100 3300030733 Bacteria 1618
841 Ga0316178_1026542 3300030735 Bacteria 1051
842 Ga0316178_1140499 3300030735 Bacteria 953
843 Ga0316183_1078833 3300030742 Bacteria 911
844 Ga0316181_1113656 3300030744 Bacteria 1970
845 Ga0265328_10016658 3300031239 Bacteria 2856
846 Ga0265331_10004885 3300031250 Bacteria 8247
847 Ga0265327_10000043 3300031251 Bacteria 285108
848 Ga0265327_10095114 3300031251 Bacteria 1447
849 Ga0307513_10015579 3300031456 Bacteria 9209
850 Ga0307513_10057584 3300031456 Bacteria 4138
851 Ga0307509_10276599 3300031507 Bacteria 1443
852 Ga0307509_10283844 3300031507 Bacteria 1415
853 Ga0307408_100000038 3300031548 Bacteria 183170
854 Ga0307408_100286496 3300031548 Bacteria 1374
855 Ga0307408_100378910 3300031548 Bacteria 1209
856 Ga0307408_100641997 3300031548 Bacteria 948
857 Ga0307408_101159865 3300031548 Bacteria 719
858 Ga0307408_101211774 3300031548 Bacteria 704
859 Ga0307514_10031043 3300031649 Bacteria 4285
860 Ga0307516_10044934 3300031730 Bacteria 4366
861 Ga0307405_10161697 3300031731 Bacteria 1587
862 Ga0307405_10360148 3300031731 Bacteria 1125
863 Ga0307405_10874873 3300031731 Bacteria 758
864 Ga0307413_10035338 3300031824 Bacteria 2865
865 Ga0307413_10783783 3300031824 Bacteria 800
866 Ga0307413_11255018 3300031824 Bacteria 646
867 Ga0307410_10811381 3300031852 Bacteria 796
868 Ga0307406_10234019 3300031901 Bacteria 1374
869 Ga0307406_10348724 3300031901 Bacteria 1156
870 Ga0307406_11570938 3300031901 Bacteria 580
871 Ga0307407_10795692 3300031903 Bacteria 719
872 Ga0307412_10052360 3300031911 Bacteria 2703
873 Ga0307412_10312586 3300031911 Bacteria 1246
874 Ga0307409_101340320 3300031995 Bacteria 741
875 Ga0307416_100005668 3300032002 Bacteria 7714
876 Ga0307416_100924902 3300032002 Bacteria 973
877 Ga0307416_102243329 3300032002 Bacteria 647
878 Ga0307414_10001112 3300032004 Bacteria 13729
879 Ga0307414_10030948 3300032004 Bacteria 3502
880 Ga0307414_10035139 3300032004 Bacteria 3332
881 Ga0307414_10084330 3300032004 Bacteria 2337
882 Ga0307414_10124210 3300032004 Bacteria 1990
883 Ga0307414_10157996 3300032004 Bacteria 1797
884 Ga0307411_10145016 3300032005 Bacteria 1756
885 Ga0307411_10559843 3300032005 Bacteria 977
886 Ga0307411_11534074 3300032005 Bacteria 613
887 Ga0307411_11614389 3300032005 Bacteria 598
888 Ga0307411_11673954 3300032005 Bacteria 588
889 Ga0307415_100229695 3300032126 Bacteria 1493
890 Ga0307510_10411944 3300033180 Bacteria 794
891 Ga0373926_0139989 3300035083 Bacteria 919
892 Ga0373934_0098868 3300035086 Bacteria 1179
893 Ga0373944_0023948 3300035089 Bacteria 1785
894 Ga0373944_0095002 3300035089 Bacteria 1001
895 Ga0373949_0008217 3300035090 Bacteria 2286
896 Ga0373939_0039567 3300035114 Bacteria 1412
897 Ga0373941_0194969 3300035115 Bacteria 767
898 Ga0373945_0130581 3300035116 Bacteria 1006
899 Ga0373954_0266143 3300035118 Bacteria 844
900 Ga0373943_0017704 3300035170 Bacteria 3262
901 Ga0373943_0182775 3300035170 Bacteria 1153
902 Ga0373943_0268024 3300035170 Bacteria 963
903 Ga0373946_0088812 3300035171 Bacteria 1366
904 Ga0373955_0044738 3300035172 Bacteria 2386
905 Ga0373931_0004526 3300035691 Bacteria 6359
906 Ga0373931_0015753 3300035691 Bacteria 3710
907 Ga0373931_0464139 3300035691 Bacteria 812
908 Ga0373935_0025734 3300035692 Bacteria 3627
909 Ga0373927_0100032 3300035695 Bacteria 1886
910 Ga0373933_0266582 3300035724 Bacteria 1105
911 Ga0373947_0176775 3300035725 Bacteria 1388
912 Ga0373937_1581300 3300036401 Archaea 603
913 Ga0373925_0034245 3300037068 Bacteria 3743
914 Ga0373925_0240421 3300037068 Bacteria 1450
915 Ga0395898_0071311 3300037466 Bacteria 3357
916 Ga0395905_0007830 3300037471 Bacteria 10586
917 Ga0395905_0085597 3300037471 Bacteria 2953
918 Ga0395905_0677221 3300037471 Bacteria 934
919 Ga0395901_0002425 3300038443 Bacteria 18923
920 Ga0237819_00165 3300038705 Bacteria 24228
921 Ga0237819_03731 3300038705 Bacteria 2637
922 Ga0237819_23238 3300038705 Bacteria 613
923 Ga0237816_00056 3300039145 Bacteria 7446
924 Ga0436361_0001966 3300039447 Bacteria 850
925 Ga0436361_0082864 3300039447 Bacteria 107951
926 Ga0436361_0196856 3300039447 Bacteria 12572
927 Ga0436361_0243330 3300039447 Bacteria 1905
928 Ga0436361_0298548 3300039447 Bacteria 2699
929 Ga0436361_0417753 3300039447 Bacteria 644
930 Ga0436361_0875016 3300039447 Bacteria 1585
931 Ga0439436_0029225 3300041404 Bacteria 1606
932 Ga0439436_0046239 3300041404 Bacteria 1237
933 Ga0439436_0049064 3300041404 Bacteria 1196
934 Ga0439436_0078777 3300041404 Bacteria 917
935 Ga0439439_0018662 3300041406 Bacteria 1716
936 Ga0439447_009343 3300041407 Bacteria 2980
937 Ga0439461_0098887 3300041410 Bacteria 708
938 Ga0439465_0000224 3300041413 Bacteria 15264
939 Ga0439465_0043300 3300041413 Bacteria 1460
940 Ga0451787_452960 3300041441 Bacteria 1038
941 Ga0451789_0698365 3300041443 Bacteria 2226
942 Ga0451789_1349124 3300041443 Bacteria 872
943 Ga0451791_0319337 3300041451 Bacteria 1116
944 Ga0451791_0672470 3300041451 Bacteria 1622
945 Ga0451791_1799097 3300041451 Bacteria 783
946 Ga0451793_0050907 3300041452 Bacteria 608
947 Ga0451793_0143369 3300041452 Bacteria 1375
948 Ga0451793_0248334 3300041452 Bacteria 1186
949 Ga0451793_0594577 3300041452 Bacteria 3345
950 Ga0451793_0678761 3300041452 Bacteria 1002
951 Ga0451793_0736074 3300041452 Bacteria 883
952 Ga0451793_1247833 3300041452 Bacteria 576
953 Ga0451797_0685350 3300041453 Bacteria 637
954 Ga0451797_1106636 3300041453 Bacteria 1282
955 Ga0451797_1204767 3300041453 Bacteria 1499
956 Ga0451797_1248801 3300041453 Bacteria 1257
957 Ga0451795_1315014 3300041456 Bacteria 729
958 Ga0451795_1586870 3300041456 Bacteria 1220
959 Ga0451800_0098586 3300041459 Bacteria 16354
960 Ga0451800_0163389 3300041459 Bacteria 606
961 Ga0451800_0493538 3300041459 Bacteria 536
962 Ga0451800_1079773 3300041459 Bacteria 516
963 Ga0451802_1524292 3300041460 Bacteria 1115
964 Ga0451802_1644705 3300041460 Bacteria 687
965 Ga0451802_1817188 3300041460 Bacteria 800
966 Ga0451802_1988730 3300041460 Bacteria 1486
967 Ga0451806_420239 3300041462 Bacteria 6696
968 Ga0451804_0562792 3300041463 Bacteria 3717
969 Ga0451807_0155804 3300041486 Bacteria 1131
970 Ga0451807_0183383 3300041486 Bacteria 4326
971 Ga0451807_1621004 3300041486 Bacteria 1475
972 Ga0451807_1664147 3300041486 Bacteria 4084
973 Ga0451807_1787886 3300041486 Bacteria 743
974 Ga0451837_0237264 3300041494 Bacteria 1207
975 Ga0451837_0800704 3300041494 Bacteria 647
976 Ga0451837_1130467 3300041494 Bacteria 1050
977 Ga0451837_1211241 3300041494 Bacteria 3067
978 Ga0451841_0157733 3300041498 Bacteria 1074
979 Ga0451841_0649399 3300041498 Bacteria 573
980 Ga0451841_1302887 3300041498 Bacteria 855
981 Ga0451841_1334294 3300041498 Bacteria 1134
982 Ga0451849_1462010 3300041505 Bacteria 681
983 Ga0451843_0012520 3300041509 Bacteria 12259
984 Ga0451843_0155094 3300041509 Bacteria 1304
985 Ga0451843_0200154 3300041509 Bacteria 784
986 Ga0451843_0206726 3300041509 Bacteria 954
987 Ga0451843_0305339 3300041509 Bacteria 679
988 Ga0451843_1170934 3300041509 Bacteria 1602
989 Ga0451843_1499722 3300041509 Bacteria 812
990 Ga0451843_1503963 3300041509 Bacteria 532
991 Ga0451843_1540849 3300041509 Bacteria 898
992 Ga0451853_0334304 3300041512 Bacteria 802
993 Ga0451853_1029461 3300041512 Bacteria 799
994 Ga0439433_0053903 3300041999 Bacteria 951
995 Ga0439433_0070620 3300041999 Bacteria 841
996 Ga0439433_0092143 3300041999 Bacteria 746
997 Ga0439433_0093817 3300041999 Bacteria 740
998 Ga0439445_0004656 3300042004 Bacteria 3110
999 Ga0439445_0027529 3300042004 Bacteria 1461
1000 Ga0439445_0097862 3300042004 Bacteria 831
1001 Ga0439432_019776 3300042006 Bacteria 2241
1002 Ga0439432_120041 3300042006 Bacteria 779
1003 Ga0439432_172159 3300042006 Bacteria 632
1004 Ga0439449_0005798 3300042007 Bacteria 4721
1005 Ga0439449_0013136 3300042007 Bacteria 3115
1006 Ga0439449_0013961 3300042007 Bacteria 3021
1007 Ga0439449_0029827 3300042007 Bacteria 2032
1008 Ga0439449_0051250 3300042007 Bacteria 1526
1009 Ga0439449_0109806 3300042007 Bacteria 1021
1010 Ga0439452_025555 3300042010 Bacteria 1498
1011 Ga0439454_006386 3300042011 Bacteria 1447
1012 Ga0439462_0067379 3300042015 Bacteria 971
1013 Ga0439462_0172200 3300042015 Bacteria 612
1014 Ga0450911_005582 3300042115 Bacteria 1934
1015 Ga0450919_001239 3300042121 Bacteria 3337
1016 Ga0450890_007668 3300042127 Bacteria 1380
1017 Ga0450890_011251 3300042127 Bacteria 1154
1018 Ga0439458_0120940 3300042157 Bacteria 689
1019 Ga0439434_0041674 3300042435 Bacteria 1411
1020 Ga0439435_0099125 3300042436 Bacteria 894
1021 Ga0439459_0000618 3300042438 Bacteria 4773
1022 Ga0450918_000320 3300042531 Bacteria 10812
1023 Ga0450901_007565 3300042533 Bacteria 1118
1024 Ga0451577_0177731 3300042876 Bacteria 1919
1025 Ga0466963_0453115 3300044694 Bacteria 905
1026 Ga0466963_0935684 3300044694 Bacteria 610
1027 Ga0453684_0118653 3300044712 Bacteria 3199
1028 Ga0453684_0473057 3300044712 Bacteria 1391
1029 Ga0453684_0584012 3300044712 Bacteria 1227
1030 Ga0451576_0041719 3300045051 Bacteria 4850
1031 Ga0451576_2363323 3300045051 Bacteria 544
1032 Ga0495627_095254 3300046453 Bacteria 853
1033 Ga0495592_0473932 3300046454 Bacteria 781
1034 Ga0495629_0180753 3300046459 Bacteria 1462
1035 Ga0495629_0330467 3300046459 Bacteria 1041
1036 Ga0495638_0032789 3300046460 Bacteria 3325
1037 Ga0495638_0156728 3300046460 Bacteria 1317
1038 Ga0495638_0265569 3300046460 Bacteria 939
1039 Ga0495651_0260417 3300046462 Bacteria 1180
1040 Ga0495580_0213174 3300046472 Bacteria 1328
1041 Ga0495580_0517029 3300046472 Bacteria 796
1042 Ga0495639_0018018 3300046475 Bacteria 3071
1043 Ga0495639_0392848 3300046475 Bacteria 700
1044 Ga0495607_0053436 3300046501 Bacteria 2334
1045 Ga0495583_0000017 3300046506 Bacteria 310888
1046 Ga0495606_0002049 3300046507 Bacteria 24679
1047 Ga0495606_0017003 3300046507 Bacteria 5517
1048 Ga0495608_0257061 3300046511 Bacteria 1088
1049 Ga0495610_0013938 3300046512 Bacteria 4750
1050 Ga0495610_0214813 3300046512 Bacteria 780
1051 Ga0495616_0163313 3300046513 Bacteria 1000
1052 Ga0495616_0260072 3300046513 Bacteria 743
1053 Ga0495628_0053645 3300046516 Bacteria 3181
1054 Ga0495631_0020149 3300046518 Bacteria 3119
1055 Ga0495631_0424324 3300046518 Bacteria 566
1056 Ga0495643_0017194 3300046522 Bacteria 4232
1057 Ga0495643_0166135 3300046522 Bacteria 1082
1058 Ga0495643_0177871 3300046522 Bacteria 1036
1059 Ga0495644_0370484 3300046523 Bacteria 565
1060 Ga0495663_0000403 3300046525 Bacteria 15874
1061 Ga0495663_0010083 3300046525 Bacteria 2624
1062 Ga0495663_0025947 3300046525 Bacteria 1712
1063 Ga0495663_0037832 3300046525 Bacteria 1456
1064 Ga0495652_0149595 3300046529 Bacteria 1826
1065 Ga0495586_0174081 3300046535 Bacteria 1216
1066 Ga0495598_0002515 3300046537 Bacteria 3790
1067 Ga0495621_0018217 3300046539 Bacteria 2278
1068 Ga0495645_0205136 3300046543 Bacteria 1334
1069 Ga0495633_0041373 3300046558 Bacteria 2191
1070 Ga0495633_0065198 3300046558 Bacteria 1702
1071 Ga0495633_0073528 3300046558 Bacteria 1593
1072 Ga0495633_0075520 3300046558 Bacteria 1569
1073 Ga0495633_0172944 3300046558 Bacteria 995
1074 Ga0495667_0480747 3300046559 Bacteria 779
1075 Ga0495668_0004728 3300046616 Bacteria 9544
1076 Ga0495625_0162856 3300046660 Bacteria 1493
1077 Ga0495647_0081064 3300046681 Bacteria 1316
1078 Ga0495658_0067293 3300046683 Bacteria 2071
1079 Ga0495669_0043381 3300046684 Bacteria 2002
1080 Ga0495613_0315803 3300046689 Bacteria 1079
1081 Ga0495670_0304692 3300046691 Bacteria 854
1082 Ga0495649_0000290 3300046694 Bacteria 44246
1083 Ga0495589_0022418 3300046794 Bacteria 3222
1084 Ga0495600_0289034 3300046809 Bacteria 1036
1085 Ga0495660_0070482 3300046810 Bacteria 1855
1086 Ga0495581_0816904 3300047315 Bacteria 534
1087 Ga0495674_0170461 3300047319 Bacteria 1817
1088 Ga0495672_0020455 3300047320 Bacteria 4337
1089 Ga0495676_0677485 3300047321 Bacteria 668
1090 Ga0495680_0141619 3300047322 Bacteria 1759
1091 Ga0495681_0108015 3300047470 Bacteria 1208
1092 Ga0495681_0164916 3300047470 Bacteria 920
1093 Ga0495684_0194495 3300047471 Bacteria 1498
1094 Ga0495684_0414770 3300047471 Bacteria 942
1095 Ga0495686_0007645 3300047472 Bacteria 8069
1096 Ga0495686_0031505 3300047472 Bacteria 3438
1097 Ga0495686_0063006 3300047472 Bacteria 2298
1098 Ga0495614_0533740 3300048089 Bacteria 560
1099 Ga0496100_0352475 3300048903 Bacteria 1112
1100 Ga0496101_0025070 3300048904 Bacteria 4134
1101 Ga0496101_0605370 3300048904 Bacteria 866
1102 Ga0496101_1123846 3300048904 Bacteria 617
1103 Ga0496102_0021039 3300048905 Bacteria 5769
1104 Ga0496102_1164163 3300048905 Bacteria 691
1105 Ga0496102_1648442 3300048905 Bacteria 559
1106 Ga0496104_0031783 3300048907 Bacteria 4911
1107 Ga0496104_0180037 3300048907 Bacteria 2024
1108 Ga0496104_0274434 3300048907 Bacteria 1599
1109 Ga0496104_0834569 3300048907 Bacteria 827
1110 Ga0496105_0112275 3300048908 Bacteria 2249
1111 Ga0496105_0293844 3300048908 Bacteria 1308
1112 Ga0496105_0310431 3300048908 Bacteria 1266
1113 Ga0496105_1020548 3300048908 Bacteria 618
1114 Ga0496106_0136718 3300048909 Bacteria 1925
1115 Ga0496107_0009476 3300048910 Bacteria 6755
1116 Ga0496107_0617220 3300048910 Bacteria 801
1117 Ga0496107_1156862 3300048910 Bacteria 557
1118 Ga0496108_0028568 3300048911 Bacteria 4615
1119 Ga0496108_0090486 3300048911 Bacteria 2601
1120 Ga0496108_0171248 3300048911 Bacteria 1878
1121 Ga0496108_1358367 3300048911 Bacteria 596
1122 Ga0496108_1505014 3300048911 Bacteria 560
1123 Ga0496109_0241197 3300048912 Bacteria 1701
1124 Ga0496109_0303698 3300048912 Bacteria 1505
1125 Ga0496109_0318559 3300048912 Bacteria 1467
1126 Ga0496109_0499144 3300048912 Bacteria 1149
1127 Ga0496110_0085437 3300048913 Bacteria 2816
1128 Ga0496110_0415617 3300048913 Bacteria 1226
1129 Ga0496110_0528202 3300048913 Bacteria 1073
1130 Ga0496110_0597742 3300048913 Bacteria 1001
1131 Ga0496110_1190467 3300048913 Bacteria 671
1132 Ga0496111_0561302 3300048914 Bacteria 838
1133 Ga0496113_0040667 3300048916 Bacteria 3427
1134 Ga0496113_0321985 3300048916 Bacteria 1239
1135 Ga0496113_0886030 3300048916 Bacteria 706
1136 Ga0496114_0015156 3300048917 Bacteria 6200
1137 Ga0496114_0074221 3300048917 Bacteria 2863
1138 Ga0496114_0272554 3300048917 Bacteria 1491
1139 Ga0496114_0793921 3300048917 Bacteria 825
1140 Ga0496114_1346753 3300048917 Bacteria 601
1141 Ga0496115_0553805 3300048918 Bacteria 919
1142 Ga0496116_0031581 3300048919 Bacteria 3788
1143 Ga0496116_0033409 3300048919 Bacteria 3651
1144 Ga0496117_0001966 3300048920 Bacteria 27335
1145 Ga0496117_0040292 3300048920 Bacteria 3436
1146 Ga0496117_0058821 3300048920 Bacteria 2659
1147 Ga0496117_0070332 3300048920 Bacteria 2351
1148 Ga0496117_0070874 3300048920 Bacteria 2338
1149 Ga0496117_0342268 3300048920 Bacteria 775
1150 Ga0496118_0027915 3300048921 Bacteria 4766
1151 Ga0496118_0032595 3300048921 Bacteria 4287
1152 Ga0496118_0045304 3300048921 Bacteria 3435
1153 Ga0496118_0107848 3300048921 Bacteria 1858
1154 Ga0496118_0168104 3300048921 Bacteria 1344
1155 Ga0496118_0189991 3300048921 Bacteria 1229
1156 Ga0496118_0404177 3300048921 Bacteria 708
1157 Ga0496119_0000255 3300048922 Bacteria 75611
1158 Ga0496119_0004546 3300048922 Bacteria 13747
1159 Ga0496119_0149564 3300048922 Bacteria 1253
1160 Ga0496120_0000240 3300048923 Bacteria 93297
1161 Ga0496120_0000598 3300048923 Bacteria 54693
1162 Ga0496121_0008127 3300048924 Bacteria 12469
1163 Ga0496121_0098890 3300048924 Bacteria 2256
1164 Ga0496121_0157964 3300048924 Bacteria 1662
1165 Ga0496121_0648438 3300048924 Bacteria 643
1166 Ga0496122_0000663 3300048925 Bacteria 69218
1167 Ga0496122_0006648 3300048925 Bacteria 13181
1168 Ga0496122_0097579 3300048925 Bacteria 1977
1169 Ga0496122_0128618 3300048925 Bacteria 1615
1170 Ga0496122_0142513 3300048925 Bacteria 1496
1171 Ga0496122_0455300 3300048925 Bacteria 633
1172 Ga0496122_0472294 3300048925 Bacteria 616
1173 Ga0496123_0000828 3300048926 Bacteria 49715
1174 Ga0496123_0001279 3300048926 Bacteria 35949
1175 Ga0496123_0023685 3300048926 Bacteria 4692
1176 Ga0496123_0098020 3300048926 Bacteria 1715
1177 Ga0496123_0121913 3300048926 Bacteria 1464
1178 Ga0496123_0129133 3300048926 Bacteria 1404
1179 Ga0496123_0204322 3300048926 Bacteria 1009
1180 Ga0496123_0309310 3300048926 Bacteria 750
1181 Ga0496124_0000009 3300048927 Bacteria 734820
1182 Ga0496124_0021163 3300048927 Bacteria 5995
1183 Ga0496124_0026783 3300048927 Bacteria 5191
1184 Ga0496124_0030421 3300048927 Bacteria 4792
1185 Ga0496124_0076288 3300048927 Bacteria 2767
1186 Ga0496124_0172938 3300048927 Bacteria 1670
1187 Ga0496124_0188838 3300048927 Bacteria 1579
1188 Ga0496124_0204340 3300048927 Bacteria 1499
1189 Ga0496124_0280324 3300048927 Bacteria 1215
1190 Ga0496124_0303126 3300048927 Bacteria 1152
1191 Ga0496125_0025528 3300048928 Bacteria 5408
1192 Ga0496125_0071631 3300048928 Bacteria 2706
1193 Ga0496125_0077343 3300048928 Bacteria 2565
1194 Ga0496125_0089734 3300048928 Bacteria 2310
1195 Ga0496125_0100233 3300048928 Bacteria 2136
1196 Ga0496125_0112107 3300048928 Bacteria 1972
1197 Ga0496125_0148737 3300048928 Bacteria 1613
1198 Ga0496125_0717106 3300048928 Bacteria 528
1199 Ga0496126_0006652 3300048929 Bacteria 12862
1200 Ga0496126_0084112 3300048929 Bacteria 2807
1201 Ga0496126_0086702 3300048929 Bacteria 2759
1202 Ga0496126_0208506 3300048929 Bacteria 1646
1203 Ga0496126_0345333 3300048929 Bacteria 1218
1204 Ga0496126_0375082 3300048929 Bacteria 1159
1205 Ga0501306_023887 3300049127 Bacteria 870
1206 Ga0501308_007083 3300049128 Bacteria 1167
1207 Ga0501309_001733 3300049129 Bacteria 2217
1208 Ga0501310_000865 3300049130 Bacteria 2705
1209 Ga0501310_028433 3300049130 Bacteria 733
1210 Ga0501304_000917 3300049160 Bacteria 1739
1211 Ga0501304_018257 3300049160 Bacteria 676
1212 Ga0501305_003418 3300049161 Bacteria 1795
1213 Ga0501294_009168 3300049517 Bacteria 970
1214 Ga0501297_004528 3300049520 Bacteria 1426
1215 Ga0501298_083728 3300049521 Bacteria 705
1216 Ga0501300_001357 3300049523 Bacteria 3684
1217 Ga0501312_003406 3300049528 Bacteria 1802
1218 Ga0501313_023853 3300049529 Bacteria 768
1219 Ga0501314_002220 3300049530 Bacteria 1482
1220 Ga0501315_002024 3300049531 Bacteria 1848
1221 Ga0501317_004293 3300049533 Bacteria 1475
1222 Ga0501321_026828 3300049537 Bacteria 749
1223 Ga0501031_0025514 3300049568 Bacteria 3854
1224 Ga0501031_0042415 3300049568 Bacteria 2970
1225 Ga0501031_0656317 3300049568 Bacteria 674
1226 Ga0501032_0022123 3300049569 Bacteria 4411
1227 Ga0501032_0228684 3300049569 Bacteria 1209
1228 Ga0501033_0010061 3300049570 Bacteria 7261
1229 Ga0501033_0085355 3300049570 Bacteria 2312
1230 Ga0501033_0271942 3300049570 Bacteria 1197
1231 Ga0501034_0021863 3300049571 Bacteria 6517
1232 Ga0501034_0035289 3300049571 Bacteria 5070
1233 Ga0501034_0072309 3300049571 Bacteria 3457
1234 Ga0501036_0073796 3300049572 Bacteria 2884
1235 Ga0501036_0323981 3300049572 Bacteria 1287
1236 Ga0501036_1011383 3300049572 Bacteria 680
1237 Ga0501037_0020065 3300049573 Bacteria 4933
1238 Ga0501038_0014117 3300049574 Bacteria 7277
1239 Ga0501038_0026943 3300049574 Bacteria 5116
1240 Ga0501039_0067085 3300049575 Bacteria 2786
1241 Ga0501039_0255226 3300049575 Bacteria 1378
1242 Ga0501043_0000004 3300049579 Bacteria 291085
1243 Ga0501043_0021135 3300049579 Bacteria 5102
1244 Ga0501043_0229570 3300049579 Bacteria 1434
1245 Ga0501046_0000050 3300049580 Bacteria 134922
1246 Ga0501047_0000012 3300049581 Bacteria 368824
1247 Ga0501047_0021327 3300049581 Bacteria 6218
1248 Ga0501047_0171970 3300049581 Bacteria 2035
1249 Ga0501048_0010686 3300049582 Bacteria 6845
1250 Ga0501068_0936823 3300049584 Bacteria 570
1251 Ga0501070_0045102 3300049586 Bacteria 3667
1252 Ga0501070_0164408 3300049586 Bacteria 1829
1253 Ga0501071_0460648 3300049587 Bacteria 973
1254 Ga0501073_0065946 3300049589 Bacteria 2524
1255 Ga0501198_000004 3300049649 Bacteria 175146
1256 Ga0501199_015195 3300049650 Bacteria 860
1257 Ga0501206_006551 3300049653 Bacteria 1515
1258 Ga0501211_002448 3300049658 Bacteria 1961
1259 Ga0501217_027085 3300049661 Bacteria 1389
1260 Ga0501222_000038 3300049662 Bacteria 51424
1261 Ga0501222_008815 3300049662 Bacteria 1336
1262 Ga0501223_009832 3300049663 Bacteria 1931
1263 Ga0501235_024396 3300049669 Bacteria 1350
1264 Ga0501250_012952 3300049680 Bacteria 994
1265 Ga0501251_052739 3300049681 Bacteria 649
1266 Ga0501253_018493 3300049683 Bacteria 1190
1267 Ga0501255_001001 3300049684 Bacteria 2155
1268 Ga0501258_006361 3300049687 Bacteria 1170
1269 Ga0501261_009717 3300049690 Bacteria 1258
1270 Ga0501225_0025880 3300049705 Bacteria 1614
1271 Ga0501225_0038030 3300049705 Bacteria 1326
1272 Ga0501229_000597 3300049706 Bacteria 4050
1273 Ga0501080_0016883 3300049742 Bacteria 6742
1274 Ga0501080_1590210 3300049742 Bacteria 554
1275 Ga0501080_1872194 3300049742 Bacteria 503
1276 Ga0501232_032573 3300049757 Bacteria 731
1277 Ga0501262_002037 3300049759 Bacteria 2279
1278 Ga0501265_010324 3300049762 Bacteria 1138
1279 Ga0501267_001203 3300049764 Bacteria 2172
1280 Ga0501268_103430 3300049765 Bacteria 613
1281 Ga0501272_005104 3300049769 Bacteria 1376
1282 Ga0501282_013499 3300049778 Bacteria 885
1283 Ga0501035_0014880 3300049822 Bacteria 7180
1284 Ga0501035_0192031 3300049822 Bacteria 1755
1285 Ga0501044_0019187 3300049823 Bacteria 7319
1286 Ga0501044_0037114 3300049823 Bacteria 5095
1287 Ga0501044_1020321 3300049823 Bacteria 699
1288 Ga0501044_1567984 3300049823 Bacteria 523
1289 Ga0501044_1602328 3300049823 Bacteria 516
1290 Ga0501045_0016727 3300049824 Bacteria 5209
1291 Ga0501226_033241 3300049853 Bacteria 589
1292 nmdc:mga03683_315569_c1 3300050489 Bacteria 735
1293 nmdc:mga03n38_539604_c1 3300050490 Bacteria 659
1294 nmdc:mga00v17_153575_c1 3300050491 Bacteria 1480
1295 nmdc:mga0yw44_104612_c1 3300050492 Bacteria 1807
1296 nmdc:mga0k408_129139_c1 3300050493 Bacteria 1500
1297 nmdc:mga0k408_186563_c1 3300050493 Bacteria 1237
1298 nmdc:mga0k408_293352_c1 3300050493 Bacteria 970
1299 nmdc:mga07m45_187418_c1 3300050496 Bacteria 1203
1300 nmdc:mga07m45_46177_c1 3300050496 Bacteria 2446
1301 nmdc:mga07m45_61691_c1 3300050496 Bacteria 2124
1302 nmdc:mga08y16_1337202_c1 3300050511 Bacteria 682
1303 nmdc:mga08y16_749189_c1 3300050511 Bacteria 973
1304 Ga0495601_0144456 3300053077 Bacteria 1552
1305 Ga0495612_0238028 3300053078 Bacteria 808
1306 Ga0495612_0358143 3300053078 Bacteria 659
1307 Ga0500635_0000046 3300053080 Bacteria 84743
1308 Ga0495595_0160133 3300053084 Bacteria 1110
1309 Ga0495619_0173642 3300053085 Bacteria 1491
1310 Ga0500651_0000088 3300053093 Bacteria 59179
1311 Ga0500658_0180230 3300053134 Bacteria 962
1312 Ga0500559_0050725 3300053136 Bacteria 1831
1313 Ga0500564_088801 3300053138 Bacteria 1378
1314 Ga0500577_0340038 3300053142 Bacteria 656
1315 Ga0500604_0155491 3300053151 Bacteria 778
1316 Ga0500622_0019200 3300053156 Bacteria 3630
1317 Ga0500634_0000049 3300053161 Bacteria 53534
1318 Ga0500636_0182491 3300053177 Bacteria 1125
1319 Ga0501084_0879507 3300054114 Bacteria 754
1320 2547503041 2547132130 Bacteria 4660562
1321 2572253883 2571042365 Bacteria 3289345
1322 2578458467 2576861471 Bacteria 4648976
1323 2643745674 2643221544 Bacteria 5886209
1324 2643907762 2643221579 Bacteria 4443405
1325 2643916031 2643221581 Bacteria 3893603
1326 2644221564 2643221639 Bacteria 6649903
1327 2644245444 2643221644 Bacteria 6865017
1328 2644257675 2643221646 Bacteria 6433402
1329 2644529358 2643221695 Bacteria 3441323
1330 2747947750 2747842428 Bacteria 4689383
1331 2748019495 2747842501 Bacteria 5293829
1332 2765578937 2765235840 Bacteria 4663337
1333 2816516997 2816332141 Bacteria 4436036
1334 2819659635 2818991457 Bacteria 5323295
1335 2831865637 2831864461 Bacteria 6502356
1336 2842393018 2842391507 Bacteria 4486072
1337 2842760247 2842757796 Bacteria 3981385
1338 2842780750 2842780639 Bacteria 4337790
1339 2852650889 2852649853 Bacteria 4036942
1340 2852685563 2852684882 Bacteria 5463342
1341 2857443732 2857442823 Bacteria 4562550
1342 2874221577 2874220319 Bacteria 4594709
1343 2895500662 2895498888 Bacteria 5283788
1344 2895516468 2895511927 Bacteria 6802080
1345 2895523612 2895522137 Bacteria 3284416
1346 2895526806 2895525241 Bacteria 3388457
1347 2919089756 2919089067 Bacteria 4560942
1348 2919131710 2919130084 Bacteria 5301837
1349 2919137695 2919134579 Bacteria 4480386
1350 2923518440 2923516293 Bacteria 3716336
1351 2928499461 2928496128 Bacteria 4631123
1352 2929197920 2929195423 Bacteria 5325372
1353 2931380798 2931380184 Bacteria 4455911
1354 2937612396 2937610967 Bacteria 4618818
1355 2939591400 2939589442 Bacteria 4214238
1356 2939623537 2939622612 Bacteria 4698046
1357 2939627373 2939626828 Bacteria 4695272
1358 2941478265 2941475908 Bacteria 4145589
1359 2941490126 2941489479 Bacteria 6313767
1360 2961048344 2961047084 Bacteria 4594415
1361 2961065340 2961064222 Bacteria 4749990
1362 2974309038 2974307012 Bacteria 4172388
1363 2977249755 2977247770 Bacteria 4160543
1364 2984515755 2984514374 Bacteria 4172479
1365 2987606381 2987605356 Bacteria 4187822
1366 2995951936 2995948881 Bacteria 6358104
1367 8002871887 8002869464 Bacteria 3588529
1368 8021624682 8021622325 Bacteria 4844743
1369 8021629196 8021626552 Bacteria 4665214
1370 8021649063 8021648035 Bacteria 4772378
1371 Ga0055543_1012054
1372 SwRhRL2b_contig_2733011
1373 SwRhRL2b_contig_3886549
1374 JGI25156J39149_1002197
1375 JGI25156J39149_1006806
1376 JGI25154J39366_1001260
1377 JGI25157J39369_1000491
1378 JGI25164J39214_1009409
1379 Ga0006778J45830_1039144
1380 rootH1_10002740
1381 rootH1_10002744
1382 rootH1_10017987
1383 rootH2_10019340
1384 rootH2_10083712
1385 rootH2_10187889
1386 rootL2_10002046
1387 rootL2_10047399
1388 rootL2_10049164
1389 rootL2_10136592
1390 rootL2_10197176
1391 rootL2_10256599
1392 rootH1_10038473
1393 rootH1_10058276
1394 rootH1_10061833
1395 rootH1_10072793
1396 rootH1_10143584
1397 rootH1_10235777
1398 Ga0055539_1000279
1399 Ga0055539_1002101
1400 Ga0055539_1023488
1401 Ga0055533_1000025
1402 Ga0055525_1000046
1403 Ga0055525_1001306
1404 Ga0055535_1000122
1405 Ga0055535_1016001
1406 Ga0055529_1000199
1407 Ga0055526_1000101
1408 Ga0055526_1003565
1409 Ga0055526_1006205
1410 Ga0055537_1000091
1411 Ga0055537_1000459
1412 Ga0055537_1000560
1413 Ga0055524_1000574
1414 Ga0055524_1001859
1415 Ga0055524_1012111
1416 Ga0055524_1032069
1417 Ga0055524_1032769
1418 Ga0055536_1001901
1419 Ga0055536_1003184
1420 Ga0055536_1005396
1421 Ga0055536_1014378
1422 Ga0055534_1000043
1423 Ga0055534_1000078
1424 Ga0055528_1000075
1425 Ga0055528_1000087
1426 Ga0055530_10001911
1427 Ga0055530_10007441
1428 Ga0055530_10008282
1429 Ga0055530_10010812
1430 Ga0055530_10030449
1431 Ga0055530_10053491
1432 Ga0055540_1000004
1433 Ga0055540_1000035
1434 Ga0055540_1014970
1435 Ga0055540_1028470
1436 Ga0055540_1046447
1437 Ga0055531_10010928
1438 Ga0055531_10012582
1439 Ga0055531_10020086
1440 Ga0055531_10025346
1441 Ga0055531_10028318
1442 Ga0058692_1000060
1443 Ga0058692_1000555
1444 Ga0055543_1003835
1445 Ga0065165_1000239
1446 Ga0065165_1000401
1447 Ga0065165_1076663
1448 Ga0065704_10000521
1449 Ga0065704_10078724
1450 Ga0065704_10138923
1451 Ga0065704_10193942
1452 Ga0065715_10160732
1453 Ga0070658_10005332
1454 Ga0070658_10138163
1455 Ga0070658_10166330
1456 Ga0070658_10501468
1457 Ga0070676_10116453
1458 Ga0070676_10163474
1459 Ga0070676_10232491
1460 Ga0070676_10271029
1461 Ga0070676_10301012
1462 Ga0070676_10812898
1463 Ga0070683_100159377
1464 Ga0070683_100239841
1465 Ga0070690_100019205
1466 Ga0070690_100028644
1467 Ga0070690_100143883
1468 Ga0070690_100273359
1469 Ga0070670_100003584
1470 Ga0070670_100034566
1471 Ga0070670_100117018
1472 Ga0070670_100150580
1473 Ga0070670_100164485
1474 Ga0070670_100202876
1475 Ga0070670_100265353
1476 Ga0070670_101077045
1477 Ga0070670_101916629
1478 Ga0070677_10025590
1479 Ga0070677_10052737
1480 Ga0070677_10084279
1481 Ga0070677_10125290
1482 Ga0070677_10291543
1483 Ga0068869_100083709
1484 Ga0068869_100092019
1485 Ga0068869_100113189
1486 Ga0068869_100133862
1487 Ga0068869_100805593
1488 Ga0070666_10022849
1489 Ga0070666_10033683
1490 Ga0070666_10725171
1491 Ga0070680_100200755
1492 Ga0070682_100319171
1493 Ga0070682_100366638
1494 Ga0070682_100441809
1495 Ga0068868_100010923
1496 Ga0068868_100105165
1497 Ga0068868_100625760
1498 Ga0068868_100627545
1499 Ga0068868_100628643
1500 Ga0068868_101225452
1501 Ga0070660_100177344
1502 Ga0070660_100258905
1503 Ga0070660_100415469
1504 Ga0070660_100441923
1505 Ga0070689_100080869
1506 Ga0070689_100221359
1507 Ga0070689_100240708
1508 Ga0070689_100383657
1509 Ga0070687_100008132
1510 Ga0070687_100317632
1511 Ga0070687_100331125
1512 Ga0070687_100603233
1513 Ga0070661_100084736
1514 Ga0070661_100230417
1515 Ga0070661_100254344
1516 Ga0070692_10275966
1517 Ga0070668_100065280
1518 Ga0070668_100106945
1519 Ga0070668_100149654
1520 Ga0070668_100436334
1521 Ga0070668_101435490
1522 Ga0070669_100001896
1523 Ga0070669_100021831
1524 Ga0070669_100095163
1525 Ga0070669_100497763
1526 Ga0070669_100709599
1527 Ga0070669_100843272
1528 Ga0070675_100001199
1529 Ga0070675_100027333
1530 Ga0070675_100038320
1531 Ga0070675_100262615
1532 Ga0070675_100562965
1533 Ga0070675_100633071
1534 Ga0070675_101151747
1535 Ga0070671_100009616
1536 Ga0070671_100069035
1537 Ga0070671_100121757
1538 Ga0070671_100134304
1539 Ga0070671_100158250
1540 Ga0070671_100401989
1541 Ga0070671_100437577
1542 Ga0070671_100737062
1543 Ga0070671_100878486
1544 Ga0070674_100003764
1545 Ga0070674_100187003
1546 Ga0070674_100271492
1547 Ga0070674_100588240
1548 Ga0070674_101091653
1549 Ga0070673_100073367
1550 Ga0070673_100205364
1551 Ga0070673_100227369
1552 Ga0070673_100236454
1553 Ga0070673_100366647
1554 Ga0070673_100708241
1555 Ga0070673_100724620
1556 Ga0070688_100075599
1557 Ga0070688_100114079
1558 Ga0070659_100000336
1559 Ga0070659_100090132
1560 Ga0070659_100209986
1561 Ga0070659_100377472
1562 Ga0070659_101023812
1563 Ga0070667_100005446
1564 Ga0070667_100016792
1565 Ga0070667_100318288
1566 Ga0070667_101317883
1567 Ga0070714_100259131
1568 Ga0070701_10374466
1569 Ga0070701_10432580
1570 Ga0070663_100007308
1571 Ga0070663_100130980
1572 Ga0070663_100318737
1573 Ga0070663_100549137
1574 Ga0070663_101180864
1575 Ga0070678_100010070
1576 Ga0070678_100043335
1577 Ga0070678_100160790
1578 Ga0070678_100170193
1579 Ga0070678_100174108
1580 Ga0070678_100266817
1581 Ga0070678_100310449
1582 Ga0070678_101194906
1583 Ga0070662_100000867
1584 Ga0070662_100178485
1585 Ga0070662_100273071
1586 Ga0070662_100313493
1587 Ga0070662_100479368
1588 Ga0070681_10464008
1589 Ga0068867_100000005
1590 Ga0068867_100082817
1591 Ga0068867_100178603
1592 Ga0068867_100398158
1593 Ga0068867_100399280
1594 Ga0068867_101466082
1595 Ga0070685_10554750
1596 Ga0070679_100003038
1597 Ga0070684_100313579
1598 Ga0070684_101159476
1599 Ga0068853_100264449
1600 Ga0068853_100347810
1601 Ga0068853_100371292
1602 Ga0068853_100371500
1603 Ga0068853_100417599
1604 Ga0068853_100664387
1605 Ga0070672_100003244
1606 Ga0070672_100220039
1607 Ga0070672_100429558
1608 Ga0070672_100438744
1609 Ga0070672_100548588
1610 Ga0070672_101241383
1611 Ga0070686_100208664
1612 Ga0070686_100319526
1613 Ga0070693_100218418
1614 Ga0070693_100364409
1615 Ga0070665_100439011
1616 Ga0070665_102536391
1617 Ga0068855_100035623
1618 Ga0068855_100063395
1619 Ga0068855_100065258
1620 Ga0068855_100187491
1621 Ga0068855_100288889
1622 Ga0068855_101509026
1623 Ga0070664_100014426
1624 Ga0070664_100266060
1625 Ga0070664_100309246
1626 Ga0070664_100517141
1627 Ga0068857_100002880
1628 Ga0068857_100643149
1629 Ga0068857_100653711
1630 Ga0068857_100788733
1631 Ga0068857_101622759
1632 Ga0068854_100032823
1633 Ga0068854_100188620
1634 Ga0068854_100296805
1635 Ga0068854_100342447
1636 Ga0068856_100004237
1637 Ga0068856_100287717
1638 Ga0068856_100566739
1639 Ga0070702_100266700
1640 Ga0068852_100023003
1641 Ga0068852_100051582
1642 Ga0068852_100125132
1643 Ga0068852_100173703
1644 Ga0068852_100201955
1645 Ga0068852_100228622
1646 Ga0068852_100344478
1647 Ga0068852_100927121
1648 Ga0068859_100010529
1649 Ga0068859_100966507
1650 Ga0068864_100002556
1651 Ga0068864_100010811
1652 Ga0068864_100074072
1653 Ga0068864_100219843
1654 Ga0068864_100287767
1655 Ga0068864_100311152
1656 Ga0068864_100407153
1657 Ga0068866_10022477
1658 Ga0068866_10451577
1659 Ga0068866_10454602
1660 Ga0068861_100001169
1661 Ga0068861_100003364
1662 Ga0068861_100020439
1663 Ga0068861_100637374
1664 Ga0068861_101175683
1665 Ga0068851_10107935
1666 Ga0068851_10149319
1667 Ga0068851_10170888
1668 Ga0068851_10742335
1669 Ga0068870_10112703
1670 Ga0068870_10198304
1671 Ga0068870_10238358
1672 Ga0068870_10561730
1673 Ga0068863_100019332
1674 Ga0068863_100075179
1675 Ga0068863_100185591
1676 Ga0068863_100222829
1677 Ga0068863_100511302
1678 Ga0068858_100015946
1679 Ga0068858_100201227
1680 Ga0068858_100761124
1681 Ga0068860_100170425
1682 Ga0068862_100112008
1683 Ga0068862_100208709
1684 Ga0068862_100707168
1685 Ga0068862_100758516
1686 Ga0081539_10083917
1687 Ga0070717_10529892
1688 Ga0075365_10065199
1689 Ga0075365_10618794
1690 Ga0075363_100215076
1691 Ga0075364_10001093
1692 Ga0075364_10279616
1693 Ga0075367_10153877
1694 Ga0075369_10027960
1695 Ga0075366_10055725
1696 Ga0075366_10113036
1697 Ga0075366_10155524
1698 Ga0075366_10200893
1699 Ga0097621_100009661
1700 Ga0097621_100010826
1701 Ga0097621_100017103
1702 Ga0097621_100113913
1703 Ga0097621_100230556
1704 Ga0097621_100603380
1705 Ga0075370_10002692
1706 Ga0075370_10037091
1707 Ga0075370_10166025
1708 Ga0068871_100005809
1709 Ga0068871_100057753
1710 Ga0068871_100067624
1711 Ga0068871_100141284
1712 Ga0068871_100223359
1713 Ga0068871_100550890
1714 Ga0068871_101054900
1715 Ga0075429_100815997
1716 Ga0068865_100094158
1717 Ga0068865_100166194
1718 Ga0068865_100277296
1719 Ga0068865_100536179
1720 Ga0097620_100010529
1721 Ga0097620_100966531
1722 Ga0079104_1000352
1723 Ga0099826_10560233
1724 Ga0105251_10000364
1725 Ga0105244_10041838
1726 Ga0105240_10055942
1727 Ga0105240_10212788
1728 Ga0105240_10654346
1729 Ga0105240_11006023
1730 Ga0105240_11068556
1731 Ga0111539_10951431
1732 Ga0111539_11239148
1733 Ga0111539_11565602
1734 Ga0105245_10048722
1735 Ga0105245_10502295
1736 Ga0105245_10662157
1737 Ga0105245_10732566
1738 Ga0105243_10006867
1739 Ga0105243_10013725
1740 Ga0105243_10102698
1741 Ga0105243_10433572
1742 Ga0105243_11468364
1743 Ga0105243_11806122
1744 Ga0105243_11870583
1745 Ga0105243_12001301
1746 Ga0105241_10119752
1747 Ga0105241_11523244
1748 Ga0105242_10330985
1749 Ga0105242_10335390
1750 Ga0105242_10912657
1751 Ga0105242_11028492
1752 Ga0105248_10014945
1753 Ga0105248_10039291
1754 Ga0105248_10105222
1755 Ga0105248_10500405
1756 Ga0105248_10585797
1757 Ga0105248_10682446
1758 Ga0105248_12289127
1759 Ga0105237_10043493
1760 Ga0105237_10078237
1761 Ga0105237_10332526
1762 Ga0105238_10035279
1763 Ga0105249_10060727
1764 Ga0105249_10163245
1765 Ga0105249_11447828
1766 Ga0105249_13359061
1767 Ga0105148_121146
1768 Ga0105239_10056095
1769 Ga0105239_10320005
1770 Ga0105239_10390603
1771 Ga0105246_10055307
1772 Ga0157319_1000031
1773 Ga0157373_10613361
1774 Ga0157373_10815433
1775 Ga0157371_10002369
1776 Ga0157371_10062945
1777 Ga0157371_10079985
1778 Ga0157371_10160203
1779 Ga0157371_10162109
1780 Ga0157371_10287601
1781 Ga0157370_10102494
1782 Ga0157370_10452984
1783 Ga0157370_10487444
1784 Ga0157370_11918103
1785 Ga0157369_10049772
1786 Ga0157369_10227086
1787 Ga0157369_10445204
1788 Ga0157374_10105010
1789 Ga0157374_10171153
1790 Ga0157374_10330567
1791 Ga0157374_10344207
1792 Ga0157378_10152828
1793 Ga0157378_10180200
1794 Ga0157378_10578450
1795 Ga0157378_12775830
1796 Ga0163162_10007486
1797 Ga0163162_10025364
1798 Ga0163162_10181423
1799 Ga0163162_10265698
1800 Ga0163162_10486191
1801 Ga0163162_10674271
1802 Ga0163162_10747585
1803 Ga0163162_11074816
1804 Ga0157372_10243948
1805 Ga0157372_11149127
1806 Ga0157375_10034088
1807 Ga0157375_10109446
1808 Ga0157375_10353768
1809 Ga0157375_10408446
1810 Ga0157375_10494459
1811 Ga0157375_11009048
1812 Ga0157375_11513579
1813 Ga0157375_12642963
1814 Ga0163163_10010139
1815 Ga0163163_10240216
1816 Ga0163163_10329833
1817 Ga0163163_10600868
1818 Ga0163163_11222756
1819 Ga0163163_11443248
1820 Ga0157380_10153834
1821 Ga0157380_10198110
1822 Ga0157380_10316828
1823 Ga0157380_10424330
1824 Ga0157380_10449479
1825 Ga0157380_10636066
1826 Ga0157380_13027101
1827 Ga0182008_10010987
1828 Ga0182008_10067339
1829 Ga0182008_10495581
1830 Ga0157377_10000022
1831 Ga0157377_10062240
1832 Ga0157377_10336995
1833 Ga0157379_10011032
1834 Ga0157379_10018910
1835 Ga0157379_10066973
1836 Ga0157379_10183696
1837 Ga0157379_10326475
1838 Ga0157379_10568848
1839 Ga0157379_10633969
1840 Ga0157376_10028517
1841 Ga0157376_10129467
1842 Ga0157376_10186237
1843 Ga0157376_10210298
1844 Ga0157376_10223886
1845 Ga0157376_10360829
1846 Ga0157376_10379663
1847 Ga0157376_10670491
1848 Ga0182006_1033096
1849 Ga0182006_1064426
1850 Ga0182006_1080302
1851 Ga0182006_1081085
1852 Ga0182006_1180587
1853 Ga0182007_10000236
1854 Ga0182007_10173386
1855 Ga0182005_1001886
1856 Ga0183360_10001
1857 Ga0163161_10033566
1858 Ga0163161_10036693
1859 Ga0163161_10059326
1860 Ga0163161_10092187
1861 Ga0163161_10094277
1862 Ga0163161_10128293
1863 Ga0163161_10263008
1864 Ga0163161_10369432
1865 Ga0163161_10799188
1866 Ga0206349_1304419
1867 Ga0213872_10000029
1868 Ga0213872_10000049
1869 Ga0213872_10077224
1870 Ga0213872_10092646
1871 Ga0209674_100007
1872 Ga0209674_113028
1873 Ga0209563_100005
1874 Ga0209563_100052
1875 Ga0207427_100516
1876 Ga0209258_100284
1877 Ga0209258_100957
1878 Ga0207425_1023502
1879 Ga0209646_1000245
1880 Ga0209026_1000021
1881 Ga0209026_1009092
1882 Ga0209026_1035437
1883 Ga0209677_100015
1884 Ga0209677_100477
1885 Ga0209677_103158
1886 Ga0209759_1000244
1887 Ga0209759_1000382
1888 Ga0209759_1002244
1889 Ga0209759_1012333
1890 Ga0209759_1027317
1891 Ga0209759_1030695
1892 Ga0209565_1000001
1893 Ga0209565_1000063
1894 Ga0209565_1025074
1895 Ga0209455_1000207
1896 Ga0209673_1000001
1897 Ga0209673_1000065
1898 Ga0209673_1005175
1899 Ga0209130_1005935
1900 Ga0209675_1000001
1901 Ga0209675_1000011
1902 Ga0209676_1000011
1903 Ga0209676_1000068
1904 Ga0209676_1000086
1905 Ga0209676_1001200
1906 Ga0209676_1017012
1907 Ga0209025_1137416
1908 Ga0209564_1000001
1909 Ga0209564_1000003
1910 Ga0209564_1002163
1911 Ga0209050_1000239
1912 Ga0209050_1000351
1913 Ga0209050_1002510
1914 Ga0209050_1004369
1915 Ga0209050_1015764
1916 Ga0209050_1018889
1917 Ga0209256_1000002
1918 Ga0209256_1000011
1919 Ga0209256_1004910
1920 Ga0209256_1007888
1921 Ga0209256_1009066
1922 Ga0209256_1012612
1923 Ga0209256_1016602
1924 Ga0209256_1024840
1925 Ga0209051_1000016
1926 Ga0209051_1001060
1927 Ga0209051_1001316
1928 Ga0209051_1003382
1929 Ga0209051_1008580
1930 Ga0209257_1000014
1931 Ga0209257_1000102
1932 Ga0209257_1000121
1933 Ga0209257_1000145
1934 Ga0209257_1002604
1935 Ga0209257_1002862
1936 Ga0209257_1008078
1937 Ga0209257_1111993
1938 Ga0209257_1139366
1939 Ga0207697_10023431
1940 Ga0207697_10030415
1941 Ga0207697_10152396
1942 Ga0207656_10036941
1943 Ga0207656_10070817
1944 Ga0207656_10147624
1945 Ga0207656_10269235
1946 Ga0207656_10295258
1947 Ga0207713_1000422
1948 Ga0207682_10003227
1949 Ga0207682_10037412
1950 Ga0207682_10053884
1951 Ga0207682_10164565
1952 Ga0207682_10256053
1953 Ga0207682_10387567
1954 Ga0207642_10068647
1955 Ga0207642_10211202
1956 Ga0207642_10597097
1957 Ga0207680_10022332
1958 Ga0207680_10321960
1959 Ga0207685_10241477
1960 Ga0207645_10032610
1961 Ga0207645_10067590
1962 Ga0207645_10087967
1963 Ga0207645_10297927
1964 Ga0207645_10734092
1965 Ga0207643_10089513
1966 Ga0207643_10178962
1967 Ga0207643_10277041
1968 Ga0207643_10937672
1969 Ga0207705_10024971
1970 Ga0207705_10180438
1971 Ga0207705_10322919
1972 Ga0207705_10419583
1973 Ga0207705_10422010
1974 Ga0207705_10571654
1975 Ga0207705_11026422
1976 Ga0207654_10019747
1977 Ga0207707_10396994
1978 Ga0207695_10014006
1979 Ga0207695_10180477
1980 Ga0207695_10245272
1981 Ga0207695_11249396
1982 Ga0207671_10040649
1983 Ga0207671_10054875
1984 Ga0207671_10779050
1985 Ga0207660_10008701
1986 Ga0207662_10027872
1987 Ga0207662_10644355
1988 Ga0207657_10048889
1989 Ga0207657_10161733
1990 Ga0207657_10193071
1991 Ga0207649_10000854
1992 Ga0207649_10185766
1993 Ga0207649_10459151
1994 Ga0207649_10894139
1995 Ga0207652_10047333
1996 Ga0207681_10000205
1997 Ga0207681_10039158
1998 Ga0207681_10102057
1999 Ga0207681_10633531
2000 Ga0207694_10031573
2001 Ga0207694_10272978
2002 Ga0207650_10012226
2003 Ga0207650_10012959
2004 Ga0207650_10044672
2005 Ga0207650_10103917
2006 Ga0207650_10458750
2007 Ga0207650_10796895
2008 Ga0207659_10016801
2009 Ga0207659_10019506
2010 Ga0207659_10019707
2011 Ga0207659_10253328
2012 Ga0207687_10322174
2013 Ga0207687_11003990
2014 Ga0207644_10003106
2015 Ga0207644_10009861
2016 Ga0207644_10027264
2017 Ga0207644_10042654
2018 Ga0207644_10258571
2019 Ga0207644_10491634
2020 Ga0207644_10602757
2021 Ga0207644_10833212
2022 Ga0207644_11807705
2023 Ga0207690_10000647
2024 Ga0207690_10032066
2025 Ga0207690_10185032
2026 Ga0207690_10624365
2027 Ga0207690_11109829
2028 Ga0207690_11203010
2029 Ga0207706_10000933
2030 Ga0207706_10112176
2031 Ga0207706_10126484
2032 Ga0207706_10146781
2033 Ga0207706_10484308
2034 Ga0207706_10951065
2035 Ga0207686_10623790
2036 Ga0207709_10001039
2037 Ga0207709_10001336
2038 Ga0207709_10009154
2039 Ga0207709_10045943
2040 Ga0207709_10191960
2041 Ga0207670_10283587
2042 Ga0207670_10574333
2043 Ga0207669_10255865
2044 Ga0207669_10398681
2045 Ga0207669_10920399
2046 Ga0207704_10012031
2047 Ga0207704_10013827
2048 Ga0207704_10686111
2049 Ga0207704_10976203
2050 Ga0207691_10150581
2051 Ga0207691_10167907
2052 Ga0207691_10203561
2053 Ga0207691_10215368
2054 Ga0207691_10222523
2055 Ga0207691_10237160
2056 Ga0207691_10237716
2057 Ga0207691_10422560
2058 Ga0207691_10596866
2059 Ga0207711_10005887
2060 Ga0207711_10017744
2061 Ga0207711_10098799
2062 Ga0207711_10161734
2063 Ga0207711_10163673
2064 Ga0207711_10620217
2065 Ga0207689_10000150
2066 Ga0207689_10004063
2067 Ga0207689_10039825
2068 Ga0207689_10092876
2069 Ga0207661_10223625
2070 Ga0207661_10251383
2071 Ga0207679_10000526
2072 Ga0207679_10376029
2073 Ga0207679_10735391
2074 Ga0207679_11091027
2075 Ga0207667_10017670
2076 Ga0207667_10051278
2077 Ga0207667_10058792
2078 Ga0207667_10365980
2079 Ga0207667_10422799
2080 Ga0207667_10947305
2081 Ga0207651_10024727
2082 Ga0207651_10054500
2083 Ga0207651_10070213
2084 Ga0207651_10139322
2085 Ga0207651_10250820
2086 Ga0207651_10368328
2087 Ga0207651_10667556
2088 Ga0207651_10915573
2089 Ga0207651_11025210
2090 Ga0207712_10005810
2091 Ga0207712_10235612
2092 Ga0207712_11092450
2093 Ga0207712_11125984
2094 Ga0207712_12025538
2095 Ga0207668_10011424
2096 Ga0207668_10122135
2097 Ga0207668_10562435
2098 Ga0207668_10722312
2099 Ga0207668_10824186
2100 Ga0207668_11066805
2101 Ga0207640_10028981
2102 Ga0207640_10171123
2103 Ga0207640_10997769
2104 Ga0207658_10214471
2105 Ga0207658_10309228
2106 Ga0207658_11228038
2107 Ga0207677_10004048
2108 Ga0207677_10005813
2109 Ga0207677_10324355
2110 Ga0207677_10327566
2111 Ga0207677_10428668
2112 Ga0207677_10552653
2113 Ga0207703_10004632
2114 Ga0207703_10229407
2115 Ga0207703_10433776
2116 Ga0207639_10103548
2117 Ga0207639_10168705
2118 Ga0207639_10351030
2119 Ga0207639_10615356
2120 Ga0207639_10793875
2121 Ga0207639_11221784
2122 Ga0207678_10002944
2123 Ga0207678_10019447
2124 Ga0207678_10173833
2125 Ga0207678_10342410
2126 Ga0207708_10353375
2127 Ga0207702_10000858
2128 Ga0207702_10092086
2129 Ga0207702_11283335
2130 Ga0207641_10023323
2131 Ga0207641_10112740
2132 Ga0207641_10115736
2133 Ga0207641_10422615
2134 Ga0207641_10494474
2135 Ga0207641_11894274
2136 Ga0207648_10000032
2137 Ga0207648_10046240
2138 Ga0207648_10190457
2139 Ga0207648_10201201
2140 Ga0207648_10283704
2141 Ga0207648_10343108
2142 Ga0207648_10416284
2143 Ga0207648_10478695
2144 Ga0207648_11494378
2145 Ga0207676_10001384
2146 Ga0207676_10041627
2147 Ga0207676_10049899
2148 Ga0207676_10076457
2149 Ga0207676_10101156
2150 Ga0207676_10270744
2151 Ga0207676_10657058
2152 Ga0207674_10026390
2153 Ga0207674_10399920
2154 Ga0207674_10640577
2155 Ga0207675_100007544
2156 Ga0207675_100019975
2157 Ga0207675_100024771
2158 Ga0207675_100276646
2159 Ga0207675_100344070
2160 Ga0207675_100512014
2161 Ga0207675_102088726
2162 Ga0207683_10071385
2163 Ga0207683_10087371
2164 Ga0207683_10139849
2165 Ga0207683_10203248
2166 Ga0207683_10216018
2167 Ga0207683_10222535
2168 Ga0207683_10241093
2169 Ga0207683_10264170
2170 Ga0207683_10368754
2171 Ga0207683_10657540
2172 Ga0207683_11426343
2173 Ga0207698_10017650
2174 Ga0207698_10113841
2175 Ga0207698_10222604
2176 Ga0207698_10341704
2177 Ga0207698_10616022
2178 Ga0207698_11153163
2179 Ga0207698_11189237
2180 Ga0207698_11391276
2181 Ga0209281_1000454
2182 Ga0209371_1000004
2183 Ga0209371_1000139
2184 Ga0209371_1012163
2185 Ga0209981_1033683
2186 Ga0209995_1000673
2187 Ga0209968_1004004
2188 Ga0209999_1006384
2189 Ga0209966_1000013
2190 Ga0209974_10127120
2191 Ga0268266_10500541
2192 Ga0268266_10557448
2193 Ga0268266_10943343
2194 Ga0268265_10184817
2195 Ga0268265_10943258
2196 Ga0268265_11436131
2197 Ga0268265_11956048
2198 Ga0268264_10003680
2199 Ga0268264_10184062
2200 Ga0268264_11163655
2201 Ga0265334_10068616
2202 Ga0265336_10000048
2203 Ga0307515_10031544
2204 Ga0307515_10094450
2205 Ga0268256_1000109
2206 Ga0268256_1001254
2207 Ga0268256_1014691
2208 Ga0307511_10226617
2209 Ga0316177_1050317
2210 Ga0314311_1227100
2211 Ga0316178_1026542
2212 Ga0316178_1140499
2213 Ga0316183_1078833
2214 Ga0316181_1113656
2215 Ga0265328_10016658
2216 Ga0265331_10004885
2217 Ga0265327_10000043
2218 Ga0265327_10095114
2219 Ga0307513_10015579
2220 Ga0307513_10057584
2221 Ga0307509_10276599
2222 Ga0307509_10283844
2223 Ga0307408_100000038
2224 Ga0307408_100286496
2225 Ga0307408_100378910
2226 Ga0307408_100641997
2227 Ga0307408_101159865
2228 Ga0307408_101211774
2229 Ga0307514_10031043
2230 Ga0307516_10044934
2231 Ga0307405_10161697
2232 Ga0307405_10360148
2233 Ga0307405_10874873
2234 Ga0307413_10035338
2235 Ga0307413_10783783
2236 Ga0307413_11255018
2237 Ga0307410_10811381
2238 Ga0307406_10234019
2239 Ga0307406_10348724
2240 Ga0307406_11570938
2241 Ga0307407_10795692
2242 Ga0307412_10052360
2243 Ga0307412_10312586
2244 Ga0307409_101340320
2245 Ga0307416_100005668
2246 Ga0307416_100924902
2247 Ga0307416_102243329
2248 Ga0307414_10001112
2249 Ga0307414_10030948
2250 Ga0307414_10035139
2251 Ga0307414_10084330
2252 Ga0307414_10124210
2253 Ga0307414_10157996
2254 Ga0307411_10145016
2255 Ga0307411_10559843
2256 Ga0307411_11534074
2257 Ga0307411_11614389
2258 Ga0307411_11673954
2259 Ga0307415_100229695
2260 Ga0307510_10411944
2261 Ga0373926_0139989
2262 Ga0373934_0098868
2263 Ga0373944_0023948
2264 Ga0373944_0095002
2265 Ga0373949_0008217
2266 Ga0373939_0039567
2267 Ga0373941_0194969
2268 Ga0373945_0130581
2269 Ga0373954_0266143
2270 Ga0373943_0017704
2271 Ga0373943_0182775
2272 Ga0373943_0268024
2273 Ga0373946_0088812
2274 Ga0373955_0044738
2275 Ga0373931_0004526
2276 Ga0373931_0015753
2277 Ga0373931_0464139
2278 Ga0373935_0025734
2279 Ga0373927_0100032
2280 Ga0373933_0266582
2281 Ga0373947_0176775
2282 Ga0373937_1581300
2283 Ga0373925_0034245
2284 Ga0373925_0240421
2285 Ga0395898_0071311
2286 Ga0395905_0007830
2287 Ga0395905_0085597
2288 Ga0395905_0677221
2289 Ga0395901_0002425
2290 Ga0237819_00165
2291 Ga0237819_03731
2292 Ga0237819_23238
2293 Ga0237816_00056
2294 Ga0436361_0001966
2295 Ga0436361_0082864
2296 Ga0436361_0196856
2297 Ga0436361_0243330
2298 Ga0436361_0298548
2299 Ga0436361_0417753
2300 Ga0436361_0875016
2301 Ga0439436_0029225
2302 Ga0439436_0046239
2303 Ga0439436_0049064
2304 Ga0439436_0078777
2305 Ga0439439_0018662
2306 Ga0439447_009343
2307 Ga0439461_0098887
2308 Ga0439465_0000224
2309 Ga0439465_0043300
2310 Ga0451787_452960
2311 Ga0451789_0698365
2312 Ga0451789_1349124
2313 Ga0451791_0319337
2314 Ga0451791_0672470
2315 Ga0451791_1799097
2316 Ga0451793_0050907
2317 Ga0451793_0143369
2318 Ga0451793_0248334
2319 Ga0451793_0594577
2320 Ga0451793_0678761
2321 Ga0451793_0736074
2322 Ga0451793_1247833
2323 Ga0451797_0685350
2324 Ga0451797_1106636
2325 Ga0451797_1204767
2326 Ga0451797_1248801
2327 Ga0451795_1315014
2328 Ga0451795_1586870
2329 Ga0451800_0098586
2330 Ga0451800_0163389
2331 Ga0451800_0493538
2332 Ga0451800_1079773
2333 Ga0451802_1524292
2334 Ga0451802_1644705
2335 Ga0451802_1817188
2336 Ga0451802_1988730
2337 Ga0451806_420239
2338 Ga0451804_0562792
2339 Ga0451807_0155804
2340 Ga0451807_0183383
2341 Ga0451807_1621004
2342 Ga0451807_1664147
2343 Ga0451807_1787886
2344 Ga0451837_0237264
2345 Ga0451837_0800704
2346 Ga0451837_1130467
2347 Ga0451837_1211241
2348 Ga0451841_0157733
2349 Ga0451841_0649399
2350 Ga0451841_1302887
2351 Ga0451841_1334294
2352 Ga0451849_1462010
2353 Ga0451843_0012520
2354 Ga0451843_0155094
2355 Ga0451843_0200154
2356 Ga0451843_0206726
2357 Ga0451843_0305339
2358 Ga0451843_1170934
2359 Ga0451843_1499722
2360 Ga0451843_1503963
2361 Ga0451843_1540849
2362 Ga0451853_0334304
2363 Ga0451853_1029461
2364 Ga0439433_0053903
2365 Ga0439433_0070620
2366 Ga0439433_0092143
2367 Ga0439433_0093817
2368 Ga0439445_0004656
2369 Ga0439445_0027529
2370 Ga0439445_0097862
2371 Ga0439432_019776
2372 Ga0439432_120041
2373 Ga0439432_172159
2374 Ga0439449_0005798
2375 Ga0439449_0013136
2376 Ga0439449_0013961
2377 Ga0439449_0029827
2378 Ga0439449_0051250
2379 Ga0439449_0109806
2380 Ga0439452_025555
2381 Ga0439454_006386
2382 Ga0439462_0067379
2383 Ga0439462_0172200
2384 Ga0450911_005582
2385 Ga0450919_001239
2386 Ga0450890_007668
2387 Ga0450890_011251
2388 Ga0439458_0120940
2389 Ga0439434_0041674
2390 Ga0439435_0099125
2391 Ga0439459_0000618
2392 Ga0450918_000320
2393 Ga0450901_007565
2394 Ga0451577_0177731
2395 Ga0466963_0453115
2396 Ga0466963_0935684
2397 Ga0453684_0118653
2398 Ga0453684_0473057
2399 Ga0453684_0584012
2400 Ga0451576_0041719
2401 Ga0451576_2363323
2402 Ga0495627_095254
2403 Ga0495592_0473932
2404 Ga0495629_0180753
2405 Ga0495629_0330467
2406 Ga0495638_0032789
2407 Ga0495638_0156728
2408 Ga0495638_0265569
2409 Ga0495651_0260417
2410 Ga0495580_0213174
2411 Ga0495580_0517029
2412 Ga0495639_0018018
2413 Ga0495639_0392848
2414 Ga0495607_0053436
2415 Ga0495583_0000017
2416 Ga0495606_0002049
2417 Ga0495606_0017003
2418 Ga0495608_0257061
2419 Ga0495610_0013938
2420 Ga0495610_0214813
2421 Ga0495616_0163313
2422 Ga0495616_0260072
2423 Ga0495628_0053645
2424 Ga0495631_0020149
2425 Ga0495631_0424324
2426 Ga0495643_0017194
2427 Ga0495643_0166135
2428 Ga0495643_0177871
2429 Ga0495644_0370484
2430 Ga0495663_0000403
2431 Ga0495663_0010083
2432 Ga0495663_0025947
2433 Ga0495663_0037832
2434 Ga0495652_0149595
2435 Ga0495586_0174081
2436 Ga0495598_0002515
2437 Ga0495621_0018217
2438 Ga0495645_0205136
2439 Ga0495633_0041373
2440 Ga0495633_0065198
2441 Ga0495633_0073528
2442 Ga0495633_0075520
2443 Ga0495633_0172944
2444 Ga0495667_0480747
2445 Ga0495668_0004728
2446 Ga0495625_0162856
2447 Ga0495647_0081064
2448 Ga0495658_0067293
2449 Ga0495669_0043381
2450 Ga0495613_0315803
2451 Ga0495670_0304692
2452 Ga0495649_0000290
2453 Ga0495589_0022418
2454 Ga0495600_0289034
2455 Ga0495660_0070482
2456 Ga0495581_0816904
2457 Ga0495674_0170461
2458 Ga0495672_0020455
2459 Ga0495676_0677485
2460 Ga0495680_0141619
2461 Ga0495681_0108015
2462 Ga0495681_0164916
2463 Ga0495684_0194495
2464 Ga0495684_0414770
2465 Ga0495686_0007645
2466 Ga0495686_0031505
2467 Ga0495686_0063006
2468 Ga0495614_0533740
2469 Ga0496100_0352475
2470 Ga0496101_0025070
2471 Ga0496101_0605370
2472 Ga0496101_1123846
2473 Ga0496102_0021039
2474 Ga0496102_1164163
2475 Ga0496102_1648442
2476 Ga0496104_0031783
2477 Ga0496104_0180037
2478 Ga0496104_0274434
2479 Ga0496104_0834569
2480 Ga0496105_0112275
2481 Ga0496105_0293844
2482 Ga0496105_0310431
2483 Ga0496105_1020548
2484 Ga0496106_0136718
2485 Ga0496107_0009476
2486 Ga0496107_0617220
2487 Ga0496107_1156862
2488 Ga0496108_0028568
2489 Ga0496108_0090486
2490 Ga0496108_0171248
2491 Ga0496108_1358367
2492 Ga0496108_1505014
2493 Ga0496109_0241197
2494 Ga0496109_0303698
2495 Ga0496109_0318559
2496 Ga0496109_0499144
2497 Ga0496110_0085437
2498 Ga0496110_0415617
2499 Ga0496110_0528202
2500 Ga0496110_0597742
2501 Ga0496110_1190467
2502 Ga0496111_0561302
2503 Ga0496113_0040667
2504 Ga0496113_0321985
2505 Ga0496113_0886030
2506 Ga0496114_0015156
2507 Ga0496114_0074221
2508 Ga0496114_0272554
2509 Ga0496114_0793921
2510 Ga0496114_1346753
2511 Ga0496115_0553805
2512 Ga0496116_0031581
2513 Ga0496116_0033409
2514 Ga0496117_0001966
2515 Ga0496117_0040292
2516 Ga0496117_0058821
2517 Ga0496117_0070332
2518 Ga0496117_0070874
2519 Ga0496117_0342268
2520 Ga0496118_0027915
2521 Ga0496118_0032595
2522 Ga0496118_0045304
2523 Ga0496118_0107848
2524 Ga0496118_0168104
2525 Ga0496118_0189991
2526 Ga0496118_0404177
2527 Ga0496119_0000255
2528 Ga0496119_0004546
2529 Ga0496119_0149564
2530 Ga0496120_0000240
2531 Ga0496120_0000598
2532 Ga0496121_0008127
2533 Ga0496121_0098890
2534 Ga0496121_0157964
2535 Ga0496121_0648438
2536 Ga0496122_0000663
2537 Ga0496122_0006648
2538 Ga0496122_0097579
2539 Ga0496122_0128618
2540 Ga0496122_0142513
2541 Ga0496122_0455300
2542 Ga0496122_0472294
2543 Ga0496123_0000828
2544 Ga0496123_0001279
2545 Ga0496123_0023685
2546 Ga0496123_0098020
2547 Ga0496123_0121913
2548 Ga0496123_0129133
2549 Ga0496123_0204322
2550 Ga0496123_0309310
2551 Ga0496124_0000009
2552 Ga0496124_0021163
2553 Ga0496124_0026783
2554 Ga0496124_0030421
2555 Ga0496124_0076288
2556 Ga0496124_0172938
2557 Ga0496124_0188838
2558 Ga0496124_0204340
2559 Ga0496124_0280324
2560 Ga0496124_0303126
2561 Ga0496125_0025528
2562 Ga0496125_0071631
2563 Ga0496125_0077343
2564 Ga0496125_0089734
2565 Ga0496125_0100233
2566 Ga0496125_0112107
2567 Ga0496125_0148737
2568 Ga0496125_0717106
2569 Ga0496126_0006652
2570 Ga0496126_0084112
2571 Ga0496126_0086702
2572 Ga0496126_0208506
2573 Ga0496126_0345333
2574 Ga0496126_0375082
2575 Ga0501306_023887
2576 Ga0501308_007083
2577 Ga0501309_001733
2578 Ga0501310_000865
2579 Ga0501310_028433
2580 Ga0501304_000917
2581 Ga0501304_018257
2582 Ga0501305_003418
2583 Ga0501294_009168
2584 Ga0501297_004528
2585 Ga0501298_083728
2586 Ga0501300_001357
2587 Ga0501312_003406
2588 Ga0501313_023853
2589 Ga0501314_002220
2590 Ga0501315_002024
2591 Ga0501317_004293
2592 Ga0501321_026828
2593 Ga0501031_0025514
2594 Ga0501031_0042415
2595 Ga0501031_0656317
2596 Ga0501032_0022123
2597 Ga0501032_0228684
2598 Ga0501033_0010061
2599 Ga0501033_0085355
2600 Ga0501033_0271942
2601 Ga0501034_0021863
2602 Ga0501034_0035289
2603 Ga0501034_0072309
2604 Ga0501036_0073796
2605 Ga0501036_0323981
2606 Ga0501036_1011383
2607 Ga0501037_0020065
2608 Ga0501038_0014117
2609 Ga0501038_0026943
2610 Ga0501039_0067085
2611 Ga0501039_0255226
2612 Ga0501043_0000004
2613 Ga0501043_0021135
2614 Ga0501043_0229570
2615 Ga0501046_0000050
2616 Ga0501047_0000012
2617 Ga0501047_0021327
2618 Ga0501047_0171970
2619 Ga0501048_0010686
2620 Ga0501068_0936823
2621 Ga0501070_0045102
2622 Ga0501070_0164408
2623 Ga0501071_0460648
2624 Ga0501073_0065946
2625 Ga0501198_000004
2626 Ga0501199_015195
2627 Ga0501206_006551
2628 Ga0501211_002448
2629 Ga0501217_027085
2630 Ga0501222_000038
2631 Ga0501222_008815
2632 Ga0501223_009832
2633 Ga0501235_024396
2634 Ga0501250_012952
2635 Ga0501251_052739
2636 Ga0501253_018493
2637 Ga0501255_001001
2638 Ga0501258_006361
2639 Ga0501261_009717
2640 Ga0501225_0025880
2641 Ga0501225_0038030
2642 Ga0501229_000597
2643 Ga0501080_0016883
2644 Ga0501080_1590210
2645 Ga0501080_1872194
2646 Ga0501232_032573
2647 Ga0501262_002037
2648 Ga0501265_010324
2649 Ga0501267_001203
2650 Ga0501268_103430
2651 Ga0501272_005104
2652 Ga0501282_013499
2653 Ga0501035_0014880
2654 Ga0501035_0192031
2655 Ga0501044_0019187
2656 Ga0501044_0037114
2657 Ga0501044_1020321
2658 Ga0501044_1567984
2659 Ga0501044_1602328
2660 Ga0501045_0016727
2661 Ga0501226_033241
2662 nmdc:mga03683_315569_c1
2663 nmdc:mga03n38_539604_c1
2664 nmdc:mga00v17_153575_c1
2665 nmdc:mga0yw44_104612_c1
2666 nmdc:mga0k408_129139_c1
2667 nmdc:mga0k408_186563_c1
2668 nmdc:mga0k408_293352_c1
2669 nmdc:mga07m45_187418_c1
2670 nmdc:mga07m45_46177_c1
2671 nmdc:mga07m45_61691_c1
2672 nmdc:mga08y16_1337202_c1
2673 nmdc:mga08y16_749189_c1
2674 Ga0495601_0144456
2675 Ga0495612_0238028
2676 Ga0495612_0358143
2677 Ga0500635_0000046
2678 Ga0495595_0160133
2679 Ga0495619_0173642
2680 Ga0500651_0000088
2681 Ga0500658_0180230
2682 Ga0500559_0050725
2683 Ga0500564_088801
2684 Ga0500577_0340038
2685 Ga0500604_0155491
2686 Ga0500622_0019200
2687 Ga0500634_0000049
2688 Ga0500636_0182491
2689 Ga0501084_0879507
2690 2547503041
2691 2572253883
2692 2578458467
2693 2643745674
2694 2643907762
2695 2643916031
2696 2644221564
2697 2644245444
2698 2644257675
2699 2644529358
2700 2747947750
2701 2748019495
2702 2765578937
2703 2816516997
2704 2819659635
2705 2831865637
2706 2842393018
2707 2842760247
2708 2842780750
2709 2852650889
2710 2852685563
2711 2857443732
2712 2874221577
2713 2895500662
2714 2895516468
2715 2895523612
2716 2895526806
2717 2919089756
2718 2919131710
2719 2919137695
2720 2923518440
2721 2928499461
2722 2929197920
2723 2931380798
2724 2937612396
2725 2939591400
2726 2939623537
2727 2939627373
2728 2941478265
2729 2941490126
2730 2961048344
2731 2961065340
2732 2974309038
2733 2977249755
2734 2984515755
2735 2987606381
2736 2995951936
2737 8002871887
2738 8021624682
2739 8021629196
2740 8021649063

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

144

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.7867 2 131
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7765 1 129
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7695 1 129
1v96-assembly1.cif.gz_A crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii ot3 0.7661 2 129
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.7656 2 131
ID Description Score Start End Superfamily
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8262 1 127 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8083 1 127 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8076 2 131 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7783 2 131 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7765 1 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A349Y6C8-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9829 19 131 GO:0004518
GO:0046872
AF-A0A3D4TN72-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.978 1 88
AF-A0A1S0V9N5-F1-model_v4 deleted 0.9761 2 131
AF-Q9PGK7-F1-model_v4 PIN domain-containing protein 0.9748 2 131 GO:0004518
GO:0046872
AF-A0A0U3AAD4-F1-model_v4 DNA-binding protein (PIN domain-containing protein) 0.9731 1 131 GO:0003677
GO:0004518
GO:0046872

Map