F493402
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 526 | 2740 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300004625|Ga0055543_1012054|Ga0055543_10120542 |
| Length | 157 |
| Sequence | MIAVDSSVLIDLLGDAPGADAAEAALRLALSTGPVVLCDVVLSEVTAGLGHGSEVMDALEEMGLGFSPIDQRAAIRAGEMQRKFKQRLLEAGTRPSGKPQAKTVAADTPGASRAIADFLVGAHAMLQCDGLITRDHGFFRDYFKGLKVIVPEGASPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 234 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 235 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 238 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 239 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 264 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 281 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 282 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 283 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 284 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 285 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 286 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 287 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 288 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 300 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 301 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 302 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 306 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 309 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 310 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 311 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 312 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 313 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 314 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 315 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 316 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 317 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 318 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 319 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 401 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 402 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 403 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 404 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 427 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 428 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 429 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 430 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 431 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 432 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 433 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 434 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 435 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 436 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 437 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 438 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 439 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 440 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 442 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 444 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 446 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 447 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 448 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 449 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 450 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 454 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 464 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 467 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 469 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 471 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 477 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 478 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 479 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 480 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 481 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 482 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 483 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 484 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 485 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 486 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 487 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 488 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 489 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 490 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 491 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 492 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 493 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 494 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 495 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 496 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 497 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 498 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 499 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 500 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 501 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 502 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 503 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 504 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 505 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 506 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 507 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 508 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 509 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 510 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 511 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 512 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 513 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 514 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 515 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 516 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 517 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 518 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 519 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 520 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 521 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 522 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 523 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 524 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 525 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 526 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 1.17 |
| Isolates | 3.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.07 |
| Bulb | 0 |
| Endosphere | 10.36 |
| Nodule | 0.36 |
| Rhizoplane | 5.62 |
| Rhizosphere | 72.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055543_1012054 | 3300004625 | Bacteria | 1750 |
| 2 | SwRhRL2b_contig_2733011 | 2162886007 | Bacteria | 3098 |
| 3 | SwRhRL2b_contig_3886549 | 2162886007 | Bacteria | 1068 |
| 4 | JGI25156J39149_1002197 | 3300002705 | Bacteria | 7254 |
| 5 | JGI25156J39149_1006806 | 3300002705 | Bacteria | 3078 |
| 6 | JGI25154J39366_1001260 | 3300002738 | Bacteria | 9490 |
| 7 | JGI25157J39369_1000491 | 3300002741 | Bacteria | 24512 |
| 8 | JGI25164J39214_1009409 | 3300002772 | Bacteria | 961 |
| 9 | Ga0006778J45830_1039144 | 3300003162 | Bacteria | 3623 |
| 10 | rootH1_10002740 | 3300003316 | Bacteria | 3767 |
| 11 | rootH1_10002744 | 3300003316 | Bacteria | 2748 |
| 12 | rootH1_10017987 | 3300003316 | Bacteria | 2116 |
| 13 | rootH2_10019340 | 3300003320 | Bacteria | 4011 |
| 14 | rootH2_10083712 | 3300003320 | Bacteria | 2181 |
| 15 | rootH2_10187889 | 3300003320 | Bacteria | 1336 |
| 16 | rootL2_10002046 | 3300003322 | Bacteria | 4121 |
| 17 | rootL2_10047399 | 3300003322 | Bacteria | 3286 |
| 18 | rootL2_10049164 | 3300003322 | Bacteria | 5122 |
| 19 | rootL2_10136592 | 3300003322 | Bacteria | 1066 |
| 20 | rootL2_10197176 | 3300003322 | Bacteria | 1229 |
| 21 | rootL2_10256599 | 3300003322 | Bacteria | 1968 |
| 22 | rootH1_10038473 | 3300003323 | Bacteria | 4146 |
| 23 | rootH1_10058276 | 3300003323 | Bacteria | 4017 |
| 24 | rootH1_10061833 | 3300003323 | Bacteria | 2662 |
| 25 | rootH1_10072793 | 3300003323 | Bacteria | 1181 |
| 26 | rootH1_10143584 | 3300003323 | Bacteria | 1595 |
| 27 | rootH1_10235777 | 3300003323 | Bacteria | 1878 |
| 28 | Ga0055539_1000279 | 3300003752 | Bacteria | 29490 |
| 29 | Ga0055539_1002101 | 3300003752 | Bacteria | 3240 |
| 30 | Ga0055539_1023488 | 3300003752 | Bacteria | 724 |
| 31 | Ga0055533_1000025 | 3300003756 | Bacteria | 332208 |
| 32 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 33 | Ga0055525_1001306 | 3300003759 | Bacteria | 5049 |
| 34 | Ga0055535_1000122 | 3300003761 | Bacteria | 83657 |
| 35 | Ga0055535_1016001 | 3300003761 | Bacteria | 1036 |
| 36 | Ga0055529_1000199 | 3300003763 | Bacteria | 80950 |
| 37 | Ga0055526_1000101 | 3300003771 | Bacteria | 76352 |
| 38 | Ga0055526_1003565 | 3300003771 | Bacteria | 9799 |
| 39 | Ga0055526_1006205 | 3300003771 | Bacteria | 6565 |
| 40 | Ga0055537_1000091 | 3300003773 | Bacteria | 66379 |
| 41 | Ga0055537_1000459 | 3300003773 | Bacteria | 25642 |
| 42 | Ga0055537_1000560 | 3300003773 | Bacteria | 21020 |
| 43 | Ga0055524_1000574 | 3300003775 | Bacteria | 27115 |
| 44 | Ga0055524_1001859 | 3300003775 | Bacteria | 11558 |
| 45 | Ga0055524_1012111 | 3300003775 | Bacteria | 3329 |
| 46 | Ga0055524_1032069 | 3300003775 | Bacteria | 1498 |
| 47 | Ga0055524_1032769 | 3300003775 | Bacteria | 1466 |
| 48 | Ga0055536_1001901 | 3300003781 | Bacteria | 12114 |
| 49 | Ga0055536_1003184 | 3300003781 | Bacteria | 8895 |
| 50 | Ga0055536_1005396 | 3300003781 | Bacteria | 6263 |
| 51 | Ga0055536_1014378 | 3300003781 | Bacteria | 2784 |
| 52 | Ga0055534_1000043 | 3300003784 | Bacteria | 99338 |
| 53 | Ga0055534_1000078 | 3300003784 | Bacteria | 75996 |
| 54 | Ga0055528_1000075 | 3300003790 | Bacteria | 76054 |
| 55 | Ga0055528_1000087 | 3300003790 | Bacteria | 72896 |
| 56 | Ga0055530_10001911 | 3300003791 | Bacteria | 14253 |
| 57 | Ga0055530_10007441 | 3300003791 | Bacteria | 4607 |
| 58 | Ga0055530_10008282 | 3300003791 | Bacteria | 4197 |
| 59 | Ga0055530_10010812 | 3300003791 | Bacteria | 3334 |
| 60 | Ga0055530_10030449 | 3300003791 | Bacteria | 1429 |
| 61 | Ga0055530_10053491 | 3300003791 | Bacteria | 927 |
| 62 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 63 | Ga0055540_1000035 | 3300003792 | Bacteria | 166843 |
| 64 | Ga0055540_1014970 | 3300003792 | Bacteria | 2283 |
| 65 | Ga0055540_1028470 | 3300003792 | Bacteria | 1321 |
| 66 | Ga0055540_1046447 | 3300003792 | Bacteria | 913 |
| 67 | Ga0055531_10010928 | 3300003794 | Bacteria | 4448 |
| 68 | Ga0055531_10012582 | 3300003794 | Bacteria | 3969 |
| 69 | Ga0055531_10020086 | 3300003794 | Bacteria | 2662 |
| 70 | Ga0055531_10025346 | 3300003794 | Bacteria | 2157 |
| 71 | Ga0055531_10028318 | 3300003794 | Bacteria | 1936 |
| 72 | Ga0058692_1000060 | 3300003856 | Bacteria | 98866 |
| 73 | Ga0058692_1000555 | 3300003856 | Bacteria | 15940 |
| 74 | Ga0055543_1003835 | 3300004625 | Bacteria | 4268 |
| 75 | Ga0065165_1000239 | 3300005262 | Bacteria | 94061 |
| 76 | Ga0065165_1000401 | 3300005262 | Bacteria | 69929 |
| 77 | Ga0065165_1076663 | 3300005262 | Bacteria | 876 |
| 78 | Ga0065704_10000521 | 3300005289 | Bacteria | 27858 |
| 79 | Ga0065704_10078724 | 3300005289 | Bacteria | 4350 |
| 80 | Ga0065704_10138923 | 3300005289 | Bacteria | 1539 |
| 81 | Ga0065704_10193942 | 3300005289 | Bacteria | 1165 |
| 82 | Ga0065715_10160732 | 3300005293 | Bacteria | 1632 |
| 83 | Ga0070658_10005332 | 3300005327 | Bacteria | 10439 |
| 84 | Ga0070658_10138163 | 3300005327 | Bacteria | 2034 |
| 85 | Ga0070658_10166330 | 3300005327 | Bacteria | 1851 |
| 86 | Ga0070658_10501468 | 3300005327 | Bacteria | 1048 |
| 87 | Ga0070676_10116453 | 3300005328 | Bacteria | 1671 |
| 88 | Ga0070676_10163474 | 3300005328 | Bacteria | 1434 |
| 89 | Ga0070676_10232491 | 3300005328 | Bacteria | 1222 |
| 90 | Ga0070676_10271029 | 3300005328 | Bacteria | 1140 |
| 91 | Ga0070676_10301012 | 3300005328 | Bacteria | 1087 |
| 92 | Ga0070676_10812898 | 3300005328 | Bacteria | 690 |
| 93 | Ga0070683_100159377 | 3300005329 | Bacteria | 2141 |
| 94 | Ga0070683_100239841 | 3300005329 | Bacteria | 1724 |
| 95 | Ga0070690_100019205 | 3300005330 | Bacteria | 4143 |
| 96 | Ga0070690_100028644 | 3300005330 | Bacteria | 3451 |
| 97 | Ga0070690_100143883 | 3300005330 | Bacteria | 1620 |
| 98 | Ga0070690_100273359 | 3300005330 | Bacteria | 1203 |
| 99 | Ga0070670_100003584 | 3300005331 | Bacteria | 12922 |
| 100 | Ga0070670_100034566 | 3300005331 | Bacteria | 4350 |
| 101 | Ga0070670_100117018 | 3300005331 | Bacteria | 2298 |
| 102 | Ga0070670_100150580 | 3300005331 | Bacteria | 2013 |
| 103 | Ga0070670_100164485 | 3300005331 | Bacteria | 1923 |
| 104 | Ga0070670_100202876 | 3300005331 | Bacteria | 1723 |
| 105 | Ga0070670_100265353 | 3300005331 | Bacteria | 1497 |
| 106 | Ga0070670_101077045 | 3300005331 | Bacteria | 732 |
| 107 | Ga0070670_101916629 | 3300005331 | Bacteria | 546 |
| 108 | Ga0070677_10025590 | 3300005333 | Bacteria | 2204 |
| 109 | Ga0070677_10052737 | 3300005333 | Bacteria | 1651 |
| 110 | Ga0070677_10084279 | 3300005333 | Bacteria | 1367 |
| 111 | Ga0070677_10125290 | 3300005333 | Bacteria | 1165 |
| 112 | Ga0070677_10291543 | 3300005333 | Bacteria | 826 |
| 113 | Ga0068869_100083709 | 3300005334 | Bacteria | 2386 |
| 114 | Ga0068869_100092019 | 3300005334 | Bacteria | 2282 |
| 115 | Ga0068869_100113189 | 3300005334 | Bacteria | 2066 |
| 116 | Ga0068869_100133862 | 3300005334 | Bacteria | 1908 |
| 117 | Ga0068869_100805593 | 3300005334 | Bacteria | 807 |
| 118 | Ga0070666_10022849 | 3300005335 | Bacteria | 4065 |
| 119 | Ga0070666_10033683 | 3300005335 | Bacteria | 3391 |
| 120 | Ga0070666_10725171 | 3300005335 | Bacteria | 730 |
| 121 | Ga0070680_100200755 | 3300005336 | Bacteria | 1682 |
| 122 | Ga0070682_100319171 | 3300005337 | Bacteria | 1147 |
| 123 | Ga0070682_100366638 | 3300005337 | Bacteria | 1079 |
| 124 | Ga0070682_100441809 | 3300005337 | Bacteria | 994 |
| 125 | Ga0068868_100010923 | 3300005338 | Bacteria | 6591 |
| 126 | Ga0068868_100105165 | 3300005338 | Bacteria | 2288 |
| 127 | Ga0068868_100625760 | 3300005338 | Bacteria | 956 |
| 128 | Ga0068868_100627545 | 3300005338 | Bacteria | 955 |
| 129 | Ga0068868_100628643 | 3300005338 | Bacteria | 954 |
| 130 | Ga0068868_101225452 | 3300005338 | Bacteria | 695 |
| 131 | Ga0070660_100177344 | 3300005339 | Bacteria | 1724 |
| 132 | Ga0070660_100258905 | 3300005339 | Bacteria | 1420 |
| 133 | Ga0070660_100415469 | 3300005339 | Bacteria | 1113 |
| 134 | Ga0070660_100441923 | 3300005339 | Bacteria | 1078 |
| 135 | Ga0070689_100080869 | 3300005340 | Bacteria | 2550 |
| 136 | Ga0070689_100221359 | 3300005340 | Bacteria | 1553 |
| 137 | Ga0070689_100240708 | 3300005340 | Bacteria | 1490 |
| 138 | Ga0070689_100383657 | 3300005340 | Bacteria | 1185 |
| 139 | Ga0070687_100008132 | 3300005343 | Bacteria | 4421 |
| 140 | Ga0070687_100317632 | 3300005343 | Bacteria | 994 |
| 141 | Ga0070687_100331125 | 3300005343 | Bacteria | 976 |
| 142 | Ga0070687_100603233 | 3300005343 | Bacteria | 754 |
| 143 | Ga0070661_100084736 | 3300005344 | Bacteria | 2341 |
| 144 | Ga0070661_100230417 | 3300005344 | Bacteria | 1423 |
| 145 | Ga0070661_100254344 | 3300005344 | Bacteria | 1356 |
| 146 | Ga0070692_10275966 | 3300005345 | Bacteria | 1017 |
| 147 | Ga0070668_100065280 | 3300005347 | Bacteria | 2823 |
| 148 | Ga0070668_100106945 | 3300005347 | Bacteria | 2223 |
| 149 | Ga0070668_100149654 | 3300005347 | Bacteria | 1887 |
| 150 | Ga0070668_100436334 | 3300005347 | Bacteria | 1123 |
| 151 | Ga0070668_101435490 | 3300005347 | Bacteria | 630 |
| 152 | Ga0070669_100001896 | 3300005353 | Bacteria | 15091 |
| 153 | Ga0070669_100021831 | 3300005353 | Bacteria | 4577 |
| 154 | Ga0070669_100095163 | 3300005353 | Bacteria | 2239 |
| 155 | Ga0070669_100497763 | 3300005353 | Bacteria | 1010 |
| 156 | Ga0070669_100709599 | 3300005353 | Bacteria | 850 |
| 157 | Ga0070669_100843272 | 3300005353 | Bacteria | 781 |
| 158 | Ga0070675_100001199 | 3300005354 | Bacteria | 18865 |
| 159 | Ga0070675_100027333 | 3300005354 | Bacteria | 4583 |
| 160 | Ga0070675_100038320 | 3300005354 | Bacteria | 3906 |
| 161 | Ga0070675_100262615 | 3300005354 | Bacteria | 1513 |
| 162 | Ga0070675_100562965 | 3300005354 | Bacteria | 1032 |
| 163 | Ga0070675_100633071 | 3300005354 | Bacteria | 971 |
| 164 | Ga0070675_101151747 | 3300005354 | Bacteria | 714 |
| 165 | Ga0070671_100009616 | 3300005355 | Bacteria | 7767 |
| 166 | Ga0070671_100069035 | 3300005355 | Bacteria | 2947 |
| 167 | Ga0070671_100121757 | 3300005355 | Bacteria | 2196 |
| 168 | Ga0070671_100134304 | 3300005355 | Bacteria | 2085 |
| 169 | Ga0070671_100158250 | 3300005355 | Bacteria | 1914 |
| 170 | Ga0070671_100401989 | 3300005355 | Bacteria | 1172 |
| 171 | Ga0070671_100437577 | 3300005355 | Bacteria | 1121 |
| 172 | Ga0070671_100737062 | 3300005355 | Bacteria | 856 |
| 173 | Ga0070671_100878486 | 3300005355 | Bacteria | 783 |
| 174 | Ga0070674_100003764 | 3300005356 | Bacteria | 8562 |
| 175 | Ga0070674_100187003 | 3300005356 | Bacteria | 1590 |
| 176 | Ga0070674_100271492 | 3300005356 | Bacteria | 1340 |
| 177 | Ga0070674_100588240 | 3300005356 | Bacteria | 939 |
| 178 | Ga0070674_101091653 | 3300005356 | Bacteria | 704 |
| 179 | Ga0070673_100073367 | 3300005364 | Bacteria | 2754 |
| 180 | Ga0070673_100205364 | 3300005364 | Bacteria | 1698 |
| 181 | Ga0070673_100227369 | 3300005364 | Bacteria | 1617 |
| 182 | Ga0070673_100236454 | 3300005364 | Bacteria | 1586 |
| 183 | Ga0070673_100366647 | 3300005364 | Bacteria | 1281 |
| 184 | Ga0070673_100708241 | 3300005364 | Bacteria | 925 |
| 185 | Ga0070673_100724620 | 3300005364 | Bacteria | 914 |
| 186 | Ga0070688_100075599 | 3300005365 | Bacteria | 2165 |
| 187 | Ga0070688_100114079 | 3300005365 | Bacteria | 1801 |
| 188 | Ga0070659_100000336 | 3300005366 | Bacteria | 36297 |
| 189 | Ga0070659_100090132 | 3300005366 | Bacteria | 2457 |
| 190 | Ga0070659_100209986 | 3300005366 | Bacteria | 1604 |
| 191 | Ga0070659_100377472 | 3300005366 | Bacteria | 1194 |
| 192 | Ga0070659_101023812 | 3300005366 | Bacteria | 725 |
| 193 | Ga0070667_100005446 | 3300005367 | Bacteria | 10632 |
| 194 | Ga0070667_100016792 | 3300005367 | Bacteria | 6056 |
| 195 | Ga0070667_100318288 | 3300005367 | Bacteria | 1403 |
| 196 | Ga0070667_101317883 | 3300005367 | Bacteria | 677 |
| 197 | Ga0070714_100259131 | 3300005435 | Bacteria | 1610 |
| 198 | Ga0070701_10374466 | 3300005438 | Bacteria | 896 |
| 199 | Ga0070701_10432580 | 3300005438 | Bacteria | 841 |
| 200 | Ga0070663_100007308 | 3300005455 | Bacteria | 6715 |
| 201 | Ga0070663_100130980 | 3300005455 | Bacteria | 1904 |
| 202 | Ga0070663_100318737 | 3300005455 | Bacteria | 1249 |
| 203 | Ga0070663_100549137 | 3300005455 | Bacteria | 965 |
| 204 | Ga0070663_101180864 | 3300005455 | Unclassified | 672 |
| 205 | Ga0070678_100010070 | 3300005456 | Bacteria | 5754 |
| 206 | Ga0070678_100043335 | 3300005456 | Bacteria | 3204 |
| 207 | Ga0070678_100160790 | 3300005456 | Bacteria | 1819 |
| 208 | Ga0070678_100170193 | 3300005456 | Bacteria | 1773 |
| 209 | Ga0070678_100174108 | 3300005456 | Bacteria | 1755 |
| 210 | Ga0070678_100266817 | 3300005456 | Bacteria | 1442 |
| 211 | Ga0070678_100310449 | 3300005456 | Bacteria | 1343 |
| 212 | Ga0070678_101194906 | 3300005456 | Bacteria | 705 |
| 213 | Ga0070662_100000867 | 3300005457 | Bacteria | 18517 |
| 214 | Ga0070662_100178485 | 3300005457 | Bacteria | 1672 |
| 215 | Ga0070662_100273071 | 3300005457 | Bacteria | 1365 |
| 216 | Ga0070662_100313493 | 3300005457 | Bacteria | 1277 |
| 217 | Ga0070662_100479368 | 3300005457 | Bacteria | 1035 |
| 218 | Ga0070681_10464008 | 3300005458 | Bacteria | 1179 |
| 219 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 220 | Ga0068867_100082817 | 3300005459 | Bacteria | 2421 |
| 221 | Ga0068867_100178603 | 3300005459 | Bacteria | 1686 |
| 222 | Ga0068867_100398158 | 3300005459 | Bacteria | 1160 |
| 223 | Ga0068867_100399280 | 3300005459 | Bacteria | 1159 |
| 224 | Ga0068867_101466082 | 3300005459 | Bacteria | 635 |
| 225 | Ga0070685_10554750 | 3300005466 | Bacteria | 821 |
| 226 | Ga0070679_100003038 | 3300005530 | Bacteria | 15334 |
| 227 | Ga0070684_100313579 | 3300005535 | Bacteria | 1440 |
| 228 | Ga0070684_101159476 | 3300005535 | Bacteria | 727 |
| 229 | Ga0068853_100264449 | 3300005539 | Bacteria | 1582 |
| 230 | Ga0068853_100347810 | 3300005539 | Bacteria | 1378 |
| 231 | Ga0068853_100371292 | 3300005539 | Bacteria | 1334 |
| 232 | Ga0068853_100371500 | 3300005539 | Bacteria | 1334 |
| 233 | Ga0068853_100417599 | 3300005539 | Bacteria | 1258 |
| 234 | Ga0068853_100664387 | 3300005539 | Bacteria | 992 |
| 235 | Ga0070672_100003244 | 3300005543 | Bacteria | 10530 |
| 236 | Ga0070672_100220039 | 3300005543 | Bacteria | 1592 |
| 237 | Ga0070672_100429558 | 3300005543 | Bacteria | 1136 |
| 238 | Ga0070672_100438744 | 3300005543 | Bacteria | 1123 |
| 239 | Ga0070672_100548588 | 3300005543 | Bacteria | 1003 |
| 240 | Ga0070672_101241383 | 3300005543 | Bacteria | 664 |
| 241 | Ga0070686_100208664 | 3300005544 | Bacteria | 1405 |
| 242 | Ga0070686_100319526 | 3300005544 | Bacteria | 1157 |
| 243 | Ga0070693_100218418 | 3300005547 | Bacteria | 1247 |
| 244 | Ga0070693_100364409 | 3300005547 | Bacteria | 993 |
| 245 | Ga0070665_100439011 | 3300005548 | Bacteria | 1315 |
| 246 | Ga0070665_102536391 | 3300005548 | Bacteria | 514 |
| 247 | Ga0068855_100035623 | 3300005563 | Bacteria | 5928 |
| 248 | Ga0068855_100063395 | 3300005563 | Bacteria | 4313 |
| 249 | Ga0068855_100065258 | 3300005563 | Bacteria | 4244 |
| 250 | Ga0068855_100187491 | 3300005563 | Bacteria | 2335 |
| 251 | Ga0068855_100288889 | 3300005563 | Bacteria | 1818 |
| 252 | Ga0068855_101509026 | 3300005563 | Bacteria | 690 |
| 253 | Ga0070664_100014426 | 3300005564 | Bacteria | 6443 |
| 254 | Ga0070664_100266060 | 3300005564 | Bacteria | 1543 |
| 255 | Ga0070664_100309246 | 3300005564 | Bacteria | 1430 |
| 256 | Ga0070664_100517141 | 3300005564 | Bacteria | 1101 |
| 257 | Ga0068857_100002880 | 3300005577 | Bacteria | 14152 |
| 258 | Ga0068857_100643149 | 3300005577 | Bacteria | 1005 |
| 259 | Ga0068857_100653711 | 3300005577 | Bacteria | 996 |
| 260 | Ga0068857_100788733 | 3300005577 | Bacteria | 907 |
| 261 | Ga0068857_101622759 | 3300005577 | Bacteria | 631 |
| 262 | Ga0068854_100032823 | 3300005578 | Bacteria | 3615 |
| 263 | Ga0068854_100188620 | 3300005578 | Bacteria | 1614 |
| 264 | Ga0068854_100296805 | 3300005578 | Bacteria | 1306 |
| 265 | Ga0068854_100342447 | 3300005578 | Bacteria | 1221 |
| 266 | Ga0068856_100004237 | 3300005614 | Bacteria | 14324 |
| 267 | Ga0068856_100287717 | 3300005614 | Bacteria | 1660 |
| 268 | Ga0068856_100566739 | 3300005614 | Bacteria | 1157 |
| 269 | Ga0070702_100266700 | 3300005615 | Bacteria | 1169 |
| 270 | Ga0068852_100023003 | 3300005616 | Bacteria | 5008 |
| 271 | Ga0068852_100051582 | 3300005616 | Bacteria | 3531 |
| 272 | Ga0068852_100125132 | 3300005616 | Bacteria | 2359 |
| 273 | Ga0068852_100173703 | 3300005616 | Bacteria | 2022 |
| 274 | Ga0068852_100201955 | 3300005616 | Bacteria | 1881 |
| 275 | Ga0068852_100228622 | 3300005616 | Bacteria | 1772 |
| 276 | Ga0068852_100344478 | 3300005616 | Bacteria | 1453 |
| 277 | Ga0068852_100927121 | 3300005616 | Bacteria | 888 |
| 278 | Ga0068859_100010529 | 3300005617 | Bacteria | 9307 |
| 279 | Ga0068859_100966507 | 3300005617 | Bacteria | 935 |
| 280 | Ga0068864_100002556 | 3300005618 | Bacteria | 15030 |
| 281 | Ga0068864_100010811 | 3300005618 | Bacteria | 7541 |
| 282 | Ga0068864_100074072 | 3300005618 | Bacteria | 2970 |
| 283 | Ga0068864_100219843 | 3300005618 | Bacteria | 1752 |
| 284 | Ga0068864_100287767 | 3300005618 | Bacteria | 1535 |
| 285 | Ga0068864_100311152 | 3300005618 | Bacteria | 1477 |
| 286 | Ga0068864_100407153 | 3300005618 | Bacteria | 1294 |
| 287 | Ga0068866_10022477 | 3300005718 | Bacteria | 2919 |
| 288 | Ga0068866_10451577 | 3300005718 | Bacteria | 841 |
| 289 | Ga0068866_10454602 | 3300005718 | Bacteria | 838 |
| 290 | Ga0068861_100001169 | 3300005719 | Bacteria | 16352 |
| 291 | Ga0068861_100003364 | 3300005719 | Bacteria | 10598 |
| 292 | Ga0068861_100020439 | 3300005719 | Bacteria | 4743 |
| 293 | Ga0068861_100637374 | 3300005719 | Bacteria | 983 |
| 294 | Ga0068861_101175683 | 3300005719 | Bacteria | 741 |
| 295 | Ga0068851_10107935 | 3300005834 | Bacteria | 1483 |
| 296 | Ga0068851_10149319 | 3300005834 | Bacteria | 1276 |
| 297 | Ga0068851_10170888 | 3300005834 | Bacteria | 1200 |
| 298 | Ga0068851_10742335 | 3300005834 | Bacteria | 607 |
| 299 | Ga0068870_10112703 | 3300005840 | Bacteria | 1556 |
| 300 | Ga0068870_10198304 | 3300005840 | Bacteria | 1216 |
| 301 | Ga0068870_10238358 | 3300005840 | Bacteria | 1122 |
| 302 | Ga0068870_10561730 | 3300005840 | Bacteria | 770 |
| 303 | Ga0068863_100019332 | 3300005841 | Bacteria | 6514 |
| 304 | Ga0068863_100075179 | 3300005841 | Bacteria | 3196 |
| 305 | Ga0068863_100185591 | 3300005841 | Bacteria | 1997 |
| 306 | Ga0068863_100222829 | 3300005841 | Bacteria | 1817 |
| 307 | Ga0068863_100511302 | 3300005841 | Bacteria | 1183 |
| 308 | Ga0068858_100015946 | 3300005842 | Bacteria | 7058 |
| 309 | Ga0068858_100201227 | 3300005842 | Bacteria | 1883 |
| 310 | Ga0068858_100761124 | 3300005842 | Bacteria | 944 |
| 311 | Ga0068860_100170425 | 3300005843 | Bacteria | 2102 |
| 312 | Ga0068862_100112008 | 3300005844 | Bacteria | 2396 |
| 313 | Ga0068862_100208709 | 3300005844 | Bacteria | 1764 |
| 314 | Ga0068862_100707168 | 3300005844 | Bacteria | 977 |
| 315 | Ga0068862_100758516 | 3300005844 | Bacteria | 945 |
| 316 | Ga0081539_10083917 | 3300005985 | Bacteria | 1666 |
| 317 | Ga0070717_10529892 | 3300006028 | Bacteria | 1066 |
| 318 | Ga0075365_10065199 | 3300006038 | Bacteria | 2441 |
| 319 | Ga0075365_10618794 | 3300006038 | Bacteria | 766 |
| 320 | Ga0075363_100215076 | 3300006048 | Bacteria | 1101 |
| 321 | Ga0075364_10001093 | 3300006051 | Bacteria | 14489 |
| 322 | Ga0075364_10279616 | 3300006051 | Bacteria | 1135 |
| 323 | Ga0075367_10153877 | 3300006178 | Bacteria | 1428 |
| 324 | Ga0075369_10027960 | 3300006186 | Bacteria | 2361 |
| 325 | Ga0075366_10055725 | 3300006195 | Bacteria | 2348 |
| 326 | Ga0075366_10113036 | 3300006195 | Bacteria | 1635 |
| 327 | Ga0075366_10155524 | 3300006195 | Bacteria | 1385 |
| 328 | Ga0075366_10200893 | 3300006195 | Bacteria | 1213 |
| 329 | Ga0097621_100009661 | 3300006237 | Bacteria | 7014 |
| 330 | Ga0097621_100010826 | 3300006237 | Bacteria | 6691 |
| 331 | Ga0097621_100017103 | 3300006237 | Bacteria | 5500 |
| 332 | Ga0097621_100113913 | 3300006237 | Bacteria | 2287 |
| 333 | Ga0097621_100230556 | 3300006237 | Bacteria | 1616 |
| 334 | Ga0097621_100603380 | 3300006237 | Bacteria | 1003 |
| 335 | Ga0075370_10002692 | 3300006353 | Bacteria | 8312 |
| 336 | Ga0075370_10037091 | 3300006353 | Bacteria | 2740 |
| 337 | Ga0075370_10166025 | 3300006353 | Bacteria | 1297 |
| 338 | Ga0068871_100005809 | 3300006358 | Bacteria | 8669 |
| 339 | Ga0068871_100057753 | 3300006358 | Bacteria | 3158 |
| 340 | Ga0068871_100067624 | 3300006358 | Bacteria | 2932 |
| 341 | Ga0068871_100141284 | 3300006358 | Bacteria | 2047 |
| 342 | Ga0068871_100223359 | 3300006358 | Bacteria | 1633 |
| 343 | Ga0068871_100550890 | 3300006358 | Bacteria | 1044 |
| 344 | Ga0068871_101054900 | 3300006358 | Bacteria | 759 |
| 345 | Ga0075429_100815997 | 3300006880 | Bacteria | 817 |
| 346 | Ga0068865_100094158 | 3300006881 | Bacteria | 2179 |
| 347 | Ga0068865_100166194 | 3300006881 | Bacteria | 1687 |
| 348 | Ga0068865_100277296 | 3300006881 | Bacteria | 1333 |
| 349 | Ga0068865_100536179 | 3300006881 | Bacteria | 981 |
| 350 | Ga0097620_100010529 | 3300006931 | Bacteria | 9307 |
| 351 | Ga0097620_100966531 | 3300006931 | Bacteria | 935 |
| 352 | Ga0079104_1000352 | 3300006946 | Bacteria | 55479 |
| 353 | Ga0099826_10560233 | 3300006948 | Bacteria | 525 |
| 354 | Ga0105251_10000364 | 3300009011 | Bacteria | 44484 |
| 355 | Ga0105244_10041838 | 3300009036 | Bacteria | 2373 |
| 356 | Ga0105240_10055942 | 3300009093 | Bacteria | 4938 |
| 357 | Ga0105240_10212788 | 3300009093 | Bacteria | 2258 |
| 358 | Ga0105240_10654346 | 3300009093 | Bacteria | 1151 |
| 359 | Ga0105240_11006023 | 3300009093 | Bacteria | 891 |
| 360 | Ga0105240_11068556 | 3300009093 | Bacteria | 860 |
| 361 | Ga0111539_10951431 | 3300009094 | Bacteria | 999 |
| 362 | Ga0111539_11239148 | 3300009094 | Bacteria | 866 |
| 363 | Ga0111539_11565602 | 3300009094 | Bacteria | 764 |
| 364 | Ga0105245_10048722 | 3300009098 | Bacteria | 3790 |
| 365 | Ga0105245_10502295 | 3300009098 | Bacteria | 1229 |
| 366 | Ga0105245_10662157 | 3300009098 | Bacteria | 1075 |
| 367 | Ga0105245_10732566 | 3300009098 | Bacteria | 1024 |
| 368 | Ga0105243_10006867 | 3300009148 | Bacteria | 8775 |
| 369 | Ga0105243_10013725 | 3300009148 | Bacteria | 6129 |
| 370 | Ga0105243_10102698 | 3300009148 | Bacteria | 2376 |
| 371 | Ga0105243_10433572 | 3300009148 | Bacteria | 1229 |
| 372 | Ga0105243_11468364 | 3300009148 | Bacteria | 705 |
| 373 | Ga0105243_11806122 | 3300009148 | Bacteria | 642 |
| 374 | Ga0105243_11870583 | 3300009148 | Bacteria | 632 |
| 375 | Ga0105243_12001301 | 3300009148 | Bacteria | 614 |
| 376 | Ga0105241_10119752 | 3300009174 | Bacteria | 2118 |
| 377 | Ga0105241_11523244 | 3300009174 | Bacteria | 644 |
| 378 | Ga0105242_10330985 | 3300009176 | Bacteria | 1400 |
| 379 | Ga0105242_10335390 | 3300009176 | Bacteria | 1392 |
| 380 | Ga0105242_10912657 | 3300009176 | Bacteria | 879 |
| 381 | Ga0105242_11028492 | 3300009176 | Bacteria | 833 |
| 382 | Ga0105248_10014945 | 3300009177 | Bacteria | 8546 |
| 383 | Ga0105248_10039291 | 3300009177 | Bacteria | 5299 |
| 384 | Ga0105248_10105222 | 3300009177 | Bacteria | 3181 |
| 385 | Ga0105248_10500405 | 3300009177 | Bacteria | 1370 |
| 386 | Ga0105248_10585797 | 3300009177 | Bacteria | 1258 |
| 387 | Ga0105248_10682446 | 3300009177 | Bacteria | 1159 |
| 388 | Ga0105248_12289127 | 3300009177 | Unclassified | 615 |
| 389 | Ga0105237_10043493 | 3300009545 | Bacteria | 4523 |
| 390 | Ga0105237_10078237 | 3300009545 | Bacteria | 3297 |
| 391 | Ga0105237_10332526 | 3300009545 | Bacteria | 1523 |
| 392 | Ga0105238_10035279 | 3300009551 | Bacteria | 5085 |
| 393 | Ga0105249_10060727 | 3300009553 | Bacteria | 3468 |
| 394 | Ga0105249_10163245 | 3300009553 | Bacteria | 2154 |
| 395 | Ga0105249_11447828 | 3300009553 | Bacteria | 759 |
| 396 | Ga0105249_13359061 | 3300009553 | Unclassified | 515 |
| 397 | Ga0105148_121146 | 3300009978 | Bacteria | 523 |
| 398 | Ga0105239_10056095 | 3300010375 | Bacteria | 4321 |
| 399 | Ga0105239_10320005 | 3300010375 | Bacteria | 1749 |
| 400 | Ga0105239_10390603 | 3300010375 | Bacteria | 1574 |
| 401 | Ga0105246_10055307 | 3300011119 | Bacteria | 2738 |
| 402 | Ga0157319_1000031 | 3300012497 | Bacteria | 48442 |
| 403 | Ga0157373_10613361 | 3300013100 | Bacteria | 793 |
| 404 | Ga0157373_10815433 | 3300013100 | Bacteria | 689 |
| 405 | Ga0157371_10002369 | 3300013102 | Bacteria | 18037 |
| 406 | Ga0157371_10062945 | 3300013102 | Bacteria | 2630 |
| 407 | Ga0157371_10079985 | 3300013102 | Bacteria | 2315 |
| 408 | Ga0157371_10160203 | 3300013102 | Bacteria | 1607 |
| 409 | Ga0157371_10162109 | 3300013102 | Bacteria | 1597 |
| 410 | Ga0157371_10287601 | 3300013102 | Bacteria | 1188 |
| 411 | Ga0157370_10102494 | 3300013104 | Bacteria | 2680 |
| 412 | Ga0157370_10452984 | 3300013104 | Bacteria | 1180 |
| 413 | Ga0157370_10487444 | 3300013104 | Bacteria | 1133 |
| 414 | Ga0157370_11918103 | 3300013104 | Bacteria | 531 |
| 415 | Ga0157369_10049772 | 3300013105 | Bacteria | 4541 |
| 416 | Ga0157369_10227086 | 3300013105 | Bacteria | 1953 |
| 417 | Ga0157369_10445204 | 3300013105 | Bacteria | 1342 |
| 418 | Ga0157374_10105010 | 3300013296 | Bacteria | 2712 |
| 419 | Ga0157374_10171153 | 3300013296 | Bacteria | 2119 |
| 420 | Ga0157374_10330567 | 3300013296 | Bacteria | 1512 |
| 421 | Ga0157374_10344207 | 3300013296 | Bacteria | 1480 |
| 422 | Ga0157378_10152828 | 3300013297 | Bacteria | 2151 |
| 423 | Ga0157378_10180200 | 3300013297 | Bacteria | 1987 |
| 424 | Ga0157378_10578450 | 3300013297 | Bacteria | 1132 |
| 425 | Ga0157378_12775830 | 3300013297 | Bacteria | 542 |
| 426 | Ga0163162_10007486 | 3300013306 | Bacteria | 10624 |
| 427 | Ga0163162_10025364 | 3300013306 | Bacteria | 5857 |
| 428 | Ga0163162_10181423 | 3300013306 | Bacteria | 2231 |
| 429 | Ga0163162_10265698 | 3300013306 | Bacteria | 1847 |
| 430 | Ga0163162_10486191 | 3300013306 | Bacteria | 1366 |
| 431 | Ga0163162_10674271 | 3300013306 | Bacteria | 1157 |
| 432 | Ga0163162_10747585 | 3300013306 | Bacteria | 1097 |
| 433 | Ga0163162_11074816 | 3300013306 | Bacteria | 911 |
| 434 | Ga0157372_10243948 | 3300013307 | Bacteria | 2085 |
| 435 | Ga0157372_11149127 | 3300013307 | Bacteria | 898 |
| 436 | Ga0157375_10034088 | 3300013308 | Bacteria | 4846 |
| 437 | Ga0157375_10109446 | 3300013308 | Bacteria | 2859 |
| 438 | Ga0157375_10353768 | 3300013308 | Bacteria | 1635 |
| 439 | Ga0157375_10408446 | 3300013308 | Bacteria | 1524 |
| 440 | Ga0157375_10494459 | 3300013308 | Bacteria | 1388 |
| 441 | Ga0157375_11009048 | 3300013308 | Bacteria | 972 |
| 442 | Ga0157375_11513579 | 3300013308 | Unclassified | 792 |
| 443 | Ga0157375_12642963 | 3300013308 | Bacteria | 600 |
| 444 | Ga0163163_10010139 | 3300014325 | Bacteria | 8453 |
| 445 | Ga0163163_10240216 | 3300014325 | Bacteria | 1861 |
| 446 | Ga0163163_10329833 | 3300014325 | Bacteria | 1580 |
| 447 | Ga0163163_10600868 | 3300014325 | Bacteria | 1163 |
| 448 | Ga0163163_11222756 | 3300014325 | Bacteria | 814 |
| 449 | Ga0163163_11443248 | 3300014325 | Bacteria | 750 |
| 450 | Ga0157380_10153834 | 3300014326 | Bacteria | 1991 |
| 451 | Ga0157380_10198110 | 3300014326 | Bacteria | 1779 |
| 452 | Ga0157380_10316828 | 3300014326 | Bacteria | 1444 |
| 453 | Ga0157380_10424330 | 3300014326 | Bacteria | 1269 |
| 454 | Ga0157380_10449479 | 3300014326 | Bacteria | 1237 |
| 455 | Ga0157380_10636066 | 3300014326 | Bacteria | 1062 |
| 456 | Ga0157380_13027101 | 3300014326 | Bacteria | 536 |
| 457 | Ga0182008_10010987 | 3300014497 | Bacteria | 4829 |
| 458 | Ga0182008_10067339 | 3300014497 | Bacteria | 1762 |
| 459 | Ga0182008_10495581 | 3300014497 | Bacteria | 671 |
| 460 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 461 | Ga0157377_10062240 | 3300014745 | Bacteria | 2135 |
| 462 | Ga0157377_10336995 | 3300014745 | Bacteria | 1007 |
| 463 | Ga0157379_10011032 | 3300014968 | Bacteria | 7876 |
| 464 | Ga0157379_10018910 | 3300014968 | Bacteria | 6079 |
| 465 | Ga0157379_10066973 | 3300014968 | Bacteria | 3211 |
| 466 | Ga0157379_10183696 | 3300014968 | Bacteria | 1889 |
| 467 | Ga0157379_10326475 | 3300014968 | Bacteria | 1401 |
| 468 | Ga0157379_10568848 | 3300014968 | Bacteria | 1056 |
| 469 | Ga0157379_10633969 | 3300014968 | Bacteria | 999 |
| 470 | Ga0157376_10028517 | 3300014969 | Bacteria | 4438 |
| 471 | Ga0157376_10129467 | 3300014969 | Bacteria | 2250 |
| 472 | Ga0157376_10186237 | 3300014969 | Bacteria | 1901 |
| 473 | Ga0157376_10210298 | 3300014969 | Bacteria | 1795 |
| 474 | Ga0157376_10223886 | 3300014969 | Bacteria | 1744 |
| 475 | Ga0157376_10360829 | 3300014969 | Bacteria | 1393 |
| 476 | Ga0157376_10379663 | 3300014969 | Bacteria | 1361 |
| 477 | Ga0157376_10670491 | 3300014969 | Bacteria | 1039 |
| 478 | Ga0182006_1033096 | 3300015261 | Bacteria | 2073 |
| 479 | Ga0182006_1064426 | 3300015261 | Bacteria | 1374 |
| 480 | Ga0182006_1080302 | 3300015261 | Bacteria | 1191 |
| 481 | Ga0182006_1081085 | 3300015261 | Bacteria | 1183 |
| 482 | Ga0182006_1180587 | 3300015261 | Bacteria | 704 |
| 483 | Ga0182007_10000236 | 3300015262 | Bacteria | 37233 |
| 484 | Ga0182007_10173386 | 3300015262 | Bacteria | 743 |
| 485 | Ga0182005_1001886 | 3300015265 | Bacteria | 7941 |
| 486 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 487 | Ga0163161_10033566 | 3300017792 | Bacteria | 3667 |
| 488 | Ga0163161_10036693 | 3300017792 | Bacteria | 3511 |
| 489 | Ga0163161_10059326 | 3300017792 | Bacteria | 2782 |
| 490 | Ga0163161_10092187 | 3300017792 | Bacteria | 2243 |
| 491 | Ga0163161_10094277 | 3300017792 | Bacteria | 2219 |
| 492 | Ga0163161_10128293 | 3300017792 | Bacteria | 1911 |
| 493 | Ga0163161_10263008 | 3300017792 | Bacteria | 1348 |
| 494 | Ga0163161_10369432 | 3300017792 | Bacteria | 1144 |
| 495 | Ga0163161_10799188 | 3300017792 | Bacteria | 793 |
| 496 | Ga0206349_1304419 | 3300020075 | Bacteria | 3262 |
| 497 | Ga0213872_10000029 | 3300021361 | Bacteria | 145850 |
| 498 | Ga0213872_10000049 | 3300021361 | Bacteria | 109094 |
| 499 | Ga0213872_10077224 | 3300021361 | Bacteria | 1497 |
| 500 | Ga0213872_10092646 | 3300021361 | Bacteria | 1351 |
| 501 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 502 | Ga0209674_113028 | 3300025226 | Bacteria | 787 |
| 503 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 504 | Ga0209563_100052 | 3300025230 | Bacteria | 334307 |
| 505 | Ga0207427_100516 | 3300025231 | Bacteria | 20429 |
| 506 | Ga0209258_100284 | 3300025242 | Bacteria | 83713 |
| 507 | Ga0209258_100957 | 3300025242 | Bacteria | 13752 |
| 508 | Ga0207425_1023502 | 3300025245 | Bacteria | 1289 |
| 509 | Ga0209646_1000245 | 3300025246 | Bacteria | 55317 |
| 510 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 511 | Ga0209026_1009092 | 3300025250 | Bacteria | 1992 |
| 512 | Ga0209026_1035437 | 3300025250 | Bacteria | 732 |
| 513 | Ga0209677_100015 | 3300025253 | Bacteria | 532137 |
| 514 | Ga0209677_100477 | 3300025253 | Bacteria | 22940 |
| 515 | Ga0209677_103158 | 3300025253 | Bacteria | 5562 |
| 516 | Ga0209759_1000244 | 3300025256 | Bacteria | 80962 |
| 517 | Ga0209759_1000382 | 3300025256 | Bacteria | 55345 |
| 518 | Ga0209759_1002244 | 3300025256 | Bacteria | 8800 |
| 519 | Ga0209759_1012333 | 3300025256 | Bacteria | 2373 |
| 520 | Ga0209759_1027317 | 3300025256 | Bacteria | 1181 |
| 521 | Ga0209759_1030695 | 3300025256 | Bacteria | 1058 |
| 522 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 523 | Ga0209565_1000063 | 3300025263 | Bacteria | 183711 |
| 524 | Ga0209565_1025074 | 3300025263 | Bacteria | 1208 |
| 525 | Ga0209455_1000207 | 3300025272 | Bacteria | 83713 |
| 526 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 527 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 528 | Ga0209673_1005175 | 3300025273 | Bacteria | 6664 |
| 529 | Ga0209130_1005935 | 3300025284 | Bacteria | 4096 |
| 530 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 531 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 532 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 533 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 534 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 535 | Ga0209676_1001200 | 3300025292 | Bacteria | 27709 |
| 536 | Ga0209676_1017012 | 3300025292 | Bacteria | 2593 |
| 537 | Ga0209025_1137416 | 3300025294 | Bacteria | 698 |
| 538 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 539 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 540 | Ga0209564_1002163 | 3300025295 | Bacteria | 16562 |
| 541 | Ga0209050_1000239 | 3300025298 | Bacteria | 119530 |
| 542 | Ga0209050_1000351 | 3300025298 | Bacteria | 88847 |
| 543 | Ga0209050_1002510 | 3300025298 | Bacteria | 15448 |
| 544 | Ga0209050_1004369 | 3300025298 | Bacteria | 9597 |
| 545 | Ga0209050_1015764 | 3300025298 | Bacteria | 3148 |
| 546 | Ga0209050_1018889 | 3300025298 | Bacteria | 2652 |
| 547 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 548 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 549 | Ga0209256_1004910 | 3300025299 | Bacteria | 8023 |
| 550 | Ga0209256_1007888 | 3300025299 | Bacteria | 5100 |
| 551 | Ga0209256_1009066 | 3300025299 | Bacteria | 4443 |
| 552 | Ga0209256_1012612 | 3300025299 | Bacteria | 3210 |
| 553 | Ga0209256_1016602 | 3300025299 | Bacteria | 2498 |
| 554 | Ga0209256_1024840 | 3300025299 | Bacteria | 1757 |
| 555 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 556 | Ga0209051_1001060 | 3300025303 | Bacteria | 25669 |
| 557 | Ga0209051_1001316 | 3300025303 | Bacteria | 21740 |
| 558 | Ga0209051_1003382 | 3300025303 | Bacteria | 10483 |
| 559 | Ga0209051_1008580 | 3300025303 | Bacteria | 5392 |
| 560 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 561 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 562 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 563 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 564 | Ga0209257_1002604 | 3300025304 | Bacteria | 17480 |
| 565 | Ga0209257_1002862 | 3300025304 | Bacteria | 16106 |
| 566 | Ga0209257_1008078 | 3300025304 | Bacteria | 6124 |
| 567 | Ga0209257_1111993 | 3300025304 | Bacteria | 650 |
| 568 | Ga0209257_1139366 | 3300025304 | Bacteria | 546 |
| 569 | Ga0207697_10023431 | 3300025315 | Bacteria | 2528 |
| 570 | Ga0207697_10030415 | 3300025315 | Bacteria | 2210 |
| 571 | Ga0207697_10152396 | 3300025315 | Bacteria | 1006 |
| 572 | Ga0207656_10036941 | 3300025321 | Bacteria | 2052 |
| 573 | Ga0207656_10070817 | 3300025321 | Bacteria | 1549 |
| 574 | Ga0207656_10147624 | 3300025321 | Bacteria | 1112 |
| 575 | Ga0207656_10269235 | 3300025321 | Bacteria | 838 |
| 576 | Ga0207656_10295258 | 3300025321 | Bacteria | 801 |
| 577 | Ga0207713_1000422 | 3300025735 | Bacteria | 44963 |
| 578 | Ga0207682_10003227 | 3300025893 | Bacteria | 7131 |
| 579 | Ga0207682_10037412 | 3300025893 | Bacteria | 1966 |
| 580 | Ga0207682_10053884 | 3300025893 | Bacteria | 1669 |
| 581 | Ga0207682_10164565 | 3300025893 | Bacteria | 1007 |
| 582 | Ga0207682_10256053 | 3300025893 | Bacteria | 816 |
| 583 | Ga0207682_10387567 | 3300025893 | Bacteria | 660 |
| 584 | Ga0207642_10068647 | 3300025899 | Bacteria | 1678 |
| 585 | Ga0207642_10211202 | 3300025899 | Bacteria | 1078 |
| 586 | Ga0207642_10597097 | 3300025899 | Bacteria | 687 |
| 587 | Ga0207680_10022332 | 3300025903 | Bacteria | 3439 |
| 588 | Ga0207680_10321960 | 3300025903 | Bacteria | 1081 |
| 589 | Ga0207685_10241477 | 3300025905 | Bacteria | 869 |
| 590 | Ga0207645_10032610 | 3300025907 | Bacteria | 3348 |
| 591 | Ga0207645_10067590 | 3300025907 | Bacteria | 2284 |
| 592 | Ga0207645_10087967 | 3300025907 | Bacteria | 1997 |
| 593 | Ga0207645_10297927 | 3300025907 | Bacteria | 1073 |
| 594 | Ga0207645_10734092 | 3300025907 | Bacteria | 671 |
| 595 | Ga0207643_10089513 | 3300025908 | Bacteria | 1793 |
| 596 | Ga0207643_10178962 | 3300025908 | Bacteria | 1282 |
| 597 | Ga0207643_10277041 | 3300025908 | Bacteria | 1039 |
| 598 | Ga0207643_10937672 | 3300025908 | Bacteria | 561 |
| 599 | Ga0207705_10024971 | 3300025909 | Bacteria | 4265 |
| 600 | Ga0207705_10180438 | 3300025909 | Bacteria | 1593 |
| 601 | Ga0207705_10322919 | 3300025909 | Bacteria | 1186 |
| 602 | Ga0207705_10419583 | 3300025909 | Bacteria | 1036 |
| 603 | Ga0207705_10422010 | 3300025909 | Bacteria | 1033 |
| 604 | Ga0207705_10571654 | 3300025909 | Bacteria | 879 |
| 605 | Ga0207705_11026422 | 3300025909 | Bacteria | 637 |
| 606 | Ga0207654_10019747 | 3300025911 | Bacteria | 3562 |
| 607 | Ga0207707_10396994 | 3300025912 | Bacteria | 1184 |
| 608 | Ga0207695_10014006 | 3300025913 | Bacteria | 9524 |
| 609 | Ga0207695_10180477 | 3300025913 | Bacteria | 2032 |
| 610 | Ga0207695_10245272 | 3300025913 | Bacteria | 1691 |
| 611 | Ga0207695_11249396 | 3300025913 | Bacteria | 623 |
| 612 | Ga0207671_10040649 | 3300025914 | Bacteria | 3442 |
| 613 | Ga0207671_10054875 | 3300025914 | Bacteria | 2952 |
| 614 | Ga0207671_10779050 | 3300025914 | Bacteria | 759 |
| 615 | Ga0207660_10008701 | 3300025917 | Bacteria | 6565 |
| 616 | Ga0207662_10027872 | 3300025918 | Bacteria | 3262 |
| 617 | Ga0207662_10644355 | 3300025918 | Bacteria | 740 |
| 618 | Ga0207657_10048889 | 3300025919 | Bacteria | 3690 |
| 619 | Ga0207657_10161733 | 3300025919 | Bacteria | 1818 |
| 620 | Ga0207657_10193071 | 3300025919 | Bacteria | 1642 |
| 621 | Ga0207649_10000854 | 3300025920 | Bacteria | 19496 |
| 622 | Ga0207649_10185766 | 3300025920 | Bacteria | 1458 |
| 623 | Ga0207649_10459151 | 3300025920 | Bacteria | 963 |
| 624 | Ga0207649_10894139 | 3300025920 | Bacteria | 696 |
| 625 | Ga0207652_10047333 | 3300025921 | Bacteria | 3673 |
| 626 | Ga0207681_10000205 | 3300025923 | Bacteria | 47034 |
| 627 | Ga0207681_10039158 | 3300025923 | Bacteria | 3145 |
| 628 | Ga0207681_10102057 | 3300025923 | Bacteria | 2071 |
| 629 | Ga0207681_10633531 | 3300025923 | Bacteria | 885 |
| 630 | Ga0207694_10031573 | 3300025924 | Bacteria | 4047 |
| 631 | Ga0207694_10272978 | 3300025924 | Bacteria | 1387 |
| 632 | Ga0207650_10012226 | 3300025925 | Bacteria | 5923 |
| 633 | Ga0207650_10012959 | 3300025925 | Bacteria | 5764 |
| 634 | Ga0207650_10044672 | 3300025925 | Bacteria | 3256 |
| 635 | Ga0207650_10103917 | 3300025925 | Bacteria | 2191 |
| 636 | Ga0207650_10458750 | 3300025925 | Bacteria | 1061 |
| 637 | Ga0207650_10796895 | 3300025925 | Bacteria | 801 |
| 638 | Ga0207659_10016801 | 3300025926 | Bacteria | 4771 |
| 639 | Ga0207659_10019506 | 3300025926 | Bacteria | 4466 |
| 640 | Ga0207659_10019707 | 3300025926 | Bacteria | 4446 |
| 641 | Ga0207659_10253328 | 3300025926 | Bacteria | 1429 |
| 642 | Ga0207687_10322174 | 3300025927 | Bacteria | 1251 |
| 643 | Ga0207687_11003990 | 3300025927 | Bacteria | 716 |
| 644 | Ga0207644_10003106 | 3300025931 | Bacteria | 10690 |
| 645 | Ga0207644_10009861 | 3300025931 | Bacteria | 6282 |
| 646 | Ga0207644_10027264 | 3300025931 | Bacteria | 3946 |
| 647 | Ga0207644_10042654 | 3300025931 | Bacteria | 3216 |
| 648 | Ga0207644_10258571 | 3300025931 | Bacteria | 1391 |
| 649 | Ga0207644_10491634 | 3300025931 | Bacteria | 1011 |
| 650 | Ga0207644_10602757 | 3300025931 | Bacteria | 912 |
| 651 | Ga0207644_10833212 | 3300025931 | Bacteria | 772 |
| 652 | Ga0207644_11807705 | 3300025931 | Bacteria | 511 |
| 653 | Ga0207690_10000647 | 3300025932 | Bacteria | 22356 |
| 654 | Ga0207690_10032066 | 3300025932 | Bacteria | 3368 |
| 655 | Ga0207690_10185032 | 3300025932 | Bacteria | 1571 |
| 656 | Ga0207690_10624365 | 3300025932 | Bacteria | 881 |
| 657 | Ga0207690_11109829 | 3300025932 | Bacteria | 659 |
| 658 | Ga0207690_11203010 | 3300025932 | Bacteria | 633 |
| 659 | Ga0207706_10000933 | 3300025933 | Bacteria | 29885 |
| 660 | Ga0207706_10112176 | 3300025933 | Bacteria | 2399 |
| 661 | Ga0207706_10126484 | 3300025933 | Bacteria | 2248 |
| 662 | Ga0207706_10146781 | 3300025933 | Bacteria | 2075 |
| 663 | Ga0207706_10484308 | 3300025933 | Bacteria | 1069 |
| 664 | Ga0207706_10951065 | 3300025933 | Bacteria | 724 |
| 665 | Ga0207686_10623790 | 3300025934 | Bacteria | 851 |
| 666 | Ga0207709_10001039 | 3300025935 | Bacteria | 20507 |
| 667 | Ga0207709_10001336 | 3300025935 | Bacteria | 17405 |
| 668 | Ga0207709_10009154 | 3300025935 | Bacteria | 5454 |
| 669 | Ga0207709_10045943 | 3300025935 | Bacteria | 2647 |
| 670 | Ga0207709_10191960 | 3300025935 | Bacteria | 1452 |
| 671 | Ga0207670_10283587 | 3300025936 | Bacteria | 1292 |
| 672 | Ga0207670_10574333 | 3300025936 | Bacteria | 923 |
| 673 | Ga0207669_10255865 | 3300025937 | Bacteria | 1307 |
| 674 | Ga0207669_10398681 | 3300025937 | Bacteria | 1077 |
| 675 | Ga0207669_10920399 | 3300025937 | Bacteria | 731 |
| 676 | Ga0207704_10012031 | 3300025938 | Bacteria | 4282 |
| 677 | Ga0207704_10013827 | 3300025938 | Bacteria | 4055 |
| 678 | Ga0207704_10686111 | 3300025938 | Bacteria | 847 |
| 679 | Ga0207704_10976203 | 3300025938 | Bacteria | 715 |
| 680 | Ga0207691_10150581 | 3300025940 | Bacteria | 2046 |
| 681 | Ga0207691_10167907 | 3300025940 | Bacteria | 1923 |
| 682 | Ga0207691_10203561 | 3300025940 | Bacteria | 1722 |
| 683 | Ga0207691_10215368 | 3300025940 | Bacteria | 1667 |
| 684 | Ga0207691_10222523 | 3300025940 | Bacteria | 1636 |
| 685 | Ga0207691_10237160 | 3300025940 | Bacteria | 1578 |
| 686 | Ga0207691_10237716 | 3300025940 | Bacteria | 1576 |
| 687 | Ga0207691_10422560 | 3300025940 | Bacteria | 1136 |
| 688 | Ga0207691_10596866 | 3300025940 | Bacteria | 935 |
| 689 | Ga0207711_10005887 | 3300025941 | Bacteria | 10351 |
| 690 | Ga0207711_10017744 | 3300025941 | Bacteria | 5913 |
| 691 | Ga0207711_10098799 | 3300025941 | Bacteria | 2579 |
| 692 | Ga0207711_10161734 | 3300025941 | Bacteria | 2027 |
| 693 | Ga0207711_10163673 | 3300025941 | Bacteria | 2015 |
| 694 | Ga0207711_10620217 | 3300025941 | Bacteria | 1009 |
| 695 | Ga0207689_10000150 | 3300025942 | Bacteria | 60037 |
| 696 | Ga0207689_10004063 | 3300025942 | Bacteria | 13296 |
| 697 | Ga0207689_10039825 | 3300025942 | Bacteria | 3890 |
| 698 | Ga0207689_10092876 | 3300025942 | Bacteria | 2479 |
| 699 | Ga0207661_10223625 | 3300025944 | Bacteria | 1664 |
| 700 | Ga0207661_10251383 | 3300025944 | Bacteria | 1571 |
| 701 | Ga0207679_10000526 | 3300025945 | Bacteria | 25924 |
| 702 | Ga0207679_10376029 | 3300025945 | Bacteria | 1244 |
| 703 | Ga0207679_10735391 | 3300025945 | Bacteria | 897 |
| 704 | Ga0207679_11091027 | 3300025945 | Bacteria | 732 |
| 705 | Ga0207667_10017670 | 3300025949 | Bacteria | 8024 |
| 706 | Ga0207667_10051278 | 3300025949 | Bacteria | 4351 |
| 707 | Ga0207667_10058792 | 3300025949 | Bacteria | 4030 |
| 708 | Ga0207667_10365980 | 3300025949 | Bacteria | 1470 |
| 709 | Ga0207667_10422799 | 3300025949 | Bacteria | 1356 |
| 710 | Ga0207667_10947305 | 3300025949 | Bacteria | 850 |
| 711 | Ga0207651_10024727 | 3300025960 | Bacteria | 3720 |
| 712 | Ga0207651_10054500 | 3300025960 | Bacteria | 2740 |
| 713 | Ga0207651_10070213 | 3300025960 | Bacteria | 2477 |
| 714 | Ga0207651_10139322 | 3300025960 | Bacteria | 1871 |
| 715 | Ga0207651_10250820 | 3300025960 | Bacteria | 1448 |
| 716 | Ga0207651_10368328 | 3300025960 | Bacteria | 1215 |
| 717 | Ga0207651_10667556 | 3300025960 | Bacteria | 913 |
| 718 | Ga0207651_10915573 | 3300025960 | Bacteria | 781 |
| 719 | Ga0207651_11025210 | 3300025960 | Bacteria | 738 |
| 720 | Ga0207712_10005810 | 3300025961 | Bacteria | 7776 |
| 721 | Ga0207712_10235612 | 3300025961 | Bacteria | 1472 |
| 722 | Ga0207712_11092450 | 3300025961 | Bacteria | 710 |
| 723 | Ga0207712_11125984 | 3300025961 | Bacteria | 699 |
| 724 | Ga0207712_12025538 | 3300025961 | Unclassified | 515 |
| 725 | Ga0207668_10011424 | 3300025972 | Bacteria | 5395 |
| 726 | Ga0207668_10122135 | 3300025972 | Bacteria | 1974 |
| 727 | Ga0207668_10562435 | 3300025972 | Bacteria | 989 |
| 728 | Ga0207668_10722312 | 3300025972 | Bacteria | 877 |
| 729 | Ga0207668_10824186 | 3300025972 | Bacteria | 822 |
| 730 | Ga0207668_11066805 | 3300025972 | Bacteria | 723 |
| 731 | Ga0207640_10028981 | 3300025981 | Bacteria | 3392 |
| 732 | Ga0207640_10171123 | 3300025981 | Bacteria | 1619 |
| 733 | Ga0207640_10997769 | 3300025981 | Bacteria | 736 |
| 734 | Ga0207658_10214471 | 3300025986 | Bacteria | 1615 |
| 735 | Ga0207658_10309228 | 3300025986 | Bacteria | 1364 |
| 736 | Ga0207658_11228038 | 3300025986 | Bacteria | 685 |
| 737 | Ga0207677_10004048 | 3300026023 | Bacteria | 7828 |
| 738 | Ga0207677_10005813 | 3300026023 | Bacteria | 6713 |
| 739 | Ga0207677_10324355 | 3300026023 | Bacteria | 1281 |
| 740 | Ga0207677_10327566 | 3300026023 | Bacteria | 1275 |
| 741 | Ga0207677_10428668 | 3300026023 | Bacteria | 1128 |
| 742 | Ga0207677_10552653 | 3300026023 | Bacteria | 1004 |
| 743 | Ga0207703_10004632 | 3300026035 | Bacteria | 11238 |
| 744 | Ga0207703_10229407 | 3300026035 | Bacteria | 1664 |
| 745 | Ga0207703_10433776 | 3300026035 | Bacteria | 1225 |
| 746 | Ga0207639_10103548 | 3300026041 | Bacteria | 2306 |
| 747 | Ga0207639_10168705 | 3300026041 | Bacteria | 1851 |
| 748 | Ga0207639_10351030 | 3300026041 | Bacteria | 1317 |
| 749 | Ga0207639_10615356 | 3300026041 | Bacteria | 1002 |
| 750 | Ga0207639_10793875 | 3300026041 | Bacteria | 882 |
| 751 | Ga0207639_11221784 | 3300026041 | Bacteria | 705 |
| 752 | Ga0207678_10002944 | 3300026067 | Bacteria | 15425 |
| 753 | Ga0207678_10019447 | 3300026067 | Bacteria | 5967 |
| 754 | Ga0207678_10173833 | 3300026067 | Bacteria | 1839 |
| 755 | Ga0207678_10342410 | 3300026067 | Bacteria | 1289 |
| 756 | Ga0207708_10353375 | 3300026075 | Bacteria | 1206 |
| 757 | Ga0207702_10000858 | 3300026078 | Bacteria | 31796 |
| 758 | Ga0207702_10092086 | 3300026078 | Bacteria | 2656 |
| 759 | Ga0207702_11283335 | 3300026078 | Bacteria | 726 |
| 760 | Ga0207641_10023323 | 3300026088 | Bacteria | 5099 |
| 761 | Ga0207641_10112740 | 3300026088 | Bacteria | 2413 |
| 762 | Ga0207641_10115736 | 3300026088 | Bacteria | 2384 |
| 763 | Ga0207641_10422615 | 3300026088 | Bacteria | 1283 |
| 764 | Ga0207641_10494474 | 3300026088 | Bacteria | 1187 |
| 765 | Ga0207641_11894274 | 3300026088 | Bacteria | 598 |
| 766 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 767 | Ga0207648_10046240 | 3300026089 | Bacteria | 3816 |
| 768 | Ga0207648_10190457 | 3300026089 | Bacteria | 1817 |
| 769 | Ga0207648_10201201 | 3300026089 | Bacteria | 1766 |
| 770 | Ga0207648_10283704 | 3300026089 | Bacteria | 1481 |
| 771 | Ga0207648_10343108 | 3300026089 | Bacteria | 1345 |
| 772 | Ga0207648_10416284 | 3300026089 | Bacteria | 1220 |
| 773 | Ga0207648_10478695 | 3300026089 | Bacteria | 1137 |
| 774 | Ga0207648_11494378 | 3300026089 | Bacteria | 635 |
| 775 | Ga0207676_10001384 | 3300026095 | Bacteria | 18052 |
| 776 | Ga0207676_10041627 | 3300026095 | Bacteria | 3528 |
| 777 | Ga0207676_10049899 | 3300026095 | Bacteria | 3259 |
| 778 | Ga0207676_10076457 | 3300026095 | Bacteria | 2705 |
| 779 | Ga0207676_10101156 | 3300026095 | Bacteria | 2389 |
| 780 | Ga0207676_10270744 | 3300026095 | Bacteria | 1538 |
| 781 | Ga0207676_10657058 | 3300026095 | Bacteria | 1012 |
| 782 | Ga0207674_10026390 | 3300026116 | Bacteria | 6172 |
| 783 | Ga0207674_10399920 | 3300026116 | Bacteria | 1327 |
| 784 | Ga0207674_10640577 | 3300026116 | Bacteria | 1026 |
| 785 | Ga0207675_100007544 | 3300026118 | Bacteria | 10277 |
| 786 | Ga0207675_100019975 | 3300026118 | Bacteria | 6251 |
| 787 | Ga0207675_100024771 | 3300026118 | Bacteria | 5583 |
| 788 | Ga0207675_100276646 | 3300026118 | Bacteria | 1630 |
| 789 | Ga0207675_100344070 | 3300026118 | Bacteria | 1460 |
| 790 | Ga0207675_100512014 | 3300026118 | Bacteria | 1196 |
| 791 | Ga0207675_102088726 | 3300026118 | Bacteria | 583 |
| 792 | Ga0207683_10071385 | 3300026121 | Bacteria | 3069 |
| 793 | Ga0207683_10087371 | 3300026121 | Bacteria | 2773 |
| 794 | Ga0207683_10139849 | 3300026121 | Bacteria | 2181 |
| 795 | Ga0207683_10203248 | 3300026121 | Bacteria | 1801 |
| 796 | Ga0207683_10216018 | 3300026121 | Bacteria | 1746 |
| 797 | Ga0207683_10222535 | 3300026121 | Bacteria | 1720 |
| 798 | Ga0207683_10241093 | 3300026121 | Bacteria | 1649 |
| 799 | Ga0207683_10264170 | 3300026121 | Bacteria | 1572 |
| 800 | Ga0207683_10368754 | 3300026121 | Bacteria | 1319 |
| 801 | Ga0207683_10657540 | 3300026121 | Bacteria | 971 |
| 802 | Ga0207683_11426343 | 3300026121 | Bacteria | 640 |
| 803 | Ga0207698_10017650 | 3300026142 | Bacteria | 4848 |
| 804 | Ga0207698_10113841 | 3300026142 | Bacteria | 2274 |
| 805 | Ga0207698_10222604 | 3300026142 | Bacteria | 1706 |
| 806 | Ga0207698_10341704 | 3300026142 | Bacteria | 1410 |
| 807 | Ga0207698_10616022 | 3300026142 | Bacteria | 1072 |
| 808 | Ga0207698_11153163 | 3300026142 | Bacteria | 788 |
| 809 | Ga0207698_11189237 | 3300026142 | Bacteria | 776 |
| 810 | Ga0207698_11391276 | 3300026142 | Bacteria | 717 |
| 811 | Ga0209281_1000454 | 3300027111 | Bacteria | 58234 |
| 812 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 813 | Ga0209371_1000139 | 3300027312 | Bacteria | 120350 |
| 814 | Ga0209371_1012163 | 3300027312 | Bacteria | 2510 |
| 815 | Ga0209981_1033683 | 3300027378 | Bacteria | 755 |
| 816 | Ga0209995_1000673 | 3300027471 | Bacteria | 5247 |
| 817 | Ga0209968_1004004 | 3300027526 | Bacteria | 2211 |
| 818 | Ga0209999_1006384 | 3300027543 | Bacteria | 2119 |
| 819 | Ga0209966_1000013 | 3300027695 | Bacteria | 83121 |
| 820 | Ga0209974_10127120 | 3300027876 | Bacteria | 907 |
| 821 | Ga0268266_10500541 | 3300028379 | Bacteria | 1160 |
| 822 | Ga0268266_10557448 | 3300028379 | Bacteria | 1098 |
| 823 | Ga0268266_10943343 | 3300028379 | Bacteria | 835 |
| 824 | Ga0268265_10184817 | 3300028380 | Bacteria | 1794 |
| 825 | Ga0268265_10943258 | 3300028380 | Bacteria | 850 |
| 826 | Ga0268265_11436131 | 3300028380 | Bacteria | 692 |
| 827 | Ga0268265_11956048 | 3300028380 | Bacteria | 593 |
| 828 | Ga0268264_10003680 | 3300028381 | Bacteria | 13159 |
| 829 | Ga0268264_10184062 | 3300028381 | Bacteria | 1899 |
| 830 | Ga0268264_11163655 | 3300028381 | Bacteria | 780 |
| 831 | Ga0265334_10068616 | 3300028573 | Bacteria | 1324 |
| 832 | Ga0265336_10000048 | 3300028666 | Bacteria | 121572 |
| 833 | Ga0307515_10031544 | 3300028794 | Bacteria | 8829 |
| 834 | Ga0307515_10094450 | 3300028794 | Bacteria | 3694 |
| 835 | Ga0268256_1000109 | 3300030500 | Bacteria | 120350 |
| 836 | Ga0268256_1001254 | 3300030500 | Bacteria | 15855 |
| 837 | Ga0268256_1014691 | 3300030500 | Bacteria | 2312 |
| 838 | Ga0307511_10226617 | 3300030521 | Bacteria | 931 |
| 839 | Ga0316177_1050317 | 3300030731 | Bacteria | 3595 |
| 840 | Ga0314311_1227100 | 3300030733 | Bacteria | 1618 |
| 841 | Ga0316178_1026542 | 3300030735 | Bacteria | 1051 |
| 842 | Ga0316178_1140499 | 3300030735 | Bacteria | 953 |
| 843 | Ga0316183_1078833 | 3300030742 | Bacteria | 911 |
| 844 | Ga0316181_1113656 | 3300030744 | Bacteria | 1970 |
| 845 | Ga0265328_10016658 | 3300031239 | Bacteria | 2856 |
| 846 | Ga0265331_10004885 | 3300031250 | Bacteria | 8247 |
| 847 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 848 | Ga0265327_10095114 | 3300031251 | Bacteria | 1447 |
| 849 | Ga0307513_10015579 | 3300031456 | Bacteria | 9209 |
| 850 | Ga0307513_10057584 | 3300031456 | Bacteria | 4138 |
| 851 | Ga0307509_10276599 | 3300031507 | Bacteria | 1443 |
| 852 | Ga0307509_10283844 | 3300031507 | Bacteria | 1415 |
| 853 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 854 | Ga0307408_100286496 | 3300031548 | Bacteria | 1374 |
| 855 | Ga0307408_100378910 | 3300031548 | Bacteria | 1209 |
| 856 | Ga0307408_100641997 | 3300031548 | Bacteria | 948 |
| 857 | Ga0307408_101159865 | 3300031548 | Bacteria | 719 |
| 858 | Ga0307408_101211774 | 3300031548 | Bacteria | 704 |
| 859 | Ga0307514_10031043 | 3300031649 | Bacteria | 4285 |
| 860 | Ga0307516_10044934 | 3300031730 | Bacteria | 4366 |
| 861 | Ga0307405_10161697 | 3300031731 | Bacteria | 1587 |
| 862 | Ga0307405_10360148 | 3300031731 | Bacteria | 1125 |
| 863 | Ga0307405_10874873 | 3300031731 | Bacteria | 758 |
| 864 | Ga0307413_10035338 | 3300031824 | Bacteria | 2865 |
| 865 | Ga0307413_10783783 | 3300031824 | Bacteria | 800 |
| 866 | Ga0307413_11255018 | 3300031824 | Bacteria | 646 |
| 867 | Ga0307410_10811381 | 3300031852 | Bacteria | 796 |
| 868 | Ga0307406_10234019 | 3300031901 | Bacteria | 1374 |
| 869 | Ga0307406_10348724 | 3300031901 | Bacteria | 1156 |
| 870 | Ga0307406_11570938 | 3300031901 | Bacteria | 580 |
| 871 | Ga0307407_10795692 | 3300031903 | Bacteria | 719 |
| 872 | Ga0307412_10052360 | 3300031911 | Bacteria | 2703 |
| 873 | Ga0307412_10312586 | 3300031911 | Bacteria | 1246 |
| 874 | Ga0307409_101340320 | 3300031995 | Bacteria | 741 |
| 875 | Ga0307416_100005668 | 3300032002 | Bacteria | 7714 |
| 876 | Ga0307416_100924902 | 3300032002 | Bacteria | 973 |
| 877 | Ga0307416_102243329 | 3300032002 | Bacteria | 647 |
| 878 | Ga0307414_10001112 | 3300032004 | Bacteria | 13729 |
| 879 | Ga0307414_10030948 | 3300032004 | Bacteria | 3502 |
| 880 | Ga0307414_10035139 | 3300032004 | Bacteria | 3332 |
| 881 | Ga0307414_10084330 | 3300032004 | Bacteria | 2337 |
| 882 | Ga0307414_10124210 | 3300032004 | Bacteria | 1990 |
| 883 | Ga0307414_10157996 | 3300032004 | Bacteria | 1797 |
| 884 | Ga0307411_10145016 | 3300032005 | Bacteria | 1756 |
| 885 | Ga0307411_10559843 | 3300032005 | Bacteria | 977 |
| 886 | Ga0307411_11534074 | 3300032005 | Bacteria | 613 |
| 887 | Ga0307411_11614389 | 3300032005 | Bacteria | 598 |
| 888 | Ga0307411_11673954 | 3300032005 | Bacteria | 588 |
| 889 | Ga0307415_100229695 | 3300032126 | Bacteria | 1493 |
| 890 | Ga0307510_10411944 | 3300033180 | Bacteria | 794 |
| 891 | Ga0373926_0139989 | 3300035083 | Bacteria | 919 |
| 892 | Ga0373934_0098868 | 3300035086 | Bacteria | 1179 |
| 893 | Ga0373944_0023948 | 3300035089 | Bacteria | 1785 |
| 894 | Ga0373944_0095002 | 3300035089 | Bacteria | 1001 |
| 895 | Ga0373949_0008217 | 3300035090 | Bacteria | 2286 |
| 896 | Ga0373939_0039567 | 3300035114 | Bacteria | 1412 |
| 897 | Ga0373941_0194969 | 3300035115 | Bacteria | 767 |
| 898 | Ga0373945_0130581 | 3300035116 | Bacteria | 1006 |
| 899 | Ga0373954_0266143 | 3300035118 | Bacteria | 844 |
| 900 | Ga0373943_0017704 | 3300035170 | Bacteria | 3262 |
| 901 | Ga0373943_0182775 | 3300035170 | Bacteria | 1153 |
| 902 | Ga0373943_0268024 | 3300035170 | Bacteria | 963 |
| 903 | Ga0373946_0088812 | 3300035171 | Bacteria | 1366 |
| 904 | Ga0373955_0044738 | 3300035172 | Bacteria | 2386 |
| 905 | Ga0373931_0004526 | 3300035691 | Bacteria | 6359 |
| 906 | Ga0373931_0015753 | 3300035691 | Bacteria | 3710 |
| 907 | Ga0373931_0464139 | 3300035691 | Bacteria | 812 |
| 908 | Ga0373935_0025734 | 3300035692 | Bacteria | 3627 |
| 909 | Ga0373927_0100032 | 3300035695 | Bacteria | 1886 |
| 910 | Ga0373933_0266582 | 3300035724 | Bacteria | 1105 |
| 911 | Ga0373947_0176775 | 3300035725 | Bacteria | 1388 |
| 912 | Ga0373937_1581300 | 3300036401 | Archaea | 603 |
| 913 | Ga0373925_0034245 | 3300037068 | Bacteria | 3743 |
| 914 | Ga0373925_0240421 | 3300037068 | Bacteria | 1450 |
| 915 | Ga0395898_0071311 | 3300037466 | Bacteria | 3357 |
| 916 | Ga0395905_0007830 | 3300037471 | Bacteria | 10586 |
| 917 | Ga0395905_0085597 | 3300037471 | Bacteria | 2953 |
| 918 | Ga0395905_0677221 | 3300037471 | Bacteria | 934 |
| 919 | Ga0395901_0002425 | 3300038443 | Bacteria | 18923 |
| 920 | Ga0237819_00165 | 3300038705 | Bacteria | 24228 |
| 921 | Ga0237819_03731 | 3300038705 | Bacteria | 2637 |
| 922 | Ga0237819_23238 | 3300038705 | Bacteria | 613 |
| 923 | Ga0237816_00056 | 3300039145 | Bacteria | 7446 |
| 924 | Ga0436361_0001966 | 3300039447 | Bacteria | 850 |
| 925 | Ga0436361_0082864 | 3300039447 | Bacteria | 107951 |
| 926 | Ga0436361_0196856 | 3300039447 | Bacteria | 12572 |
| 927 | Ga0436361_0243330 | 3300039447 | Bacteria | 1905 |
| 928 | Ga0436361_0298548 | 3300039447 | Bacteria | 2699 |
| 929 | Ga0436361_0417753 | 3300039447 | Bacteria | 644 |
| 930 | Ga0436361_0875016 | 3300039447 | Bacteria | 1585 |
| 931 | Ga0439436_0029225 | 3300041404 | Bacteria | 1606 |
| 932 | Ga0439436_0046239 | 3300041404 | Bacteria | 1237 |
| 933 | Ga0439436_0049064 | 3300041404 | Bacteria | 1196 |
| 934 | Ga0439436_0078777 | 3300041404 | Bacteria | 917 |
| 935 | Ga0439439_0018662 | 3300041406 | Bacteria | 1716 |
| 936 | Ga0439447_009343 | 3300041407 | Bacteria | 2980 |
| 937 | Ga0439461_0098887 | 3300041410 | Bacteria | 708 |
| 938 | Ga0439465_0000224 | 3300041413 | Bacteria | 15264 |
| 939 | Ga0439465_0043300 | 3300041413 | Bacteria | 1460 |
| 940 | Ga0451787_452960 | 3300041441 | Bacteria | 1038 |
| 941 | Ga0451789_0698365 | 3300041443 | Bacteria | 2226 |
| 942 | Ga0451789_1349124 | 3300041443 | Bacteria | 872 |
| 943 | Ga0451791_0319337 | 3300041451 | Bacteria | 1116 |
| 944 | Ga0451791_0672470 | 3300041451 | Bacteria | 1622 |
| 945 | Ga0451791_1799097 | 3300041451 | Bacteria | 783 |
| 946 | Ga0451793_0050907 | 3300041452 | Bacteria | 608 |
| 947 | Ga0451793_0143369 | 3300041452 | Bacteria | 1375 |
| 948 | Ga0451793_0248334 | 3300041452 | Bacteria | 1186 |
| 949 | Ga0451793_0594577 | 3300041452 | Bacteria | 3345 |
| 950 | Ga0451793_0678761 | 3300041452 | Bacteria | 1002 |
| 951 | Ga0451793_0736074 | 3300041452 | Bacteria | 883 |
| 952 | Ga0451793_1247833 | 3300041452 | Bacteria | 576 |
| 953 | Ga0451797_0685350 | 3300041453 | Bacteria | 637 |
| 954 | Ga0451797_1106636 | 3300041453 | Bacteria | 1282 |
| 955 | Ga0451797_1204767 | 3300041453 | Bacteria | 1499 |
| 956 | Ga0451797_1248801 | 3300041453 | Bacteria | 1257 |
| 957 | Ga0451795_1315014 | 3300041456 | Bacteria | 729 |
| 958 | Ga0451795_1586870 | 3300041456 | Bacteria | 1220 |
| 959 | Ga0451800_0098586 | 3300041459 | Bacteria | 16354 |
| 960 | Ga0451800_0163389 | 3300041459 | Bacteria | 606 |
| 961 | Ga0451800_0493538 | 3300041459 | Bacteria | 536 |
| 962 | Ga0451800_1079773 | 3300041459 | Bacteria | 516 |
| 963 | Ga0451802_1524292 | 3300041460 | Bacteria | 1115 |
| 964 | Ga0451802_1644705 | 3300041460 | Bacteria | 687 |
| 965 | Ga0451802_1817188 | 3300041460 | Bacteria | 800 |
| 966 | Ga0451802_1988730 | 3300041460 | Bacteria | 1486 |
| 967 | Ga0451806_420239 | 3300041462 | Bacteria | 6696 |
| 968 | Ga0451804_0562792 | 3300041463 | Bacteria | 3717 |
| 969 | Ga0451807_0155804 | 3300041486 | Bacteria | 1131 |
| 970 | Ga0451807_0183383 | 3300041486 | Bacteria | 4326 |
| 971 | Ga0451807_1621004 | 3300041486 | Bacteria | 1475 |
| 972 | Ga0451807_1664147 | 3300041486 | Bacteria | 4084 |
| 973 | Ga0451807_1787886 | 3300041486 | Bacteria | 743 |
| 974 | Ga0451837_0237264 | 3300041494 | Bacteria | 1207 |
| 975 | Ga0451837_0800704 | 3300041494 | Bacteria | 647 |
| 976 | Ga0451837_1130467 | 3300041494 | Bacteria | 1050 |
| 977 | Ga0451837_1211241 | 3300041494 | Bacteria | 3067 |
| 978 | Ga0451841_0157733 | 3300041498 | Bacteria | 1074 |
| 979 | Ga0451841_0649399 | 3300041498 | Bacteria | 573 |
| 980 | Ga0451841_1302887 | 3300041498 | Bacteria | 855 |
| 981 | Ga0451841_1334294 | 3300041498 | Bacteria | 1134 |
| 982 | Ga0451849_1462010 | 3300041505 | Bacteria | 681 |
| 983 | Ga0451843_0012520 | 3300041509 | Bacteria | 12259 |
| 984 | Ga0451843_0155094 | 3300041509 | Bacteria | 1304 |
| 985 | Ga0451843_0200154 | 3300041509 | Bacteria | 784 |
| 986 | Ga0451843_0206726 | 3300041509 | Bacteria | 954 |
| 987 | Ga0451843_0305339 | 3300041509 | Bacteria | 679 |
| 988 | Ga0451843_1170934 | 3300041509 | Bacteria | 1602 |
| 989 | Ga0451843_1499722 | 3300041509 | Bacteria | 812 |
| 990 | Ga0451843_1503963 | 3300041509 | Bacteria | 532 |
| 991 | Ga0451843_1540849 | 3300041509 | Bacteria | 898 |
| 992 | Ga0451853_0334304 | 3300041512 | Bacteria | 802 |
| 993 | Ga0451853_1029461 | 3300041512 | Bacteria | 799 |
| 994 | Ga0439433_0053903 | 3300041999 | Bacteria | 951 |
| 995 | Ga0439433_0070620 | 3300041999 | Bacteria | 841 |
| 996 | Ga0439433_0092143 | 3300041999 | Bacteria | 746 |
| 997 | Ga0439433_0093817 | 3300041999 | Bacteria | 740 |
| 998 | Ga0439445_0004656 | 3300042004 | Bacteria | 3110 |
| 999 | Ga0439445_0027529 | 3300042004 | Bacteria | 1461 |
| 1000 | Ga0439445_0097862 | 3300042004 | Bacteria | 831 |
| 1001 | Ga0439432_019776 | 3300042006 | Bacteria | 2241 |
| 1002 | Ga0439432_120041 | 3300042006 | Bacteria | 779 |
| 1003 | Ga0439432_172159 | 3300042006 | Bacteria | 632 |
| 1004 | Ga0439449_0005798 | 3300042007 | Bacteria | 4721 |
| 1005 | Ga0439449_0013136 | 3300042007 | Bacteria | 3115 |
| 1006 | Ga0439449_0013961 | 3300042007 | Bacteria | 3021 |
| 1007 | Ga0439449_0029827 | 3300042007 | Bacteria | 2032 |
| 1008 | Ga0439449_0051250 | 3300042007 | Bacteria | 1526 |
| 1009 | Ga0439449_0109806 | 3300042007 | Bacteria | 1021 |
| 1010 | Ga0439452_025555 | 3300042010 | Bacteria | 1498 |
| 1011 | Ga0439454_006386 | 3300042011 | Bacteria | 1447 |
| 1012 | Ga0439462_0067379 | 3300042015 | Bacteria | 971 |
| 1013 | Ga0439462_0172200 | 3300042015 | Bacteria | 612 |
| 1014 | Ga0450911_005582 | 3300042115 | Bacteria | 1934 |
| 1015 | Ga0450919_001239 | 3300042121 | Bacteria | 3337 |
| 1016 | Ga0450890_007668 | 3300042127 | Bacteria | 1380 |
| 1017 | Ga0450890_011251 | 3300042127 | Bacteria | 1154 |
| 1018 | Ga0439458_0120940 | 3300042157 | Bacteria | 689 |
| 1019 | Ga0439434_0041674 | 3300042435 | Bacteria | 1411 |
| 1020 | Ga0439435_0099125 | 3300042436 | Bacteria | 894 |
| 1021 | Ga0439459_0000618 | 3300042438 | Bacteria | 4773 |
| 1022 | Ga0450918_000320 | 3300042531 | Bacteria | 10812 |
| 1023 | Ga0450901_007565 | 3300042533 | Bacteria | 1118 |
| 1024 | Ga0451577_0177731 | 3300042876 | Bacteria | 1919 |
| 1025 | Ga0466963_0453115 | 3300044694 | Bacteria | 905 |
| 1026 | Ga0466963_0935684 | 3300044694 | Bacteria | 610 |
| 1027 | Ga0453684_0118653 | 3300044712 | Bacteria | 3199 |
| 1028 | Ga0453684_0473057 | 3300044712 | Bacteria | 1391 |
| 1029 | Ga0453684_0584012 | 3300044712 | Bacteria | 1227 |
| 1030 | Ga0451576_0041719 | 3300045051 | Bacteria | 4850 |
| 1031 | Ga0451576_2363323 | 3300045051 | Bacteria | 544 |
| 1032 | Ga0495627_095254 | 3300046453 | Bacteria | 853 |
| 1033 | Ga0495592_0473932 | 3300046454 | Bacteria | 781 |
| 1034 | Ga0495629_0180753 | 3300046459 | Bacteria | 1462 |
| 1035 | Ga0495629_0330467 | 3300046459 | Bacteria | 1041 |
| 1036 | Ga0495638_0032789 | 3300046460 | Bacteria | 3325 |
| 1037 | Ga0495638_0156728 | 3300046460 | Bacteria | 1317 |
| 1038 | Ga0495638_0265569 | 3300046460 | Bacteria | 939 |
| 1039 | Ga0495651_0260417 | 3300046462 | Bacteria | 1180 |
| 1040 | Ga0495580_0213174 | 3300046472 | Bacteria | 1328 |
| 1041 | Ga0495580_0517029 | 3300046472 | Bacteria | 796 |
| 1042 | Ga0495639_0018018 | 3300046475 | Bacteria | 3071 |
| 1043 | Ga0495639_0392848 | 3300046475 | Bacteria | 700 |
| 1044 | Ga0495607_0053436 | 3300046501 | Bacteria | 2334 |
| 1045 | Ga0495583_0000017 | 3300046506 | Bacteria | 310888 |
| 1046 | Ga0495606_0002049 | 3300046507 | Bacteria | 24679 |
| 1047 | Ga0495606_0017003 | 3300046507 | Bacteria | 5517 |
| 1048 | Ga0495608_0257061 | 3300046511 | Bacteria | 1088 |
| 1049 | Ga0495610_0013938 | 3300046512 | Bacteria | 4750 |
| 1050 | Ga0495610_0214813 | 3300046512 | Bacteria | 780 |
| 1051 | Ga0495616_0163313 | 3300046513 | Bacteria | 1000 |
| 1052 | Ga0495616_0260072 | 3300046513 | Bacteria | 743 |
| 1053 | Ga0495628_0053645 | 3300046516 | Bacteria | 3181 |
| 1054 | Ga0495631_0020149 | 3300046518 | Bacteria | 3119 |
| 1055 | Ga0495631_0424324 | 3300046518 | Bacteria | 566 |
| 1056 | Ga0495643_0017194 | 3300046522 | Bacteria | 4232 |
| 1057 | Ga0495643_0166135 | 3300046522 | Bacteria | 1082 |
| 1058 | Ga0495643_0177871 | 3300046522 | Bacteria | 1036 |
| 1059 | Ga0495644_0370484 | 3300046523 | Bacteria | 565 |
| 1060 | Ga0495663_0000403 | 3300046525 | Bacteria | 15874 |
| 1061 | Ga0495663_0010083 | 3300046525 | Bacteria | 2624 |
| 1062 | Ga0495663_0025947 | 3300046525 | Bacteria | 1712 |
| 1063 | Ga0495663_0037832 | 3300046525 | Bacteria | 1456 |
| 1064 | Ga0495652_0149595 | 3300046529 | Bacteria | 1826 |
| 1065 | Ga0495586_0174081 | 3300046535 | Bacteria | 1216 |
| 1066 | Ga0495598_0002515 | 3300046537 | Bacteria | 3790 |
| 1067 | Ga0495621_0018217 | 3300046539 | Bacteria | 2278 |
| 1068 | Ga0495645_0205136 | 3300046543 | Bacteria | 1334 |
| 1069 | Ga0495633_0041373 | 3300046558 | Bacteria | 2191 |
| 1070 | Ga0495633_0065198 | 3300046558 | Bacteria | 1702 |
| 1071 | Ga0495633_0073528 | 3300046558 | Bacteria | 1593 |
| 1072 | Ga0495633_0075520 | 3300046558 | Bacteria | 1569 |
| 1073 | Ga0495633_0172944 | 3300046558 | Bacteria | 995 |
| 1074 | Ga0495667_0480747 | 3300046559 | Bacteria | 779 |
| 1075 | Ga0495668_0004728 | 3300046616 | Bacteria | 9544 |
| 1076 | Ga0495625_0162856 | 3300046660 | Bacteria | 1493 |
| 1077 | Ga0495647_0081064 | 3300046681 | Bacteria | 1316 |
| 1078 | Ga0495658_0067293 | 3300046683 | Bacteria | 2071 |
| 1079 | Ga0495669_0043381 | 3300046684 | Bacteria | 2002 |
| 1080 | Ga0495613_0315803 | 3300046689 | Bacteria | 1079 |
| 1081 | Ga0495670_0304692 | 3300046691 | Bacteria | 854 |
| 1082 | Ga0495649_0000290 | 3300046694 | Bacteria | 44246 |
| 1083 | Ga0495589_0022418 | 3300046794 | Bacteria | 3222 |
| 1084 | Ga0495600_0289034 | 3300046809 | Bacteria | 1036 |
| 1085 | Ga0495660_0070482 | 3300046810 | Bacteria | 1855 |
| 1086 | Ga0495581_0816904 | 3300047315 | Bacteria | 534 |
| 1087 | Ga0495674_0170461 | 3300047319 | Bacteria | 1817 |
| 1088 | Ga0495672_0020455 | 3300047320 | Bacteria | 4337 |
| 1089 | Ga0495676_0677485 | 3300047321 | Bacteria | 668 |
| 1090 | Ga0495680_0141619 | 3300047322 | Bacteria | 1759 |
| 1091 | Ga0495681_0108015 | 3300047470 | Bacteria | 1208 |
| 1092 | Ga0495681_0164916 | 3300047470 | Bacteria | 920 |
| 1093 | Ga0495684_0194495 | 3300047471 | Bacteria | 1498 |
| 1094 | Ga0495684_0414770 | 3300047471 | Bacteria | 942 |
| 1095 | Ga0495686_0007645 | 3300047472 | Bacteria | 8069 |
| 1096 | Ga0495686_0031505 | 3300047472 | Bacteria | 3438 |
| 1097 | Ga0495686_0063006 | 3300047472 | Bacteria | 2298 |
| 1098 | Ga0495614_0533740 | 3300048089 | Bacteria | 560 |
| 1099 | Ga0496100_0352475 | 3300048903 | Bacteria | 1112 |
| 1100 | Ga0496101_0025070 | 3300048904 | Bacteria | 4134 |
| 1101 | Ga0496101_0605370 | 3300048904 | Bacteria | 866 |
| 1102 | Ga0496101_1123846 | 3300048904 | Bacteria | 617 |
| 1103 | Ga0496102_0021039 | 3300048905 | Bacteria | 5769 |
| 1104 | Ga0496102_1164163 | 3300048905 | Bacteria | 691 |
| 1105 | Ga0496102_1648442 | 3300048905 | Bacteria | 559 |
| 1106 | Ga0496104_0031783 | 3300048907 | Bacteria | 4911 |
| 1107 | Ga0496104_0180037 | 3300048907 | Bacteria | 2024 |
| 1108 | Ga0496104_0274434 | 3300048907 | Bacteria | 1599 |
| 1109 | Ga0496104_0834569 | 3300048907 | Bacteria | 827 |
| 1110 | Ga0496105_0112275 | 3300048908 | Bacteria | 2249 |
| 1111 | Ga0496105_0293844 | 3300048908 | Bacteria | 1308 |
| 1112 | Ga0496105_0310431 | 3300048908 | Bacteria | 1266 |
| 1113 | Ga0496105_1020548 | 3300048908 | Bacteria | 618 |
| 1114 | Ga0496106_0136718 | 3300048909 | Bacteria | 1925 |
| 1115 | Ga0496107_0009476 | 3300048910 | Bacteria | 6755 |
| 1116 | Ga0496107_0617220 | 3300048910 | Bacteria | 801 |
| 1117 | Ga0496107_1156862 | 3300048910 | Bacteria | 557 |
| 1118 | Ga0496108_0028568 | 3300048911 | Bacteria | 4615 |
| 1119 | Ga0496108_0090486 | 3300048911 | Bacteria | 2601 |
| 1120 | Ga0496108_0171248 | 3300048911 | Bacteria | 1878 |
| 1121 | Ga0496108_1358367 | 3300048911 | Bacteria | 596 |
| 1122 | Ga0496108_1505014 | 3300048911 | Bacteria | 560 |
| 1123 | Ga0496109_0241197 | 3300048912 | Bacteria | 1701 |
| 1124 | Ga0496109_0303698 | 3300048912 | Bacteria | 1505 |
| 1125 | Ga0496109_0318559 | 3300048912 | Bacteria | 1467 |
| 1126 | Ga0496109_0499144 | 3300048912 | Bacteria | 1149 |
| 1127 | Ga0496110_0085437 | 3300048913 | Bacteria | 2816 |
| 1128 | Ga0496110_0415617 | 3300048913 | Bacteria | 1226 |
| 1129 | Ga0496110_0528202 | 3300048913 | Bacteria | 1073 |
| 1130 | Ga0496110_0597742 | 3300048913 | Bacteria | 1001 |
| 1131 | Ga0496110_1190467 | 3300048913 | Bacteria | 671 |
| 1132 | Ga0496111_0561302 | 3300048914 | Bacteria | 838 |
| 1133 | Ga0496113_0040667 | 3300048916 | Bacteria | 3427 |
| 1134 | Ga0496113_0321985 | 3300048916 | Bacteria | 1239 |
| 1135 | Ga0496113_0886030 | 3300048916 | Bacteria | 706 |
| 1136 | Ga0496114_0015156 | 3300048917 | Bacteria | 6200 |
| 1137 | Ga0496114_0074221 | 3300048917 | Bacteria | 2863 |
| 1138 | Ga0496114_0272554 | 3300048917 | Bacteria | 1491 |
| 1139 | Ga0496114_0793921 | 3300048917 | Bacteria | 825 |
| 1140 | Ga0496114_1346753 | 3300048917 | Bacteria | 601 |
| 1141 | Ga0496115_0553805 | 3300048918 | Bacteria | 919 |
| 1142 | Ga0496116_0031581 | 3300048919 | Bacteria | 3788 |
| 1143 | Ga0496116_0033409 | 3300048919 | Bacteria | 3651 |
| 1144 | Ga0496117_0001966 | 3300048920 | Bacteria | 27335 |
| 1145 | Ga0496117_0040292 | 3300048920 | Bacteria | 3436 |
| 1146 | Ga0496117_0058821 | 3300048920 | Bacteria | 2659 |
| 1147 | Ga0496117_0070332 | 3300048920 | Bacteria | 2351 |
| 1148 | Ga0496117_0070874 | 3300048920 | Bacteria | 2338 |
| 1149 | Ga0496117_0342268 | 3300048920 | Bacteria | 775 |
| 1150 | Ga0496118_0027915 | 3300048921 | Bacteria | 4766 |
| 1151 | Ga0496118_0032595 | 3300048921 | Bacteria | 4287 |
| 1152 | Ga0496118_0045304 | 3300048921 | Bacteria | 3435 |
| 1153 | Ga0496118_0107848 | 3300048921 | Bacteria | 1858 |
| 1154 | Ga0496118_0168104 | 3300048921 | Bacteria | 1344 |
| 1155 | Ga0496118_0189991 | 3300048921 | Bacteria | 1229 |
| 1156 | Ga0496118_0404177 | 3300048921 | Bacteria | 708 |
| 1157 | Ga0496119_0000255 | 3300048922 | Bacteria | 75611 |
| 1158 | Ga0496119_0004546 | 3300048922 | Bacteria | 13747 |
| 1159 | Ga0496119_0149564 | 3300048922 | Bacteria | 1253 |
| 1160 | Ga0496120_0000240 | 3300048923 | Bacteria | 93297 |
| 1161 | Ga0496120_0000598 | 3300048923 | Bacteria | 54693 |
| 1162 | Ga0496121_0008127 | 3300048924 | Bacteria | 12469 |
| 1163 | Ga0496121_0098890 | 3300048924 | Bacteria | 2256 |
| 1164 | Ga0496121_0157964 | 3300048924 | Bacteria | 1662 |
| 1165 | Ga0496121_0648438 | 3300048924 | Bacteria | 643 |
| 1166 | Ga0496122_0000663 | 3300048925 | Bacteria | 69218 |
| 1167 | Ga0496122_0006648 | 3300048925 | Bacteria | 13181 |
| 1168 | Ga0496122_0097579 | 3300048925 | Bacteria | 1977 |
| 1169 | Ga0496122_0128618 | 3300048925 | Bacteria | 1615 |
| 1170 | Ga0496122_0142513 | 3300048925 | Bacteria | 1496 |
| 1171 | Ga0496122_0455300 | 3300048925 | Bacteria | 633 |
| 1172 | Ga0496122_0472294 | 3300048925 | Bacteria | 616 |
| 1173 | Ga0496123_0000828 | 3300048926 | Bacteria | 49715 |
| 1174 | Ga0496123_0001279 | 3300048926 | Bacteria | 35949 |
| 1175 | Ga0496123_0023685 | 3300048926 | Bacteria | 4692 |
| 1176 | Ga0496123_0098020 | 3300048926 | Bacteria | 1715 |
| 1177 | Ga0496123_0121913 | 3300048926 | Bacteria | 1464 |
| 1178 | Ga0496123_0129133 | 3300048926 | Bacteria | 1404 |
| 1179 | Ga0496123_0204322 | 3300048926 | Bacteria | 1009 |
| 1180 | Ga0496123_0309310 | 3300048926 | Bacteria | 750 |
| 1181 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 1182 | Ga0496124_0021163 | 3300048927 | Bacteria | 5995 |
| 1183 | Ga0496124_0026783 | 3300048927 | Bacteria | 5191 |
| 1184 | Ga0496124_0030421 | 3300048927 | Bacteria | 4792 |
| 1185 | Ga0496124_0076288 | 3300048927 | Bacteria | 2767 |
| 1186 | Ga0496124_0172938 | 3300048927 | Bacteria | 1670 |
| 1187 | Ga0496124_0188838 | 3300048927 | Bacteria | 1579 |
| 1188 | Ga0496124_0204340 | 3300048927 | Bacteria | 1499 |
| 1189 | Ga0496124_0280324 | 3300048927 | Bacteria | 1215 |
| 1190 | Ga0496124_0303126 | 3300048927 | Bacteria | 1152 |
| 1191 | Ga0496125_0025528 | 3300048928 | Bacteria | 5408 |
| 1192 | Ga0496125_0071631 | 3300048928 | Bacteria | 2706 |
| 1193 | Ga0496125_0077343 | 3300048928 | Bacteria | 2565 |
| 1194 | Ga0496125_0089734 | 3300048928 | Bacteria | 2310 |
| 1195 | Ga0496125_0100233 | 3300048928 | Bacteria | 2136 |
| 1196 | Ga0496125_0112107 | 3300048928 | Bacteria | 1972 |
| 1197 | Ga0496125_0148737 | 3300048928 | Bacteria | 1613 |
| 1198 | Ga0496125_0717106 | 3300048928 | Bacteria | 528 |
| 1199 | Ga0496126_0006652 | 3300048929 | Bacteria | 12862 |
| 1200 | Ga0496126_0084112 | 3300048929 | Bacteria | 2807 |
| 1201 | Ga0496126_0086702 | 3300048929 | Bacteria | 2759 |
| 1202 | Ga0496126_0208506 | 3300048929 | Bacteria | 1646 |
| 1203 | Ga0496126_0345333 | 3300048929 | Bacteria | 1218 |
| 1204 | Ga0496126_0375082 | 3300048929 | Bacteria | 1159 |
| 1205 | Ga0501306_023887 | 3300049127 | Bacteria | 870 |
| 1206 | Ga0501308_007083 | 3300049128 | Bacteria | 1167 |
| 1207 | Ga0501309_001733 | 3300049129 | Bacteria | 2217 |
| 1208 | Ga0501310_000865 | 3300049130 | Bacteria | 2705 |
| 1209 | Ga0501310_028433 | 3300049130 | Bacteria | 733 |
| 1210 | Ga0501304_000917 | 3300049160 | Bacteria | 1739 |
| 1211 | Ga0501304_018257 | 3300049160 | Bacteria | 676 |
| 1212 | Ga0501305_003418 | 3300049161 | Bacteria | 1795 |
| 1213 | Ga0501294_009168 | 3300049517 | Bacteria | 970 |
| 1214 | Ga0501297_004528 | 3300049520 | Bacteria | 1426 |
| 1215 | Ga0501298_083728 | 3300049521 | Bacteria | 705 |
| 1216 | Ga0501300_001357 | 3300049523 | Bacteria | 3684 |
| 1217 | Ga0501312_003406 | 3300049528 | Bacteria | 1802 |
| 1218 | Ga0501313_023853 | 3300049529 | Bacteria | 768 |
| 1219 | Ga0501314_002220 | 3300049530 | Bacteria | 1482 |
| 1220 | Ga0501315_002024 | 3300049531 | Bacteria | 1848 |
| 1221 | Ga0501317_004293 | 3300049533 | Bacteria | 1475 |
| 1222 | Ga0501321_026828 | 3300049537 | Bacteria | 749 |
| 1223 | Ga0501031_0025514 | 3300049568 | Bacteria | 3854 |
| 1224 | Ga0501031_0042415 | 3300049568 | Bacteria | 2970 |
| 1225 | Ga0501031_0656317 | 3300049568 | Bacteria | 674 |
| 1226 | Ga0501032_0022123 | 3300049569 | Bacteria | 4411 |
| 1227 | Ga0501032_0228684 | 3300049569 | Bacteria | 1209 |
| 1228 | Ga0501033_0010061 | 3300049570 | Bacteria | 7261 |
| 1229 | Ga0501033_0085355 | 3300049570 | Bacteria | 2312 |
| 1230 | Ga0501033_0271942 | 3300049570 | Bacteria | 1197 |
| 1231 | Ga0501034_0021863 | 3300049571 | Bacteria | 6517 |
| 1232 | Ga0501034_0035289 | 3300049571 | Bacteria | 5070 |
| 1233 | Ga0501034_0072309 | 3300049571 | Bacteria | 3457 |
| 1234 | Ga0501036_0073796 | 3300049572 | Bacteria | 2884 |
| 1235 | Ga0501036_0323981 | 3300049572 | Bacteria | 1287 |
| 1236 | Ga0501036_1011383 | 3300049572 | Bacteria | 680 |
| 1237 | Ga0501037_0020065 | 3300049573 | Bacteria | 4933 |
| 1238 | Ga0501038_0014117 | 3300049574 | Bacteria | 7277 |
| 1239 | Ga0501038_0026943 | 3300049574 | Bacteria | 5116 |
| 1240 | Ga0501039_0067085 | 3300049575 | Bacteria | 2786 |
| 1241 | Ga0501039_0255226 | 3300049575 | Bacteria | 1378 |
| 1242 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 1243 | Ga0501043_0021135 | 3300049579 | Bacteria | 5102 |
| 1244 | Ga0501043_0229570 | 3300049579 | Bacteria | 1434 |
| 1245 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 1246 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 1247 | Ga0501047_0021327 | 3300049581 | Bacteria | 6218 |
| 1248 | Ga0501047_0171970 | 3300049581 | Bacteria | 2035 |
| 1249 | Ga0501048_0010686 | 3300049582 | Bacteria | 6845 |
| 1250 | Ga0501068_0936823 | 3300049584 | Bacteria | 570 |
| 1251 | Ga0501070_0045102 | 3300049586 | Bacteria | 3667 |
| 1252 | Ga0501070_0164408 | 3300049586 | Bacteria | 1829 |
| 1253 | Ga0501071_0460648 | 3300049587 | Bacteria | 973 |
| 1254 | Ga0501073_0065946 | 3300049589 | Bacteria | 2524 |
| 1255 | Ga0501198_000004 | 3300049649 | Bacteria | 175146 |
| 1256 | Ga0501199_015195 | 3300049650 | Bacteria | 860 |
| 1257 | Ga0501206_006551 | 3300049653 | Bacteria | 1515 |
| 1258 | Ga0501211_002448 | 3300049658 | Bacteria | 1961 |
| 1259 | Ga0501217_027085 | 3300049661 | Bacteria | 1389 |
| 1260 | Ga0501222_000038 | 3300049662 | Bacteria | 51424 |
| 1261 | Ga0501222_008815 | 3300049662 | Bacteria | 1336 |
| 1262 | Ga0501223_009832 | 3300049663 | Bacteria | 1931 |
| 1263 | Ga0501235_024396 | 3300049669 | Bacteria | 1350 |
| 1264 | Ga0501250_012952 | 3300049680 | Bacteria | 994 |
| 1265 | Ga0501251_052739 | 3300049681 | Bacteria | 649 |
| 1266 | Ga0501253_018493 | 3300049683 | Bacteria | 1190 |
| 1267 | Ga0501255_001001 | 3300049684 | Bacteria | 2155 |
| 1268 | Ga0501258_006361 | 3300049687 | Bacteria | 1170 |
| 1269 | Ga0501261_009717 | 3300049690 | Bacteria | 1258 |
| 1270 | Ga0501225_0025880 | 3300049705 | Bacteria | 1614 |
| 1271 | Ga0501225_0038030 | 3300049705 | Bacteria | 1326 |
| 1272 | Ga0501229_000597 | 3300049706 | Bacteria | 4050 |
| 1273 | Ga0501080_0016883 | 3300049742 | Bacteria | 6742 |
| 1274 | Ga0501080_1590210 | 3300049742 | Bacteria | 554 |
| 1275 | Ga0501080_1872194 | 3300049742 | Bacteria | 503 |
| 1276 | Ga0501232_032573 | 3300049757 | Bacteria | 731 |
| 1277 | Ga0501262_002037 | 3300049759 | Bacteria | 2279 |
| 1278 | Ga0501265_010324 | 3300049762 | Bacteria | 1138 |
| 1279 | Ga0501267_001203 | 3300049764 | Bacteria | 2172 |
| 1280 | Ga0501268_103430 | 3300049765 | Bacteria | 613 |
| 1281 | Ga0501272_005104 | 3300049769 | Bacteria | 1376 |
| 1282 | Ga0501282_013499 | 3300049778 | Bacteria | 885 |
| 1283 | Ga0501035_0014880 | 3300049822 | Bacteria | 7180 |
| 1284 | Ga0501035_0192031 | 3300049822 | Bacteria | 1755 |
| 1285 | Ga0501044_0019187 | 3300049823 | Bacteria | 7319 |
| 1286 | Ga0501044_0037114 | 3300049823 | Bacteria | 5095 |
| 1287 | Ga0501044_1020321 | 3300049823 | Bacteria | 699 |
| 1288 | Ga0501044_1567984 | 3300049823 | Bacteria | 523 |
| 1289 | Ga0501044_1602328 | 3300049823 | Bacteria | 516 |
| 1290 | Ga0501045_0016727 | 3300049824 | Bacteria | 5209 |
| 1291 | Ga0501226_033241 | 3300049853 | Bacteria | 589 |
| 1292 | nmdc:mga03683_315569_c1 | 3300050489 | Bacteria | 735 |
| 1293 | nmdc:mga03n38_539604_c1 | 3300050490 | Bacteria | 659 |
| 1294 | nmdc:mga00v17_153575_c1 | 3300050491 | Bacteria | 1480 |
| 1295 | nmdc:mga0yw44_104612_c1 | 3300050492 | Bacteria | 1807 |
| 1296 | nmdc:mga0k408_129139_c1 | 3300050493 | Bacteria | 1500 |
| 1297 | nmdc:mga0k408_186563_c1 | 3300050493 | Bacteria | 1237 |
| 1298 | nmdc:mga0k408_293352_c1 | 3300050493 | Bacteria | 970 |
| 1299 | nmdc:mga07m45_187418_c1 | 3300050496 | Bacteria | 1203 |
| 1300 | nmdc:mga07m45_46177_c1 | 3300050496 | Bacteria | 2446 |
| 1301 | nmdc:mga07m45_61691_c1 | 3300050496 | Bacteria | 2124 |
| 1302 | nmdc:mga08y16_1337202_c1 | 3300050511 | Bacteria | 682 |
| 1303 | nmdc:mga08y16_749189_c1 | 3300050511 | Bacteria | 973 |
| 1304 | Ga0495601_0144456 | 3300053077 | Bacteria | 1552 |
| 1305 | Ga0495612_0238028 | 3300053078 | Bacteria | 808 |
| 1306 | Ga0495612_0358143 | 3300053078 | Bacteria | 659 |
| 1307 | Ga0500635_0000046 | 3300053080 | Bacteria | 84743 |
| 1308 | Ga0495595_0160133 | 3300053084 | Bacteria | 1110 |
| 1309 | Ga0495619_0173642 | 3300053085 | Bacteria | 1491 |
| 1310 | Ga0500651_0000088 | 3300053093 | Bacteria | 59179 |
| 1311 | Ga0500658_0180230 | 3300053134 | Bacteria | 962 |
| 1312 | Ga0500559_0050725 | 3300053136 | Bacteria | 1831 |
| 1313 | Ga0500564_088801 | 3300053138 | Bacteria | 1378 |
| 1314 | Ga0500577_0340038 | 3300053142 | Bacteria | 656 |
| 1315 | Ga0500604_0155491 | 3300053151 | Bacteria | 778 |
| 1316 | Ga0500622_0019200 | 3300053156 | Bacteria | 3630 |
| 1317 | Ga0500634_0000049 | 3300053161 | Bacteria | 53534 |
| 1318 | Ga0500636_0182491 | 3300053177 | Bacteria | 1125 |
| 1319 | Ga0501084_0879507 | 3300054114 | Bacteria | 754 |
| 1320 | 2547503041 | 2547132130 | Bacteria | 4660562 |
| 1321 | 2572253883 | 2571042365 | Bacteria | 3289345 |
| 1322 | 2578458467 | 2576861471 | Bacteria | 4648976 |
| 1323 | 2643745674 | 2643221544 | Bacteria | 5886209 |
| 1324 | 2643907762 | 2643221579 | Bacteria | 4443405 |
| 1325 | 2643916031 | 2643221581 | Bacteria | 3893603 |
| 1326 | 2644221564 | 2643221639 | Bacteria | 6649903 |
| 1327 | 2644245444 | 2643221644 | Bacteria | 6865017 |
| 1328 | 2644257675 | 2643221646 | Bacteria | 6433402 |
| 1329 | 2644529358 | 2643221695 | Bacteria | 3441323 |
| 1330 | 2747947750 | 2747842428 | Bacteria | 4689383 |
| 1331 | 2748019495 | 2747842501 | Bacteria | 5293829 |
| 1332 | 2765578937 | 2765235840 | Bacteria | 4663337 |
| 1333 | 2816516997 | 2816332141 | Bacteria | 4436036 |
| 1334 | 2819659635 | 2818991457 | Bacteria | 5323295 |
| 1335 | 2831865637 | 2831864461 | Bacteria | 6502356 |
| 1336 | 2842393018 | 2842391507 | Bacteria | 4486072 |
| 1337 | 2842760247 | 2842757796 | Bacteria | 3981385 |
| 1338 | 2842780750 | 2842780639 | Bacteria | 4337790 |
| 1339 | 2852650889 | 2852649853 | Bacteria | 4036942 |
| 1340 | 2852685563 | 2852684882 | Bacteria | 5463342 |
| 1341 | 2857443732 | 2857442823 | Bacteria | 4562550 |
| 1342 | 2874221577 | 2874220319 | Bacteria | 4594709 |
| 1343 | 2895500662 | 2895498888 | Bacteria | 5283788 |
| 1344 | 2895516468 | 2895511927 | Bacteria | 6802080 |
| 1345 | 2895523612 | 2895522137 | Bacteria | 3284416 |
| 1346 | 2895526806 | 2895525241 | Bacteria | 3388457 |
| 1347 | 2919089756 | 2919089067 | Bacteria | 4560942 |
| 1348 | 2919131710 | 2919130084 | Bacteria | 5301837 |
| 1349 | 2919137695 | 2919134579 | Bacteria | 4480386 |
| 1350 | 2923518440 | 2923516293 | Bacteria | 3716336 |
| 1351 | 2928499461 | 2928496128 | Bacteria | 4631123 |
| 1352 | 2929197920 | 2929195423 | Bacteria | 5325372 |
| 1353 | 2931380798 | 2931380184 | Bacteria | 4455911 |
| 1354 | 2937612396 | 2937610967 | Bacteria | 4618818 |
| 1355 | 2939591400 | 2939589442 | Bacteria | 4214238 |
| 1356 | 2939623537 | 2939622612 | Bacteria | 4698046 |
| 1357 | 2939627373 | 2939626828 | Bacteria | 4695272 |
| 1358 | 2941478265 | 2941475908 | Bacteria | 4145589 |
| 1359 | 2941490126 | 2941489479 | Bacteria | 6313767 |
| 1360 | 2961048344 | 2961047084 | Bacteria | 4594415 |
| 1361 | 2961065340 | 2961064222 | Bacteria | 4749990 |
| 1362 | 2974309038 | 2974307012 | Bacteria | 4172388 |
| 1363 | 2977249755 | 2977247770 | Bacteria | 4160543 |
| 1364 | 2984515755 | 2984514374 | Bacteria | 4172479 |
| 1365 | 2987606381 | 2987605356 | Bacteria | 4187822 |
| 1366 | 2995951936 | 2995948881 | Bacteria | 6358104 |
| 1367 | 8002871887 | 8002869464 | Bacteria | 3588529 |
| 1368 | 8021624682 | 8021622325 | Bacteria | 4844743 |
| 1369 | 8021629196 | 8021626552 | Bacteria | 4665214 |
| 1370 | 8021649063 | 8021648035 | Bacteria | 4772378 |
| 1371 | Ga0055543_1012054 | |||
| 1372 | SwRhRL2b_contig_2733011 | |||
| 1373 | SwRhRL2b_contig_3886549 | |||
| 1374 | JGI25156J39149_1002197 | |||
| 1375 | JGI25156J39149_1006806 | |||
| 1376 | JGI25154J39366_1001260 | |||
| 1377 | JGI25157J39369_1000491 | |||
| 1378 | JGI25164J39214_1009409 | |||
| 1379 | Ga0006778J45830_1039144 | |||
| 1380 | rootH1_10002740 | |||
| 1381 | rootH1_10002744 | |||
| 1382 | rootH1_10017987 | |||
| 1383 | rootH2_10019340 | |||
| 1384 | rootH2_10083712 | |||
| 1385 | rootH2_10187889 | |||
| 1386 | rootL2_10002046 | |||
| 1387 | rootL2_10047399 | |||
| 1388 | rootL2_10049164 | |||
| 1389 | rootL2_10136592 | |||
| 1390 | rootL2_10197176 | |||
| 1391 | rootL2_10256599 | |||
| 1392 | rootH1_10038473 | |||
| 1393 | rootH1_10058276 | |||
| 1394 | rootH1_10061833 | |||
| 1395 | rootH1_10072793 | |||
| 1396 | rootH1_10143584 | |||
| 1397 | rootH1_10235777 | |||
| 1398 | Ga0055539_1000279 | |||
| 1399 | Ga0055539_1002101 | |||
| 1400 | Ga0055539_1023488 | |||
| 1401 | Ga0055533_1000025 | |||
| 1402 | Ga0055525_1000046 | |||
| 1403 | Ga0055525_1001306 | |||
| 1404 | Ga0055535_1000122 | |||
| 1405 | Ga0055535_1016001 | |||
| 1406 | Ga0055529_1000199 | |||
| 1407 | Ga0055526_1000101 | |||
| 1408 | Ga0055526_1003565 | |||
| 1409 | Ga0055526_1006205 | |||
| 1410 | Ga0055537_1000091 | |||
| 1411 | Ga0055537_1000459 | |||
| 1412 | Ga0055537_1000560 | |||
| 1413 | Ga0055524_1000574 | |||
| 1414 | Ga0055524_1001859 | |||
| 1415 | Ga0055524_1012111 | |||
| 1416 | Ga0055524_1032069 | |||
| 1417 | Ga0055524_1032769 | |||
| 1418 | Ga0055536_1001901 | |||
| 1419 | Ga0055536_1003184 | |||
| 1420 | Ga0055536_1005396 | |||
| 1421 | Ga0055536_1014378 | |||
| 1422 | Ga0055534_1000043 | |||
| 1423 | Ga0055534_1000078 | |||
| 1424 | Ga0055528_1000075 | |||
| 1425 | Ga0055528_1000087 | |||
| 1426 | Ga0055530_10001911 | |||
| 1427 | Ga0055530_10007441 | |||
| 1428 | Ga0055530_10008282 | |||
| 1429 | Ga0055530_10010812 | |||
| 1430 | Ga0055530_10030449 | |||
| 1431 | Ga0055530_10053491 | |||
| 1432 | Ga0055540_1000004 | |||
| 1433 | Ga0055540_1000035 | |||
| 1434 | Ga0055540_1014970 | |||
| 1435 | Ga0055540_1028470 | |||
| 1436 | Ga0055540_1046447 | |||
| 1437 | Ga0055531_10010928 | |||
| 1438 | Ga0055531_10012582 | |||
| 1439 | Ga0055531_10020086 | |||
| 1440 | Ga0055531_10025346 | |||
| 1441 | Ga0055531_10028318 | |||
| 1442 | Ga0058692_1000060 | |||
| 1443 | Ga0058692_1000555 | |||
| 1444 | Ga0055543_1003835 | |||
| 1445 | Ga0065165_1000239 | |||
| 1446 | Ga0065165_1000401 | |||
| 1447 | Ga0065165_1076663 | |||
| 1448 | Ga0065704_10000521 | |||
| 1449 | Ga0065704_10078724 | |||
| 1450 | Ga0065704_10138923 | |||
| 1451 | Ga0065704_10193942 | |||
| 1452 | Ga0065715_10160732 | |||
| 1453 | Ga0070658_10005332 | |||
| 1454 | Ga0070658_10138163 | |||
| 1455 | Ga0070658_10166330 | |||
| 1456 | Ga0070658_10501468 | |||
| 1457 | Ga0070676_10116453 | |||
| 1458 | Ga0070676_10163474 | |||
| 1459 | Ga0070676_10232491 | |||
| 1460 | Ga0070676_10271029 | |||
| 1461 | Ga0070676_10301012 | |||
| 1462 | Ga0070676_10812898 | |||
| 1463 | Ga0070683_100159377 | |||
| 1464 | Ga0070683_100239841 | |||
| 1465 | Ga0070690_100019205 | |||
| 1466 | Ga0070690_100028644 | |||
| 1467 | Ga0070690_100143883 | |||
| 1468 | Ga0070690_100273359 | |||
| 1469 | Ga0070670_100003584 | |||
| 1470 | Ga0070670_100034566 | |||
| 1471 | Ga0070670_100117018 | |||
| 1472 | Ga0070670_100150580 | |||
| 1473 | Ga0070670_100164485 | |||
| 1474 | Ga0070670_100202876 | |||
| 1475 | Ga0070670_100265353 | |||
| 1476 | Ga0070670_101077045 | |||
| 1477 | Ga0070670_101916629 | |||
| 1478 | Ga0070677_10025590 | |||
| 1479 | Ga0070677_10052737 | |||
| 1480 | Ga0070677_10084279 | |||
| 1481 | Ga0070677_10125290 | |||
| 1482 | Ga0070677_10291543 | |||
| 1483 | Ga0068869_100083709 | |||
| 1484 | Ga0068869_100092019 | |||
| 1485 | Ga0068869_100113189 | |||
| 1486 | Ga0068869_100133862 | |||
| 1487 | Ga0068869_100805593 | |||
| 1488 | Ga0070666_10022849 | |||
| 1489 | Ga0070666_10033683 | |||
| 1490 | Ga0070666_10725171 | |||
| 1491 | Ga0070680_100200755 | |||
| 1492 | Ga0070682_100319171 | |||
| 1493 | Ga0070682_100366638 | |||
| 1494 | Ga0070682_100441809 | |||
| 1495 | Ga0068868_100010923 | |||
| 1496 | Ga0068868_100105165 | |||
| 1497 | Ga0068868_100625760 | |||
| 1498 | Ga0068868_100627545 | |||
| 1499 | Ga0068868_100628643 | |||
| 1500 | Ga0068868_101225452 | |||
| 1501 | Ga0070660_100177344 | |||
| 1502 | Ga0070660_100258905 | |||
| 1503 | Ga0070660_100415469 | |||
| 1504 | Ga0070660_100441923 | |||
| 1505 | Ga0070689_100080869 | |||
| 1506 | Ga0070689_100221359 | |||
| 1507 | Ga0070689_100240708 | |||
| 1508 | Ga0070689_100383657 | |||
| 1509 | Ga0070687_100008132 | |||
| 1510 | Ga0070687_100317632 | |||
| 1511 | Ga0070687_100331125 | |||
| 1512 | Ga0070687_100603233 | |||
| 1513 | Ga0070661_100084736 | |||
| 1514 | Ga0070661_100230417 | |||
| 1515 | Ga0070661_100254344 | |||
| 1516 | Ga0070692_10275966 | |||
| 1517 | Ga0070668_100065280 | |||
| 1518 | Ga0070668_100106945 | |||
| 1519 | Ga0070668_100149654 | |||
| 1520 | Ga0070668_100436334 | |||
| 1521 | Ga0070668_101435490 | |||
| 1522 | Ga0070669_100001896 | |||
| 1523 | Ga0070669_100021831 | |||
| 1524 | Ga0070669_100095163 | |||
| 1525 | Ga0070669_100497763 | |||
| 1526 | Ga0070669_100709599 | |||
| 1527 | Ga0070669_100843272 | |||
| 1528 | Ga0070675_100001199 | |||
| 1529 | Ga0070675_100027333 | |||
| 1530 | Ga0070675_100038320 | |||
| 1531 | Ga0070675_100262615 | |||
| 1532 | Ga0070675_100562965 | |||
| 1533 | Ga0070675_100633071 | |||
| 1534 | Ga0070675_101151747 | |||
| 1535 | Ga0070671_100009616 | |||
| 1536 | Ga0070671_100069035 | |||
| 1537 | Ga0070671_100121757 | |||
| 1538 | Ga0070671_100134304 | |||
| 1539 | Ga0070671_100158250 | |||
| 1540 | Ga0070671_100401989 | |||
| 1541 | Ga0070671_100437577 | |||
| 1542 | Ga0070671_100737062 | |||
| 1543 | Ga0070671_100878486 | |||
| 1544 | Ga0070674_100003764 | |||
| 1545 | Ga0070674_100187003 | |||
| 1546 | Ga0070674_100271492 | |||
| 1547 | Ga0070674_100588240 | |||
| 1548 | Ga0070674_101091653 | |||
| 1549 | Ga0070673_100073367 | |||
| 1550 | Ga0070673_100205364 | |||
| 1551 | Ga0070673_100227369 | |||
| 1552 | Ga0070673_100236454 | |||
| 1553 | Ga0070673_100366647 | |||
| 1554 | Ga0070673_100708241 | |||
| 1555 | Ga0070673_100724620 | |||
| 1556 | Ga0070688_100075599 | |||
| 1557 | Ga0070688_100114079 | |||
| 1558 | Ga0070659_100000336 | |||
| 1559 | Ga0070659_100090132 | |||
| 1560 | Ga0070659_100209986 | |||
| 1561 | Ga0070659_100377472 | |||
| 1562 | Ga0070659_101023812 | |||
| 1563 | Ga0070667_100005446 | |||
| 1564 | Ga0070667_100016792 | |||
| 1565 | Ga0070667_100318288 | |||
| 1566 | Ga0070667_101317883 | |||
| 1567 | Ga0070714_100259131 | |||
| 1568 | Ga0070701_10374466 | |||
| 1569 | Ga0070701_10432580 | |||
| 1570 | Ga0070663_100007308 | |||
| 1571 | Ga0070663_100130980 | |||
| 1572 | Ga0070663_100318737 | |||
| 1573 | Ga0070663_100549137 | |||
| 1574 | Ga0070663_101180864 | |||
| 1575 | Ga0070678_100010070 | |||
| 1576 | Ga0070678_100043335 | |||
| 1577 | Ga0070678_100160790 | |||
| 1578 | Ga0070678_100170193 | |||
| 1579 | Ga0070678_100174108 | |||
| 1580 | Ga0070678_100266817 | |||
| 1581 | Ga0070678_100310449 | |||
| 1582 | Ga0070678_101194906 | |||
| 1583 | Ga0070662_100000867 | |||
| 1584 | Ga0070662_100178485 | |||
| 1585 | Ga0070662_100273071 | |||
| 1586 | Ga0070662_100313493 | |||
| 1587 | Ga0070662_100479368 | |||
| 1588 | Ga0070681_10464008 | |||
| 1589 | Ga0068867_100000005 | |||
| 1590 | Ga0068867_100082817 | |||
| 1591 | Ga0068867_100178603 | |||
| 1592 | Ga0068867_100398158 | |||
| 1593 | Ga0068867_100399280 | |||
| 1594 | Ga0068867_101466082 | |||
| 1595 | Ga0070685_10554750 | |||
| 1596 | Ga0070679_100003038 | |||
| 1597 | Ga0070684_100313579 | |||
| 1598 | Ga0070684_101159476 | |||
| 1599 | Ga0068853_100264449 | |||
| 1600 | Ga0068853_100347810 | |||
| 1601 | Ga0068853_100371292 | |||
| 1602 | Ga0068853_100371500 | |||
| 1603 | Ga0068853_100417599 | |||
| 1604 | Ga0068853_100664387 | |||
| 1605 | Ga0070672_100003244 | |||
| 1606 | Ga0070672_100220039 | |||
| 1607 | Ga0070672_100429558 | |||
| 1608 | Ga0070672_100438744 | |||
| 1609 | Ga0070672_100548588 | |||
| 1610 | Ga0070672_101241383 | |||
| 1611 | Ga0070686_100208664 | |||
| 1612 | Ga0070686_100319526 | |||
| 1613 | Ga0070693_100218418 | |||
| 1614 | Ga0070693_100364409 | |||
| 1615 | Ga0070665_100439011 | |||
| 1616 | Ga0070665_102536391 | |||
| 1617 | Ga0068855_100035623 | |||
| 1618 | Ga0068855_100063395 | |||
| 1619 | Ga0068855_100065258 | |||
| 1620 | Ga0068855_100187491 | |||
| 1621 | Ga0068855_100288889 | |||
| 1622 | Ga0068855_101509026 | |||
| 1623 | Ga0070664_100014426 | |||
| 1624 | Ga0070664_100266060 | |||
| 1625 | Ga0070664_100309246 | |||
| 1626 | Ga0070664_100517141 | |||
| 1627 | Ga0068857_100002880 | |||
| 1628 | Ga0068857_100643149 | |||
| 1629 | Ga0068857_100653711 | |||
| 1630 | Ga0068857_100788733 | |||
| 1631 | Ga0068857_101622759 | |||
| 1632 | Ga0068854_100032823 | |||
| 1633 | Ga0068854_100188620 | |||
| 1634 | Ga0068854_100296805 | |||
| 1635 | Ga0068854_100342447 | |||
| 1636 | Ga0068856_100004237 | |||
| 1637 | Ga0068856_100287717 | |||
| 1638 | Ga0068856_100566739 | |||
| 1639 | Ga0070702_100266700 | |||
| 1640 | Ga0068852_100023003 | |||
| 1641 | Ga0068852_100051582 | |||
| 1642 | Ga0068852_100125132 | |||
| 1643 | Ga0068852_100173703 | |||
| 1644 | Ga0068852_100201955 | |||
| 1645 | Ga0068852_100228622 | |||
| 1646 | Ga0068852_100344478 | |||
| 1647 | Ga0068852_100927121 | |||
| 1648 | Ga0068859_100010529 | |||
| 1649 | Ga0068859_100966507 | |||
| 1650 | Ga0068864_100002556 | |||
| 1651 | Ga0068864_100010811 | |||
| 1652 | Ga0068864_100074072 | |||
| 1653 | Ga0068864_100219843 | |||
| 1654 | Ga0068864_100287767 | |||
| 1655 | Ga0068864_100311152 | |||
| 1656 | Ga0068864_100407153 | |||
| 1657 | Ga0068866_10022477 | |||
| 1658 | Ga0068866_10451577 | |||
| 1659 | Ga0068866_10454602 | |||
| 1660 | Ga0068861_100001169 | |||
| 1661 | Ga0068861_100003364 | |||
| 1662 | Ga0068861_100020439 | |||
| 1663 | Ga0068861_100637374 | |||
| 1664 | Ga0068861_101175683 | |||
| 1665 | Ga0068851_10107935 | |||
| 1666 | Ga0068851_10149319 | |||
| 1667 | Ga0068851_10170888 | |||
| 1668 | Ga0068851_10742335 | |||
| 1669 | Ga0068870_10112703 | |||
| 1670 | Ga0068870_10198304 | |||
| 1671 | Ga0068870_10238358 | |||
| 1672 | Ga0068870_10561730 | |||
| 1673 | Ga0068863_100019332 | |||
| 1674 | Ga0068863_100075179 | |||
| 1675 | Ga0068863_100185591 | |||
| 1676 | Ga0068863_100222829 | |||
| 1677 | Ga0068863_100511302 | |||
| 1678 | Ga0068858_100015946 | |||
| 1679 | Ga0068858_100201227 | |||
| 1680 | Ga0068858_100761124 | |||
| 1681 | Ga0068860_100170425 | |||
| 1682 | Ga0068862_100112008 | |||
| 1683 | Ga0068862_100208709 | |||
| 1684 | Ga0068862_100707168 | |||
| 1685 | Ga0068862_100758516 | |||
| 1686 | Ga0081539_10083917 | |||
| 1687 | Ga0070717_10529892 | |||
| 1688 | Ga0075365_10065199 | |||
| 1689 | Ga0075365_10618794 | |||
| 1690 | Ga0075363_100215076 | |||
| 1691 | Ga0075364_10001093 | |||
| 1692 | Ga0075364_10279616 | |||
| 1693 | Ga0075367_10153877 | |||
| 1694 | Ga0075369_10027960 | |||
| 1695 | Ga0075366_10055725 | |||
| 1696 | Ga0075366_10113036 | |||
| 1697 | Ga0075366_10155524 | |||
| 1698 | Ga0075366_10200893 | |||
| 1699 | Ga0097621_100009661 | |||
| 1700 | Ga0097621_100010826 | |||
| 1701 | Ga0097621_100017103 | |||
| 1702 | Ga0097621_100113913 | |||
| 1703 | Ga0097621_100230556 | |||
| 1704 | Ga0097621_100603380 | |||
| 1705 | Ga0075370_10002692 | |||
| 1706 | Ga0075370_10037091 | |||
| 1707 | Ga0075370_10166025 | |||
| 1708 | Ga0068871_100005809 | |||
| 1709 | Ga0068871_100057753 | |||
| 1710 | Ga0068871_100067624 | |||
| 1711 | Ga0068871_100141284 | |||
| 1712 | Ga0068871_100223359 | |||
| 1713 | Ga0068871_100550890 | |||
| 1714 | Ga0068871_101054900 | |||
| 1715 | Ga0075429_100815997 | |||
| 1716 | Ga0068865_100094158 | |||
| 1717 | Ga0068865_100166194 | |||
| 1718 | Ga0068865_100277296 | |||
| 1719 | Ga0068865_100536179 | |||
| 1720 | Ga0097620_100010529 | |||
| 1721 | Ga0097620_100966531 | |||
| 1722 | Ga0079104_1000352 | |||
| 1723 | Ga0099826_10560233 | |||
| 1724 | Ga0105251_10000364 | |||
| 1725 | Ga0105244_10041838 | |||
| 1726 | Ga0105240_10055942 | |||
| 1727 | Ga0105240_10212788 | |||
| 1728 | Ga0105240_10654346 | |||
| 1729 | Ga0105240_11006023 | |||
| 1730 | Ga0105240_11068556 | |||
| 1731 | Ga0111539_10951431 | |||
| 1732 | Ga0111539_11239148 | |||
| 1733 | Ga0111539_11565602 | |||
| 1734 | Ga0105245_10048722 | |||
| 1735 | Ga0105245_10502295 | |||
| 1736 | Ga0105245_10662157 | |||
| 1737 | Ga0105245_10732566 | |||
| 1738 | Ga0105243_10006867 | |||
| 1739 | Ga0105243_10013725 | |||
| 1740 | Ga0105243_10102698 | |||
| 1741 | Ga0105243_10433572 | |||
| 1742 | Ga0105243_11468364 | |||
| 1743 | Ga0105243_11806122 | |||
| 1744 | Ga0105243_11870583 | |||
| 1745 | Ga0105243_12001301 | |||
| 1746 | Ga0105241_10119752 | |||
| 1747 | Ga0105241_11523244 | |||
| 1748 | Ga0105242_10330985 | |||
| 1749 | Ga0105242_10335390 | |||
| 1750 | Ga0105242_10912657 | |||
| 1751 | Ga0105242_11028492 | |||
| 1752 | Ga0105248_10014945 | |||
| 1753 | Ga0105248_10039291 | |||
| 1754 | Ga0105248_10105222 | |||
| 1755 | Ga0105248_10500405 | |||
| 1756 | Ga0105248_10585797 | |||
| 1757 | Ga0105248_10682446 | |||
| 1758 | Ga0105248_12289127 | |||
| 1759 | Ga0105237_10043493 | |||
| 1760 | Ga0105237_10078237 | |||
| 1761 | Ga0105237_10332526 | |||
| 1762 | Ga0105238_10035279 | |||
| 1763 | Ga0105249_10060727 | |||
| 1764 | Ga0105249_10163245 | |||
| 1765 | Ga0105249_11447828 | |||
| 1766 | Ga0105249_13359061 | |||
| 1767 | Ga0105148_121146 | |||
| 1768 | Ga0105239_10056095 | |||
| 1769 | Ga0105239_10320005 | |||
| 1770 | Ga0105239_10390603 | |||
| 1771 | Ga0105246_10055307 | |||
| 1772 | Ga0157319_1000031 | |||
| 1773 | Ga0157373_10613361 | |||
| 1774 | Ga0157373_10815433 | |||
| 1775 | Ga0157371_10002369 | |||
| 1776 | Ga0157371_10062945 | |||
| 1777 | Ga0157371_10079985 | |||
| 1778 | Ga0157371_10160203 | |||
| 1779 | Ga0157371_10162109 | |||
| 1780 | Ga0157371_10287601 | |||
| 1781 | Ga0157370_10102494 | |||
| 1782 | Ga0157370_10452984 | |||
| 1783 | Ga0157370_10487444 | |||
| 1784 | Ga0157370_11918103 | |||
| 1785 | Ga0157369_10049772 | |||
| 1786 | Ga0157369_10227086 | |||
| 1787 | Ga0157369_10445204 | |||
| 1788 | Ga0157374_10105010 | |||
| 1789 | Ga0157374_10171153 | |||
| 1790 | Ga0157374_10330567 | |||
| 1791 | Ga0157374_10344207 | |||
| 1792 | Ga0157378_10152828 | |||
| 1793 | Ga0157378_10180200 | |||
| 1794 | Ga0157378_10578450 | |||
| 1795 | Ga0157378_12775830 | |||
| 1796 | Ga0163162_10007486 | |||
| 1797 | Ga0163162_10025364 | |||
| 1798 | Ga0163162_10181423 | |||
| 1799 | Ga0163162_10265698 | |||
| 1800 | Ga0163162_10486191 | |||
| 1801 | Ga0163162_10674271 | |||
| 1802 | Ga0163162_10747585 | |||
| 1803 | Ga0163162_11074816 | |||
| 1804 | Ga0157372_10243948 | |||
| 1805 | Ga0157372_11149127 | |||
| 1806 | Ga0157375_10034088 | |||
| 1807 | Ga0157375_10109446 | |||
| 1808 | Ga0157375_10353768 | |||
| 1809 | Ga0157375_10408446 | |||
| 1810 | Ga0157375_10494459 | |||
| 1811 | Ga0157375_11009048 | |||
| 1812 | Ga0157375_11513579 | |||
| 1813 | Ga0157375_12642963 | |||
| 1814 | Ga0163163_10010139 | |||
| 1815 | Ga0163163_10240216 | |||
| 1816 | Ga0163163_10329833 | |||
| 1817 | Ga0163163_10600868 | |||
| 1818 | Ga0163163_11222756 | |||
| 1819 | Ga0163163_11443248 | |||
| 1820 | Ga0157380_10153834 | |||
| 1821 | Ga0157380_10198110 | |||
| 1822 | Ga0157380_10316828 | |||
| 1823 | Ga0157380_10424330 | |||
| 1824 | Ga0157380_10449479 | |||
| 1825 | Ga0157380_10636066 | |||
| 1826 | Ga0157380_13027101 | |||
| 1827 | Ga0182008_10010987 | |||
| 1828 | Ga0182008_10067339 | |||
| 1829 | Ga0182008_10495581 | |||
| 1830 | Ga0157377_10000022 | |||
| 1831 | Ga0157377_10062240 | |||
| 1832 | Ga0157377_10336995 | |||
| 1833 | Ga0157379_10011032 | |||
| 1834 | Ga0157379_10018910 | |||
| 1835 | Ga0157379_10066973 | |||
| 1836 | Ga0157379_10183696 | |||
| 1837 | Ga0157379_10326475 | |||
| 1838 | Ga0157379_10568848 | |||
| 1839 | Ga0157379_10633969 | |||
| 1840 | Ga0157376_10028517 | |||
| 1841 | Ga0157376_10129467 | |||
| 1842 | Ga0157376_10186237 | |||
| 1843 | Ga0157376_10210298 | |||
| 1844 | Ga0157376_10223886 | |||
| 1845 | Ga0157376_10360829 | |||
| 1846 | Ga0157376_10379663 | |||
| 1847 | Ga0157376_10670491 | |||
| 1848 | Ga0182006_1033096 | |||
| 1849 | Ga0182006_1064426 | |||
| 1850 | Ga0182006_1080302 | |||
| 1851 | Ga0182006_1081085 | |||
| 1852 | Ga0182006_1180587 | |||
| 1853 | Ga0182007_10000236 | |||
| 1854 | Ga0182007_10173386 | |||
| 1855 | Ga0182005_1001886 | |||
| 1856 | Ga0183360_10001 | |||
| 1857 | Ga0163161_10033566 | |||
| 1858 | Ga0163161_10036693 | |||
| 1859 | Ga0163161_10059326 | |||
| 1860 | Ga0163161_10092187 | |||
| 1861 | Ga0163161_10094277 | |||
| 1862 | Ga0163161_10128293 | |||
| 1863 | Ga0163161_10263008 | |||
| 1864 | Ga0163161_10369432 | |||
| 1865 | Ga0163161_10799188 | |||
| 1866 | Ga0206349_1304419 | |||
| 1867 | Ga0213872_10000029 | |||
| 1868 | Ga0213872_10000049 | |||
| 1869 | Ga0213872_10077224 | |||
| 1870 | Ga0213872_10092646 | |||
| 1871 | Ga0209674_100007 | |||
| 1872 | Ga0209674_113028 | |||
| 1873 | Ga0209563_100005 | |||
| 1874 | Ga0209563_100052 | |||
| 1875 | Ga0207427_100516 | |||
| 1876 | Ga0209258_100284 | |||
| 1877 | Ga0209258_100957 | |||
| 1878 | Ga0207425_1023502 | |||
| 1879 | Ga0209646_1000245 | |||
| 1880 | Ga0209026_1000021 | |||
| 1881 | Ga0209026_1009092 | |||
| 1882 | Ga0209026_1035437 | |||
| 1883 | Ga0209677_100015 | |||
| 1884 | Ga0209677_100477 | |||
| 1885 | Ga0209677_103158 | |||
| 1886 | Ga0209759_1000244 | |||
| 1887 | Ga0209759_1000382 | |||
| 1888 | Ga0209759_1002244 | |||
| 1889 | Ga0209759_1012333 | |||
| 1890 | Ga0209759_1027317 | |||
| 1891 | Ga0209759_1030695 | |||
| 1892 | Ga0209565_1000001 | |||
| 1893 | Ga0209565_1000063 | |||
| 1894 | Ga0209565_1025074 | |||
| 1895 | Ga0209455_1000207 | |||
| 1896 | Ga0209673_1000001 | |||
| 1897 | Ga0209673_1000065 | |||
| 1898 | Ga0209673_1005175 | |||
| 1899 | Ga0209130_1005935 | |||
| 1900 | Ga0209675_1000001 | |||
| 1901 | Ga0209675_1000011 | |||
| 1902 | Ga0209676_1000011 | |||
| 1903 | Ga0209676_1000068 | |||
| 1904 | Ga0209676_1000086 | |||
| 1905 | Ga0209676_1001200 | |||
| 1906 | Ga0209676_1017012 | |||
| 1907 | Ga0209025_1137416 | |||
| 1908 | Ga0209564_1000001 | |||
| 1909 | Ga0209564_1000003 | |||
| 1910 | Ga0209564_1002163 | |||
| 1911 | Ga0209050_1000239 | |||
| 1912 | Ga0209050_1000351 | |||
| 1913 | Ga0209050_1002510 | |||
| 1914 | Ga0209050_1004369 | |||
| 1915 | Ga0209050_1015764 | |||
| 1916 | Ga0209050_1018889 | |||
| 1917 | Ga0209256_1000002 | |||
| 1918 | Ga0209256_1000011 | |||
| 1919 | Ga0209256_1004910 | |||
| 1920 | Ga0209256_1007888 | |||
| 1921 | Ga0209256_1009066 | |||
| 1922 | Ga0209256_1012612 | |||
| 1923 | Ga0209256_1016602 | |||
| 1924 | Ga0209256_1024840 | |||
| 1925 | Ga0209051_1000016 | |||
| 1926 | Ga0209051_1001060 | |||
| 1927 | Ga0209051_1001316 | |||
| 1928 | Ga0209051_1003382 | |||
| 1929 | Ga0209051_1008580 | |||
| 1930 | Ga0209257_1000014 | |||
| 1931 | Ga0209257_1000102 | |||
| 1932 | Ga0209257_1000121 | |||
| 1933 | Ga0209257_1000145 | |||
| 1934 | Ga0209257_1002604 | |||
| 1935 | Ga0209257_1002862 | |||
| 1936 | Ga0209257_1008078 | |||
| 1937 | Ga0209257_1111993 | |||
| 1938 | Ga0209257_1139366 | |||
| 1939 | Ga0207697_10023431 | |||
| 1940 | Ga0207697_10030415 | |||
| 1941 | Ga0207697_10152396 | |||
| 1942 | Ga0207656_10036941 | |||
| 1943 | Ga0207656_10070817 | |||
| 1944 | Ga0207656_10147624 | |||
| 1945 | Ga0207656_10269235 | |||
| 1946 | Ga0207656_10295258 | |||
| 1947 | Ga0207713_1000422 | |||
| 1948 | Ga0207682_10003227 | |||
| 1949 | Ga0207682_10037412 | |||
| 1950 | Ga0207682_10053884 | |||
| 1951 | Ga0207682_10164565 | |||
| 1952 | Ga0207682_10256053 | |||
| 1953 | Ga0207682_10387567 | |||
| 1954 | Ga0207642_10068647 | |||
| 1955 | Ga0207642_10211202 | |||
| 1956 | Ga0207642_10597097 | |||
| 1957 | Ga0207680_10022332 | |||
| 1958 | Ga0207680_10321960 | |||
| 1959 | Ga0207685_10241477 | |||
| 1960 | Ga0207645_10032610 | |||
| 1961 | Ga0207645_10067590 | |||
| 1962 | Ga0207645_10087967 | |||
| 1963 | Ga0207645_10297927 | |||
| 1964 | Ga0207645_10734092 | |||
| 1965 | Ga0207643_10089513 | |||
| 1966 | Ga0207643_10178962 | |||
| 1967 | Ga0207643_10277041 | |||
| 1968 | Ga0207643_10937672 | |||
| 1969 | Ga0207705_10024971 | |||
| 1970 | Ga0207705_10180438 | |||
| 1971 | Ga0207705_10322919 | |||
| 1972 | Ga0207705_10419583 | |||
| 1973 | Ga0207705_10422010 | |||
| 1974 | Ga0207705_10571654 | |||
| 1975 | Ga0207705_11026422 | |||
| 1976 | Ga0207654_10019747 | |||
| 1977 | Ga0207707_10396994 | |||
| 1978 | Ga0207695_10014006 | |||
| 1979 | Ga0207695_10180477 | |||
| 1980 | Ga0207695_10245272 | |||
| 1981 | Ga0207695_11249396 | |||
| 1982 | Ga0207671_10040649 | |||
| 1983 | Ga0207671_10054875 | |||
| 1984 | Ga0207671_10779050 | |||
| 1985 | Ga0207660_10008701 | |||
| 1986 | Ga0207662_10027872 | |||
| 1987 | Ga0207662_10644355 | |||
| 1988 | Ga0207657_10048889 | |||
| 1989 | Ga0207657_10161733 | |||
| 1990 | Ga0207657_10193071 | |||
| 1991 | Ga0207649_10000854 | |||
| 1992 | Ga0207649_10185766 | |||
| 1993 | Ga0207649_10459151 | |||
| 1994 | Ga0207649_10894139 | |||
| 1995 | Ga0207652_10047333 | |||
| 1996 | Ga0207681_10000205 | |||
| 1997 | Ga0207681_10039158 | |||
| 1998 | Ga0207681_10102057 | |||
| 1999 | Ga0207681_10633531 | |||
| 2000 | Ga0207694_10031573 | |||
| 2001 | Ga0207694_10272978 | |||
| 2002 | Ga0207650_10012226 | |||
| 2003 | Ga0207650_10012959 | |||
| 2004 | Ga0207650_10044672 | |||
| 2005 | Ga0207650_10103917 | |||
| 2006 | Ga0207650_10458750 | |||
| 2007 | Ga0207650_10796895 | |||
| 2008 | Ga0207659_10016801 | |||
| 2009 | Ga0207659_10019506 | |||
| 2010 | Ga0207659_10019707 | |||
| 2011 | Ga0207659_10253328 | |||
| 2012 | Ga0207687_10322174 | |||
| 2013 | Ga0207687_11003990 | |||
| 2014 | Ga0207644_10003106 | |||
| 2015 | Ga0207644_10009861 | |||
| 2016 | Ga0207644_10027264 | |||
| 2017 | Ga0207644_10042654 | |||
| 2018 | Ga0207644_10258571 | |||
| 2019 | Ga0207644_10491634 | |||
| 2020 | Ga0207644_10602757 | |||
| 2021 | Ga0207644_10833212 | |||
| 2022 | Ga0207644_11807705 | |||
| 2023 | Ga0207690_10000647 | |||
| 2024 | Ga0207690_10032066 | |||
| 2025 | Ga0207690_10185032 | |||
| 2026 | Ga0207690_10624365 | |||
| 2027 | Ga0207690_11109829 | |||
| 2028 | Ga0207690_11203010 | |||
| 2029 | Ga0207706_10000933 | |||
| 2030 | Ga0207706_10112176 | |||
| 2031 | Ga0207706_10126484 | |||
| 2032 | Ga0207706_10146781 | |||
| 2033 | Ga0207706_10484308 | |||
| 2034 | Ga0207706_10951065 | |||
| 2035 | Ga0207686_10623790 | |||
| 2036 | Ga0207709_10001039 | |||
| 2037 | Ga0207709_10001336 | |||
| 2038 | Ga0207709_10009154 | |||
| 2039 | Ga0207709_10045943 | |||
| 2040 | Ga0207709_10191960 | |||
| 2041 | Ga0207670_10283587 | |||
| 2042 | Ga0207670_10574333 | |||
| 2043 | Ga0207669_10255865 | |||
| 2044 | Ga0207669_10398681 | |||
| 2045 | Ga0207669_10920399 | |||
| 2046 | Ga0207704_10012031 | |||
| 2047 | Ga0207704_10013827 | |||
| 2048 | Ga0207704_10686111 | |||
| 2049 | Ga0207704_10976203 | |||
| 2050 | Ga0207691_10150581 | |||
| 2051 | Ga0207691_10167907 | |||
| 2052 | Ga0207691_10203561 | |||
| 2053 | Ga0207691_10215368 | |||
| 2054 | Ga0207691_10222523 | |||
| 2055 | Ga0207691_10237160 | |||
| 2056 | Ga0207691_10237716 | |||
| 2057 | Ga0207691_10422560 | |||
| 2058 | Ga0207691_10596866 | |||
| 2059 | Ga0207711_10005887 | |||
| 2060 | Ga0207711_10017744 | |||
| 2061 | Ga0207711_10098799 | |||
| 2062 | Ga0207711_10161734 | |||
| 2063 | Ga0207711_10163673 | |||
| 2064 | Ga0207711_10620217 | |||
| 2065 | Ga0207689_10000150 | |||
| 2066 | Ga0207689_10004063 | |||
| 2067 | Ga0207689_10039825 | |||
| 2068 | Ga0207689_10092876 | |||
| 2069 | Ga0207661_10223625 | |||
| 2070 | Ga0207661_10251383 | |||
| 2071 | Ga0207679_10000526 | |||
| 2072 | Ga0207679_10376029 | |||
| 2073 | Ga0207679_10735391 | |||
| 2074 | Ga0207679_11091027 | |||
| 2075 | Ga0207667_10017670 | |||
| 2076 | Ga0207667_10051278 | |||
| 2077 | Ga0207667_10058792 | |||
| 2078 | Ga0207667_10365980 | |||
| 2079 | Ga0207667_10422799 | |||
| 2080 | Ga0207667_10947305 | |||
| 2081 | Ga0207651_10024727 | |||
| 2082 | Ga0207651_10054500 | |||
| 2083 | Ga0207651_10070213 | |||
| 2084 | Ga0207651_10139322 | |||
| 2085 | Ga0207651_10250820 | |||
| 2086 | Ga0207651_10368328 | |||
| 2087 | Ga0207651_10667556 | |||
| 2088 | Ga0207651_10915573 | |||
| 2089 | Ga0207651_11025210 | |||
| 2090 | Ga0207712_10005810 | |||
| 2091 | Ga0207712_10235612 | |||
| 2092 | Ga0207712_11092450 | |||
| 2093 | Ga0207712_11125984 | |||
| 2094 | Ga0207712_12025538 | |||
| 2095 | Ga0207668_10011424 | |||
| 2096 | Ga0207668_10122135 | |||
| 2097 | Ga0207668_10562435 | |||
| 2098 | Ga0207668_10722312 | |||
| 2099 | Ga0207668_10824186 | |||
| 2100 | Ga0207668_11066805 | |||
| 2101 | Ga0207640_10028981 | |||
| 2102 | Ga0207640_10171123 | |||
| 2103 | Ga0207640_10997769 | |||
| 2104 | Ga0207658_10214471 | |||
| 2105 | Ga0207658_10309228 | |||
| 2106 | Ga0207658_11228038 | |||
| 2107 | Ga0207677_10004048 | |||
| 2108 | Ga0207677_10005813 | |||
| 2109 | Ga0207677_10324355 | |||
| 2110 | Ga0207677_10327566 | |||
| 2111 | Ga0207677_10428668 | |||
| 2112 | Ga0207677_10552653 | |||
| 2113 | Ga0207703_10004632 | |||
| 2114 | Ga0207703_10229407 | |||
| 2115 | Ga0207703_10433776 | |||
| 2116 | Ga0207639_10103548 | |||
| 2117 | Ga0207639_10168705 | |||
| 2118 | Ga0207639_10351030 | |||
| 2119 | Ga0207639_10615356 | |||
| 2120 | Ga0207639_10793875 | |||
| 2121 | Ga0207639_11221784 | |||
| 2122 | Ga0207678_10002944 | |||
| 2123 | Ga0207678_10019447 | |||
| 2124 | Ga0207678_10173833 | |||
| 2125 | Ga0207678_10342410 | |||
| 2126 | Ga0207708_10353375 | |||
| 2127 | Ga0207702_10000858 | |||
| 2128 | Ga0207702_10092086 | |||
| 2129 | Ga0207702_11283335 | |||
| 2130 | Ga0207641_10023323 | |||
| 2131 | Ga0207641_10112740 | |||
| 2132 | Ga0207641_10115736 | |||
| 2133 | Ga0207641_10422615 | |||
| 2134 | Ga0207641_10494474 | |||
| 2135 | Ga0207641_11894274 | |||
| 2136 | Ga0207648_10000032 | |||
| 2137 | Ga0207648_10046240 | |||
| 2138 | Ga0207648_10190457 | |||
| 2139 | Ga0207648_10201201 | |||
| 2140 | Ga0207648_10283704 | |||
| 2141 | Ga0207648_10343108 | |||
| 2142 | Ga0207648_10416284 | |||
| 2143 | Ga0207648_10478695 | |||
| 2144 | Ga0207648_11494378 | |||
| 2145 | Ga0207676_10001384 | |||
| 2146 | Ga0207676_10041627 | |||
| 2147 | Ga0207676_10049899 | |||
| 2148 | Ga0207676_10076457 | |||
| 2149 | Ga0207676_10101156 | |||
| 2150 | Ga0207676_10270744 | |||
| 2151 | Ga0207676_10657058 | |||
| 2152 | Ga0207674_10026390 | |||
| 2153 | Ga0207674_10399920 | |||
| 2154 | Ga0207674_10640577 | |||
| 2155 | Ga0207675_100007544 | |||
| 2156 | Ga0207675_100019975 | |||
| 2157 | Ga0207675_100024771 | |||
| 2158 | Ga0207675_100276646 | |||
| 2159 | Ga0207675_100344070 | |||
| 2160 | Ga0207675_100512014 | |||
| 2161 | Ga0207675_102088726 | |||
| 2162 | Ga0207683_10071385 | |||
| 2163 | Ga0207683_10087371 | |||
| 2164 | Ga0207683_10139849 | |||
| 2165 | Ga0207683_10203248 | |||
| 2166 | Ga0207683_10216018 | |||
| 2167 | Ga0207683_10222535 | |||
| 2168 | Ga0207683_10241093 | |||
| 2169 | Ga0207683_10264170 | |||
| 2170 | Ga0207683_10368754 | |||
| 2171 | Ga0207683_10657540 | |||
| 2172 | Ga0207683_11426343 | |||
| 2173 | Ga0207698_10017650 | |||
| 2174 | Ga0207698_10113841 | |||
| 2175 | Ga0207698_10222604 | |||
| 2176 | Ga0207698_10341704 | |||
| 2177 | Ga0207698_10616022 | |||
| 2178 | Ga0207698_11153163 | |||
| 2179 | Ga0207698_11189237 | |||
| 2180 | Ga0207698_11391276 | |||
| 2181 | Ga0209281_1000454 | |||
| 2182 | Ga0209371_1000004 | |||
| 2183 | Ga0209371_1000139 | |||
| 2184 | Ga0209371_1012163 | |||
| 2185 | Ga0209981_1033683 | |||
| 2186 | Ga0209995_1000673 | |||
| 2187 | Ga0209968_1004004 | |||
| 2188 | Ga0209999_1006384 | |||
| 2189 | Ga0209966_1000013 | |||
| 2190 | Ga0209974_10127120 | |||
| 2191 | Ga0268266_10500541 | |||
| 2192 | Ga0268266_10557448 | |||
| 2193 | Ga0268266_10943343 | |||
| 2194 | Ga0268265_10184817 | |||
| 2195 | Ga0268265_10943258 | |||
| 2196 | Ga0268265_11436131 | |||
| 2197 | Ga0268265_11956048 | |||
| 2198 | Ga0268264_10003680 | |||
| 2199 | Ga0268264_10184062 | |||
| 2200 | Ga0268264_11163655 | |||
| 2201 | Ga0265334_10068616 | |||
| 2202 | Ga0265336_10000048 | |||
| 2203 | Ga0307515_10031544 | |||
| 2204 | Ga0307515_10094450 | |||
| 2205 | Ga0268256_1000109 | |||
| 2206 | Ga0268256_1001254 | |||
| 2207 | Ga0268256_1014691 | |||
| 2208 | Ga0307511_10226617 | |||
| 2209 | Ga0316177_1050317 | |||
| 2210 | Ga0314311_1227100 | |||
| 2211 | Ga0316178_1026542 | |||
| 2212 | Ga0316178_1140499 | |||
| 2213 | Ga0316183_1078833 | |||
| 2214 | Ga0316181_1113656 | |||
| 2215 | Ga0265328_10016658 | |||
| 2216 | Ga0265331_10004885 | |||
| 2217 | Ga0265327_10000043 | |||
| 2218 | Ga0265327_10095114 | |||
| 2219 | Ga0307513_10015579 | |||
| 2220 | Ga0307513_10057584 | |||
| 2221 | Ga0307509_10276599 | |||
| 2222 | Ga0307509_10283844 | |||
| 2223 | Ga0307408_100000038 | |||
| 2224 | Ga0307408_100286496 | |||
| 2225 | Ga0307408_100378910 | |||
| 2226 | Ga0307408_100641997 | |||
| 2227 | Ga0307408_101159865 | |||
| 2228 | Ga0307408_101211774 | |||
| 2229 | Ga0307514_10031043 | |||
| 2230 | Ga0307516_10044934 | |||
| 2231 | Ga0307405_10161697 | |||
| 2232 | Ga0307405_10360148 | |||
| 2233 | Ga0307405_10874873 | |||
| 2234 | Ga0307413_10035338 | |||
| 2235 | Ga0307413_10783783 | |||
| 2236 | Ga0307413_11255018 | |||
| 2237 | Ga0307410_10811381 | |||
| 2238 | Ga0307406_10234019 | |||
| 2239 | Ga0307406_10348724 | |||
| 2240 | Ga0307406_11570938 | |||
| 2241 | Ga0307407_10795692 | |||
| 2242 | Ga0307412_10052360 | |||
| 2243 | Ga0307412_10312586 | |||
| 2244 | Ga0307409_101340320 | |||
| 2245 | Ga0307416_100005668 | |||
| 2246 | Ga0307416_100924902 | |||
| 2247 | Ga0307416_102243329 | |||
| 2248 | Ga0307414_10001112 | |||
| 2249 | Ga0307414_10030948 | |||
| 2250 | Ga0307414_10035139 | |||
| 2251 | Ga0307414_10084330 | |||
| 2252 | Ga0307414_10124210 | |||
| 2253 | Ga0307414_10157996 | |||
| 2254 | Ga0307411_10145016 | |||
| 2255 | Ga0307411_10559843 | |||
| 2256 | Ga0307411_11534074 | |||
| 2257 | Ga0307411_11614389 | |||
| 2258 | Ga0307411_11673954 | |||
| 2259 | Ga0307415_100229695 | |||
| 2260 | Ga0307510_10411944 | |||
| 2261 | Ga0373926_0139989 | |||
| 2262 | Ga0373934_0098868 | |||
| 2263 | Ga0373944_0023948 | |||
| 2264 | Ga0373944_0095002 | |||
| 2265 | Ga0373949_0008217 | |||
| 2266 | Ga0373939_0039567 | |||
| 2267 | Ga0373941_0194969 | |||
| 2268 | Ga0373945_0130581 | |||
| 2269 | Ga0373954_0266143 | |||
| 2270 | Ga0373943_0017704 | |||
| 2271 | Ga0373943_0182775 | |||
| 2272 | Ga0373943_0268024 | |||
| 2273 | Ga0373946_0088812 | |||
| 2274 | Ga0373955_0044738 | |||
| 2275 | Ga0373931_0004526 | |||
| 2276 | Ga0373931_0015753 | |||
| 2277 | Ga0373931_0464139 | |||
| 2278 | Ga0373935_0025734 | |||
| 2279 | Ga0373927_0100032 | |||
| 2280 | Ga0373933_0266582 | |||
| 2281 | Ga0373947_0176775 | |||
| 2282 | Ga0373937_1581300 | |||
| 2283 | Ga0373925_0034245 | |||
| 2284 | Ga0373925_0240421 | |||
| 2285 | Ga0395898_0071311 | |||
| 2286 | Ga0395905_0007830 | |||
| 2287 | Ga0395905_0085597 | |||
| 2288 | Ga0395905_0677221 | |||
| 2289 | Ga0395901_0002425 | |||
| 2290 | Ga0237819_00165 | |||
| 2291 | Ga0237819_03731 | |||
| 2292 | Ga0237819_23238 | |||
| 2293 | Ga0237816_00056 | |||
| 2294 | Ga0436361_0001966 | |||
| 2295 | Ga0436361_0082864 | |||
| 2296 | Ga0436361_0196856 | |||
| 2297 | Ga0436361_0243330 | |||
| 2298 | Ga0436361_0298548 | |||
| 2299 | Ga0436361_0417753 | |||
| 2300 | Ga0436361_0875016 | |||
| 2301 | Ga0439436_0029225 | |||
| 2302 | Ga0439436_0046239 | |||
| 2303 | Ga0439436_0049064 | |||
| 2304 | Ga0439436_0078777 | |||
| 2305 | Ga0439439_0018662 | |||
| 2306 | Ga0439447_009343 | |||
| 2307 | Ga0439461_0098887 | |||
| 2308 | Ga0439465_0000224 | |||
| 2309 | Ga0439465_0043300 | |||
| 2310 | Ga0451787_452960 | |||
| 2311 | Ga0451789_0698365 | |||
| 2312 | Ga0451789_1349124 | |||
| 2313 | Ga0451791_0319337 | |||
| 2314 | Ga0451791_0672470 | |||
| 2315 | Ga0451791_1799097 | |||
| 2316 | Ga0451793_0050907 | |||
| 2317 | Ga0451793_0143369 | |||
| 2318 | Ga0451793_0248334 | |||
| 2319 | Ga0451793_0594577 | |||
| 2320 | Ga0451793_0678761 | |||
| 2321 | Ga0451793_0736074 | |||
| 2322 | Ga0451793_1247833 | |||
| 2323 | Ga0451797_0685350 | |||
| 2324 | Ga0451797_1106636 | |||
| 2325 | Ga0451797_1204767 | |||
| 2326 | Ga0451797_1248801 | |||
| 2327 | Ga0451795_1315014 | |||
| 2328 | Ga0451795_1586870 | |||
| 2329 | Ga0451800_0098586 | |||
| 2330 | Ga0451800_0163389 | |||
| 2331 | Ga0451800_0493538 | |||
| 2332 | Ga0451800_1079773 | |||
| 2333 | Ga0451802_1524292 | |||
| 2334 | Ga0451802_1644705 | |||
| 2335 | Ga0451802_1817188 | |||
| 2336 | Ga0451802_1988730 | |||
| 2337 | Ga0451806_420239 | |||
| 2338 | Ga0451804_0562792 | |||
| 2339 | Ga0451807_0155804 | |||
| 2340 | Ga0451807_0183383 | |||
| 2341 | Ga0451807_1621004 | |||
| 2342 | Ga0451807_1664147 | |||
| 2343 | Ga0451807_1787886 | |||
| 2344 | Ga0451837_0237264 | |||
| 2345 | Ga0451837_0800704 | |||
| 2346 | Ga0451837_1130467 | |||
| 2347 | Ga0451837_1211241 | |||
| 2348 | Ga0451841_0157733 | |||
| 2349 | Ga0451841_0649399 | |||
| 2350 | Ga0451841_1302887 | |||
| 2351 | Ga0451841_1334294 | |||
| 2352 | Ga0451849_1462010 | |||
| 2353 | Ga0451843_0012520 | |||
| 2354 | Ga0451843_0155094 | |||
| 2355 | Ga0451843_0200154 | |||
| 2356 | Ga0451843_0206726 | |||
| 2357 | Ga0451843_0305339 | |||
| 2358 | Ga0451843_1170934 | |||
| 2359 | Ga0451843_1499722 | |||
| 2360 | Ga0451843_1503963 | |||
| 2361 | Ga0451843_1540849 | |||
| 2362 | Ga0451853_0334304 | |||
| 2363 | Ga0451853_1029461 | |||
| 2364 | Ga0439433_0053903 | |||
| 2365 | Ga0439433_0070620 | |||
| 2366 | Ga0439433_0092143 | |||
| 2367 | Ga0439433_0093817 | |||
| 2368 | Ga0439445_0004656 | |||
| 2369 | Ga0439445_0027529 | |||
| 2370 | Ga0439445_0097862 | |||
| 2371 | Ga0439432_019776 | |||
| 2372 | Ga0439432_120041 | |||
| 2373 | Ga0439432_172159 | |||
| 2374 | Ga0439449_0005798 | |||
| 2375 | Ga0439449_0013136 | |||
| 2376 | Ga0439449_0013961 | |||
| 2377 | Ga0439449_0029827 | |||
| 2378 | Ga0439449_0051250 | |||
| 2379 | Ga0439449_0109806 | |||
| 2380 | Ga0439452_025555 | |||
| 2381 | Ga0439454_006386 | |||
| 2382 | Ga0439462_0067379 | |||
| 2383 | Ga0439462_0172200 | |||
| 2384 | Ga0450911_005582 | |||
| 2385 | Ga0450919_001239 | |||
| 2386 | Ga0450890_007668 | |||
| 2387 | Ga0450890_011251 | |||
| 2388 | Ga0439458_0120940 | |||
| 2389 | Ga0439434_0041674 | |||
| 2390 | Ga0439435_0099125 | |||
| 2391 | Ga0439459_0000618 | |||
| 2392 | Ga0450918_000320 | |||
| 2393 | Ga0450901_007565 | |||
| 2394 | Ga0451577_0177731 | |||
| 2395 | Ga0466963_0453115 | |||
| 2396 | Ga0466963_0935684 | |||
| 2397 | Ga0453684_0118653 | |||
| 2398 | Ga0453684_0473057 | |||
| 2399 | Ga0453684_0584012 | |||
| 2400 | Ga0451576_0041719 | |||
| 2401 | Ga0451576_2363323 | |||
| 2402 | Ga0495627_095254 | |||
| 2403 | Ga0495592_0473932 | |||
| 2404 | Ga0495629_0180753 | |||
| 2405 | Ga0495629_0330467 | |||
| 2406 | Ga0495638_0032789 | |||
| 2407 | Ga0495638_0156728 | |||
| 2408 | Ga0495638_0265569 | |||
| 2409 | Ga0495651_0260417 | |||
| 2410 | Ga0495580_0213174 | |||
| 2411 | Ga0495580_0517029 | |||
| 2412 | Ga0495639_0018018 | |||
| 2413 | Ga0495639_0392848 | |||
| 2414 | Ga0495607_0053436 | |||
| 2415 | Ga0495583_0000017 | |||
| 2416 | Ga0495606_0002049 | |||
| 2417 | Ga0495606_0017003 | |||
| 2418 | Ga0495608_0257061 | |||
| 2419 | Ga0495610_0013938 | |||
| 2420 | Ga0495610_0214813 | |||
| 2421 | Ga0495616_0163313 | |||
| 2422 | Ga0495616_0260072 | |||
| 2423 | Ga0495628_0053645 | |||
| 2424 | Ga0495631_0020149 | |||
| 2425 | Ga0495631_0424324 | |||
| 2426 | Ga0495643_0017194 | |||
| 2427 | Ga0495643_0166135 | |||
| 2428 | Ga0495643_0177871 | |||
| 2429 | Ga0495644_0370484 | |||
| 2430 | Ga0495663_0000403 | |||
| 2431 | Ga0495663_0010083 | |||
| 2432 | Ga0495663_0025947 | |||
| 2433 | Ga0495663_0037832 | |||
| 2434 | Ga0495652_0149595 | |||
| 2435 | Ga0495586_0174081 | |||
| 2436 | Ga0495598_0002515 | |||
| 2437 | Ga0495621_0018217 | |||
| 2438 | Ga0495645_0205136 | |||
| 2439 | Ga0495633_0041373 | |||
| 2440 | Ga0495633_0065198 | |||
| 2441 | Ga0495633_0073528 | |||
| 2442 | Ga0495633_0075520 | |||
| 2443 | Ga0495633_0172944 | |||
| 2444 | Ga0495667_0480747 | |||
| 2445 | Ga0495668_0004728 | |||
| 2446 | Ga0495625_0162856 | |||
| 2447 | Ga0495647_0081064 | |||
| 2448 | Ga0495658_0067293 | |||
| 2449 | Ga0495669_0043381 | |||
| 2450 | Ga0495613_0315803 | |||
| 2451 | Ga0495670_0304692 | |||
| 2452 | Ga0495649_0000290 | |||
| 2453 | Ga0495589_0022418 | |||
| 2454 | Ga0495600_0289034 | |||
| 2455 | Ga0495660_0070482 | |||
| 2456 | Ga0495581_0816904 | |||
| 2457 | Ga0495674_0170461 | |||
| 2458 | Ga0495672_0020455 | |||
| 2459 | Ga0495676_0677485 | |||
| 2460 | Ga0495680_0141619 | |||
| 2461 | Ga0495681_0108015 | |||
| 2462 | Ga0495681_0164916 | |||
| 2463 | Ga0495684_0194495 | |||
| 2464 | Ga0495684_0414770 | |||
| 2465 | Ga0495686_0007645 | |||
| 2466 | Ga0495686_0031505 | |||
| 2467 | Ga0495686_0063006 | |||
| 2468 | Ga0495614_0533740 | |||
| 2469 | Ga0496100_0352475 | |||
| 2470 | Ga0496101_0025070 | |||
| 2471 | Ga0496101_0605370 | |||
| 2472 | Ga0496101_1123846 | |||
| 2473 | Ga0496102_0021039 | |||
| 2474 | Ga0496102_1164163 | |||
| 2475 | Ga0496102_1648442 | |||
| 2476 | Ga0496104_0031783 | |||
| 2477 | Ga0496104_0180037 | |||
| 2478 | Ga0496104_0274434 | |||
| 2479 | Ga0496104_0834569 | |||
| 2480 | Ga0496105_0112275 | |||
| 2481 | Ga0496105_0293844 | |||
| 2482 | Ga0496105_0310431 | |||
| 2483 | Ga0496105_1020548 | |||
| 2484 | Ga0496106_0136718 | |||
| 2485 | Ga0496107_0009476 | |||
| 2486 | Ga0496107_0617220 | |||
| 2487 | Ga0496107_1156862 | |||
| 2488 | Ga0496108_0028568 | |||
| 2489 | Ga0496108_0090486 | |||
| 2490 | Ga0496108_0171248 | |||
| 2491 | Ga0496108_1358367 | |||
| 2492 | Ga0496108_1505014 | |||
| 2493 | Ga0496109_0241197 | |||
| 2494 | Ga0496109_0303698 | |||
| 2495 | Ga0496109_0318559 | |||
| 2496 | Ga0496109_0499144 | |||
| 2497 | Ga0496110_0085437 | |||
| 2498 | Ga0496110_0415617 | |||
| 2499 | Ga0496110_0528202 | |||
| 2500 | Ga0496110_0597742 | |||
| 2501 | Ga0496110_1190467 | |||
| 2502 | Ga0496111_0561302 | |||
| 2503 | Ga0496113_0040667 | |||
| 2504 | Ga0496113_0321985 | |||
| 2505 | Ga0496113_0886030 | |||
| 2506 | Ga0496114_0015156 | |||
| 2507 | Ga0496114_0074221 | |||
| 2508 | Ga0496114_0272554 | |||
| 2509 | Ga0496114_0793921 | |||
| 2510 | Ga0496114_1346753 | |||
| 2511 | Ga0496115_0553805 | |||
| 2512 | Ga0496116_0031581 | |||
| 2513 | Ga0496116_0033409 | |||
| 2514 | Ga0496117_0001966 | |||
| 2515 | Ga0496117_0040292 | |||
| 2516 | Ga0496117_0058821 | |||
| 2517 | Ga0496117_0070332 | |||
| 2518 | Ga0496117_0070874 | |||
| 2519 | Ga0496117_0342268 | |||
| 2520 | Ga0496118_0027915 | |||
| 2521 | Ga0496118_0032595 | |||
| 2522 | Ga0496118_0045304 | |||
| 2523 | Ga0496118_0107848 | |||
| 2524 | Ga0496118_0168104 | |||
| 2525 | Ga0496118_0189991 | |||
| 2526 | Ga0496118_0404177 | |||
| 2527 | Ga0496119_0000255 | |||
| 2528 | Ga0496119_0004546 | |||
| 2529 | Ga0496119_0149564 | |||
| 2530 | Ga0496120_0000240 | |||
| 2531 | Ga0496120_0000598 | |||
| 2532 | Ga0496121_0008127 | |||
| 2533 | Ga0496121_0098890 | |||
| 2534 | Ga0496121_0157964 | |||
| 2535 | Ga0496121_0648438 | |||
| 2536 | Ga0496122_0000663 | |||
| 2537 | Ga0496122_0006648 | |||
| 2538 | Ga0496122_0097579 | |||
| 2539 | Ga0496122_0128618 | |||
| 2540 | Ga0496122_0142513 | |||
| 2541 | Ga0496122_0455300 | |||
| 2542 | Ga0496122_0472294 | |||
| 2543 | Ga0496123_0000828 | |||
| 2544 | Ga0496123_0001279 | |||
| 2545 | Ga0496123_0023685 | |||
| 2546 | Ga0496123_0098020 | |||
| 2547 | Ga0496123_0121913 | |||
| 2548 | Ga0496123_0129133 | |||
| 2549 | Ga0496123_0204322 | |||
| 2550 | Ga0496123_0309310 | |||
| 2551 | Ga0496124_0000009 | |||
| 2552 | Ga0496124_0021163 | |||
| 2553 | Ga0496124_0026783 | |||
| 2554 | Ga0496124_0030421 | |||
| 2555 | Ga0496124_0076288 | |||
| 2556 | Ga0496124_0172938 | |||
| 2557 | Ga0496124_0188838 | |||
| 2558 | Ga0496124_0204340 | |||
| 2559 | Ga0496124_0280324 | |||
| 2560 | Ga0496124_0303126 | |||
| 2561 | Ga0496125_0025528 | |||
| 2562 | Ga0496125_0071631 | |||
| 2563 | Ga0496125_0077343 | |||
| 2564 | Ga0496125_0089734 | |||
| 2565 | Ga0496125_0100233 | |||
| 2566 | Ga0496125_0112107 | |||
| 2567 | Ga0496125_0148737 | |||
| 2568 | Ga0496125_0717106 | |||
| 2569 | Ga0496126_0006652 | |||
| 2570 | Ga0496126_0084112 | |||
| 2571 | Ga0496126_0086702 | |||
| 2572 | Ga0496126_0208506 | |||
| 2573 | Ga0496126_0345333 | |||
| 2574 | Ga0496126_0375082 | |||
| 2575 | Ga0501306_023887 | |||
| 2576 | Ga0501308_007083 | |||
| 2577 | Ga0501309_001733 | |||
| 2578 | Ga0501310_000865 | |||
| 2579 | Ga0501310_028433 | |||
| 2580 | Ga0501304_000917 | |||
| 2581 | Ga0501304_018257 | |||
| 2582 | Ga0501305_003418 | |||
| 2583 | Ga0501294_009168 | |||
| 2584 | Ga0501297_004528 | |||
| 2585 | Ga0501298_083728 | |||
| 2586 | Ga0501300_001357 | |||
| 2587 | Ga0501312_003406 | |||
| 2588 | Ga0501313_023853 | |||
| 2589 | Ga0501314_002220 | |||
| 2590 | Ga0501315_002024 | |||
| 2591 | Ga0501317_004293 | |||
| 2592 | Ga0501321_026828 | |||
| 2593 | Ga0501031_0025514 | |||
| 2594 | Ga0501031_0042415 | |||
| 2595 | Ga0501031_0656317 | |||
| 2596 | Ga0501032_0022123 | |||
| 2597 | Ga0501032_0228684 | |||
| 2598 | Ga0501033_0010061 | |||
| 2599 | Ga0501033_0085355 | |||
| 2600 | Ga0501033_0271942 | |||
| 2601 | Ga0501034_0021863 | |||
| 2602 | Ga0501034_0035289 | |||
| 2603 | Ga0501034_0072309 | |||
| 2604 | Ga0501036_0073796 | |||
| 2605 | Ga0501036_0323981 | |||
| 2606 | Ga0501036_1011383 | |||
| 2607 | Ga0501037_0020065 | |||
| 2608 | Ga0501038_0014117 | |||
| 2609 | Ga0501038_0026943 | |||
| 2610 | Ga0501039_0067085 | |||
| 2611 | Ga0501039_0255226 | |||
| 2612 | Ga0501043_0000004 | |||
| 2613 | Ga0501043_0021135 | |||
| 2614 | Ga0501043_0229570 | |||
| 2615 | Ga0501046_0000050 | |||
| 2616 | Ga0501047_0000012 | |||
| 2617 | Ga0501047_0021327 | |||
| 2618 | Ga0501047_0171970 | |||
| 2619 | Ga0501048_0010686 | |||
| 2620 | Ga0501068_0936823 | |||
| 2621 | Ga0501070_0045102 | |||
| 2622 | Ga0501070_0164408 | |||
| 2623 | Ga0501071_0460648 | |||
| 2624 | Ga0501073_0065946 | |||
| 2625 | Ga0501198_000004 | |||
| 2626 | Ga0501199_015195 | |||
| 2627 | Ga0501206_006551 | |||
| 2628 | Ga0501211_002448 | |||
| 2629 | Ga0501217_027085 | |||
| 2630 | Ga0501222_000038 | |||
| 2631 | Ga0501222_008815 | |||
| 2632 | Ga0501223_009832 | |||
| 2633 | Ga0501235_024396 | |||
| 2634 | Ga0501250_012952 | |||
| 2635 | Ga0501251_052739 | |||
| 2636 | Ga0501253_018493 | |||
| 2637 | Ga0501255_001001 | |||
| 2638 | Ga0501258_006361 | |||
| 2639 | Ga0501261_009717 | |||
| 2640 | Ga0501225_0025880 | |||
| 2641 | Ga0501225_0038030 | |||
| 2642 | Ga0501229_000597 | |||
| 2643 | Ga0501080_0016883 | |||
| 2644 | Ga0501080_1590210 | |||
| 2645 | Ga0501080_1872194 | |||
| 2646 | Ga0501232_032573 | |||
| 2647 | Ga0501262_002037 | |||
| 2648 | Ga0501265_010324 | |||
| 2649 | Ga0501267_001203 | |||
| 2650 | Ga0501268_103430 | |||
| 2651 | Ga0501272_005104 | |||
| 2652 | Ga0501282_013499 | |||
| 2653 | Ga0501035_0014880 | |||
| 2654 | Ga0501035_0192031 | |||
| 2655 | Ga0501044_0019187 | |||
| 2656 | Ga0501044_0037114 | |||
| 2657 | Ga0501044_1020321 | |||
| 2658 | Ga0501044_1567984 | |||
| 2659 | Ga0501044_1602328 | |||
| 2660 | Ga0501045_0016727 | |||
| 2661 | Ga0501226_033241 | |||
| 2662 | nmdc:mga03683_315569_c1 | |||
| 2663 | nmdc:mga03n38_539604_c1 | |||
| 2664 | nmdc:mga00v17_153575_c1 | |||
| 2665 | nmdc:mga0yw44_104612_c1 | |||
| 2666 | nmdc:mga0k408_129139_c1 | |||
| 2667 | nmdc:mga0k408_186563_c1 | |||
| 2668 | nmdc:mga0k408_293352_c1 | |||
| 2669 | nmdc:mga07m45_187418_c1 | |||
| 2670 | nmdc:mga07m45_46177_c1 | |||
| 2671 | nmdc:mga07m45_61691_c1 | |||
| 2672 | nmdc:mga08y16_1337202_c1 | |||
| 2673 | nmdc:mga08y16_749189_c1 | |||
| 2674 | Ga0495601_0144456 | |||
| 2675 | Ga0495612_0238028 | |||
| 2676 | Ga0495612_0358143 | |||
| 2677 | Ga0500635_0000046 | |||
| 2678 | Ga0495595_0160133 | |||
| 2679 | Ga0495619_0173642 | |||
| 2680 | Ga0500651_0000088 | |||
| 2681 | Ga0500658_0180230 | |||
| 2682 | Ga0500559_0050725 | |||
| 2683 | Ga0500564_088801 | |||
| 2684 | Ga0500577_0340038 | |||
| 2685 | Ga0500604_0155491 | |||
| 2686 | Ga0500622_0019200 | |||
| 2687 | Ga0500634_0000049 | |||
| 2688 | Ga0500636_0182491 | |||
| 2689 | Ga0501084_0879507 | |||
| 2690 | 2547503041 | |||
| 2691 | 2572253883 | |||
| 2692 | 2578458467 | |||
| 2693 | 2643745674 | |||
| 2694 | 2643907762 | |||
| 2695 | 2643916031 | |||
| 2696 | 2644221564 | |||
| 2697 | 2644245444 | |||
| 2698 | 2644257675 | |||
| 2699 | 2644529358 | |||
| 2700 | 2747947750 | |||
| 2701 | 2748019495 | |||
| 2702 | 2765578937 | |||
| 2703 | 2816516997 | |||
| 2704 | 2819659635 | |||
| 2705 | 2831865637 | |||
| 2706 | 2842393018 | |||
| 2707 | 2842760247 | |||
| 2708 | 2842780750 | |||
| 2709 | 2852650889 | |||
| 2710 | 2852685563 | |||
| 2711 | 2857443732 | |||
| 2712 | 2874221577 | |||
| 2713 | 2895500662 | |||
| 2714 | 2895516468 | |||
| 2715 | 2895523612 | |||
| 2716 | 2895526806 | |||
| 2717 | 2919089756 | |||
| 2718 | 2919131710 | |||
| 2719 | 2919137695 | |||
| 2720 | 2923518440 | |||
| 2721 | 2928499461 | |||
| 2722 | 2929197920 | |||
| 2723 | 2931380798 | |||
| 2724 | 2937612396 | |||
| 2725 | 2939591400 | |||
| 2726 | 2939623537 | |||
| 2727 | 2939627373 | |||
| 2728 | 2941478265 | |||
| 2729 | 2941490126 | |||
| 2730 | 2961048344 | |||
| 2731 | 2961065340 | |||
| 2732 | 2974309038 | |||
| 2733 | 2977249755 | |||
| 2734 | 2984515755 | |||
| 2735 | 2987606381 | |||
| 2736 | 2995951936 | |||
| 2737 | 8002871887 | |||
| 2738 | 8021624682 | |||
| 2739 | 8021629196 | |||
| 2740 | 8021649063 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5sv2-assembly1.cif.gz_A-2 | toxin vapc21 from mycobacterium tuberculosis | 0.7867 | 2 | 131 |
| 3zvk-assembly1.cif.gz_B | crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter | 0.7765 | 1 | 129 |
| 3zvk-assembly1.cif.gz_D | crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter | 0.7695 | 1 | 129 |
| 1v96-assembly1.cif.gz_A | crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii ot3 | 0.7661 | 2 | 129 |
| 5ecw-assembly1.cif.gz_A | structure of the shigella flexneri vapc mutant d7a | 0.7656 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFA7_1_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8262 | 1 | 127 | 3.40.50.1010 |
| af_P9WFA7_1_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8083 | 1 | 127 | 3.40.50.1010 |
| af_L0T5V6_2_136_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8076 | 2 | 131 | 3.40.50.1010 |
| 5sv2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7783 | 2 | 131 | 3.40.50.1010 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7765 | 1 | 129 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349Y6C8-F1-model_v4 | VapC toxin family PIN domain ribonuclease | 0.9829 | 19 | 131 |
GO:0004518
GO:0046872 |
| AF-A0A3D4TN72-F1-model_v4 | VapC toxin family PIN domain ribonuclease | 0.978 | 1 | 88 |
|
| AF-A0A1S0V9N5-F1-model_v4 | deleted | 0.9761 | 2 | 131 |
|
| AF-Q9PGK7-F1-model_v4 | PIN domain-containing protein | 0.9748 | 2 | 131 |
GO:0004518
GO:0046872 |
| AF-A0A0U3AAD4-F1-model_v4 | DNA-binding protein (PIN domain-containing protein) | 0.9731 | 1 | 131 |
GO:0003677
GO:0004518 GO:0046872 |