F493407

General Info

Members Datasets Scaffolds Average Seq Length
1370 402 1370 118

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100687352|Ga0307408_1006873522
Length 113
Sequence MMRAPRGRAAHDAAMYALNFYSPIVADQLRQQRKTATIRLGDKSAKYKKGMVVQVLVGVEVKTLGELSPREIEHDNPEIRRGEEMASFLGALYNREVSEHDTVTVIRFSQIRG

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
206 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
233 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
259 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
260 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
261 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
267 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
268 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
273 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
274 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
275 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
276 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 10.73
Rhizosphere 88.25
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c018612 3300000041 Bacteria 614
2 ARSoilOldRDRAFT_c014836 3300000044 Bacteria 665
3 JGI24739J22299_10043588 3300001989 Bacteria 1483
4 JGI24743J22301_10026142 3300001991 Bacteria 1134
5 JGI24743J22301_10041519 3300001991 Bacteria 924
6 JGI24745J21846_1013727 3300002073 Bacteria 935
7 JGI24745J21846_1016072 3300002073 Bacteria 867
8 JGI24738J21930_10009170 3300002075 Bacteria 2236
9 JGI24738J21930_10066658 3300002075 Bacteria 742
10 JGI24744J21845_10001143 3300002077 Bacteria 5162
11 JGI24744J21845_10012243 3300002077 Bacteria 1744
12 JGI24033J26618_1029443 3300002155 Bacteria 734
13 JGI24742J22300_10002102 3300002244 Bacteria 3170
14 JGI24751J29686_10025912 3300002459 Bacteria 1216
15 JGI25406J46586_10016584 3300003203 Bacteria 3067
16 JGI25406J46586_10117343 3300003203 Bacteria 785
17 JGI25406J46586_10152068 3300003203 Bacteria 675
18 JGI25406J46586_10168553 3300003203 Bacteria 638
19 JGI25407J50210_10000656 3300003373 Bacteria 7128
20 Ga0070658_10029938 3300005327 Bacteria 4374
21 Ga0070658_10473161 3300005327 Bacteria 1081
22 Ga0070658_10945957 3300005327 Bacteria 749
23 Ga0070676_10172059 3300005328 Bacteria 1402
24 Ga0070676_10214378 3300005328 Bacteria 1269
25 Ga0070676_10422244 3300005328 Bacteria 932
26 Ga0070676_10472998 3300005328 Bacteria 885
27 Ga0070683_100124901 3300005329 Bacteria 2432
28 Ga0070683_100187123 3300005329 Bacteria 1966
29 Ga0070683_100280578 3300005329 Bacteria 1585
30 Ga0070683_101175899 3300005329 Bacteria 737
31 Ga0070690_100054339 3300005330 Bacteria 2564
32 Ga0070670_100019253 3300005331 Bacteria 5854
33 Ga0070670_100066805 3300005331 Bacteria 3086
34 Ga0070670_100599445 3300005331 Bacteria 986
35 Ga0070677_10385868 3300005333 Bacteria 735
36 Ga0070677_10623654 3300005333 Unclassified 600
37 Ga0068869_100072127 3300005334 Bacteria 2558
38 Ga0068869_100238186 3300005334 Bacteria 1449
39 Ga0068869_100560024 3300005334 Unclassified 961
40 Ga0068869_101066398 3300005334 Bacteria 706
41 Ga0070666_10236931 3300005335 Bacteria 1290
42 Ga0070666_10420999 3300005335 Bacteria 962
43 Ga0070680_100028880 3300005336 Bacteria 4451
44 Ga0070680_100618691 3300005336 Bacteria 930
45 Ga0070680_100750899 3300005336 Bacteria 840
46 Ga0070680_101466899 3300005336 Bacteria 591
47 Ga0070682_100011420 3300005337 Bacteria 5074
48 Ga0070682_100104778 3300005337 Bacteria 1874
49 Ga0070682_101105258 3300005337 Unclassified 664
50 Ga0068868_100051600 3300005338 Bacteria 3237
51 Ga0068868_100153201 3300005338 Bacteria 1899
52 Ga0068868_100574370 3300005338 Bacteria 996
53 Ga0068868_100955248 3300005338 Bacteria 782
54 Ga0068868_101088962 3300005338 Bacteria 735
55 Ga0070660_100088230 3300005339 Bacteria 2442
56 Ga0070660_100113170 3300005339 Bacteria 2161
57 Ga0070660_100264444 3300005339 Unclassified 1405
58 Ga0070660_100439270 3300005339 Bacteria 1082
59 Ga0070689_100003195 3300005340 Bacteria 10846
60 Ga0070689_100012403 3300005340 Bacteria 6139
61 Ga0070689_100048614 3300005340 Bacteria 3272
62 Ga0070689_100274485 3300005340 Bacteria 1397
63 Ga0070691_10010224 3300005341 Bacteria 4279
64 Ga0070691_10229563 3300005341 Unclassified 987
65 Ga0070691_10390404 3300005341 Bacteria 782
66 Ga0070691_10484685 3300005341 Bacteria 712
67 Ga0070687_100055214 3300005343 Bacteria 2073
68 Ga0070661_100136430 3300005344 Bacteria 1846
69 Ga0070661_100214281 3300005344 Unclassified 1475
70 Ga0070661_101125872 3300005344 Bacteria 655
71 Ga0070692_10004125 3300005345 Bacteria 6008
72 Ga0070692_10016994 3300005345 Bacteria 3470
73 Ga0070692_10075547 3300005345 Bacteria 1804
74 Ga0070692_10095936 3300005345 Bacteria 1619
75 Ga0070692_10242160 3300005345 Unclassified 1076
76 Ga0070668_100037411 3300005347 Bacteria 3706
77 Ga0070668_100162934 3300005347 Bacteria 1810
78 Ga0070668_100223003 3300005347 Bacteria 1555
79 Ga0070669_100248324 3300005353 Unclassified 1416
80 Ga0070669_100367195 3300005353 Bacteria 1171
81 Ga0070669_100688250 3300005353 Bacteria 863
82 Ga0070675_100045693 3300005354 Bacteria 3584
83 Ga0070675_100198289 3300005354 Bacteria 1742
84 Ga0070675_100297615 3300005354 Bacteria 1421
85 Ga0070675_100349785 3300005354 Bacteria 1310
86 Ga0070675_100528356 3300005354 Bacteria 1065
87 Ga0070675_101180331 3300005354 Bacteria 704
88 Ga0070671_100022042 3300005355 Bacteria 5203
89 Ga0070671_100754728 3300005355 Unclassified 846
90 Ga0070671_101570822 3300005355 Unclassified 583
91 Ga0070674_100000543 3300005356 Bacteria 18923
92 Ga0070674_100026183 3300005356 Bacteria 3807
93 Ga0070674_100039776 3300005356 Bacteria 3177
94 Ga0070674_100056971 3300005356 Bacteria 2711
95 Ga0070674_100293314 3300005356 Bacteria 1294
96 Ga0070674_100390055 3300005356 Bacteria 1135
97 Ga0070674_100422954 3300005356 Bacteria 1093
98 Ga0070674_100433677 3300005356 Unclassified 1081
99 Ga0070673_100064639 3300005364 Bacteria 2916
100 Ga0070673_100088994 3300005364 Bacteria 2519
101 Ga0070673_100129318 3300005364 Bacteria 2116
102 Ga0070673_100280897 3300005364 Bacteria 1460
103 Ga0070673_100650606 3300005364 Bacteria 965
104 Ga0070688_100001134 3300005365 Bacteria 13349
105 Ga0070688_100024156 3300005365 Bacteria 3582
106 Ga0070688_100061436 3300005365 Bacteria 2375
107 Ga0070688_100344828 3300005365 Bacteria 1089
108 Ga0070659_100058795 3300005366 Bacteria 3035
109 Ga0070659_100091995 3300005366 Bacteria 2431
110 Ga0070659_100178573 3300005366 Unclassified 1741
111 Ga0070659_100226408 3300005366 Bacteria 1544
112 Ga0070659_100316783 3300005366 Bacteria 1303
113 Ga0070659_100452729 3300005366 Unclassified 1089
114 Ga0070659_100695711 3300005366 Bacteria 879
115 Ga0070667_100180014 3300005367 Unclassified 1869
116 Ga0070709_10034300 3300005434 Bacteria 3076
117 Ga0070709_10155644 3300005434 Unclassified 1584
118 Ga0070709_10248479 3300005434 Bacteria 1280
119 Ga0070709_10415937 3300005434 Bacteria 1006
120 Ga0070714_100527994 3300005435 Bacteria 1128
121 Ga0070714_101708955 3300005435 Unclassified 615
122 Ga0070713_100043151 3300005436 Bacteria 3685
123 Ga0070713_100124169 3300005436 Bacteria 2268
124 Ga0070713_100128892 3300005436 Bacteria 2229
125 Ga0070713_100524350 3300005436 Unclassified 1120
126 Ga0070713_101494049 3300005436 Unclassified 656
127 Ga0070710_10006936 3300005437 Bacteria 5463
128 Ga0070710_10598516 3300005437 Unclassified 767
129 Ga0070701_10008762 3300005438 Bacteria 4393
130 Ga0070701_10397838 3300005438 Bacteria 872
131 Ga0070711_100005506 3300005439 Bacteria 7577
132 Ga0070711_100319800 3300005439 Bacteria 1239
133 Ga0070705_100081313 3300005440 Unclassified 1990
134 Ga0070705_100085082 3300005440 Bacteria 1954
135 Ga0070705_100087954 3300005440 Bacteria 1927
136 Ga0070705_100289541 3300005440 Bacteria 1169
137 Ga0070705_100324402 3300005440 Bacteria 1113
138 Ga0070700_100008508 3300005441 Bacteria 5586
139 Ga0070700_100099828 3300005441 Bacteria 1910
140 Ga0070700_101108227 3300005441 Bacteria 656
141 Ga0070700_101723793 3300005441 Unclassified 538
142 Ga0070694_100145374 3300005444 Unclassified 1726
143 Ga0070694_100968389 3300005444 Bacteria 705
144 Ga0070708_100227126 3300005445 Bacteria 1751
145 Ga0070708_100567009 3300005445 Bacteria 1071
146 Ga0070708_100727302 3300005445 Bacteria 934
147 Ga0070663_100025748 3300005455 Bacteria 3975
148 Ga0070678_100003432 3300005456 Bacteria 8840
149 Ga0070678_100013319 3300005456 Bacteria 5151
150 Ga0070678_100318747 3300005456 Bacteria 1327
151 Ga0070678_100570611 3300005456 Bacteria 1007
152 Ga0070678_101498927 3300005456 Bacteria 631
153 Ga0070678_101605333 3300005456 Unclassified 611
154 Ga0070662_100034293 3300005457 Bacteria 3578
155 Ga0070662_100133636 3300005457 Unclassified 1916
156 Ga0070662_100178742 3300005457 Unclassified 1671
157 Ga0070662_100254675 3300005457 Bacteria 1412
158 Ga0070662_100708630 3300005457 Unclassified 852
159 Ga0070662_100749667 3300005457 Bacteria 828
160 Ga0070681_10089523 3300005458 Bacteria 3029
161 Ga0070681_10273401 3300005458 Unclassified 1601
162 Ga0070681_10327004 3300005458 Bacteria 1443
163 Ga0070681_11022020 3300005458 Bacteria 747
164 Ga0070681_11449666 3300005458 Unclassified 611
165 Ga0068867_100000290 3300005459 Bacteria 32965
166 Ga0070685_10004074 3300005466 Bacteria 7385
167 Ga0070685_10033304 3300005466 Bacteria 2893
168 Ga0070685_11474389 3300005466 Bacteria 524
169 Ga0070706_100011218 3300005467 Bacteria 8322
170 Ga0070706_100197611 3300005467 Bacteria 1878
171 Ga0070706_100667593 3300005467 Bacteria 965
172 Ga0070706_100772351 3300005467 Unclassified 890
173 Ga0070706_100798104 3300005467 Bacteria 874
174 Ga0070706_101144319 3300005467 Bacteria 716
175 Ga0070707_100031096 3300005468 Bacteria 5083
176 Ga0070707_100063580 3300005468 Bacteria 3542
177 Ga0070707_100337744 3300005468 Unclassified 1464
178 Ga0070707_100666946 3300005468 Bacteria 1003
179 Ga0070698_100008197 3300005471 Bacteria 11302
180 Ga0070698_100103485 3300005471 Bacteria 2817
181 Ga0070698_100357409 3300005471 Bacteria 1392
182 Ga0070698_100948606 3300005471 Bacteria 807
183 Ga0070699_100032659 3300005518 Bacteria 4495
184 Ga0070679_100683358 3300005530 Unclassified 969
185 Ga0070679_101091612 3300005530 Bacteria 743
186 Ga0070684_100023810 3300005535 Bacteria 5128
187 Ga0070684_100110938 3300005535 Bacteria 2460
188 Ga0070684_100161577 3300005535 Bacteria 2032
189 Ga0070684_100203231 3300005535 Bacteria 1805
190 Ga0070684_100329967 3300005535 Unclassified 1402
191 Ga0070684_101078195 3300005535 Bacteria 755
192 Ga0070697_100140274 3300005536 Bacteria 2032
193 Ga0070697_100275506 3300005536 Bacteria 1443
194 Ga0068853_100011239 3300005539 Bacteria 7266
195 Ga0068853_100108159 3300005539 Bacteria 2466
196 Ga0068853_100118772 3300005539 Bacteria 2356
197 Ga0068853_101678676 3300005539 Bacteria 616
198 Ga0070672_100040791 3300005543 Bacteria 3564
199 Ga0070672_100495475 3300005543 Bacteria 1056
200 Ga0070672_100682032 3300005543 Bacteria 899
201 Ga0070672_101117092 3300005543 Bacteria 701
202 Ga0070672_101947924 3300005543 Bacteria 529
203 Ga0070686_100002931 3300005544 Bacteria 9362
204 Ga0070686_100022405 3300005544 Bacteria 3762
205 Ga0070686_100072561 3300005544 Bacteria 2258
206 Ga0070686_100146224 3300005544 Bacteria 1651
207 Ga0070686_100693319 3300005544 Bacteria 811
208 Ga0070695_100093669 3300005545 Bacteria 2010
209 Ga0070695_100365674 3300005545 Bacteria 1084
210 Ga0070695_101128024 3300005545 Bacteria 643
211 Ga0070696_100002162 3300005546 Bacteria 12949
212 Ga0070696_100123372 3300005546 Bacteria 1877
213 Ga0070696_100230061 3300005546 Bacteria 1394
214 Ga0070696_100282496 3300005546 Bacteria 1266
215 Ga0070696_100380644 3300005546 Archaea 1100
216 Ga0070696_101442658 3300005546 Bacteria 588
217 Ga0070693_100011761 3300005547 Bacteria 4412
218 Ga0070693_100028406 3300005547 Bacteria 3040
219 Ga0070693_100163771 3300005547 Unclassified 1419
220 Ga0070693_100442881 3300005547 Unclassified 910
221 Ga0070665_100038326 3300005548 Bacteria 4818
222 Ga0070665_100102205 3300005548 Bacteria 2869
223 Ga0070665_100721772 3300005548 Bacteria 1010
224 Ga0070704_100038219 3300005549 Bacteria 3286
225 Ga0070704_100040005 3300005549 Bacteria 3223
226 Ga0070704_100073992 3300005549 Bacteria 2484
227 Ga0070704_100081925 3300005549 Bacteria 2378
228 Ga0070704_100313531 3300005549 Bacteria 1311
229 Ga0070704_100452752 3300005549 Bacteria 1105
230 Ga0070704_101035516 3300005549 Unclassified 744
231 Ga0070704_101803141 3300005549 Unclassified 566
232 Ga0068855_100009327 3300005563 Bacteria 11852
233 Ga0068855_100052751 3300005563 Bacteria 4786
234 Ga0068855_100074518 3300005563 Bacteria 3941
235 Ga0068855_100141727 3300005563 Bacteria 2739
236 Ga0068855_100279881 3300005563 Bacteria 1853
237 Ga0068855_100481408 3300005563 Bacteria 1351
238 Ga0070664_100109412 3300005564 Bacteria 2410
239 Ga0070664_100141117 3300005564 Bacteria 2121
240 Ga0070664_100466168 3300005564 Bacteria 1161
241 Ga0070664_101718314 3300005564 Bacteria 595
242 Ga0068857_100159470 3300005577 Bacteria 2046
243 Ga0068857_100750415 3300005577 Unclassified 929
244 Ga0068857_101349131 3300005577 Bacteria 693
245 Ga0068854_100092207 3300005578 Bacteria 2256
246 Ga0068854_100421424 3300005578 Bacteria 1109
247 Ga0068854_100593144 3300005578 Bacteria 945
248 Ga0068854_100614220 3300005578 Bacteria 930
249 Ga0068856_100076171 3300005614 Bacteria 3324
250 Ga0068856_100561282 3300005614 Bacteria 1163
251 Ga0068856_101145264 3300005614 Unclassified 795
252 Ga0070702_100012275 3300005615 Bacteria 4287
253 Ga0070702_100027701 3300005615 Bacteria 3061
254 Ga0070702_100063509 3300005615 Bacteria 2156
255 Ga0070702_100108561 3300005615 Bacteria 1716
256 Ga0070702_100130284 3300005615 Bacteria 1587
257 Ga0070702_100507449 3300005615 Unclassified 887
258 Ga0070702_100568069 3300005615 Bacteria 845
259 Ga0068852_100037616 3300005616 Bacteria 4059
260 Ga0068852_100070976 3300005616 Bacteria 3057
261 Ga0068852_100099570 3300005616 Bacteria 2620
262 Ga0068859_100146843 3300005617 Bacteria 2433
263 Ga0068859_100506270 3300005617 Bacteria 1303
264 Ga0068859_101091363 3300005617 Bacteria 878
265 Ga0068864_100098673 3300005618 Bacteria 2587
266 Ga0068864_100584236 3300005618 Bacteria 1083
267 Ga0068864_100817564 3300005618 Bacteria 917
268 Ga0068864_102132291 3300005618 Unclassified 567
269 Ga0068866_10000154 3300005718 Bacteria 31512
270 Ga0068866_10016635 3300005718 Bacteria 3292
271 Ga0068866_10109474 3300005718 Bacteria 1539
272 Ga0068866_10136568 3300005718 Bacteria 1402
273 Ga0068861_100010755 3300005719 Bacteria 6359
274 Ga0068861_100228250 3300005719 Bacteria 1577
275 Ga0068861_102382012 3300005719 Bacteria 532
276 Ga0068851_10033473 3300005834 Bacteria 2561
277 Ga0068851_10455370 3300005834 Bacteria 761
278 Ga0068870_10007395 3300005840 Bacteria 4892
279 Ga0068870_10015826 3300005840 Bacteria 3588
280 Ga0068870_10225408 3300005840 Bacteria 1150
281 Ga0068870_10388004 3300005840 Bacteria 906
282 Ga0068870_10611433 3300005840 Unclassified 742
283 Ga0068870_10994489 3300005840 Bacteria 598
284 Ga0068863_100539658 3300005841 Bacteria 1151
285 Ga0068863_100672428 3300005841 Bacteria 1028
286 Ga0068863_101028274 3300005841 Bacteria 827
287 Ga0068858_100190276 3300005842 Bacteria 1939
288 Ga0068858_100289688 3300005842 Bacteria 1560
289 Ga0068858_100839874 3300005842 Bacteria 897
290 Ga0068858_101226178 3300005842 Unclassified 738
291 Ga0068860_100044311 3300005843 Bacteria 4240
292 Ga0068860_100145459 3300005843 Bacteria 2281
293 Ga0068860_101307236 3300005843 Bacteria 746
294 Ga0068862_100376068 3300005844 Bacteria 1324
295 Ga0068862_100500081 3300005844 Bacteria 1154
296 Ga0068862_100818003 3300005844 Bacteria 911
297 Ga0081455_10094945 3300005937 Bacteria 2408
298 Ga0081538_10000613 3300005981 Bacteria 39554
299 Ga0081538_10039698 3300005981 Bacteria 3014
300 Ga0081538_10044010 3300005981 Bacteria 2792
301 Ga0081539_10000200 3300005985 Bacteria 139291
302 Ga0081539_10000397 3300005985 Bacteria 93458
303 Ga0081539_10002800 3300005985 Bacteria 23310
304 Ga0081539_10022450 3300005985 Bacteria 4174
305 Ga0081539_10244462 3300005985 Bacteria 801
306 Ga0070717_10042948 3300006028 Bacteria 3688
307 Ga0070717_10062130 3300006028 Bacteria 3097
308 Ga0070717_10066567 3300006028 Bacteria 2996
309 Ga0075365_10081590 3300006038 Bacteria 2191
310 Ga0075368_10094774 3300006042 Bacteria 1223
311 Ga0075363_100205666 3300006048 Bacteria 1126
312 Ga0075432_10003840 3300006058 Bacteria 5121
313 Ga0075432_10123707 3300006058 Bacteria 974
314 Ga0075432_10358228 3300006058 Bacteria 620
315 Ga0070716_100031802 3300006173 Bacteria 2873
316 Ga0070712_100015578 3300006175 Bacteria 4902
317 Ga0070712_100029034 3300006175 Bacteria 3705
318 Ga0070712_100056883 3300006175 Bacteria 2745
319 Ga0070712_100088858 3300006175 Bacteria 2259
320 Ga0070712_100120167 3300006175 Unclassified 1976
321 Ga0070712_100345180 3300006175 Bacteria 1217
322 Ga0070712_100462255 3300006175 Bacteria 1058
323 Ga0070712_101077956 3300006175 Bacteria 697
324 Ga0075367_10065198 3300006178 Bacteria 2180
325 Ga0097621_100074987 3300006237 Bacteria 2803
326 Ga0097621_100076399 3300006237 Bacteria 2778
327 Ga0097621_100303055 3300006237 Bacteria 1412
328 Ga0097621_100708147 3300006237 Bacteria 927
329 Ga0097621_101056789 3300006237 Unclassified 761
330 Ga0068871_100004124 3300006358 Bacteria 10049
331 Ga0068871_100020207 3300006358 Bacteria 5098
332 Ga0068871_101046338 3300006358 Bacteria 762
333 Ga0068871_101242042 3300006358 Bacteria 700
334 Ga0075428_100007989 3300006844 Bacteria 11737
335 Ga0075428_100267067 3300006844 Unclassified 1841
336 Ga0075428_100445810 3300006844 Bacteria 1386
337 Ga0075428_101580197 3300006844 Bacteria 686
338 Ga0075430_100374816 3300006846 Bacteria 1175
339 Ga0075431_100208318 3300006847 Bacteria 1998
340 Ga0075431_100490317 3300006847 Bacteria 1221
341 Ga0075433_10016681 3300006852 Bacteria 6061
342 Ga0075433_10055523 3300006852 Bacteria 3457
343 Ga0075433_10574982 3300006852 Bacteria 990
344 Ga0075434_100023057 3300006871 Bacteria 6061
345 Ga0075434_100557236 3300006871 Bacteria 1166
346 Ga0075434_100601432 3300006871 Bacteria 1119
347 Ga0075434_102076474 3300006871 Bacteria 573
348 Ga0068865_100000501 3300006881 Bacteria 21962
349 Ga0068865_100048860 3300006881 Bacteria 2913
350 Ga0068865_100186082 3300006881 Bacteria 1602
351 Ga0068865_100272849 3300006881 Unclassified 1343
352 Ga0068865_100409759 3300006881 Unclassified 1112
353 Ga0068865_101000886 3300006881 Bacteria 732
354 Ga0097620_100146839 3300006931 Bacteria 2433
355 Ga0097620_100506273 3300006931 Bacteria 1303
356 Ga0097620_101091147 3300006931 Bacteria 878
357 Ga0075435_100114458 3300007076 Bacteria 2245
358 Ga0075435_100355678 3300007076 Bacteria 1256
359 Ga0105250_10446172 3300009092 Unclassified 580
360 Ga0105240_10168178 3300009093 Bacteria 2599
361 Ga0105240_11735494 3300009093 Unclassified 651
362 Ga0111539_10005906 3300009094 Bacteria 15814
363 Ga0111539_10088786 3300009094 Bacteria 3632
364 Ga0111539_10121293 3300009094 Bacteria 3063
365 Ga0111539_10329889 3300009094 Bacteria 1776
366 Ga0111539_10849147 3300009094 Unclassified 1062
367 Ga0111539_10927450 3300009094 Bacteria 1013
368 Ga0111539_11079746 3300009094 Bacteria 933
369 Ga0111539_11758956 3300009094 Bacteria 719
370 Ga0111539_12297269 3300009094 Bacteria 626
371 Ga0111539_13471265 3300009094 Bacteria 506
372 Ga0105245_10002969 3300009098 Bacteria 15201
373 Ga0105245_10099412 3300009098 Bacteria 2689
374 Ga0105245_10122355 3300009098 Bacteria 2432
375 Ga0105245_10128518 3300009098 Bacteria 2374
376 Ga0105245_10330135 3300009098 Bacteria 1505
377 Ga0105245_10416867 3300009098 Unclassified 1345
378 Ga0105245_10440039 3300009098 Bacteria 1310
379 Ga0105245_10582413 3300009098 Unclassified 1144
380 Ga0105245_11650673 3300009098 Bacteria 693
381 Ga0105247_10507536 3300009101 Bacteria 880
382 Ga0105247_11759172 3300009101 Bacteria 514
383 Ga0114129_10023764 3300009147 Bacteria 8687
384 Ga0114129_10032301 3300009147 Bacteria 7398
385 Ga0114129_10054566 3300009147 Bacteria 5603
386 Ga0114129_10077312 3300009147 Bacteria 4630
387 Ga0114129_10119462 3300009147 Bacteria 3630
388 Ga0114129_10226938 3300009147 Bacteria 2517
389 Ga0114129_10235519 3300009147 Bacteria 2463
390 Ga0114129_10491521 3300009147 Bacteria 1604
391 Ga0114129_10602774 3300009147 Bacteria 1423
392 Ga0114129_11975623 3300009147 Bacteria 706
393 Ga0114129_12394109 3300009147 Bacteria 632
394 Ga0114129_12469908 3300009147 Unclassified 622
395 Ga0105243_10001079 3300009148 Bacteria 24973
396 Ga0105243_10041427 3300009148 Bacteria 3602
397 Ga0105243_10045850 3300009148 Bacteria 3437
398 Ga0105243_10065608 3300009148 Bacteria 2917
399 Ga0105243_10179690 3300009148 Unclassified 1839
400 Ga0105243_10400780 3300009148 Bacteria 1274
401 Ga0105243_10458573 3300009148 Bacteria 1198
402 Ga0105243_10625464 3300009148 Bacteria 1040
403 Ga0105243_10771017 3300009148 Unclassified 945
404 Ga0105243_10774772 3300009148 Bacteria 943
405 Ga0105243_11618832 3300009148 Bacteria 674
406 Ga0105241_10034431 3300009174 Bacteria 3805
407 Ga0105241_10063555 3300009174 Bacteria 2849
408 Ga0105242_10001102 3300009176 Bacteria 21272
409 Ga0105242_10290555 3300009176 Bacteria 1488
410 Ga0105242_10305488 3300009176 Bacteria 1454
411 Ga0105242_10455064 3300009176 Bacteria 1207
412 Ga0105242_11050675 3300009176 Bacteria 825
413 Ga0105248_10055520 3300009177 Bacteria 4443
414 Ga0105248_10121237 3300009177 Bacteria 2950
415 Ga0105248_10232932 3300009177 Bacteria 2073
416 Ga0105248_10267784 3300009177 Bacteria 1924
417 Ga0105237_10258715 3300009545 Bacteria 1743
418 Ga0105238_10082188 3300009551 Bacteria 3211
419 Ga0105238_10230103 3300009551 Unclassified 1831
420 Ga0105249_10001927 3300009553 Bacteria 18015
421 Ga0105249_10079948 3300009553 Bacteria 3036
422 Ga0105249_10428545 3300009553 Bacteria 1358
423 Ga0105249_11720358 3300009553 Bacteria 700
424 Ga0105249_13331295 3300009553 Bacteria 517
425 Ga0105239_10001224 3300010375 Bacteria 34981
426 Ga0105239_10007498 3300010375 Bacteria 12521
427 Ga0105239_10233302 3300010375 Bacteria 2065
428 Ga0105239_10248445 3300010375 Unclassified 1998
429 Ga0105239_10495421 3300010375 Bacteria 1389
430 Ga0105239_10551793 3300010375 Bacteria 1312
431 Ga0105246_10017459 3300011119 Bacteria 4560
432 Ga0105246_10065106 3300011119 Bacteria 2548
433 Ga0105246_10184549 3300011119 Unclassified 1609
434 Ga0105246_10261586 3300011119 Bacteria 1379
435 Ga0105246_10353141 3300011119 Bacteria 1205
436 Ga0105246_10523740 3300011119 Bacteria 1011
437 Ga0105246_10806903 3300011119 Bacteria 833
438 Ga0157338_1020450 3300012515 Bacteria 767
439 Ga0157370_10165839 3300013104 Bacteria 2054
440 Ga0157370_10205076 3300013104 Bacteria 1828
441 Ga0157369_10093222 3300013105 Bacteria 3215
442 Ga0157369_10680052 3300013105 Unclassified 1060
443 Ga0157369_10706909 3300013105 Bacteria 1038
444 Ga0157369_11474644 3300013105 Bacteria 692
445 Ga0157369_11934321 3300013105 Bacteria 599
446 Ga0157374_10002604 3300013296 Bacteria 15209
447 Ga0157374_10158520 3300013296 Unclassified 2204
448 Ga0157374_10224673 3300013296 Unclassified 1843
449 Ga0157374_10464457 3300013296 Bacteria 1268
450 Ga0157374_10623179 3300013296 Bacteria 1089
451 Ga0157374_11395100 3300013296 Bacteria 723
452 Ga0157374_11664555 3300013296 Bacteria 663
453 Ga0157374_12644901 3300013296 Bacteria 529
454 Ga0157378_10002273 3300013297 Bacteria 17055
455 Ga0157378_10690021 3300013297 Bacteria 1040
456 Ga0157378_11076418 3300013297 Unclassified 840
457 Ga0163162_10023555 3300013306 Bacteria 6077
458 Ga0157372_10079449 3300013307 Bacteria 3709
459 Ga0157372_10089598 3300013307 Bacteria 3495
460 Ga0157372_10424498 3300013307 Bacteria 1549
461 Ga0157372_10540436 3300013307 Bacteria 1359
462 Ga0157372_11993383 3300013307 Unclassified 667
463 Ga0157375_10038081 3300013308 Bacteria 4614
464 Ga0157375_10197601 3300013308 Bacteria 2166
465 Ga0157375_10203438 3300013308 Bacteria 2136
466 Ga0157375_10205428 3300013308 Bacteria 2126
467 Ga0157375_10285624 3300013308 Bacteria 1813
468 Ga0157375_10293606 3300013308 Bacteria 1789
469 Ga0157375_10353133 3300013308 Bacteria 1636
470 Ga0157375_12276285 3300013308 Bacteria 646
471 Ga0163163_10035159 3300014325 Bacteria 4859
472 Ga0163163_10056026 3300014325 Bacteria 3896
473 Ga0163163_10361202 3300014325 Bacteria 1509
474 Ga0163163_11720790 3300014325 Bacteria 688
475 Ga0163163_11792278 3300014325 Bacteria 674
476 Ga0157380_10031685 3300014326 Bacteria 4060
477 Ga0157380_10104181 3300014326 Bacteria 2369
478 Ga0157380_10114211 3300014326 Bacteria 2275
479 Ga0157380_10186358 3300014326 Bacteria 1828
480 Ga0182008_10240503 3300014497 Unclassified 931
481 Ga0157377_10065955 3300014745 Bacteria 2081
482 Ga0157377_10096751 3300014745 Bacteria 1752
483 Ga0157377_10138404 3300014745 Unclassified 1494
484 Ga0157377_10175205 3300014745 Bacteria 1344
485 Ga0157377_10344303 3300014745 Bacteria 998
486 Ga0157377_11063525 3300014745 Bacteria 617
487 Ga0157379_10156707 3300014968 Bacteria 2055
488 Ga0157379_10379133 3300014968 Bacteria 1297
489 Ga0157379_10479015 3300014968 Bacteria 1151
490 Ga0157379_12492212 3300014968 Unclassified 517
491 Ga0157376_10063860 3300014969 Bacteria 3103
492 Ga0157376_10067491 3300014969 Bacteria 3025
493 Ga0157376_10091007 3300014969 Bacteria 2642
494 Ga0157376_10127144 3300014969 Bacteria 2269
495 Ga0157376_10684308 3300014969 Bacteria 1029
496 Ga0157376_10893563 3300014969 Bacteria 906
497 Ga0163161_10043385 3300017792 Bacteria 3238
498 Ga0163161_10186232 3300017792 Bacteria 1594
499 Ga0163161_10202882 3300017792 Bacteria 1529
500 Ga0207656_10099563 3300025321 Bacteria 1331
501 Ga0207653_10006929 3300025885 Bacteria 3535
502 Ga0207653_10325785 3300025885 Bacteria 598
503 Ga0207682_10387583 3300025893 Unclassified 660
504 Ga0207682_10438797 3300025893 Bacteria 618
505 Ga0207692_10005239 3300025898 Bacteria 5181
506 Ga0207692_10012702 3300025898 Bacteria 3624
507 Ga0207692_10441196 3300025898 Bacteria 818
508 Ga0207642_10000121 3300025899 Bacteria 21373
509 Ga0207642_10010352 3300025899 Bacteria 3283
510 Ga0207642_10086139 3300025899 Bacteria 1539
511 Ga0207642_10120377 3300025899 Bacteria 1353
512 Ga0207688_10013564 3300025901 Bacteria 4430
513 Ga0207688_10018261 3300025901 Bacteria 3818
514 Ga0207688_10035032 3300025901 Bacteria 2781
515 Ga0207688_10059697 3300025901 Bacteria 2148
516 Ga0207688_10481982 3300025901 Bacteria 775
517 Ga0207680_10390991 3300025903 Unclassified 982
518 Ga0207680_10459245 3300025903 Bacteria 904
519 Ga0207647_10141020 3300025904 Bacteria 1412
520 Ga0207699_10005440 3300025906 Bacteria 6101
521 Ga0207699_10373065 3300025906 Unclassified 1011
522 Ga0207699_11122427 3300025906 Bacteria 582
523 Ga0207645_10046257 3300025907 Bacteria 2780
524 Ga0207645_10108585 3300025907 Bacteria 1795
525 Ga0207645_10258496 3300025907 Unclassified 1153
526 Ga0207643_10011385 3300025908 Bacteria 4803
527 Ga0207643_10024864 3300025908 Bacteria 3306
528 Ga0207643_10033195 3300025908 Bacteria 2888
529 Ga0207643_10049089 3300025908 Bacteria 2391
530 Ga0207643_10230264 3300025908 Bacteria 1136
531 Ga0207705_10571876 3300025909 Unclassified 878
532 Ga0207705_10828381 3300025909 Bacteria 718
533 Ga0207705_11501303 3300025909 Bacteria 510
534 Ga0207684_10078849 3300025910 Bacteria 2801
535 Ga0207684_10323244 3300025910 Bacteria 1329
536 Ga0207654_10079295 3300025911 Bacteria 1972
537 Ga0207654_10093248 3300025911 Bacteria 1841
538 Ga0207707_10216185 3300025912 Unclassified 1669
539 Ga0207707_10355571 3300025912 Unclassified 1262
540 Ga0207707_11156135 3300025912 Unclassified 628
541 Ga0207695_10181137 3300025913 Bacteria 2027
542 Ga0207695_10224898 3300025913 Bacteria 1783
543 Ga0207693_10000499 3300025915 Bacteria 35458
544 Ga0207693_10051202 3300025915 Bacteria 3241
545 Ga0207693_10054819 3300025915 Bacteria 3127
546 Ga0207693_10082992 3300025915 Unclassified 2510
547 Ga0207693_10224061 3300025915 Bacteria 1477
548 Ga0207693_10859919 3300025915 Bacteria 697
549 Ga0207663_10006965 3300025916 Bacteria 5829
550 Ga0207663_10061314 3300025916 Bacteria 2386
551 Ga0207660_10030174 3300025917 Bacteria 3726
552 Ga0207660_10129643 3300025917 Bacteria 1918
553 Ga0207662_10082152 3300025918 Bacteria 1968
554 Ga0207662_10390112 3300025918 Unclassified 942
555 Ga0207657_10024564 3300025919 Bacteria 5574
556 Ga0207657_10040844 3300025919 Bacteria 4107
557 Ga0207657_10225929 3300025919 Bacteria 1498
558 Ga0207657_10377706 3300025919 Bacteria 1116
559 Ga0207652_10111373 3300025921 Bacteria 2427
560 Ga0207652_10195518 3300025921 Bacteria 1819
561 Ga0207652_10214056 3300025921 Bacteria 1736
562 Ga0207652_11228118 3300025921 Bacteria 651
563 Ga0207646_10031346 3300025922 Bacteria 4813
564 Ga0207646_10051314 3300025922 Bacteria 3691
565 Ga0207681_10220229 3300025923 Unclassified 1468
566 Ga0207681_10297453 3300025923 Bacteria 1276
567 Ga0207681_10343595 3300025923 Bacteria 1193
568 Ga0207694_10133467 3300025924 Bacteria 1992
569 Ga0207694_10844290 3300025924 Unclassified 774
570 Ga0207650_10026154 3300025925 Bacteria 4161
571 Ga0207650_10043408 3300025925 Bacteria 3300
572 Ga0207650_10207686 3300025925 Bacteria 1571
573 Ga0207659_10049378 3300025926 Bacteria 2984
574 Ga0207659_10501292 3300025926 Bacteria 1028
575 Ga0207659_10904142 3300025926 Unclassified 759
576 Ga0207659_11159924 3300025926 Bacteria 664
577 Ga0207659_11438065 3300025926 Unclassified 591
578 Ga0207687_10008259 3300025927 Bacteria 6810
579 Ga0207687_10026498 3300025927 Bacteria 3883
580 Ga0207687_10197800 3300025927 Bacteria 1569
581 Ga0207687_10205192 3300025927 Bacteria 1543
582 Ga0207687_10304971 3300025927 Bacteria 1284
583 Ga0207687_10371214 3300025927 Bacteria 1170
584 Ga0207687_10441075 3300025927 Unclassified 1078
585 Ga0207687_10665511 3300025927 Bacteria 882
586 Ga0207687_11020486 3300025927 Bacteria 710
587 Ga0207687_11480602 3300025927 Bacteria 583
588 Ga0207700_10029670 3300025928 Bacteria 3862
589 Ga0207700_10140576 3300025928 Bacteria 1983
590 Ga0207700_10291445 3300025928 Bacteria 1407
591 Ga0207700_10430452 3300025928 Unclassified 1160
592 Ga0207664_10185285 3300025929 Bacteria 1789
593 Ga0207664_10455777 3300025929 Bacteria 1142
594 Ga0207664_10499241 3300025929 Bacteria 1089
595 Ga0207664_10951012 3300025929 Unclassified 770
596 Ga0207644_10041470 3300025931 Bacteria 3256
597 Ga0207644_10171420 3300025931 Bacteria 1694
598 Ga0207644_10241726 3300025931 Bacteria 1438
599 Ga0207644_10450718 3300025931 Bacteria 1057
600 Ga0207644_10678067 3300025931 Unclassified 859
601 Ga0207690_10078519 3300025932 Bacteria 2298
602 Ga0207690_10118310 3300025932 Bacteria 1920
603 Ga0207690_10151441 3300025932 Bacteria 1720
604 Ga0207690_10160963 3300025932 Bacteria 1673
605 Ga0207690_10371145 3300025932 Unclassified 1135
606 Ga0207690_10888321 3300025932 Unclassified 739
607 Ga0207706_10036092 3300025933 Bacteria 4392
608 Ga0207706_10040968 3300025933 Bacteria 4106
609 Ga0207706_10095842 3300025933 Bacteria 2609
610 Ga0207706_10149522 3300025933 Bacteria 2054
611 Ga0207706_10203550 3300025933 Bacteria 1736
612 Ga0207706_10213715 3300025933 Bacteria 1690
613 Ga0207706_11213399 3300025933 Bacteria 626
614 Ga0207686_10007426 3300025934 Bacteria 5901
615 Ga0207686_10073981 3300025934 Bacteria 2200
616 Ga0207686_10081334 3300025934 Bacteria 2114
617 Ga0207686_10585967 3300025934 Bacteria 876
618 Ga0207686_11053058 3300025934 Bacteria 662
619 Ga0207686_11688937 3300025934 Bacteria 523
620 Ga0207709_10000781 3300025935 Bacteria 24924
621 Ga0207709_10026050 3300025935 Bacteria 3355
622 Ga0207709_10029386 3300025935 Bacteria 3188
623 Ga0207709_10104363 3300025935 Bacteria 1881
624 Ga0207709_10135973 3300025935 Bacteria 1683
625 Ga0207709_10310048 3300025935 Bacteria 1177
626 Ga0207709_10457446 3300025935 Bacteria 988
627 Ga0207709_10831434 3300025935 Bacteria 747
628 Ga0207670_10076864 3300025936 Bacteria 2324
629 Ga0207670_10091541 3300025936 Bacteria 2151
630 Ga0207670_10107744 3300025936 Bacteria 2001
631 Ga0207670_11590238 3300025936 Bacteria 556
632 Ga0207669_10019605 3300025937 Bacteria 3526
633 Ga0207669_10027179 3300025937 Bacteria 3127
634 Ga0207669_10138365 3300025937 Bacteria 1686
635 Ga0207669_10153021 3300025937 Bacteria 1618
636 Ga0207669_10390344 3300025937 Unclassified 1087
637 Ga0207669_10535492 3300025937 Bacteria 943
638 Ga0207669_11239637 3300025937 Bacteria 632
639 Ga0207704_10001528 3300025938 Bacteria 10371
640 Ga0207704_10148550 3300025938 Bacteria 1650
641 Ga0207704_10916754 3300025938 Unclassified 738
642 Ga0207665_10013877 3300025939 Bacteria 5298
643 Ga0207665_10064208 3300025939 Bacteria 2495
644 Ga0207665_11000958 3300025939 Bacteria 665
645 Ga0207691_10104442 3300025940 Bacteria 2525
646 Ga0207691_10142606 3300025940 Bacteria 2110
647 Ga0207711_10045931 3300025941 Bacteria 3732
648 Ga0207711_10381169 3300025941 Unclassified 1308
649 Ga0207711_10554850 3300025941 Bacteria 1071
650 Ga0207689_10096263 3300025942 Bacteria 2431
651 Ga0207689_10109310 3300025942 Bacteria 2272
652 Ga0207689_10225654 3300025942 Bacteria 1548
653 Ga0207661_10170430 3300025944 Bacteria 1895
654 Ga0207661_10208489 3300025944 Bacteria 1721
655 Ga0207661_10220679 3300025944 Bacteria 1675
656 Ga0207661_10321855 3300025944 Bacteria 1390
657 Ga0207661_11910048 3300025944 Bacteria 539
658 Ga0207679_10201069 3300025945 Bacteria 1664
659 Ga0207679_10214096 3300025945 Bacteria 1618
660 Ga0207679_10449805 3300025945 Bacteria 1142
661 Ga0207679_10553567 3300025945 Bacteria 1032
662 Ga0207667_10079631 3300025949 Bacteria 3395
663 Ga0207667_10253034 3300025949 Bacteria 1802
664 Ga0207667_10368882 3300025949 Unclassified 1463
665 Ga0207667_10494854 3300025949 Unclassified 1240
666 Ga0207667_11075681 3300025949 Bacteria 788
667 Ga0207651_10023333 3300025960 Bacteria 3803
668 Ga0207651_10289158 3300025960 Bacteria 1358
669 Ga0207651_10888927 3300025960 Bacteria 793
670 Ga0207712_10004576 3300025961 Bacteria 8726
671 Ga0207712_10044115 3300025961 Bacteria 3080
672 Ga0207712_10572621 3300025961 Bacteria 974
673 Ga0207668_10003765 3300025972 Bacteria 8932
674 Ga0207668_10154482 3300025972 Bacteria 1781
675 Ga0207668_10384882 3300025972 Bacteria 1182
676 Ga0207668_11576534 3300025972 Bacteria 593
677 Ga0207668_11846692 3300025972 Bacteria 545
678 Ga0207640_10108807 3300025981 Bacteria 1960
679 Ga0207640_10200161 3300025981 Bacteria 1513
680 Ga0207640_10221847 3300025981 Bacteria 1448
681 Ga0207640_10295890 3300025981 Unclassified 1278
682 Ga0207640_10657036 3300025981 Bacteria 894
683 Ga0207658_11847008 3300025986 Bacteria 551
684 Ga0207677_10008583 3300026023 Bacteria 5718
685 Ga0207677_10109194 3300026023 Bacteria 2056
686 Ga0207677_10137651 3300026023 Bacteria 1864
687 Ga0207677_10373671 3300026023 Bacteria 1201
688 Ga0207677_10391252 3300026023 Bacteria 1176
689 Ga0207677_10647479 3300026023 Bacteria 932
690 Ga0207677_10982908 3300026023 Bacteria 765
691 Ga0207703_10149599 3300026035 Bacteria 2034
692 Ga0207703_10188969 3300026035 Bacteria 1823
693 Ga0207703_10209016 3300026035 Bacteria 1739
694 Ga0207703_10298597 3300026035 Bacteria 1468
695 Ga0207639_10008584 3300026041 Bacteria 7010
696 Ga0207639_10159022 3300026041 Bacteria 1902
697 Ga0207639_10340844 3300026041 Bacteria 1336
698 Ga0207639_11529900 3300026041 Bacteria 626
699 Ga0207639_12121827 3300026041 Bacteria 523
700 Ga0207678_10047645 3300026067 Bacteria 3706
701 Ga0207678_10073033 3300026067 Bacteria 2940
702 Ga0207678_10103374 3300026067 Bacteria 2432
703 Ga0207678_10175787 3300026067 Bacteria 1828
704 Ga0207678_10226914 3300026067 Bacteria 1599
705 Ga0207678_11172123 3300026067 Unclassified 680
706 Ga0207708_10001823 3300026075 Bacteria 15722
707 Ga0207708_10019061 3300026075 Bacteria 5166
708 Ga0207708_10071276 3300026075 Bacteria 2662
709 Ga0207708_10375213 3300026075 Bacteria 1172
710 Ga0207708_10517923 3300026075 Bacteria 1002
711 Ga0207708_10591980 3300026075 Bacteria 939
712 Ga0207702_10084913 3300026078 Bacteria 2758
713 Ga0207702_10334112 3300026078 Unclassified 1446
714 Ga0207702_10476677 3300026078 Bacteria 1214
715 Ga0207702_12079474 3300026078 Unclassified 558
716 Ga0207641_10155609 3300026088 Bacteria 2074
717 Ga0207641_10850970 3300026088 Bacteria 904
718 Ga0207641_11178859 3300026088 Unclassified 765
719 Ga0207648_10002767 3300026089 Bacteria 18606
720 Ga0207648_10115346 3300026089 Bacteria 2360
721 Ga0207648_10170859 3300026089 Bacteria 1921
722 Ga0207648_10203638 3300026089 Bacteria 1756
723 Ga0207648_10357528 3300026089 Unclassified 1317
724 Ga0207648_10763094 3300026089 Bacteria 899
725 Ga0207648_10828210 3300026089 Bacteria 862
726 Ga0207648_11863577 3300026089 Unclassified 563
727 Ga0207676_10066145 3300026095 Bacteria 2881
728 Ga0207676_11386908 3300026095 Bacteria 699
729 Ga0207674_10053134 3300026116 Bacteria 4130
730 Ga0207674_10279683 3300026116 Bacteria 1617
731 Ga0207675_100017381 3300026118 Bacteria 6714
732 Ga0207675_100080907 3300026118 Bacteria 3046
733 Ga0207675_100398121 3300026118 Bacteria 1356
734 Ga0207683_10001565 3300026121 Bacteria 20601
735 Ga0207683_10024042 3300026121 Bacteria 5243
736 Ga0207683_10093849 3300026121 Bacteria 2674
737 Ga0207683_10193681 3300026121 Bacteria 1846
738 Ga0207683_10231428 3300026121 Bacteria 1685
739 Ga0207683_10336592 3300026121 Bacteria 1384
740 Ga0207683_10518069 3300026121 Bacteria 1102
741 Ga0207683_11384313 3300026121 Unclassified 651
742 Ga0207683_11701301 3300026121 Bacteria 580
743 Ga0207698_10663964 3300026142 Bacteria 1034
744 Ga0207698_11045938 3300026142 Bacteria 828
745 Ga0207428_10000244 3300027907 Bacteria 74209
746 Ga0207428_10017553 3300027907 Bacteria 6137
747 Ga0207428_10062192 3300027907 Bacteria 2953
748 Ga0207428_10190763 3300027907 Bacteria 1545
749 Ga0207428_10341436 3300027907 Bacteria 1103
750 Ga0268266_10127491 3300028379 Bacteria 2273
751 Ga0268266_10741861 3300028379 Bacteria 947
752 Ga0268265_10168157 3300028380 Bacteria 1871
753 Ga0268265_10213031 3300028380 Bacteria 1685
754 Ga0268265_10224947 3300028380 Bacteria 1645
755 Ga0268265_10837575 3300028380 Bacteria 899
756 Ga0268264_10064057 3300028381 Bacteria 3093
757 Ga0268264_10172897 3300028381 Unclassified 1955
758 Ga0268264_10288350 3300028381 Bacteria 1541
759 Ga0268264_10886826 3300028381 Bacteria 895
760 Ga0265337_1180496 3300028556 Unclassified 573
761 Ga0265319_1015811 3300028563 Bacteria 2910
762 Ga0265334_10091715 3300028573 Bacteria 1107
763 Ga0265318_10006523 3300028577 Bacteria 5362
764 Ga0265322_10003434 3300028654 Bacteria 4789
765 Ga0265338_10049826 3300028800 Bacteria 3791
766 Ga0265330_10021550 3300031235 Bacteria 2939
767 Ga0265320_10052314 3300031240 Bacteria 1978
768 Ga0265340_10020712 3300031247 Bacteria 3376
769 Ga0265331_10256016 3300031250 Bacteria 785
770 Ga0265327_10047790 3300031251 Bacteria 2254
771 Ga0265316_10010198 3300031344 Bacteria 8580
772 Ga0265316_10327849 3300031344 Bacteria 1111
773 Ga0307408_100006069 3300031548 Bacteria 8037
774 Ga0307408_100687352 3300031548 Bacteria 918
775 Ga0265314_10029645 3300031711 Bacteria 4062
776 Ga0265342_10033446 3300031712 Bacteria 3161
777 Ga0307406_10006630 3300031901 Bacteria 6401
778 Ga0307412_11574126 3300031911 Bacteria 599
779 Ga0307409_100014581 3300031995 Bacteria 5120
780 Ga0307409_102512958 3300031995 Bacteria 544
781 Ga0307416_100259067 3300032002 Bacteria 1699
782 Ga0307416_100330182 3300032002 Bacteria 1532
783 Ga0307411_10309153 3300032005 Bacteria 1271
784 Ga0307415_100000296 3300032126 Bacteria 21625
785 Ga0373930_0054694 3300034816 Bacteria 879
786 Ga0373930_0085012 3300034816 Bacteria 736
787 Ga0373950_0003227 3300034818 Bacteria 2312
788 Ga0373950_0047168 3300034818 Bacteria 839
789 Ga0373958_0164461 3300034819 Bacteria 563
790 Ga0373938_0017268 3300034957 Bacteria 1420
791 Ga0373928_0013245 3300035084 Bacteria 1654
792 Ga0373940_0015848 3300035088 Bacteria 1859
793 Ga0373940_0088428 3300035088 Bacteria 925
794 Ga0373949_0012995 3300035090 Bacteria 1845
795 Ga0373949_0024504 3300035090 Bacteria 1404
796 Ga0373951_0069655 3300035091 Bacteria 894
797 Ga0373952_0032221 3300035092 Unclassified 1169
798 Ga0373952_0045527 3300035092 Bacteria 1029
799 Ga0373932_0030305 3300035112 Bacteria 1498
800 Ga0373939_0024933 3300035114 Bacteria 1671
801 Ga0373939_0057850 3300035114 Bacteria 1224
802 Ga0373941_0004913 3300035115 Bacteria 3116
803 Ga0373960_0007134 3300035121 Bacteria 2640
804 Ga0373960_0017803 3300035121 Bacteria 1845
805 Ga0373943_0294903 3300035170 Bacteria 920
806 Ga0373946_0031397 3300035171 Bacteria 2127
807 Ga0373942_0077751 3300035207 Unclassified 980
808 Ga0373961_0363333 3300035241 Bacteria 548
809 Ga0373962_0066725 3300035242 Bacteria 1067
810 Ga0373931_0080509 3300035691 Bacteria 1796
811 Ga0373931_0677139 3300035691 Unclassified 680
812 Ga0373931_0738855 3300035691 Bacteria 652
813 Ga0373935_0875574 3300035692 Bacteria 665
814 Ga0373935_1395502 3300035692 Bacteria 524
815 Ga0373947_0100166 3300035725 Bacteria 1820
816 Ga0373947_0588854 3300035725 Unclassified 758
817 Ga0373947_0960474 3300035725 Unclassified 583
818 Ga0373925_1249120 3300037068 Bacteria 610
819 Ga0395899_0004452 3300037312 Bacteria 10926
820 Ga0395899_0059931 3300037312 Bacteria 2805
821 Ga0395899_0092699 3300037312 Unclassified 2187
822 Ga0395899_0095731 3300037312 Bacteria 2147
823 Ga0395899_0179076 3300037312 Bacteria 1489
824 Ga0395899_0235520 3300037312 Bacteria 1262
825 Ga0395899_0273881 3300037312 Bacteria 1150
826 Ga0395899_0354746 3300037312 Bacteria 980
827 Ga0395899_0605495 3300037312 Bacteria 697
828 Ga0395900_0005149 3300037418 Bacteria 13734
829 Ga0395900_0015990 3300037418 Bacteria 7646
830 Ga0395900_0028418 3300037418 Bacteria 5727
831 Ga0395900_0034196 3300037418 Bacteria 5233
832 Ga0395900_0049205 3300037418 Bacteria 4342
833 Ga0395900_0054838 3300037418 Bacteria 4104
834 Ga0395900_0084409 3300037418 Bacteria 3263
835 Ga0395900_0111027 3300037418 Bacteria 2816
836 Ga0395900_0112213 3300037418 Bacteria 2799
837 Ga0395900_0335269 3300037418 Bacteria 1489
838 Ga0395900_0351489 3300037418 Bacteria 1447
839 Ga0395900_0378526 3300037418 Bacteria 1384
840 Ga0395900_0488028 3300037418 Bacteria 1184
841 Ga0395900_0605758 3300037418 Bacteria 1035
842 Ga0395900_1205454 3300037418 Unclassified 672
843 Ga0395900_1300897 3300037418 Bacteria 641
844 Ga0395898_0008743 3300037466 Bacteria 10682
845 Ga0395898_0009899 3300037466 Bacteria 9991
846 Ga0395898_0010359 3300037466 Bacteria 9750
847 Ga0395898_0012306 3300037466 Bacteria 8847
848 Ga0395898_0014022 3300037466 Bacteria 8236
849 Ga0395898_0020346 3300037466 Bacteria 6739
850 Ga0395898_0194287 3300037466 Bacteria 1939
851 Ga0395898_0275884 3300037466 Bacteria 1603
852 Ga0395898_0423974 3300037466 Bacteria 1268
853 Ga0395898_0498844 3300037466 Bacteria 1158
854 Ga0395898_1009982 3300037466 Bacteria 767
855 Ga0395898_1126301 3300037466 Bacteria 717
856 Ga0395898_1550486 3300037466 Bacteria 587
857 Ga0395905_0001978 3300037471 Bacteria 23430
858 Ga0395905_0005427 3300037471 Bacteria 13026
859 Ga0395905_0009544 3300037471 Bacteria 9479
860 Ga0395905_0010689 3300037471 Bacteria 8902
861 Ga0395905_0030391 3300037471 Bacteria 5090
862 Ga0395905_0058810 3300037471 Bacteria 3594
863 Ga0395905_0066504 3300037471 Bacteria 3375
864 Ga0395905_0078229 3300037471 Unclassified 3099
865 Ga0395905_0184513 3300037471 Unclassified 1958
866 Ga0395905_0226825 3300037471 Bacteria 1747
867 Ga0395905_0324635 3300037471 Bacteria 1429
868 Ga0395905_0946860 3300037471 Bacteria 764
869 Ga0395905_1163385 3300037471 Bacteria 675
870 Ga0395905_1791465 3300037471 Bacteria 520
871 Ga0395901_0001057 3300038443 Bacteria 29607
872 Ga0395901_0002203 3300038443 Bacteria 19874
873 Ga0395901_0003853 3300038443 Bacteria 15102
874 Ga0395901_0005172 3300038443 Bacteria 13163
875 Ga0395901_0007398 3300038443 Bacteria 11079
876 Ga0395901_0020884 3300038443 Bacteria 6706
877 Ga0395901_0038896 3300038443 Bacteria 4920
878 Ga0395901_0052611 3300038443 Bacteria 4232
879 Ga0395901_0069768 3300038443 Bacteria 3660
880 Ga0395901_0185212 3300038443 Unclassified 2183
881 Ga0395901_0447505 3300038443 Bacteria 1321
882 Ga0395901_0771281 3300038443 Bacteria 953
883 Ga0395901_0954514 3300038443 Unclassified 836
884 Ga0395901_1515472 3300038443 Bacteria 626
885 Ga0395901_1833748 3300038443 Unclassified 555
886 Ga0395901_1933921 3300038443 Bacteria 537
887 Ga0395901_2032968 3300038443 Bacteria 520
888 Ga0242419_020830 3300038698 Unclassified 549
889 Ga0439466_0033807 3300041411 Bacteria 1736
890 Ga0439465_0161717 3300041413 Bacteria 803
891 Ga0451793_0055089 3300041452 Unclassified 516
892 Ga0451793_1909678 3300041452 Bacteria 713
893 Ga0451802_1142471 3300041460 Unclassified 631
894 Ga0451833_0041664 3300041491 Bacteria 554
895 Ga0451835_0827331 3300041492 Bacteria 718
896 Ga0451835_0877562 3300041492 Unclassified 936
897 Ga0451845_0252246 3300041501 Bacteria 1133
898 Ga0451851_1114086 3300041507 Bacteria 555
899 Ga0451853_2147256 3300041512 Bacteria 545
900 Ga0451853_3049901 3300041512 Bacteria 654
901 Ga0439432_166650 3300042006 Bacteria 644
902 Ga0439450_033238 3300042008 Unclassified 1169
903 Ga0439455_0067033 3300042012 Bacteria 960
904 Ga0439463_186578 3300042016 Bacteria 538
905 Ga0450911_053899 3300042115 Bacteria 522
906 Ga0450920_045646 3300042122 Bacteria 875
907 Ga0450920_070287 3300042122 Unclassified 712
908 Ga0450923_002353 3300042125 Bacteria 2701
909 Ga0450906_007163 3300042145 Bacteria 2212
910 Ga0450907_032012 3300042146 Bacteria 895
911 Ga0450910_021902 3300042147 Bacteria 969
912 Ga0439458_0111816 3300042157 Bacteria 715
913 Ga0450908_021794 3300042184 Bacteria 1124
914 Ga0450918_068779 3300042531 Unclassified 662
915 Ga0453683_1080618 3300044673 Bacteria 534
916 Ga0466963_0468182 3300044694 Unclassified 889
917 Ga0466963_1034055 3300044694 Bacteria 578
918 Ga0466960_0031228 3300044901 Bacteria 2457
919 Ga0466960_0094703 3300044901 Bacteria 1528
920 Ga0466960_0343033 3300044901 Bacteria 850
921 Ga0451576_0165698 3300045051 Bacteria 2306
922 Ga0451576_1846427 3300045051 Bacteria 624
923 Ga0451576_2155685 3300045051 Unclassified 573
924 Ga0466967_1420019 3300045976 Unclassified 691
925 Ga0466967_2027913 3300045976 Bacteria 572
926 Ga0495592_0168953 3300046454 Bacteria 1499
927 Ga0495603_0027012 3300046455 Bacteria 3466
928 Ga0495603_0115527 3300046455 Bacteria 1565
929 Ga0495603_0361152 3300046455 Unclassified 833
930 Ga0495629_0024941 3300046459 Bacteria 4253
931 Ga0495629_0204123 3300046459 Bacteria 1366
932 Ga0495629_0303650 3300046459 Unclassified 1093
933 Ga0495629_0411579 3300046459 Bacteria 918
934 Ga0495629_0700797 3300046459 Unclassified 672
935 Ga0495641_0069757 3300046461 Unclassified 1579
936 Ga0495641_0087876 3300046461 Bacteria 1390
937 Ga0495641_0137360 3300046461 Bacteria 1091
938 Ga0495641_0141276 3300046461 Bacteria 1076
939 Ga0495641_0516825 3300046461 Bacteria 545
940 Ga0495651_0288308 3300046462 Bacteria 1106
941 Ga0495653_0054139 3300046463 Bacteria 3067
942 Ga0495653_0186438 3300046463 Bacteria 1419
943 Ga0495582_0122295 3300046473 Bacteria 1467
944 Ga0495582_0183516 3300046473 Unclassified 1192
945 Ga0495582_0428109 3300046473 Bacteria 764
946 Ga0495639_0034969 3300046475 Bacteria 2248
947 Ga0495639_0160519 3300046475 Bacteria 1088
948 Ga0495639_0274915 3300046475 Bacteria 836
949 Ga0495662_0198546 3300046476 Unclassified 989
950 Ga0495584_0095884 3300046491 Bacteria 1498
951 Ga0495584_0133619 3300046491 Bacteria 1259
952 Ga0495584_0174772 3300046491 Bacteria 1091
953 Ga0495584_0301353 3300046491 Bacteria 814
954 Ga0495594_0082316 3300046499 Bacteria 1798
955 Ga0495596_0034772 3300046500 Bacteria 1999
956 Ga0495596_0070800 3300046500 Bacteria 1355
957 Ga0495583_0086904 3300046506 Bacteria 1352
958 Ga0495616_0223921 3300046513 Bacteria 818
959 Ga0495616_0437582 3300046513 Bacteria 532
960 Ga0495630_0260893 3300046517 Bacteria 1324
961 Ga0495630_0261192 3300046517 Unclassified 1323
962 Ga0495631_0198752 3300046518 Bacteria 857
963 Ga0495631_0403611 3300046518 Bacteria 582
964 Ga0495644_0091022 3300046523 Bacteria 1151
965 Ga0495663_0016372 3300046525 Bacteria 2096
966 Ga0495663_0059385 3300046525 Bacteria 1200
967 Ga0495642_0030214 3300046528 Bacteria 2167
968 Ga0495642_0064211 3300046528 Bacteria 1527
969 Ga0495642_0126222 3300046528 Unclassified 1100
970 Ga0495652_0155334 3300046529 Bacteria 1782
971 Ga0495652_0343358 3300046529 Unclassified 1072
972 Ga0495652_0552240 3300046529 Bacteria 792
973 Ga0495665_0084689 3300046531 Bacteria 1666
974 Ga0495640_0269196 3300046533 Unclassified 1063
975 Ga0495586_0468048 3300046535 Bacteria 727
976 Ga0495609_0032652 3300046538 Bacteria 2364
977 Ga0495609_0302068 3300046538 Bacteria 652
978 Ga0495609_0353934 3300046538 Bacteria 592
979 Ga0495667_0056141 3300046559 Bacteria 2590
980 Ga0495667_0097742 3300046559 Bacteria 1901
981 Ga0495667_0166932 3300046559 Bacteria 1415
982 Ga0495656_0067050 3300046615 Bacteria 1583
983 Ga0495656_0196354 3300046615 Bacteria 999
984 Ga0495668_0078305 3300046616 Bacteria 1815
985 Ga0495634_0017483 3300046642 Bacteria 5116
986 Ga0495634_0637102 3300046642 Bacteria 616
987 Ga0495635_0033730 3300046663 Bacteria 3551
988 Ga0495635_0049127 3300046663 Bacteria 2908
989 Ga0495659_0023271 3300046664 Bacteria 2104
990 Ga0495659_0335046 3300046664 Unclassified 644
991 Ga0495661_0082811 3300046665 Bacteria 1846
992 Ga0495588_0115700 3300046674 Unclassified 1413
993 Ga0495588_0247087 3300046674 Bacteria 941
994 Ga0495588_0308964 3300046674 Bacteria 832
995 Ga0495657_0540419 3300046675 Bacteria 677
996 Ga0495658_0047786 3300046683 Bacteria 2411
997 Ga0495669_0549598 3300046684 Bacteria 562
998 Ga0495669_0580753 3300046684 Bacteria 545
999 Ga0495613_0072324 3300046689 Bacteria 2513
1000 Ga0495613_0123142 3300046689 Bacteria 1861
1001 Ga0495613_0144829 3300046689 Bacteria 1696
1002 Ga0495613_0300737 3300046689 Unclassified 1111
1003 Ga0495613_0720147 3300046689 Bacteria 656
1004 Ga0495624_0487179 3300046690 Archaea 738
1005 Ga0495624_0542786 3300046690 Bacteria 694
1006 Ga0495624_0549455 3300046690 Unclassified 690
1007 Ga0495670_0082737 3300046691 Bacteria 1637
1008 Ga0495670_0275366 3300046691 Bacteria 900
1009 Ga0495671_0616589 3300046692 Bacteria 516
1010 Ga0495589_0075744 3300046794 Bacteria 1641
1011 Ga0495589_0080496 3300046794 Bacteria 1585
1012 Ga0495589_0256080 3300046794 Bacteria 817
1013 Ga0495660_0173154 3300046810 Bacteria 1050
1014 Ga0495581_0000815 3300047315 Bacteria 16569
1015 Ga0495581_0024868 3300047315 Bacteria 3469
1016 Ga0495581_0099421 3300047315 Bacteria 1690
1017 Ga0495636_0251784 3300047318 Bacteria 817
1018 Ga0495674_0130458 3300047319 Bacteria 2118
1019 Ga0495676_0066392 3300047321 Bacteria 2796
1020 Ga0495676_0071849 3300047321 Bacteria 2659
1021 Ga0495676_0241654 3300047321 Bacteria 1236
1022 Ga0495680_0021040 3300047322 Bacteria 5467
1023 Ga0495680_0161405 3300047322 Bacteria 1627
1024 Ga0495677_0248699 3300047445 Bacteria 695
1025 Ga0495679_196837 3300047446 Bacteria 531
1026 Ga0495684_0102161 3300047471 Bacteria 2167
1027 Ga0495684_0224957 3300047471 Bacteria 1374
1028 Ga0495593_0050015 3300047673 Bacteria 2216
1029 Ga0495593_0511177 3300047673 Bacteria 602
1030 Ga0495614_0195795 3300048089 Bacteria 913
1031 Ga0496100_0007110 3300048903 Bacteria 6146
1032 Ga0496100_0104499 3300048903 Bacteria 1957
1033 Ga0496100_0545393 3300048903 Bacteria 897
1034 Ga0496100_0560665 3300048903 Bacteria 884
1035 Ga0496100_0759502 3300048903 Bacteria 758
1036 Ga0496100_0940393 3300048903 Unclassified 679
1037 Ga0496100_1162324 3300048903 Unclassified 608
1038 Ga0496100_1255881 3300048903 Unclassified 584
1039 Ga0496101_0005857 3300048904 Bacteria 7867
1040 Ga0496101_0013613 3300048904 Bacteria 5455
1041 Ga0496101_0185344 3300048904 Bacteria 1604
1042 Ga0496101_0431834 3300048904 Bacteria 1038
1043 Ga0496101_0806664 3300048904 Unclassified 740
1044 Ga0496101_0868490 3300048904 Bacteria 711
1045 Ga0496101_1025768 3300048904 Bacteria 648
1046 Ga0496101_1068342 3300048904 Unclassified 634
1047 Ga0496101_1250247 3300048904 Bacteria 581
1048 Ga0496102_0001216 3300048905 Bacteria 23348
1049 Ga0496102_0018474 3300048905 Bacteria 6128
1050 Ga0496102_0039943 3300048905 Bacteria 4242
1051 Ga0496102_0055637 3300048905 Bacteria 3607
1052 Ga0496102_0712053 3300048905 Bacteria 927
1053 Ga0496102_0832623 3300048905 Bacteria 845
1054 Ga0496102_1836761 3300048905 Bacteria 523
1055 Ga0496102_1873517 3300048905 Bacteria 516
1056 Ga0496103_0000709 3300048906 Bacteria 24669
1057 Ga0496103_0002863 3300048906 Bacteria 10729
1058 Ga0496103_0009008 3300048906 Bacteria 5912
1059 Ga0496103_0148406 3300048906 Bacteria 1501
1060 Ga0496103_0422893 3300048906 Bacteria 855
1061 Ga0496104_0003038 3300048907 Bacteria 14448
1062 Ga0496104_0028939 3300048907 Bacteria 5137
1063 Ga0496104_0034322 3300048907 Unclassified 4730
1064 Ga0496104_0077140 3300048907 Bacteria 3174
1065 Ga0496104_0173013 3300048907 Bacteria 2070
1066 Ga0496104_0284137 3300048907 Bacteria 1567
1067 Ga0496105_0001193 3300048908 Bacteria 18081
1068 Ga0496105_0015049 3300048908 Bacteria 6156
1069 Ga0496105_0015103 3300048908 Bacteria 6146
1070 Ga0496105_0029430 3300048908 Bacteria 4495
1071 Ga0496105_0053606 3300048908 Bacteria 3330
1072 Ga0496105_0341599 3300048908 Unclassified 1197
1073 Ga0496105_0610785 3300048908 Bacteria 845
1074 Ga0496106_0008920 3300048909 Bacteria 7414
1075 Ga0496106_0062713 3300048909 Bacteria 2823
1076 Ga0496106_0065489 3300048909 Bacteria 2766
1077 Ga0496106_0163329 3300048909 Bacteria 1762
1078 Ga0496106_0191934 3300048909 Bacteria 1624
1079 Ga0496106_0348740 3300048909 Bacteria 1189
1080 Ga0496106_0358788 3300048909 Unclassified 1171
1081 Ga0496106_0928906 3300048909 Bacteria 686
1082 Ga0496106_1032390 3300048909 Bacteria 646
1083 Ga0496106_1315032 3300048909 Bacteria 561
1084 Ga0496107_0003225 3300048910 Bacteria 10858
1085 Ga0496107_0031191 3300048910 Bacteria 3801
1086 Ga0496107_0114044 3300048910 Bacteria 1988
1087 Ga0496107_0121990 3300048910 Bacteria 1920
1088 Ga0496107_0123867 3300048910 Bacteria 1905
1089 Ga0496107_0211250 3300048910 Bacteria 1443
1090 Ga0496107_0610303 3300048910 Bacteria 806
1091 Ga0496107_0769929 3300048910 Bacteria 706
1092 Ga0496108_0005258 3300048911 Bacteria 10455
1093 Ga0496108_0009378 3300048911 Bacteria 7924
1094 Ga0496108_0028460 3300048911 Bacteria 4624
1095 Ga0496108_0049964 3300048911 Bacteria 3499
1096 Ga0496108_0067854 3300048911 Bacteria 3008
1097 Ga0496108_0115064 3300048911 Bacteria 2303
1098 Ga0496108_0149778 3300048911 Bacteria 2013
1099 Ga0496108_0193236 3300048911 Bacteria 1764
1100 Ga0496108_0198914 3300048911 Bacteria 1739
1101 Ga0496108_0377813 3300048911 Bacteria 1237
1102 Ga0496108_0431233 3300048911 Bacteria 1151
1103 Ga0496108_0574316 3300048911 Bacteria 983
1104 Ga0496108_0910159 3300048911 Bacteria 755
1105 Ga0496109_0000533 3300048912 Bacteria 32234
1106 Ga0496109_0004031 3300048912 Bacteria 12269
1107 Ga0496109_0057472 3300048912 Bacteria 3551
1108 Ga0496109_0077744 3300048912 Bacteria 3054
1109 Ga0496109_0138267 3300048912 Bacteria 2277
1110 Ga0496109_0179949 3300048912 Bacteria 1985
1111 Ga0496109_0195256 3300048912 Bacteria 1902
1112 Ga0496109_0215528 3300048912 Bacteria 1805
1113 Ga0496109_0233044 3300048912 Bacteria 1732
1114 Ga0496109_0301791 3300048912 Bacteria 1510
1115 Ga0496109_0495362 3300048912 Bacteria 1153
1116 Ga0496109_0510463 3300048912 Bacteria 1135
1117 Ga0496109_0610129 3300048912 Bacteria 1027
1118 Ga0496109_1258264 3300048912 Bacteria 676
1119 Ga0496110_0028591 3300048913 Bacteria 4790
1120 Ga0496110_0041901 3300048913 Bacteria 3996
1121 Ga0496110_0051862 3300048913 Bacteria 3605
1122 Ga0496110_0108726 3300048913 Bacteria 2490
1123 Ga0496110_0112745 3300048913 Bacteria 2445
1124 Ga0496110_0194078 3300048913 Bacteria 1844
1125 Ga0496110_0249659 3300048913 Bacteria 1615
1126 Ga0496110_0389351 3300048913 Bacteria 1270
1127 Ga0496110_0393406 3300048913 Bacteria 1263
1128 Ga0496110_0400138 3300048913 Bacteria 1252
1129 Ga0496110_0426227 3300048913 Bacteria 1209
1130 Ga0496110_0514004 3300048913 Bacteria 1090
1131 Ga0496110_0697644 3300048913 Unclassified 916
1132 Ga0496110_0881771 3300048913 Bacteria 800
1133 Ga0496110_0922852 3300048913 Bacteria 779
1134 Ga0496111_0011785 3300048914 Bacteria 5903
1135 Ga0496111_0023057 3300048914 Bacteria 4366
1136 Ga0496111_0025216 3300048914 Bacteria 4194
1137 Ga0496111_0068678 3300048914 Bacteria 2576
1138 Ga0496111_0116434 3300048914 Bacteria 1971
1139 Ga0496111_0334932 3300048914 Bacteria 1120
1140 Ga0496111_0451468 3300048914 Bacteria 948
1141 Ga0496111_0513683 3300048914 Bacteria 881
1142 Ga0496111_1103742 3300048914 Bacteria 565
1143 Ga0496112_0001663 3300048915 Bacteria 17282
1144 Ga0496112_0019921 3300048915 Bacteria 6348
1145 Ga0496112_0085148 3300048915 Bacteria 3128
1146 Ga0496112_0164303 3300048915 Bacteria 2186
1147 Ga0496112_0230522 3300048915 Bacteria 1806
1148 Ga0496112_0577637 3300048915 Bacteria 1057
1149 Ga0496112_0716751 3300048915 Bacteria 928
1150 Ga0496112_0998323 3300048915 Bacteria 757
1151 Ga0496113_0069858 3300048916 Bacteria 2668
1152 Ga0496113_0104684 3300048916 Bacteria 2196
1153 Ga0496113_0173872 3300048916 Bacteria 1706
1154 Ga0496113_0197068 3300048916 Bacteria 1600
1155 Ga0496113_0726978 3300048916 Bacteria 791
1156 Ga0496113_0786953 3300048916 Bacteria 756
1157 Ga0496113_1140724 3300048916 Bacteria 610
1158 Ga0496113_1197263 3300048916 Bacteria 593
1159 Ga0496114_0012037 3300048917 Bacteria 6920
1160 Ga0496114_0013918 3300048917 Bacteria 6450
1161 Ga0496114_0066173 3300048917 Bacteria 3029
1162 Ga0496114_0067177 3300048917 Bacteria 3007
1163 Ga0496114_0399995 3300048917 Bacteria 1216
1164 Ga0496114_0478603 3300048917 Bacteria 1101
1165 Ga0496114_0490923 3300048917 Bacteria 1086
1166 Ga0496114_0998194 3300048917 Bacteria 720
1167 Ga0496114_1715519 3300048917 Unclassified 516
1168 Ga0496115_0000825 3300048918 Bacteria 22720
1169 Ga0496115_0083885 3300048918 Bacteria 2597
1170 Ga0496115_0160807 3300048918 Bacteria 1855
1171 Ga0496115_0191882 3300048918 Bacteria 1688
1172 Ga0496115_0221916 3300048918 Bacteria 1560
1173 Ga0496115_0298598 3300048918 Unclassified 1320
1174 Ga0496115_0510661 3300048918 Bacteria 965
1175 Ga0501031_0003668 3300049568 Bacteria 9881
1176 Ga0501031_0023299 3300049568 Bacteria 4037
1177 Ga0501031_0255214 3300049568 Unclassified 1139
1178 Ga0501031_0388328 3300049568 Bacteria 903
1179 Ga0501031_0777790 3300049568 Bacteria 614
1180 Ga0501032_0067586 3300049569 Bacteria 2387
1181 Ga0501032_0173465 3300049569 Bacteria 1413
1182 Ga0501032_0755398 3300049569 Bacteria 615
1183 Ga0501033_0008760 3300049570 Bacteria 7821
1184 Ga0501033_0020560 3300049570 Bacteria 4988
1185 Ga0501034_0204331 3300049571 Bacteria 1932
1186 Ga0501034_0313754 3300049571 Bacteria 1502
1187 Ga0501034_0489558 3300049571 Bacteria 1144
1188 Ga0501036_0004682 3300049572 Bacteria 11048
1189 Ga0501036_0012175 3300049572 Bacteria 7125
1190 Ga0501036_0249966 3300049572 Bacteria 1486
1191 Ga0501036_0290584 3300049572 Bacteria 1368
1192 Ga0501037_0016483 3300049573 Bacteria 5439
1193 Ga0501037_0546047 3300049573 Bacteria 782
1194 Ga0501037_0879299 3300049573 Unclassified 588
1195 Ga0501038_0028547 3300049574 Bacteria 4956
1196 Ga0501038_0043430 3300049574 Bacteria 3908
1197 Ga0501038_0094451 3300049574 Bacteria 2500
1198 Ga0501038_0229671 3300049574 Bacteria 1477
1199 Ga0501038_0773725 3300049574 Bacteria 715
1200 Ga0501039_0005475 3300049575 Bacteria 9605
1201 Ga0501039_0087912 3300049575 Bacteria 2421
1202 Ga0501040_0062753 3300049576 Bacteria 2556
1203 Ga0501040_0116265 3300049576 Bacteria 1873
1204 Ga0501040_0270809 3300049576 Bacteria 1212
1205 Ga0501040_0516588 3300049576 Bacteria 861
1206 Ga0501040_0608604 3300049576 Bacteria 789
1207 Ga0501041_0285222 3300049577 Bacteria 1039
1208 Ga0501042_0004174 3300049578 Bacteria 9182
1209 Ga0501042_0400622 3300049578 Bacteria 994
1210 Ga0501042_0531251 3300049578 Unclassified 855
1211 Ga0501042_0554256 3300049578 Unclassified 835
1212 Ga0501042_1414901 3300049578 Bacteria 507
1213 Ga0501043_0009672 3300049579 Bacteria 7557
1214 Ga0501043_0278632 3300049579 Bacteria 1282
1215 Ga0501046_0030209 3300049580 Bacteria 4399
1216 Ga0501046_0030605 3300049580 Bacteria 4367
1217 Ga0501046_0655076 3300049580 Unclassified 742
1218 Ga0501047_1239987 3300049581 Bacteria 559
1219 Ga0501048_0001065 3300049582 Bacteria 20549
1220 Ga0501048_0036518 3300049582 Bacteria 3531
1221 Ga0501048_0557929 3300049582 Bacteria 822
1222 Ga0501048_0638955 3300049582 Bacteria 764
1223 Ga0501048_1107077 3300049582 Bacteria 570
1224 Ga0501067_0129846 3300049583 Bacteria 1402
1225 Ga0501068_0152090 3300049584 Bacteria 1455
1226 Ga0501068_0324915 3300049584 Bacteria 986
1227 Ga0501068_0411074 3300049584 Unclassified 873
1228 Ga0501068_0828180 3300049584 Unclassified 607
1229 Ga0501069_0006041 3300049585 Bacteria 6321
1230 Ga0501069_0010100 3300049585 Bacteria 4993
1231 Ga0501069_0042030 3300049585 Bacteria 2528
1232 Ga0501069_0050968 3300049585 Bacteria 2303
1233 Ga0501069_0280448 3300049585 Bacteria 975
1234 Ga0501070_0002312 3300049586 Bacteria 16724
1235 Ga0501070_0042585 3300049586 Bacteria 3782
1236 Ga0501070_0189033 3300049586 Bacteria 1693
1237 Ga0501070_1091936 3300049586 Bacteria 616
1238 Ga0501071_0026831 3300049587 Bacteria 4047
1239 Ga0501071_0038822 3300049587 Bacteria 3403
1240 Ga0501071_0125126 3300049587 Bacteria 1907
1241 Ga0501071_0311983 3300049587 Bacteria 1193
1242 Ga0501071_0400128 3300049587 Bacteria 1048
1243 Ga0501071_1129309 3300049587 Bacteria 605
1244 Ga0501072_0026780 3300049588 Bacteria 4497
1245 Ga0501072_0031320 3300049588 Bacteria 4162
1246 Ga0501072_0091769 3300049588 Bacteria 2411
1247 Ga0501072_0116621 3300049588 Bacteria 2127
1248 Ga0501072_0191970 3300049588 Bacteria 1629
1249 Ga0501072_0341212 3300049588 Bacteria 1190
1250 Ga0501072_0349265 3300049588 Bacteria 1174
1251 Ga0501072_0447845 3300049588 Unclassified 1023
1252 Ga0501073_0024570 3300049589 Bacteria 4326
1253 Ga0501073_0166950 3300049589 Bacteria 1524
1254 Ga0501073_0387506 3300049589 Bacteria 965
1255 Ga0501074_0002914 3300049590 Bacteria 12012
1256 Ga0501074_0010330 3300049590 Bacteria 6772
1257 Ga0501074_0223282 3300049590 Bacteria 1341
1258 Ga0501074_0527677 3300049590 Bacteria 836
1259 Ga0501075_0001970 3300049591 Bacteria 13550
1260 Ga0501075_0078782 3300049591 Bacteria 2494
1261 Ga0501075_0179517 3300049591 Bacteria 1615
1262 Ga0501075_0202897 3300049591 Bacteria 1512
1263 Ga0501075_0521444 3300049591 Bacteria 907
1264 Ga0501075_1421471 3300049591 Bacteria 525
1265 Ga0501076_0033353 3300049592 Bacteria 4019
1266 Ga0501076_0152493 3300049592 Bacteria 1880
1267 Ga0501076_0198057 3300049592 Bacteria 1640
1268 Ga0501076_0397219 3300049592 Unclassified 1134
1269 Ga0501076_1063426 3300049592 Bacteria 666
1270 Ga0501077_0001392 3300049593 Bacteria 14564
1271 Ga0501077_0021877 3300049593 Bacteria 4048
1272 Ga0501077_0029897 3300049593 Bacteria 3465
1273 Ga0501077_0364865 3300049593 Unclassified 922
1274 Ga0501077_0812515 3300049593 Bacteria 601
1275 Ga0501079_0014430 3300049741 Bacteria 6023
1276 Ga0501079_0040024 3300049741 Bacteria 3616
1277 Ga0501079_0105914 3300049741 Bacteria 2182
1278 Ga0501079_0120689 3300049741 Bacteria 2038
1279 Ga0501079_0288397 3300049741 Bacteria 1283
1280 Ga0501079_0548029 3300049741 Bacteria 909
1281 Ga0501079_0602552 3300049741 Bacteria 864
1282 Ga0501079_0804629 3300049741 Bacteria 740
1283 Ga0501080_0013819 3300049742 Bacteria 7433
1284 Ga0501080_0031642 3300049742 Bacteria 4930
1285 Ga0501080_0642827 3300049742 Bacteria 939
1286 Ga0501080_1182316 3300049742 Bacteria 658
1287 Ga0501080_1403301 3300049742 Unclassified 596
1288 Ga0501081_0015196 3300049743 Bacteria 5078
1289 Ga0501081_0048445 3300049743 Bacteria 2924
1290 Ga0501081_0049214 3300049743 Bacteria 2902
1291 Ga0501081_0076557 3300049743 Bacteria 2337
1292 Ga0501081_0076587 3300049743 Bacteria 2336
1293 Ga0501081_0500717 3300049743 Unclassified 905
1294 Ga0501081_0771382 3300049743 Bacteria 723
1295 Ga0501083_0032509 3300049744 Bacteria 3577
1296 Ga0501083_0100326 3300049744 Bacteria 1909
1297 Ga0501035_0004073 3300049822 Bacteria 13903
1298 Ga0501035_0037804 3300049822 Bacteria 4369
1299 Ga0501044_0264982 3300049823 Bacteria 1656
1300 Ga0501045_0012901 3300049824 Bacteria 5890
1301 Ga0501045_0022550 3300049824 Bacteria 4509
1302 Ga0501045_0241394 3300049824 Bacteria 1345
1303 Ga0501045_0258112 3300049824 Bacteria 1297
1304 Ga0501045_0842476 3300049824 Bacteria 675
1305 Ga0501045_0984534 3300049824 Bacteria 618
1306 nmdc:mga03n38_253063_c1 3300050490 Bacteria 931
1307 nmdc:mga00v17_22035_c1 3300050491 Bacteria 3672
1308 nmdc:mga0yw44_22599_c1 3300050492 Bacteria 3529
1309 nmdc:mga05p37_1034212_c1 3300050507 Unclassified 868
1310 nmdc:mga05p37_181660_c1 3300050507 Unclassified 2559
1311 nmdc:mga05p37_22079_c1 3300050507 Bacteria 7713
1312 nmdc:mga05p37_2214_c1 3300050507 Bacteria 22643
1313 nmdc:mga05p37_329018_c1 3300050507 Bacteria 1806
1314 nmdc:mga05p37_41821_c1 3300050507 Bacteria 5628
1315 nmdc:mga05p37_452113_c1 3300050507 Unclassified 1486
1316 nmdc:mga05p37_496671_c1 3300050507 Bacteria 1402
1317 nmdc:mga05p37_783995_c1 3300050507 Bacteria 1045
1318 nmdc:mga05p37_91749_c1 3300050507 Bacteria 3743
1319 nmdc:mga09592_103199_c1 3300050508 Bacteria 2443
1320 nmdc:mga09592_254711_c1 3300050508 Bacteria 1521
1321 nmdc:mga09592_304137_c1 3300050508 Bacteria 1382
1322 nmdc:mga0qj67_580112_c1 3300050509 Bacteria 898
1323 nmdc:mga0qj67_705293_c1 3300050509 Bacteria 802
1324 nmdc:mga06r32_101263_c1 3300050510 Bacteria 2827
1325 nmdc:mga06r32_1481454_c1 3300050510 Bacteria 619
1326 nmdc:mga06r32_157216_c1 3300050510 Bacteria 2255
1327 nmdc:mga08y16_1074249_c1 3300050511 Archaea 781
1328 nmdc:mga08y16_1499174_c1 3300050511 Bacteria 635
1329 nmdc:mga08y16_1835783_c1 3300050511 Bacteria 558
1330 nmdc:mga08y16_193359_c1 3300050511 Bacteria 2110
1331 nmdc:mga08y16_22993_c1 3300050511 Bacteria 6580
1332 nmdc:mga08y16_624845_c1 3300050511 Unclassified 1084
1333 nmdc:mga08y16_86653_c1 3300050511 Bacteria 3264
1334 nmdc:mga0n895_1327768_c1 3300050512 Bacteria 689
1335 nmdc:mga0n895_7675_c1 3300050512 Bacteria 9277
1336 nmdc:mga0rr50_11564_c1 3300050513 Bacteria 5656
1337 nmdc:mga0rr50_146141_c1 3300050513 Bacteria 1907
1338 nmdc:mga0rr50_1502412_c1 3300050513 Unclassified 569
1339 nmdc:mga08x19_588129_c1 3300050514 Bacteria 788
1340 nmdc:mga08x19_75787_c1 3300050514 Bacteria 2200
1341 nmdc:mga0a205_1181332_c1 3300050515 Bacteria 613
1342 nmdc:mga0a205_45194_c1 3300050515 Bacteria 4246
1343 nmdc:mga0a205_6767_c1 3300050515 Bacteria 10367
1344 nmdc:mga0a205_839073_c1 3300050515 Bacteria 766
1345 Ga0495601_0298950 3300053077 Bacteria 1049
1346 Ga0495612_0004034 3300053078 Bacteria 6082
1347 Ga0495655_0151345 3300053083 Unclassified 730
1348 Ga0495595_0298899 3300053084 Bacteria 810
1349 Ga0495619_0045013 3300053085 Bacteria 2898
1350 Ga0495619_0218158 3300053085 Bacteria 1321
1351 Ga0495619_0389709 3300053085 Bacteria 963
1352 Ga0501084_0008860 3300054114 Bacteria 8327
1353 Ga0501084_0019282 3300054114 Bacteria 5681
1354 Ga0501084_0062245 3300054114 Bacteria 3123
1355 Ga0501084_0910798 3300054114 Unclassified 739
1356 Ga0587076_075782 3300059645 Bacteria 708
1357 Ga0587107_127080 3300059652 Unclassified 532
1358 Ga0501082_0144147 3300060353 Bacteria 2067
1359 Ga0501082_0193382 3300060353 Bacteria 1769
1360 Ga0501082_0254962 3300060353 Bacteria 1526
1361 Ga0501082_0269290 3300060353 Unclassified 1482
1362 Ga0501082_0497397 3300060353 Bacteria 1066
1363 Ga0501082_0793315 3300060353 Bacteria 828
1364 Ga0501082_1842793 3300060353 Bacteria 528
1365 Ga0530510_0008183 3300061734 Bacteria 7294
1366 Ga0530510_0063356 3300061734 Bacteria 2677
1367 Ga0530510_0181132 3300061734 Bacteria 1562
1368 Ga0530510_0198191 3300061734 Bacteria 1491
1369 Ga0530510_0238376 3300061734 Bacteria 1354
1370 Ga0530510_0900785 3300061734 Unclassified 676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100687352 Ga0307408_1006873522 101
2 3300031911 Ga0307412_11574126 Ga0307412_115741261 101
3 3300032002 Ga0307416_100330182 Ga0307416_1003301823 101
4 3300005467 Ga0070706_100798104 Ga0070706_1007981042 111
5 3300045051 Ga0451576_2155685 Ga0451576_2155685_107_454 113
6 3300002077 JGI24744J21845_10001143 JGI24744J21845_100011435 114
7 3300002244 JGI24742J22300_10002102 JGI24742J22300_100021023 114
8 3300005329 Ga0070683_101175899 Ga0070683_1011758992 114
9 3300005330 Ga0070690_100054339 Ga0070690_1000543395 114
10 3300005336 Ga0070680_100028880 Ga0070680_1000288804 114
11 3300005337 Ga0070682_100011420 Ga0070682_1000114205 114
12 3300005339 Ga0070660_100113170 Ga0070660_1001131705 114
13 3300005340 Ga0070689_100003195 Ga0070689_1000031955 114
14 3300005345 Ga0070692_10004125 Ga0070692_100041256 114
15 3300005347 Ga0070668_100037411 Ga0070668_1000374114 114
16 3300005353 Ga0070669_100248324 Ga0070669_1002483243 114
17 3300005355 Ga0070671_100022042 Ga0070671_1000220425 114
18 3300005355 Ga0070671_101570822 Ga0070671_1015708222 114
19 3300005356 Ga0070674_100000543 Ga0070674_10000054316 114
20 3300005364 Ga0070673_100064639 Ga0070673_1000646394 114
21 3300005365 Ga0070688_100001134 Ga0070688_1000011348 114
22 3300005366 Ga0070659_100091995 Ga0070659_1000919953 114
23 3300005367 Ga0070667_100180014 Ga0070667_1001800143 114
24 3300005434 Ga0070709_10155644 Ga0070709_101556443 114
25 3300005435 Ga0070714_100527994 Ga0070714_1005279943 114
26 3300005437 Ga0070710_10006936 Ga0070710_100069365 114
27 3300005438 Ga0070701_10008762 Ga0070701_100087625 114
28 3300005439 Ga0070711_100005506 Ga0070711_1000055066 114
29 3300005440 Ga0070705_100081313 Ga0070705_1000813133 114
30 3300005441 Ga0070700_100008508 Ga0070700_1000085084 114
31 3300005455 Ga0070663_100025748 Ga0070663_1000257485 114
32 3300005456 Ga0070678_100013319 Ga0070678_1000133196 114
33 3300005457 Ga0070662_100133636 Ga0070662_1001336363 114
34 3300005458 Ga0070681_10273401 Ga0070681_102734012 114
35 3300005459 Ga0068867_100000290 Ga0068867_10000029029 114
36 3300005466 Ga0070685_10033304 Ga0070685_100333045 114
37 3300005468 Ga0070707_100666946 Ga0070707_1006669463 114
38 3300005539 Ga0068853_100011239 Ga0068853_1000112395 114
39 3300005543 Ga0070672_101117092 Ga0070672_1011170922 114
40 3300005544 Ga0070686_100002931 Ga0070686_1000029318 114
41 3300005545 Ga0070695_100093669 Ga0070695_1000936693 114
42 3300005546 Ga0070696_100002162 Ga0070696_1000021625 114
43 3300005546 Ga0070696_100230061 Ga0070696_1002300612 114
44 3300005549 Ga0070704_100040005 Ga0070704_1000400055 114
45 3300005563 Ga0068855_100141727 Ga0068855_1001417273 114
46 3300005614 Ga0068856_100076171 Ga0068856_1000761714 114
47 3300005616 Ga0068852_100037616 Ga0068852_1000376165 114
48 3300005718 Ga0068866_10000154 Ga0068866_1000015428 114
49 3300005719 Ga0068861_100010755 Ga0068861_1000107553 114
50 3300005841 Ga0068863_101028274 Ga0068863_1010282742 114
51 3300005842 Ga0068858_100190276 Ga0068858_1001902763 114
52 3300005843 Ga0068860_100145459 Ga0068860_1001454592 114
53 3300006175 Ga0070712_100029034 Ga0070712_1000290344 114
54 3300006237 Ga0097621_100076399 Ga0097621_1000763995 114
55 3300006358 Ga0068871_100004124 Ga0068871_1000041245 114
56 3300006871 Ga0075434_102076474 Ga0075434_1020764742 114
57 3300006881 Ga0068865_100000501 Ga0068865_10000050119 114
58 3300009098 Ga0105245_11650673 Ga0105245_116506731 114
59 3300013105 Ga0157369_10680052 Ga0157369_106800522 114
60 3300013296 Ga0157374_11664555 Ga0157374_116645552 114
61 3300013307 Ga0157372_10540436 Ga0157372_105404363 114
62 3300017792 Ga0163161_10043385 Ga0163161_100433853 114
63 3300025885 Ga0207653_10006929 Ga0207653_100069295 114
64 3300025898 Ga0207692_10005239 Ga0207692_100052395 114
65 3300025899 Ga0207642_10000121 Ga0207642_1000012119 114
66 3300025901 Ga0207688_10035032 Ga0207688_100350325 114
67 3300025904 Ga0207647_10141020 Ga0207647_101410202 114
68 3300025911 Ga0207654_10079295 Ga0207654_100792955 114
69 3300025912 Ga0207707_10216185 Ga0207707_102161852 114
70 3300025915 Ga0207693_10000499 Ga0207693_1000049934 114
71 3300025916 Ga0207663_10006965 Ga0207663_100069654 114
72 3300025919 Ga0207657_10040844 Ga0207657_100408445 114
73 3300025927 Ga0207687_10008259 Ga0207687_100082596 114
74 3300025929 Ga0207664_10499241 Ga0207664_104992412 114
75 3300025931 Ga0207644_10041470 Ga0207644_100414705 114
76 3300025932 Ga0207690_10078519 Ga0207690_100785193 114
77 3300025933 Ga0207706_10095842 Ga0207706_100958425 114
78 3300025933 Ga0207706_11213399 Ga0207706_112133991 114
79 3300025934 Ga0207686_10007426 Ga0207686_100074265 114
80 3300025935 Ga0207709_10000781 Ga0207709_1000078122 114
81 3300025937 Ga0207669_10027179 Ga0207669_100271793 114
82 3300025938 Ga0207704_10001528 Ga0207704_100015289 114
83 3300025941 Ga0207711_10045931 Ga0207711_100459315 114
84 3300025949 Ga0207667_10079631 Ga0207667_100796315 114
85 3300025961 Ga0207712_10004576 Ga0207712_100045765 114
86 3300025972 Ga0207668_10003765 Ga0207668_100037656 114
87 3300026023 Ga0207677_10008583 Ga0207677_100085835 114
88 3300026041 Ga0207639_10008584 Ga0207639_100085846 114
89 3300026067 Ga0207678_10047645 Ga0207678_100476455 114
90 3300026075 Ga0207708_10001823 Ga0207708_100018235 114
91 3300026078 Ga0207702_10084913 Ga0207702_100849135 114
92 3300026089 Ga0207648_10002767 Ga0207648_1000276718 114
93 3300026118 Ga0207675_100080907 Ga0207675_1000809073 114
94 3300026121 Ga0207683_10001565 Ga0207683_100015655 114
95 3300026142 Ga0207698_11045938 Ga0207698_110459382 114
96 3300028381 Ga0268264_10064057 Ga0268264_100640575 114
97 3300035725 Ga0373947_0100166 Ga0373947_0100166_699_1043 114
98 3300037312 Ga0395899_0004452 Ga0395899_0004452_7896_8240 114
99 3300037312 Ga0395899_0095731 Ga0395899_0095731_1073_1417 114
100 3300037312 Ga0395899_0273881 Ga0395899_0273881_441_785 114
101 3300037418 Ga0395900_0005149 Ga0395900_0005149_3861_4205 114
102 3300037418 Ga0395900_0351489 Ga0395900_0351489_283_627 114
103 3300037418 Ga0395900_0605758 Ga0395900_0605758_77_421 114
104 3300037466 Ga0395898_0012306 Ga0395898_0012306_4996_5340 114
105 3300037466 Ga0395898_0275884 Ga0395898_0275884_448_792 114
106 3300037466 Ga0395898_1126301 Ga0395898_1126301_298_642 114
107 3300037471 Ga0395905_0005427 Ga0395905_0005427_3392_3736 114
108 3300037471 Ga0395905_0078229 Ga0395905_0078229_1524_1868 114
109 3300037471 Ga0395905_0184513 Ga0395905_0184513_1000_1344 114
110 3300038443 Ga0395901_0005172 Ga0395901_0005172_9878_10222 114
111 3300038443 Ga0395901_0185212 Ga0395901_0185212_842_1186 114
112 3300046455 Ga0495603_0027012 Ga0495603_0027012_2733_3077 114
113 3300046459 Ga0495629_0700797 Ga0495629_0700797_215_559 114
114 3300046461 Ga0495641_0069757 Ga0495641_0069757_571_915 114
115 3300046461 Ga0495641_0516825 Ga0495641_0516825_77_433 114
116 3300046473 Ga0495582_0183516 Ga0495582_0183516_798_1142 114
117 3300046475 Ga0495639_0034969 Ga0495639_0034969_607_951 114
118 3300046476 Ga0495662_0198546 Ga0495662_0198546_396_740 114
119 3300046491 Ga0495584_0133619 Ga0495584_0133619_345_689 114
120 3300046499 Ga0495594_0082316 Ga0495594_0082316_1056_1400 114
121 3300046528 Ga0495642_0126222 Ga0495642_0126222_582_926 114
122 3300046531 Ga0495665_0084689 Ga0495665_0084689_482_826 114
123 3300046674 Ga0495588_0115700 Ga0495588_0115700_288_632 114
124 3300046683 Ga0495658_0047786 Ga0495658_0047786_1260_1604 114
125 3300046689 Ga0495613_0300737 Ga0495613_0300737_98_442 114
126 3300046689 Ga0495613_0720147 Ga0495613_0720147_89_433 114
127 3300046690 Ga0495624_0549455 Ga0495624_0549455_71_415 114
128 3300046794 Ga0495589_0075744 Ga0495589_0075744_112_456 114
129 3300047315 Ga0495581_0000815 Ga0495581_0000815_15708_16052 114
130 3300047315 Ga0495581_0024868 Ga0495581_0024868_556_900 114
131 3300047318 Ga0495636_0251784 Ga0495636_0251784_413_757 114
132 3300047321 Ga0495676_0066392 Ga0495676_0066392_649_993 114
133 3300047673 Ga0495593_0511177 Ga0495593_0511177_179_523 114
134 3300048089 Ga0495614_0195795 Ga0495614_0195795_307_651 114
135 3300048903 Ga0496100_0007110 Ga0496100_0007110_2323_2667 114
136 3300048903 Ga0496100_0560665 Ga0496100_0560665_15_359 114
137 3300048904 Ga0496101_0013613 Ga0496101_0013613_1303_1647 114
138 3300048905 Ga0496102_0001216 Ga0496102_0001216_14725_15069 114
139 3300048905 Ga0496102_0055637 Ga0496102_0055637_3204_3548 114
140 3300048905 Ga0496102_1836761 Ga0496102_1836761_164_508 114
141 3300048906 Ga0496103_0000709 Ga0496103_0000709_2323_2667 114
142 3300048906 Ga0496103_0009008 Ga0496103_0009008_442_786 114
143 3300048907 Ga0496104_0284137 Ga0496104_0284137_879_1223 114
144 3300048908 Ga0496105_0015049 Ga0496105_0015049_2022_2366 114
145 3300048909 Ga0496106_0008920 Ga0496106_0008920_3782_4126 114
146 3300048909 Ga0496106_0163329 Ga0496106_0163329_454_798 114
147 3300048910 Ga0496107_0003225 Ga0496107_0003225_3449_3793 114
148 3300048911 Ga0496108_0049964 Ga0496108_0049964_3008_3352 114
149 3300048911 Ga0496108_0115064 Ga0496108_0115064_1746_2090 114
150 3300048911 Ga0496108_0910159 Ga0496108_0910159_126_470 114
151 3300048912 Ga0496109_0138267 Ga0496109_0138267_97_441 114
152 3300048912 Ga0496109_0233044 Ga0496109_0233044_106_450 114
153 3300048912 Ga0496109_1258264 Ga0496109_1258264_38_382 114
154 3300048913 Ga0496110_0112745 Ga0496110_0112745_1604_1948 114
155 3300048913 Ga0496110_0514004 Ga0496110_0514004_493_837 114
156 3300048914 Ga0496111_0451468 Ga0496111_0451468_138_482 114
157 3300048914 Ga0496111_1103742 Ga0496111_1103742_148_492 114
158 3300048915 Ga0496112_0230522 Ga0496112_0230522_610_954 114
159 3300048916 Ga0496113_0173872 Ga0496113_0173872_1211_1555 114
160 3300048917 Ga0496114_0012037 Ga0496114_0012037_4110_4454 114
161 3300048918 Ga0496115_0000825 Ga0496115_0000825_3220_3564 114
162 3300050512 nmdc:mga0n895_1327768_c1 nmdc:mga0n895_1327768_c1_309_653 114
163 3300005333 Ga0070677_10385868 Ga0070677_103858681 115
164 3300005335 Ga0070666_10236931 Ga0070666_102369311 115
165 3300005340 Ga0070689_100274485 Ga0070689_1002744851 115
166 3300005366 Ga0070659_100178573 Ga0070659_1001785733 115
167 3300005434 Ga0070709_10034300 Ga0070709_100343004 115
168 3300005434 Ga0070709_10248479 Ga0070709_102484793 115
169 3300005436 Ga0070713_100124169 Ga0070713_1001241694 115
170 3300005436 Ga0070713_100128892 Ga0070713_1001288924 115
171 3300005436 Ga0070713_100524350 Ga0070713_1005243503 115
172 3300005440 Ga0070705_100085082 Ga0070705_1000850824 115
173 3300005444 Ga0070694_100145374 Ga0070694_1001453741 115
174 3300005445 Ga0070708_100727302 Ga0070708_1007273022 115
175 3300005456 Ga0070678_100003432 Ga0070678_1000034328 115
176 3300005467 Ga0070706_100197611 Ga0070706_1001976115 115
177 3300005468 Ga0070707_100031096 Ga0070707_1000310965 115
178 3300005468 Ga0070707_100337744 Ga0070707_1003377442 115
179 3300005471 Ga0070698_100103485 Ga0070698_1001034852 115
180 3300005518 Ga0070699_100032659 Ga0070699_1000326594 115
181 3300005536 Ga0070697_100140274 Ga0070697_1001402744 115
182 3300005536 Ga0070697_100275506 Ga0070697_1002755062 115
183 3300005545 Ga0070695_100365674 Ga0070695_1003656742 115
184 3300005546 Ga0070696_100282496 Ga0070696_1002824961 115
185 3300005547 Ga0070693_100011761 Ga0070693_1000117614 115
186 3300005549 Ga0070704_100038219 Ga0070704_1000382194 115
187 3300005563 Ga0068855_100074518 Ga0068855_1000745184 115
188 3300005563 Ga0068855_100279881 Ga0068855_1002798814 115
189 3300005614 Ga0068856_100561282 Ga0068856_1005612822 115
190 3300005615 Ga0070702_100012275 Ga0070702_1000122754 115
191 3300005719 Ga0068861_102382012 Ga0068861_1023820121 115
192 3300006028 Ga0070717_10062130 Ga0070717_100621304 115
193 3300006028 Ga0070717_10066567 Ga0070717_100665674 115
194 3300006038 Ga0075365_10081590 Ga0075365_100815901 115
195 3300006173 Ga0070716_100031802 Ga0070716_1000318024 115
196 3300006175 Ga0070712_100056883 Ga0070712_1000568834 115
197 3300006175 Ga0070712_100345180 Ga0070712_1003451802 115
198 3300006175 Ga0070712_100462255 Ga0070712_1004622552 115
199 3300006237 Ga0097621_100708147 Ga0097621_1007081473 115
200 3300006237 Ga0097621_101056789 Ga0097621_1010567892 115
201 3300006358 Ga0068871_100020207 Ga0068871_1000202073 115
202 3300006871 Ga0075434_100557236 Ga0075434_1005572362 115
203 3300006871 Ga0075434_100601432 Ga0075434_1006014322 115
204 3300006881 Ga0068865_100272849 Ga0068865_1002728492 115
205 3300007076 Ga0075435_100114458 Ga0075435_1001144585 115
206 3300007076 Ga0075435_100355678 Ga0075435_1003556782 115
207 3300009094 Ga0111539_10849147 Ga0111539_108491472 115
208 3300009094 Ga0111539_12297269 Ga0111539_122972692 115
209 3300009098 Ga0105245_10122355 Ga0105245_101223553 115
210 3300009098 Ga0105245_10582413 Ga0105245_105824132 115
211 3300009147 Ga0114129_10077312 Ga0114129_100773125 115
212 3300009147 Ga0114129_10235519 Ga0114129_102355195 115
213 3300009148 Ga0105243_10625464 Ga0105243_106254642 115
214 3300009148 Ga0105243_10774772 Ga0105243_107747721 115
215 3300010375 Ga0105239_10007498 Ga0105239_100074988 115
216 3300013296 Ga0157374_10224673 Ga0157374_102246732 115
217 3300013307 Ga0157372_10079449 Ga0157372_100794494 115
218 3300013308 Ga0157375_10203438 Ga0157375_102034381 115
219 3300013308 Ga0157375_12276285 Ga0157375_122762852 115
220 3300014497 Ga0182008_10240503 Ga0182008_102405032 115
221 3300014745 Ga0157377_10138404 Ga0157377_101384042 115
222 3300014745 Ga0157377_10344303 Ga0157377_103443033 115
223 3300017792 Ga0163161_10186232 Ga0163161_101862323 115
224 3300025893 Ga0207682_10438797 Ga0207682_104387972 115
225 3300025898 Ga0207692_10012702 Ga0207692_100127024 115
226 3300025906 Ga0207699_10005440 Ga0207699_100054404 115
227 3300025906 Ga0207699_11122427 Ga0207699_111224271 115
228 3300025911 Ga0207654_10093248 Ga0207654_100932484 115
229 3300025915 Ga0207693_10051202 Ga0207693_100512024 115
230 3300025915 Ga0207693_10224061 Ga0207693_102240613 115
231 3300025916 Ga0207663_10061314 Ga0207663_100613144 115
232 3300025917 Ga0207660_10129643 Ga0207660_101296432 115
233 3300025921 Ga0207652_10111373 Ga0207652_101113733 115
234 3300025921 Ga0207652_11228118 Ga0207652_112281182 115
235 3300025922 Ga0207646_10031346 Ga0207646_100313465 115
236 3300025926 Ga0207659_10904142 Ga0207659_109041422 115
237 3300025927 Ga0207687_11020486 Ga0207687_110204861 115
238 3300025928 Ga0207700_10029670 Ga0207700_100296703 115
239 3300025928 Ga0207700_10140576 Ga0207700_101405764 115
240 3300025928 Ga0207700_10291445 Ga0207700_102914453 115
241 3300025929 Ga0207664_10185285 Ga0207664_101852853 115
242 3300025929 Ga0207664_10455777 Ga0207664_104557772 115
243 3300025932 Ga0207690_10371145 Ga0207690_103711452 115
244 3300025935 Ga0207709_10135973 Ga0207709_101359732 115
245 3300025938 Ga0207704_10916754 Ga0207704_109167541 115
246 3300025939 Ga0207665_10013877 Ga0207665_100138774 115
247 3300025939 Ga0207665_11000958 Ga0207665_110009582 115
248 3300025941 Ga0207711_10381169 Ga0207711_103811691 115
249 3300025949 Ga0207667_10253034 Ga0207667_102530344 115
250 3300025949 Ga0207667_10494854 Ga0207667_104948543 115
251 3300025981 Ga0207640_10221847 Ga0207640_102218472 115
252 3300026023 Ga0207677_10109194 Ga0207677_101091943 115
253 3300026041 Ga0207639_12121827 Ga0207639_121218271 115
254 3300026067 Ga0207678_10103374 Ga0207678_101033742 115
255 3300026078 Ga0207702_12079474 Ga0207702_120794742 115
256 3300026121 Ga0207683_10024042 Ga0207683_100240424 115
257 3300026121 Ga0207683_10193681 Ga0207683_101936813 115
258 3300028381 Ga0268264_10172897 Ga0268264_101728972 115
259 3300035691 Ga0373931_0677139 Ga0373931_0677139_147_494 115
260 3300037312 Ga0395899_0059931 Ga0395899_0059931_453_800 115
261 3300037312 Ga0395899_0092699 Ga0395899_0092699_482_829 115
262 3300037312 Ga0395899_0354746 Ga0395899_0354746_67_414 115
263 3300037312 Ga0395899_0605495 Ga0395899_0605495_169_516 115
264 3300037418 Ga0395900_0028418 Ga0395900_0028418_2632_2979 115
265 3300037418 Ga0395900_0034196 Ga0395900_0034196_4680_5027 115
266 3300037418 Ga0395900_0054838 Ga0395900_0054838_2858_3205 115
267 3300037418 Ga0395900_0084409 Ga0395900_0084409_1495_1842 115
268 3300037418 Ga0395900_0111027 Ga0395900_0111027_1803_2150 115
269 3300037418 Ga0395900_0112213 Ga0395900_0112213_2096_2443 115
270 3300037418 Ga0395900_0335269 Ga0395900_0335269_1032_1379 115
271 3300037418 Ga0395900_0378526 Ga0395900_0378526_415_762 115
272 3300037418 Ga0395900_0488028 Ga0395900_0488028_440_787 115
273 3300037418 Ga0395900_1205454 Ga0395900_1205454_80_427 115
274 3300037466 Ga0395898_0008743 Ga0395898_0008743_8418_8765 115
275 3300037466 Ga0395898_0009899 Ga0395898_0009899_1851_2198 115
276 3300037466 Ga0395898_0010359 Ga0395898_0010359_746_1093 115
277 3300037466 Ga0395898_0014022 Ga0395898_0014022_6436_6783 115
278 3300037466 Ga0395898_0423974 Ga0395898_0423974_650_997 115
279 3300037466 Ga0395898_1009982 Ga0395898_1009982_126_473 115
280 3300037466 Ga0395898_1550486 Ga0395898_1550486_148_495 115
281 3300037471 Ga0395905_0001978 Ga0395905_0001978_22034_22381 115
282 3300037471 Ga0395905_0009544 Ga0395905_0009544_1511_1858 115
283 3300037471 Ga0395905_0010689 Ga0395905_0010689_2112_2459 115
284 3300037471 Ga0395905_0058810 Ga0395905_0058810_1448_1795 115
285 3300037471 Ga0395905_0226825 Ga0395905_0226825_713_1060 115
286 3300037471 Ga0395905_0324635 Ga0395905_0324635_414_761 115
287 3300037471 Ga0395905_0946860 Ga0395905_0946860_52_399 115
288 3300037471 Ga0395905_1163385 Ga0395905_1163385_166_513 115
289 3300038443 Ga0395901_0001057 Ga0395901_0001057_1823_2170 115
290 3300038443 Ga0395901_0002203 Ga0395901_0002203_18200_18547 115
291 3300038443 Ga0395901_0003853 Ga0395901_0003853_13042_13389 115
292 3300038443 Ga0395901_0007398 Ga0395901_0007398_782_1129 115
293 3300038443 Ga0395901_0038896 Ga0395901_0038896_4311_4658 115
294 3300038443 Ga0395901_0069768 Ga0395901_0069768_1874_2221 115
295 3300038443 Ga0395901_0447505 Ga0395901_0447505_102_449 115
296 3300038443 Ga0395901_0771281 Ga0395901_0771281_587_934 115
297 3300038443 Ga0395901_0954514 Ga0395901_0954514_398_745 115
298 3300038443 Ga0395901_1833748 Ga0395901_1833748_197_544 115
299 3300038443 Ga0395901_2032968 Ga0395901_2032968_132_479 115
300 3300041452 Ga0451793_1909678 Ga0451793_1909678_165_512 115
301 3300041512 Ga0451853_2147256 Ga0451853_2147256_60_413 115
302 3300041512 Ga0451853_3049901 Ga0451853_3049901_233_580 115
303 3300044901 Ga0466960_0094703 Ga0466960_0094703_704_1051 115
304 3300044901 Ga0466960_0343033 Ga0466960_0343033_158_505 115
305 3300046461 Ga0495641_0141276 Ga0495641_0141276_258_608 115
306 3300046491 Ga0495584_0095884 Ga0495584_0095884_438_785 115
307 3300046491 Ga0495584_0174772 Ga0495584_0174772_106_453 115
308 3300046500 Ga0495596_0034772 Ga0495596_0034772_941_1288 115
309 3300046506 Ga0495583_0086904 Ga0495583_0086904_334_681 115
310 3300046518 Ga0495631_0198752 Ga0495631_0198752_187_534 115
311 3300046525 Ga0495663_0016372 Ga0495663_0016372_1637_1984 115
312 3300046528 Ga0495642_0030214 Ga0495642_0030214_1744_2091 115
313 3300046528 Ga0495642_0064211 Ga0495642_0064211_652_999 115
314 3300046538 Ga0495609_0032652 Ga0495609_0032652_1967_2314 115
315 3300046538 Ga0495609_0353934 Ga0495609_0353934_233_580 115
316 3300046615 Ga0495656_0067050 Ga0495656_0067050_734_1081 115
317 3300046615 Ga0495656_0196354 Ga0495656_0196354_353_700 115
318 3300046616 Ga0495668_0078305 Ga0495668_0078305_456_803 115
319 3300046664 Ga0495659_0023271 Ga0495659_0023271_1596_1943 115
320 3300046664 Ga0495659_0335046 Ga0495659_0335046_85_432 115
321 3300046665 Ga0495661_0082811 Ga0495661_0082811_722_1069 115
322 3300046674 Ga0495588_0247087 Ga0495588_0247087_294_641 115
323 3300046684 Ga0495669_0549598 Ga0495669_0549598_116_463 115
324 3300046691 Ga0495670_0082737 Ga0495670_0082737_358_705 115
325 3300046794 Ga0495589_0080496 Ga0495589_0080496_169_516 115
326 3300047445 Ga0495677_0248699 Ga0495677_0248699_223_570 115
327 3300048903 Ga0496100_0104499 Ga0496100_0104499_1331_1678 115
328 3300048903 Ga0496100_1255881 Ga0496100_1255881_97_444 115
329 3300048904 Ga0496101_0806664 Ga0496101_0806664_311_658 115
330 3300048904 Ga0496101_0868490 Ga0496101_0868490_215_562 115
331 3300048905 Ga0496102_0712053 Ga0496102_0712053_43_390 115
332 3300048906 Ga0496103_0148406 Ga0496103_0148406_116_463 115
333 3300048907 Ga0496104_0034322 Ga0496104_0034322_109_456 115
334 3300048908 Ga0496105_0015103 Ga0496105_0015103_4822_5169 115
335 3300048908 Ga0496105_0341599 Ga0496105_0341599_187_534 115
336 3300048909 Ga0496106_0191934 Ga0496106_0191934_419_766 115
337 3300048909 Ga0496106_0348740 Ga0496106_0348740_265_612 115
338 3300048909 Ga0496106_0358788 Ga0496106_0358788_15_362 115
339 3300048909 Ga0496106_1032390 Ga0496106_1032390_236_583 115
340 3300048910 Ga0496107_0114044 Ga0496107_0114044_419_766 115
341 3300048910 Ga0496107_0211250 Ga0496107_0211250_934_1281 115
342 3300048910 Ga0496107_0610303 Ga0496107_0610303_106_453 115
343 3300048911 Ga0496108_0009378 Ga0496108_0009378_298_645 115
344 3300048911 Ga0496108_0028460 Ga0496108_0028460_265_612 115
345 3300048911 Ga0496108_0574316 Ga0496108_0574316_626_973 115
346 3300048912 Ga0496109_0000533 Ga0496109_0000533_25651_25998 115
347 3300048912 Ga0496109_0004031 Ga0496109_0004031_862_1209 115
348 3300048913 Ga0496110_0041901 Ga0496110_0041901_971_1318 115
349 3300048913 Ga0496110_0249659 Ga0496110_0249659_984_1331 115
350 3300048913 Ga0496110_0393406 Ga0496110_0393406_390_737 115
351 3300048914 Ga0496111_0011785 Ga0496111_0011785_976_1323 115
352 3300048914 Ga0496111_0116434 Ga0496111_0116434_1439_1786 115
353 3300048915 Ga0496112_0001663 Ga0496112_0001663_15929_16276 115
354 3300048915 Ga0496112_0577637 Ga0496112_0577637_441_788 115
355 3300048915 Ga0496112_0998323 Ga0496112_0998323_59_406 115
356 3300048916 Ga0496113_0069858 Ga0496113_0069858_1212_1559 115
357 3300048916 Ga0496113_0104684 Ga0496113_0104684_717_1064 115
358 3300048917 Ga0496114_0998194 Ga0496114_0998194_161_508 115
359 3300048918 Ga0496115_0298598 Ga0496115_0298598_763_1110 115
360 3300048918 Ga0496115_0510661 Ga0496115_0510661_134_481 115
361 3300049568 Ga0501031_0023299 Ga0501031_0023299_2894_3241 115
362 3300049568 Ga0501031_0255214 Ga0501031_0255214_600_947 115
363 3300049569 Ga0501032_0173465 Ga0501032_0173465_626_973 115
364 3300049570 Ga0501033_0008760 Ga0501033_0008760_7171_7518 115
365 3300049571 Ga0501034_0313754 Ga0501034_0313754_350_697 115
366 3300049572 Ga0501036_0012175 Ga0501036_0012175_3276_3623 115
367 3300049573 Ga0501037_0016483 Ga0501037_0016483_479_826 115
368 3300049574 Ga0501038_0043430 Ga0501038_0043430_2755_3102 115
369 3300049575 Ga0501039_0005475 Ga0501039_0005475_3757_4104 115
370 3300049576 Ga0501040_0270809 Ga0501040_0270809_206_553 115
371 3300049576 Ga0501040_0608604 Ga0501040_0608604_287_634 115
372 3300049578 Ga0501042_0004174 Ga0501042_0004174_313_660 115
373 3300049578 Ga0501042_0554256 Ga0501042_0554256_26_373 115
374 3300049579 Ga0501043_0009672 Ga0501043_0009672_5287_5634 115
375 3300049580 Ga0501046_0030605 Ga0501046_0030605_871_1218 115
376 3300049582 Ga0501048_0001065 Ga0501048_0001065_7965_8312 115
377 3300049582 Ga0501048_0638955 Ga0501048_0638955_275_622 115
378 3300049585 Ga0501069_0006041 Ga0501069_0006041_957_1304 115
379 3300049586 Ga0501070_0002312 Ga0501070_0002312_9381_9728 115
380 3300049587 Ga0501071_0125126 Ga0501071_0125126_532_879 115
381 3300049588 Ga0501072_0026780 Ga0501072_0026780_2994_3341 115
382 3300049588 Ga0501072_0116621 Ga0501072_0116621_523_870 115
383 3300049588 Ga0501072_0447845 Ga0501072_0447845_459_806 115
384 3300049589 Ga0501073_0387506 Ga0501073_0387506_555_902 115
385 3300049590 Ga0501074_0002914 Ga0501074_0002914_8910_9257 115
386 3300049591 Ga0501075_0001970 Ga0501075_0001970_3503_3850 115
387 3300049591 Ga0501075_0202897 Ga0501075_0202897_557_904 115
388 3300049591 Ga0501075_0521444 Ga0501075_0521444_380_727 115
389 3300049592 Ga0501076_0152493 Ga0501076_0152493_1275_1622 115
390 3300049593 Ga0501077_0364865 Ga0501077_0364865_169_516 115
391 3300049741 Ga0501079_0120689 Ga0501079_0120689_1486_1833 115
392 3300049741 Ga0501079_0288397 Ga0501079_0288397_635_982 115
393 3300049741 Ga0501079_0804629 Ga0501079_0804629_377_724 115
394 3300049743 Ga0501081_0048445 Ga0501081_0048445_532_879 115
395 3300049743 Ga0501081_0076557 Ga0501081_0076557_1589_1936 115
396 3300049743 Ga0501081_0500717 Ga0501081_0500717_489_836 115
397 3300049744 Ga0501083_0032509 Ga0501083_0032509_475_822 115
398 3300049822 Ga0501035_0037804 Ga0501035_0037804_850_1197 115
399 3300049824 Ga0501045_0022550 Ga0501045_0022550_3736_4083 115
400 3300049824 Ga0501045_0258112 Ga0501045_0258112_203_550 115
401 3300050507 nmdc:mga05p37_329018_c1 nmdc:mga05p37_329018_c1_700_1047 115
402 3300050515 nmdc:mga0a205_1181332_c1 nmdc:mga0a205_1181332_c1_48_395 115
403 3300050515 nmdc:mga0a205_839073_c1 nmdc:mga0a205_839073_c1_11_358 115
404 3300053083 Ga0495655_0151345 Ga0495655_0151345_238_585 115
405 3300054114 Ga0501084_0062245 Ga0501084_0062245_2443_2790 115
406 3300059645 Ga0587076_075782 Ga0587076_075782_96_443 115
407 3300060353 Ga0501082_0254962 Ga0501082_0254962_1048_1395 115
408 3300060353 Ga0501082_0497397 Ga0501082_0497397_556_903 115
409 3300060353 Ga0501082_0793315 Ga0501082_0793315_313_660 115
410 3300061734 Ga0530510_0181132 Ga0530510_0181132_441_788 115
411 3300061734 Ga0530510_0238376 Ga0530510_0238376_965_1312 115
412 3300001991 JGI24743J22301_10026142 JGI24743J22301_100261422 116
413 3300002075 JGI24738J21930_10066658 JGI24738J21930_100666582 116
414 3300002155 JGI24033J26618_1029443 JGI24033J26618_10294431 116
415 3300002459 JGI24751J29686_10025912 JGI24751J29686_100259123 116
416 3300003203 JGI25406J46586_10168553 JGI25406J46586_101685532 116
417 3300003373 JGI25407J50210_10000656 JGI25407J50210_100006566 116
418 3300005327 Ga0070658_10945957 Ga0070658_109459571 116
419 3300005328 Ga0070676_10172059 Ga0070676_101720592 116
420 3300005328 Ga0070676_10422244 Ga0070676_104222442 116
421 3300005329 Ga0070683_100187123 Ga0070683_1001871234 116
422 3300005331 Ga0070670_100019253 Ga0070670_1000192534 116
423 3300005331 Ga0070670_100066805 Ga0070670_1000668054 116
424 3300005334 Ga0068869_100238186 Ga0068869_1002381863 116
425 3300005334 Ga0068869_100560024 Ga0068869_1005600242 116
426 3300005335 Ga0070666_10420999 Ga0070666_104209992 116
427 3300005336 Ga0070680_101466899 Ga0070680_1014668992 116
428 3300005337 Ga0070682_100104778 Ga0070682_1001047784 116
429 3300005338 Ga0068868_100574370 Ga0068868_1005743702 116
430 3300005338 Ga0068868_101088962 Ga0068868_1010889622 116
431 3300005340 Ga0070689_100012403 Ga0070689_1000124038 116
432 3300005341 Ga0070691_10390404 Ga0070691_103904042 116
433 3300005341 Ga0070691_10484685 Ga0070691_104846852 116
434 3300005344 Ga0070661_101125872 Ga0070661_1011258722 116
435 3300005345 Ga0070692_10095936 Ga0070692_100959363 116
436 3300005353 Ga0070669_100688250 Ga0070669_1006882502 116
437 3300005354 Ga0070675_100198289 Ga0070675_1001982891 116
438 3300005354 Ga0070675_100297615 Ga0070675_1002976153 116
439 3300005354 Ga0070675_101180331 Ga0070675_1011803312 116
440 3300005355 Ga0070671_100754728 Ga0070671_1007547282 116
441 3300005356 Ga0070674_100026183 Ga0070674_1000261834 116
442 3300005356 Ga0070674_100039776 Ga0070674_1000397764 116
443 3300005356 Ga0070674_100293314 Ga0070674_1002933143 116
444 3300005356 Ga0070674_100433677 Ga0070674_1004336772 116
445 3300005364 Ga0070673_100129318 Ga0070673_1001293182 116
446 3300005365 Ga0070688_100024156 Ga0070688_1000241562 116
447 3300005366 Ga0070659_100226408 Ga0070659_1002264081 116
448 3300005440 Ga0070705_100324402 Ga0070705_1003244022 116
449 3300005441 Ga0070700_101108227 Ga0070700_1011082271 116
450 3300005444 Ga0070694_100968389 Ga0070694_1009683891 116
451 3300005456 Ga0070678_100318747 Ga0070678_1003187472 116
452 3300005456 Ga0070678_101605333 Ga0070678_1016053331 116
453 3300005457 Ga0070662_100254675 Ga0070662_1002546752 116
454 3300005466 Ga0070685_10004074 Ga0070685_100040746 116
455 3300005467 Ga0070706_100011218 Ga0070706_1000112185 116
456 3300005468 Ga0070707_100063580 Ga0070707_1000635804 116
457 3300005471 Ga0070698_100008197 Ga0070698_10000819710 116
458 3300005535 Ga0070684_100110938 Ga0070684_1001109384 116
459 3300005543 Ga0070672_101947924 Ga0070672_1019479242 116
460 3300005544 Ga0070686_100022405 Ga0070686_1000224054 116
461 3300005547 Ga0070693_100163771 Ga0070693_1001637713 116
462 3300005548 Ga0070665_100038326 Ga0070665_1000383265 116
463 3300005549 Ga0070704_100073992 Ga0070704_1000739923 116
464 3300005549 Ga0070704_100313531 Ga0070704_1003135312 116
465 3300005564 Ga0070664_101718314 Ga0070664_1017183141 116
466 3300005577 Ga0068857_100159470 Ga0068857_1001594702 116
467 3300005578 Ga0068854_100421424 Ga0068854_1004214243 116
468 3300005614 Ga0068856_101145264 Ga0068856_1011452643 116
469 3300005615 Ga0070702_100027701 Ga0070702_1000277012 116
470 3300005615 Ga0070702_100130284 Ga0070702_1001302843 116
471 3300005615 Ga0070702_100568069 Ga0070702_1005680691 116
472 3300005617 Ga0068859_100146843 Ga0068859_1001468433 116
473 3300005617 Ga0068859_100506270 Ga0068859_1005062702 116
474 3300005618 Ga0068864_100098673 Ga0068864_1000986734 116
475 3300005618 Ga0068864_102132291 Ga0068864_1021322912 116
476 3300005718 Ga0068866_10109474 Ga0068866_101094744 116
477 3300005840 Ga0068870_10007395 Ga0068870_100073954 116
478 3300005840 Ga0068870_10015826 Ga0068870_100158262 116
479 3300005840 Ga0068870_10994489 Ga0068870_109944891 116
480 3300005842 Ga0068858_100289688 Ga0068858_1002896882 116
481 3300005981 Ga0081538_10000613 Ga0081538_1000061321 116
482 3300005981 Ga0081538_10044010 Ga0081538_100440103 116
483 3300005985 Ga0081539_10000397 Ga0081539_1000039775 116
484 3300005985 Ga0081539_10022450 Ga0081539_100224504 116
485 3300005985 Ga0081539_10244462 Ga0081539_102444622 116
486 3300006175 Ga0070712_100015578 Ga0070712_1000155785 116
487 3300006358 Ga0068871_101242042 Ga0068871_1012420422 116
488 3300006844 Ga0075428_100267067 Ga0075428_1002670672 116
489 3300006844 Ga0075428_101580197 Ga0075428_1015801972 116
490 3300006846 Ga0075430_100374816 Ga0075430_1003748162 116
491 3300006847 Ga0075431_100208318 Ga0075431_1002083183 116
492 3300006881 Ga0068865_100186082 Ga0068865_1001860823 116
493 3300006881 Ga0068865_100409759 Ga0068865_1004097592 116
494 3300006931 Ga0097620_100146839 Ga0097620_1001468393 116
495 3300006931 Ga0097620_100506273 Ga0097620_1005062732 116
496 3300009092 Ga0105250_10446172 Ga0105250_104461721 116
497 3300009094 Ga0111539_10927450 Ga0111539_109274501 116
498 3300009098 Ga0105245_10002969 Ga0105245_1000296919 116
499 3300009098 Ga0105245_10128518 Ga0105245_101285184 116
500 3300009098 Ga0105245_10416867 Ga0105245_104168673 116
501 3300009101 Ga0105247_10507536 Ga0105247_105075362 116
502 3300009147 Ga0114129_10054566 Ga0114129_100545664 116
503 3300009147 Ga0114129_10119462 Ga0114129_101194623 116
504 3300009147 Ga0114129_10226938 Ga0114129_102269385 116
505 3300009147 Ga0114129_10491521 Ga0114129_104915213 116
506 3300009147 Ga0114129_12394109 Ga0114129_123941092 116
507 3300009148 Ga0105243_10001079 Ga0105243_100010795 116
508 3300009148 Ga0105243_10041427 Ga0105243_100414271 116
509 3300009148 Ga0105243_10400780 Ga0105243_104007803 116
510 3300009148 Ga0105243_10771017 Ga0105243_107710172 116
511 3300009174 Ga0105241_10034431 Ga0105241_100344314 116
512 3300009176 Ga0105242_10001102 Ga0105242_100011026 116
513 3300009176 Ga0105242_10305488 Ga0105242_103054883 116
514 3300009177 Ga0105248_10121237 Ga0105248_101212373 116
515 3300009551 Ga0105238_10230103 Ga0105238_102301033 116
516 3300009553 Ga0105249_10001927 Ga0105249_100019275 116
517 3300009553 Ga0105249_10428545 Ga0105249_104285453 116
518 3300009553 Ga0105249_11720358 Ga0105249_117203582 116
519 3300010375 Ga0105239_10001224 Ga0105239_1000122428 116
520 3300011119 Ga0105246_10017459 Ga0105246_100174595 116
521 3300011119 Ga0105246_10065106 Ga0105246_100651063 116
522 3300011119 Ga0105246_10184549 Ga0105246_101845493 116
523 3300011119 Ga0105246_10353141 Ga0105246_103531411 116
524 3300011119 Ga0105246_10806903 Ga0105246_108069031 116
525 3300013105 Ga0157369_10706909 Ga0157369_107069092 116
526 3300013105 Ga0157369_11474644 Ga0157369_114746442 116
527 3300013105 Ga0157369_11934321 Ga0157369_119343211 116
528 3300013296 Ga0157374_10002604 Ga0157374_1000260419 116
529 3300013296 Ga0157374_10464457 Ga0157374_104644572 116
530 3300013296 Ga0157374_12644901 Ga0157374_126449011 116
531 3300013297 Ga0157378_10002273 Ga0157378_1000227318 116
532 3300013297 Ga0157378_11076418 Ga0157378_110764182 116
533 3300013306 Ga0163162_10023555 Ga0163162_100235555 116
534 3300013308 Ga0157375_10205428 Ga0157375_102054283 116
535 3300013308 Ga0157375_10285624 Ga0157375_102856243 116
536 3300013308 Ga0157375_10353133 Ga0157375_103531332 116
537 3300014325 Ga0163163_10035159 Ga0163163_100351594 116
538 3300014326 Ga0157380_10104181 Ga0157380_101041812 116
539 3300014326 Ga0157380_10186358 Ga0157380_101863581 116
540 3300014745 Ga0157377_10065955 Ga0157377_100659554 116
541 3300014968 Ga0157379_10156707 Ga0157379_101567072 116
542 3300014969 Ga0157376_10067491 Ga0157376_100674913 116
543 3300014969 Ga0157376_10127144 Ga0157376_101271444 116
544 3300025898 Ga0207692_10441196 Ga0207692_104411961 116
545 3300025899 Ga0207642_10086139 Ga0207642_100861394 116
546 3300025899 Ga0207642_10120377 Ga0207642_101203771 116
547 3300025901 Ga0207688_10018261 Ga0207688_100182613 116
548 3300025903 Ga0207680_10390991 Ga0207680_103909912 116
549 3300025906 Ga0207699_10373065 Ga0207699_103730652 116
550 3300025907 Ga0207645_10046257 Ga0207645_100462574 116
551 3300025908 Ga0207643_10011385 Ga0207643_100113852 116
552 3300025908 Ga0207643_10024864 Ga0207643_100248643 116
553 3300025909 Ga0207705_10828381 Ga0207705_108283812 116
554 3300025910 Ga0207684_10078849 Ga0207684_100788495 116
555 3300025910 Ga0207684_10323244 Ga0207684_103232442 116
556 3300025915 Ga0207693_10054819 Ga0207693_100548195 116
557 3300025917 Ga0207660_10030174 Ga0207660_100301743 116
558 3300025918 Ga0207662_10390112 Ga0207662_103901123 116
559 3300025922 Ga0207646_10051314 Ga0207646_100513144 116
560 3300025923 Ga0207681_10220229 Ga0207681_102202293 116
561 3300025923 Ga0207681_10343595 Ga0207681_103435952 116
562 3300025925 Ga0207650_10026154 Ga0207650_100261544 116
563 3300025925 Ga0207650_10043408 Ga0207650_100434083 116
564 3300025926 Ga0207659_10049378 Ga0207659_100493781 116
565 3300025926 Ga0207659_10501292 Ga0207659_105012921 116
566 3300025927 Ga0207687_10197800 Ga0207687_101978003 116
567 3300025927 Ga0207687_10441075 Ga0207687_104410752 116
568 3300025927 Ga0207687_11480602 Ga0207687_114806021 116
569 3300025931 Ga0207644_10171420 Ga0207644_101714204 116
570 3300025931 Ga0207644_10678067 Ga0207644_106780672 116
571 3300025932 Ga0207690_10888321 Ga0207690_108883212 116
572 3300025934 Ga0207686_10585967 Ga0207686_105859672 116
573 3300025935 Ga0207709_10310048 Ga0207709_103100482 116
574 3300025936 Ga0207670_10107744 Ga0207670_101077442 116
575 3300025936 Ga0207670_11590238 Ga0207670_115902382 116
576 3300025937 Ga0207669_10019605 Ga0207669_100196054 116
577 3300025937 Ga0207669_10138365 Ga0207669_101383654 116
578 3300025937 Ga0207669_10153021 Ga0207669_101530213 116
579 3300025937 Ga0207669_10390344 Ga0207669_103903443 116
580 3300025937 Ga0207669_10535492 Ga0207669_105354921 116
581 3300025940 Ga0207691_10142606 Ga0207691_101426061 116
582 3300025944 Ga0207661_10208489 Ga0207661_102084892 116
583 3300025945 Ga0207679_10214096 Ga0207679_102140963 116
584 3300025960 Ga0207651_10023333 Ga0207651_100233331 116
585 3300025960 Ga0207651_10289158 Ga0207651_102891583 116
586 3300025960 Ga0207651_10888927 Ga0207651_108889272 116
587 3300025972 Ga0207668_11576534 Ga0207668_115765342 116
588 3300025981 Ga0207640_10108807 Ga0207640_101088073 116
589 3300026023 Ga0207677_10373671 Ga0207677_103736712 116
590 3300026035 Ga0207703_10188969 Ga0207703_101889691 116
591 3300026035 Ga0207703_10209016 Ga0207703_102090163 116
592 3300026067 Ga0207678_10226914 Ga0207678_102269141 116
593 3300026075 Ga0207708_10071276 Ga0207708_100712764 116
594 3300026088 Ga0207641_10850970 Ga0207641_108509702 116
595 3300026089 Ga0207648_10170859 Ga0207648_101708591 116
596 3300026089 Ga0207648_10357528 Ga0207648_103575283 116
597 3300026095 Ga0207676_10066145 Ga0207676_100661454 116
598 3300026116 Ga0207674_10053134 Ga0207674_100531344 116
599 3300026121 Ga0207683_10093849 Ga0207683_100938492 116
600 3300026121 Ga0207683_10518069 Ga0207683_105180692 116
601 3300026121 Ga0207683_11384313 Ga0207683_113843132 116
602 3300026121 Ga0207683_11701301 Ga0207683_117013012 116
603 3300027907 Ga0207428_10017553 Ga0207428_100175535 116
604 3300028379 Ga0268266_10741861 Ga0268266_107418612 116
605 3300028380 Ga0268265_10168157 Ga0268265_101681572 116
606 3300031548 Ga0307408_100006069 Ga0307408_1000060693 116
607 3300031901 Ga0307406_10006630 Ga0307406_100066303 116
608 3300031995 Ga0307409_100014581 Ga0307409_1000145813 116
609 3300032005 Ga0307411_10309153 Ga0307411_103091532 116
610 3300032126 Ga0307415_100000296 Ga0307415_10000029610 116
611 3300035171 Ga0373946_0031397 Ga0373946_0031397_161_520 116
612 3300035691 Ga0373931_0738855 Ga0373931_0738855_223_579 116
613 3300035692 Ga0373935_1395502 Ga0373935_1395502_77_433 116
614 3300035725 Ga0373947_0588854 Ga0373947_0588854_90_449 116
615 3300035725 Ga0373947_0960474 Ga0373947_0960474_50_409 116
616 3300037312 Ga0395899_0235520 Ga0395899_0235520_611_961 116
617 3300037418 Ga0395900_0015990 Ga0395900_0015990_4435_4785 116
618 3300037466 Ga0395898_0194287 Ga0395898_0194287_869_1219 116
619 3300037466 Ga0395898_0498844 Ga0395898_0498844_640_999 116
620 3300037471 Ga0395905_0030391 Ga0395905_0030391_2569_2919 116
621 3300038443 Ga0395901_0052611 Ga0395901_0052611_2886_3236 116
622 3300038443 Ga0395901_1933921 Ga0395901_1933921_165_515 116
623 3300041460 Ga0451802_1142471 Ga0451802_1142471_57_413 116
624 3300041507 Ga0451851_1114086 Ga0451851_1114086_149_508 116
625 3300042006 Ga0439432_166650 Ga0439432_166650_130_486 116
626 3300042008 Ga0439450_033238 Ga0439450_033238_231_581 116
627 3300042122 Ga0450920_070287 Ga0450920_070287_315_680 116
628 3300042157 Ga0439458_0111816 Ga0439458_0111816_178_537 116
629 3300042531 Ga0450918_068779 Ga0450918_068779_37_402 116
630 3300044673 Ga0453683_1080618 Ga0453683_1080618_46_405 116
631 3300046454 Ga0495592_0168953 Ga0495592_0168953_855_1211 116
632 3300046455 Ga0495603_0361152 Ga0495603_0361152_408_767 116
633 3300046459 Ga0495629_0204123 Ga0495629_0204123_617_976 116
634 3300046459 Ga0495629_0411579 Ga0495629_0411579_237_596 116
635 3300046461 Ga0495641_0137360 Ga0495641_0137360_367_726 116
636 3300046462 Ga0495651_0288308 Ga0495651_0288308_402_758 116
637 3300046463 Ga0495653_0186438 Ga0495653_0186438_560_916 116
638 3300046473 Ga0495582_0122295 Ga0495582_0122295_264_623 116
639 3300046473 Ga0495582_0428109 Ga0495582_0428109_101_451 116
640 3300046475 Ga0495639_0274915 Ga0495639_0274915_185_541 116
641 3300046517 Ga0495630_0261192 Ga0495630_0261192_901_1260 116
642 3300046529 Ga0495652_0552240 Ga0495652_0552240_351_707 116
643 3300046559 Ga0495667_0056141 Ga0495667_0056141_251_607 116
644 3300046559 Ga0495667_0166932 Ga0495667_0166932_661_1020 116
645 3300046642 Ga0495634_0637102 Ga0495634_0637102_201_560 116
646 3300046663 Ga0495635_0033730 Ga0495635_0033730_916_1275 116
647 3300046675 Ga0495657_0540419 Ga0495657_0540419_68_424 116
648 3300046689 Ga0495613_0144829 Ga0495613_0144829_1283_1642 116
649 3300046691 Ga0495670_0275366 Ga0495670_0275366_178_534 116
650 3300046794 Ga0495589_0256080 Ga0495589_0256080_358_708 116
651 3300047315 Ga0495581_0099421 Ga0495581_0099421_944_1303 116
652 3300047319 Ga0495674_0130458 Ga0495674_0130458_527_886 116
653 3300047321 Ga0495676_0241654 Ga0495676_0241654_654_1013 116
654 3300047322 Ga0495680_0021040 Ga0495680_0021040_3973_4332 116
655 3300047471 Ga0495684_0224957 Ga0495684_0224957_563_922 116
656 3300048904 Ga0496101_0005857 Ga0496101_0005857_220_576 116
657 3300048905 Ga0496102_0039943 Ga0496102_0039943_1504_1860 116
658 3300048906 Ga0496103_0422893 Ga0496103_0422893_318_674 116
659 3300048907 Ga0496104_0003038 Ga0496104_0003038_11777_12133 116
660 3300048908 Ga0496105_0053606 Ga0496105_0053606_880_1236 116
661 3300048909 Ga0496106_0928906 Ga0496106_0928906_20_373 116
662 3300048910 Ga0496107_0031191 Ga0496107_0031191_743_1099 116
663 3300048910 Ga0496107_0769929 Ga0496107_0769929_280_636 116
664 3300048911 Ga0496108_0067854 Ga0496108_0067854_844_1200 116
665 3300048911 Ga0496108_0149778 Ga0496108_0149778_689_1048 116
666 3300048911 Ga0496108_0193236 Ga0496108_0193236_140_490 116
667 3300048912 Ga0496109_0057472 Ga0496109_0057472_1894_2250 116
668 3300048912 Ga0496109_0179949 Ga0496109_0179949_541_891 116
669 3300048912 Ga0496109_0195256 Ga0496109_0195256_312_668 116
670 3300048912 Ga0496109_0301791 Ga0496109_0301791_640_996 116
671 3300048913 Ga0496110_0028591 Ga0496110_0028591_3582_3938 116
672 3300048913 Ga0496110_0108726 Ga0496110_0108726_1509_1868 116
673 3300048913 Ga0496110_0389351 Ga0496110_0389351_341_691 116
674 3300048913 Ga0496110_0400138 Ga0496110_0400138_617_976 116
675 3300048913 Ga0496110_0697644 Ga0496110_0697644_283_633 116
676 3300048914 Ga0496111_0025216 Ga0496111_0025216_1792_2148 116
677 3300048914 Ga0496111_0068678 Ga0496111_0068678_837_1187 116
678 3300048914 Ga0496111_0334932 Ga0496111_0334932_743_1102 116
679 3300048915 Ga0496112_0019921 Ga0496112_0019921_2386_2739 116
680 3300048916 Ga0496113_0197068 Ga0496113_0197068_654_1010 116
681 3300048916 Ga0496113_0786953 Ga0496113_0786953_285_641 116
682 3300048916 Ga0496113_1140724 Ga0496113_1140724_101_451 116
683 3300048917 Ga0496114_0013918 Ga0496114_0013918_351_707 116
684 3300048917 Ga0496114_1715519 Ga0496114_1715519_18_368 116
685 3300048918 Ga0496115_0083885 Ga0496115_0083885_1891_2247 116
686 3300049571 Ga0501034_0204331 Ga0501034_0204331_219_569 116
687 3300049571 Ga0501034_0489558 Ga0501034_0489558_237_587 116
688 3300049572 Ga0501036_0290584 Ga0501036_0290584_845_1213 116
689 3300049582 Ga0501048_0557929 Ga0501048_0557929_275_643 116
690 3300049582 Ga0501048_1107077 Ga0501048_1107077_14_367 116
691 3300049586 Ga0501070_1091936 Ga0501070_1091936_113_472 116
692 3300049587 Ga0501071_0311983 Ga0501071_0311983_481_849 116
693 3300049588 Ga0501072_0191970 Ga0501072_0191970_217_585 116
694 3300049590 Ga0501074_0527677 Ga0501074_0527677_343_711 116
695 3300049592 Ga0501076_0198057 Ga0501076_0198057_167_535 116
696 3300049593 Ga0501077_0812515 Ga0501077_0812515_88_456 116
697 3300049824 Ga0501045_0842476 Ga0501045_0842476_237_605 116
698 3300050507 nmdc:mga05p37_1034212_c1 nmdc:mga05p37_1034212_c1_403_759 116
699 3300050507 nmdc:mga05p37_181660_c1 nmdc:mga05p37_181660_c1_1615_1965 116
700 3300050507 nmdc:mga05p37_22079_c1 nmdc:mga05p37_22079_c1_4745_5095 116
701 3300050507 nmdc:mga05p37_452113_c1 nmdc:mga05p37_452113_c1_352_711 116
702 3300050507 nmdc:mga05p37_496671_c1 nmdc:mga05p37_496671_c1_27_377 116
703 3300050507 nmdc:mga05p37_91749_c1 nmdc:mga05p37_91749_c1_829_1179 116
704 3300050508 nmdc:mga09592_103199_c1 nmdc:mga09592_103199_c1_1610_1960 116
705 3300050508 nmdc:mga09592_254711_c1 nmdc:mga09592_254711_c1_1078_1428 116
706 3300050508 nmdc:mga09592_304137_c1 nmdc:mga09592_304137_c1_876_1226 116
707 3300050509 nmdc:mga0qj67_580112_c1 nmdc:mga0qj67_580112_c1_34_384 116
708 3300050509 nmdc:mga0qj67_705293_c1 nmdc:mga0qj67_705293_c1_12_362 116
709 3300050510 nmdc:mga06r32_1481454_c1 nmdc:mga06r32_1481454_c1_87_437 116
710 3300050510 nmdc:mga06r32_157216_c1 nmdc:mga06r32_157216_c1_1659_2009 116
711 3300050511 nmdc:mga08y16_1074249_c1 nmdc:mga08y16_1074249_c1_395_745 116
712 3300050511 nmdc:mga08y16_1499174_c1 nmdc:mga08y16_1499174_c1_19_369 116
713 3300050511 nmdc:mga08y16_86653_c1 nmdc:mga08y16_86653_c1_1822_2172 116
714 3300053077 Ga0495601_0298950 Ga0495601_0298950_51_407 116
715 3300053084 Ga0495595_0298899 Ga0495595_0298899_36_395 116
716 3300053085 Ga0495619_0389709 Ga0495619_0389709_333_692 116
717 3300060353 Ga0501082_1842793 Ga0501082_1842793_134_493 116
718 3300003203 JGI25406J46586_10152068 JGI25406J46586_101520682 117
719 3300005328 Ga0070676_10472998 Ga0070676_104729981 117
720 3300005338 Ga0068868_100051600 Ga0068868_1000516004 117
721 3300005338 Ga0068868_100955248 Ga0068868_1009552481 117
722 3300005341 Ga0070691_10229563 Ga0070691_102295633 117
723 3300005356 Ga0070674_100390055 Ga0070674_1003900553 117
724 3300005364 Ga0070673_100650606 Ga0070673_1006506061 117
725 3300005366 Ga0070659_100452729 Ga0070659_1004527293 117
726 3300005436 Ga0070713_100043151 Ga0070713_1000431514 117
727 3300005436 Ga0070713_101494049 Ga0070713_1014940491 117
728 3300005437 Ga0070710_10598516 Ga0070710_105985162 117
729 3300005439 Ga0070711_100319800 Ga0070711_1003198003 117
730 3300005440 Ga0070705_100289541 Ga0070705_1002895411 117
731 3300005445 Ga0070708_100227126 Ga0070708_1002271263 117
732 3300005445 Ga0070708_100567009 Ga0070708_1005670091 117
733 3300005457 Ga0070662_100708630 Ga0070662_1007086302 117
734 3300005466 Ga0070685_11474389 Ga0070685_114743891 117
735 3300005467 Ga0070706_100667593 Ga0070706_1006675932 117
736 3300005467 Ga0070706_101144319 Ga0070706_1011443192 117
737 3300005471 Ga0070698_100357409 Ga0070698_1003574092 117
738 3300005471 Ga0070698_100948606 Ga0070698_1009486061 117
739 3300005530 Ga0070679_100683358 Ga0070679_1006833582 117
740 3300005539 Ga0068853_101678676 Ga0068853_1016786762 117
741 3300005544 Ga0070686_100146224 Ga0070686_1001462243 117
742 3300005546 Ga0070696_100380644 Ga0070696_1003806442 117
743 3300005546 Ga0070696_101442658 Ga0070696_1014426581 117
744 3300005549 Ga0070704_100452752 Ga0070704_1004527521 117
745 3300005549 Ga0070704_101035516 Ga0070704_1010355161 117
746 3300005549 Ga0070704_101803141 Ga0070704_1018031412 117
747 3300005615 Ga0070702_100108561 Ga0070702_1001085611 117
748 3300005719 Ga0068861_100228250 Ga0068861_1002282503 117
749 3300005841 Ga0068863_100672428 Ga0068863_1006724282 117
750 3300005843 Ga0068860_101307236 Ga0068860_1013072362 117
751 3300005844 Ga0068862_100500081 Ga0068862_1005000811 117
752 3300006028 Ga0070717_10042948 Ga0070717_100429484 117
753 3300006175 Ga0070712_100088858 Ga0070712_1000888582 117
754 3300006175 Ga0070712_100120167 Ga0070712_1001201673 117
755 3300006175 Ga0070712_101077956 Ga0070712_1010779562 117
756 3300006847 Ga0075431_100490317 Ga0075431_1004903172 117
757 3300006852 Ga0075433_10016681 Ga0075433_100166815 117
758 3300006852 Ga0075433_10574982 Ga0075433_105749823 117
759 3300006871 Ga0075434_100023057 Ga0075434_1000230575 117
760 3300009094 Ga0111539_13471265 Ga0111539_134712652 117
761 3300009098 Ga0105245_10330135 Ga0105245_103301352 117
762 3300009101 Ga0105247_11759172 Ga0105247_117591721 117
763 3300009148 Ga0105243_10179690 Ga0105243_101796903 117
764 3300010375 Ga0105239_10248445 Ga0105239_102484452 117
765 3300010375 Ga0105239_10495421 Ga0105239_104954212 117
766 3300011119 Ga0105246_10523740 Ga0105246_105237402 117
767 3300012515 Ga0157338_1020450 Ga0157338_10204502 117
768 3300013296 Ga0157374_10623179 Ga0157374_106231792 117
769 3300013296 Ga0157374_11395100 Ga0157374_113951001 117
770 3300013297 Ga0157378_10690021 Ga0157378_106900211 117
771 3300014968 Ga0157379_10479015 Ga0157379_104790152 117
772 3300014969 Ga0157376_10063860 Ga0157376_100638604 117
773 3300025901 Ga0207688_10481982 Ga0207688_104819822 117
774 3300025915 Ga0207693_10082992 Ga0207693_100829924 117
775 3300025915 Ga0207693_10859919 Ga0207693_108599192 117
776 3300025927 Ga0207687_10371214 Ga0207687_103712142 117
777 3300025927 Ga0207687_10665511 Ga0207687_106655112 117
778 3300025928 Ga0207700_10430452 Ga0207700_104304522 117
779 3300025933 Ga0207706_10036092 Ga0207706_100360924 117
780 3300025934 Ga0207686_11053058 Ga0207686_110530582 117
781 3300025935 Ga0207709_10029386 Ga0207709_100293864 117
782 3300025935 Ga0207709_10831434 Ga0207709_108314342 117
783 3300025939 Ga0207665_10064208 Ga0207665_100642084 117
784 3300025961 Ga0207712_10044115 Ga0207712_100441154 117
785 3300026023 Ga0207677_10391252 Ga0207677_103912522 117
786 3300026023 Ga0207677_10982908 Ga0207677_109829082 117
787 3300026075 Ga0207708_10375213 Ga0207708_103752132 117
788 3300026078 Ga0207702_10334112 Ga0207702_103341123 117
789 3300026078 Ga0207702_10476677 Ga0207702_104766773 117
790 3300026089 Ga0207648_10828210 Ga0207648_108282102 117
791 3300026118 Ga0207675_100017381 Ga0207675_1000173814 117
792 3300027907 Ga0207428_10062192 Ga0207428_100621923 117
793 3300028380 Ga0268265_10213031 Ga0268265_102130313 117
794 3300028381 Ga0268264_10886826 Ga0268264_108868262 117
795 3300034816 Ga0373930_0054694 Ga0373930_0054694_477_845 117
796 3300034818 Ga0373950_0003227 Ga0373950_0003227_838_1206 117
797 3300035084 Ga0373928_0013245 Ga0373928_0013245_1021_1389 117
798 3300035088 Ga0373940_0015848 Ga0373940_0015848_1424_1792 117
799 3300035090 Ga0373949_0012995 Ga0373949_0012995_666_1034 117
800 3300035091 Ga0373951_0069655 Ga0373951_0069655_62_430 117
801 3300035092 Ga0373952_0032221 Ga0373952_0032221_502_870 117
802 3300035112 Ga0373932_0030305 Ga0373932_0030305_1010_1378 117
803 3300035114 Ga0373939_0024933 Ga0373939_0024933_912_1280 117
804 3300035115 Ga0373941_0004913 Ga0373941_0004913_589_957 117
805 3300035121 Ga0373960_0017803 Ga0373960_0017803_1295_1663 117
806 3300037068 Ga0373925_1249120 Ga0373925_1249120_91_453 117
807 3300041452 Ga0451793_0055089 Ga0451793_0055089_49_411 117
808 3300041491 Ga0451833_0041664 Ga0451833_0041664_158_511 117
809 3300041492 Ga0451835_0877562 Ga0451835_0877562_338_700 117
810 3300044694 Ga0466963_1034055 Ga0466963_1034055_125_481 117
811 3300045976 Ga0466967_2027913 Ga0466967_2027913_127_483 117
812 3300046455 Ga0495603_0115527 Ga0495603_0115527_166_528 117
813 3300046459 Ga0495629_0024941 Ga0495629_0024941_2903_3265 117
814 3300046461 Ga0495641_0087876 Ga0495641_0087876_615_977 117
815 3300046463 Ga0495653_0054139 Ga0495653_0054139_857_1213 117
816 3300046475 Ga0495639_0160519 Ga0495639_0160519_280_642 117
817 3300046513 Ga0495616_0437582 Ga0495616_0437582_20_442 117
818 3300046517 Ga0495630_0260893 Ga0495630_0260893_441_803 117
819 3300046529 Ga0495652_0155334 Ga0495652_0155334_607_963 117
820 3300046642 Ga0495634_0017483 Ga0495634_0017483_999_1361 117
821 3300046674 Ga0495588_0308964 Ga0495588_0308964_175_537 117
822 3300046684 Ga0495669_0580753 Ga0495669_0580753_79_501 117
823 3300046689 Ga0495613_0072324 Ga0495613_0072324_1151_1513 117
824 3300046690 Ga0495624_0487179 Ga0495624_0487179_63_425 117
825 3300046692 Ga0495671_0616589 Ga0495671_0616589_67_489 117
826 3300047321 Ga0495676_0071849 Ga0495676_0071849_1053_1415 117
827 3300047471 Ga0495684_0102161 Ga0495684_0102161_1168_1524 117
828 3300047673 Ga0495593_0050015 Ga0495593_0050015_776_1138 117
829 3300048903 Ga0496100_0759502 Ga0496100_0759502_95_463 117
830 3300048904 Ga0496101_0431834 Ga0496101_0431834_606_974 117
831 3300048904 Ga0496101_1025768 Ga0496101_1025768_65_433 117
832 3300048905 Ga0496102_0018474 Ga0496102_0018474_2854_3222 117
833 3300048906 Ga0496103_0002863 Ga0496103_0002863_4319_4687 117
834 3300048907 Ga0496104_0028939 Ga0496104_0028939_4182_4538 117
835 3300048907 Ga0496104_0077140 Ga0496104_0077140_606_974 117
836 3300048908 Ga0496105_0001193 Ga0496105_0001193_14841_15197 117
837 3300048908 Ga0496105_0029430 Ga0496105_0029430_3522_3890 117
838 3300048908 Ga0496105_0610785 Ga0496105_0610785_225_587 117
839 3300048909 Ga0496106_0062713 Ga0496106_0062713_753_1115 117
840 3300048909 Ga0496106_1315032 Ga0496106_1315032_34_420 117
841 3300048910 Ga0496107_0121990 Ga0496107_0121990_870_1232 117
842 3300048910 Ga0496107_0123867 Ga0496107_0123867_831_1187 117
843 3300048911 Ga0496108_0198914 Ga0496108_0198914_1098_1466 117
844 3300048911 Ga0496108_0431233 Ga0496108_0431233_77_439 117
845 3300048912 Ga0496109_0077744 Ga0496109_0077744_2579_2947 117
846 3300048912 Ga0496109_0215528 Ga0496109_0215528_449_811 117
847 3300048912 Ga0496109_0510463 Ga0496109_0510463_565_921 117
848 3300048913 Ga0496110_0881771 Ga0496110_0881771_301_669 117
849 3300048913 Ga0496110_0922852 Ga0496110_0922852_160_522 117
850 3300048915 Ga0496112_0085148 Ga0496112_0085148_2634_3002 117
851 3300048916 Ga0496113_0726978 Ga0496113_0726978_312_674 117
852 3300048916 Ga0496113_1197263 Ga0496113_1197263_64_432 117
853 3300048917 Ga0496114_0067177 Ga0496114_0067177_1515_1877 117
854 3300048917 Ga0496114_0478603 Ga0496114_0478603_62_430 117
855 3300048917 Ga0496114_0490923 Ga0496114_0490923_330_686 117
856 3300048918 Ga0496115_0160807 Ga0496115_0160807_953_1321 117
857 3300049583 Ga0501067_0129846 Ga0501067_0129846_988_1350 117
858 3300049585 Ga0501069_0050968 Ga0501069_0050968_1048_1410 117
859 3300050507 nmdc:mga05p37_41821_c1 nmdc:mga05p37_41821_c1_2371_2730 117
860 3300050510 nmdc:mga06r32_101263_c1 nmdc:mga06r32_101263_c1_2383_2742 117
861 3300050511 nmdc:mga08y16_624845_c1 nmdc:mga08y16_624845_c1_298_657 117
862 3300050512 nmdc:mga0n895_7675_c1 nmdc:mga0n895_7675_c1_8531_8890 117
863 3300050513 nmdc:mga0rr50_11564_c1 nmdc:mga0rr50_11564_c1_1527_1895 117
864 3300050513 nmdc:mga0rr50_146141_c1 nmdc:mga0rr50_146141_c1_388_747 117
865 3300050514 nmdc:mga08x19_75787_c1 nmdc:mga08x19_75787_c1_1513_1881 117
866 3300050515 nmdc:mga0a205_6767_c1 nmdc:mga0a205_6767_c1_5623_5982 117
867 3300053078 Ga0495612_0004034 Ga0495612_0004034_4677_5033 117
868 3300053085 Ga0495619_0218158 Ga0495619_0218158_648_1004 117
869 3300003203 JGI25406J46586_10117343 JGI25406J46586_101173432 118
870 3300005327 Ga0070658_10473161 Ga0070658_104731611 118
871 3300005336 Ga0070680_100750899 Ga0070680_1007508992 118
872 3300005339 Ga0070660_100264444 Ga0070660_1002644441 118
873 3300005339 Ga0070660_100439270 Ga0070660_1004392701 118
874 3300005344 Ga0070661_100214281 Ga0070661_1002142813 118
875 3300005434 Ga0070709_10415937 Ga0070709_104159372 118
876 3300005435 Ga0070714_101708955 Ga0070714_1017089551 118
877 3300005458 Ga0070681_11449666 Ga0070681_114496661 118
878 3300005535 Ga0070684_100329967 Ga0070684_1003299673 118
879 3300005546 Ga0070696_100123372 Ga0070696_1001233724 118
880 3300005563 Ga0068855_100009327 Ga0068855_1000093273 118
881 3300005563 Ga0068855_100481408 Ga0068855_1004814082 118
882 3300005981 Ga0081538_10039698 Ga0081538_100396983 118
883 3300005985 Ga0081539_10002800 Ga0081539_100028007 118
884 3300009093 Ga0105240_10168178 Ga0105240_101681783 118
885 3300009093 Ga0105240_11735494 Ga0105240_117354941 118
886 3300009094 Ga0111539_10088786 Ga0111539_100887864 118
887 3300009147 Ga0114129_10023764 Ga0114129_100237645 118
888 3300009147 Ga0114129_12469908 Ga0114129_124699082 118
889 3300009177 Ga0105248_10232932 Ga0105248_102329321 118
890 3300013104 Ga0157370_10165839 Ga0157370_101658393 118
891 3300013105 Ga0157369_10093222 Ga0157369_100932224 118
892 3300025909 Ga0207705_10571876 Ga0207705_105718762 118
893 3300025912 Ga0207707_10355571 Ga0207707_103555713 118
894 3300025913 Ga0207695_10181137 Ga0207695_101811374 118
895 3300025913 Ga0207695_10224898 Ga0207695_102248984 118
896 3300025919 Ga0207657_10225929 Ga0207657_102259294 118
897 3300025929 Ga0207664_10951012 Ga0207664_109510122 118
898 3300025934 Ga0207686_11688937 Ga0207686_116889372 118
899 3300025944 Ga0207661_10170430 Ga0207661_101704302 118
900 3300025949 Ga0207667_10368882 Ga0207667_103688822 118
901 3300025981 Ga0207640_10295890 Ga0207640_102958903 118
902 3300028556 Ga0265337_1180496 Ga0265337_11804961 118
903 3300028563 Ga0265319_1015811 Ga0265319_10158112 118
904 3300028573 Ga0265334_10091715 Ga0265334_100917152 118
905 3300028577 Ga0265318_10006523 Ga0265318_100065235 118
906 3300028654 Ga0265322_10003434 Ga0265322_100034346 118
907 3300028800 Ga0265338_10049826 Ga0265338_100498261 118
908 3300031235 Ga0265330_10021550 Ga0265330_100215502 118
909 3300031240 Ga0265320_10052314 Ga0265320_100523143 118
910 3300031247 Ga0265340_10020712 Ga0265340_100207121 118
911 3300031250 Ga0265331_10256016 Ga0265331_102560162 118
912 3300031251 Ga0265327_10047790 Ga0265327_100477904 118
913 3300031344 Ga0265316_10010198 Ga0265316_100101985 118
914 3300031344 Ga0265316_10327849 Ga0265316_103278492 118
915 3300031711 Ga0265314_10029645 Ga0265314_100296455 118
916 3300031712 Ga0265342_10033446 Ga0265342_100334461 118
917 3300034818 Ga0373950_0047168 Ga0373950_0047168_209_565 118
918 3300035170 Ga0373943_0294903 Ga0373943_0294903_450_809 118
919 3300035692 Ga0373935_0875574 Ga0373935_0875574_278_634 118
920 3300037312 Ga0395899_0179076 Ga0395899_0179076_997_1368 118
921 3300037418 Ga0395900_0049205 Ga0395900_0049205_3269_3640 118
922 3300037418 Ga0395900_1300897 Ga0395900_1300897_209_595 118
923 3300037466 Ga0395898_0020346 Ga0395898_0020346_4369_4740 118
924 3300037471 Ga0395905_0066504 Ga0395905_0066504_2220_2591 118
925 3300038443 Ga0395901_0020884 Ga0395901_0020884_4319_4690 118
926 3300038698 Ga0242419_020830 Ga0242419_020830_31_411 118
927 3300041411 Ga0439466_0033807 Ga0439466_0033807_134_505 118
928 3300041413 Ga0439465_0161717 Ga0439465_0161717_156_527 118
929 3300042012 Ga0439455_0067033 Ga0439455_0067033_563_928 118
930 3300044694 Ga0466963_0468182 Ga0466963_0468182_79_441 118
931 3300044901 Ga0466960_0031228 Ga0466960_0031228_1433_1798 118
932 3300045051 Ga0451576_0165698 Ga0451576_0165698_573_938 118
933 3300045976 Ga0466967_1420019 Ga0466967_1420019_39_401 118
934 3300046459 Ga0495629_0303650 Ga0495629_0303650_650_1039 118
935 3300046529 Ga0495652_0343358 Ga0495652_0343358_531_920 118
936 3300046533 Ga0495640_0269196 Ga0495640_0269196_117_506 118
937 3300046535 Ga0495586_0468048 Ga0495586_0468048_305_688 118
938 3300046559 Ga0495667_0097742 Ga0495667_0097742_441_824 118
939 3300046663 Ga0495635_0049127 Ga0495635_0049127_859_1242 118
940 3300046689 Ga0495613_0123142 Ga0495613_0123142_677_1060 118
941 3300046690 Ga0495624_0542786 Ga0495624_0542786_238_621 118
942 3300047322 Ga0495680_0161405 Ga0495680_0161405_382_765 118
943 3300048903 Ga0496100_0940393 Ga0496100_0940393_181_540 118
944 3300048904 Ga0496101_1250247 Ga0496101_1250247_64_441 118
945 3300048907 Ga0496104_0173013 Ga0496104_0173013_189_566 118
946 3300048914 Ga0496111_0513683 Ga0496111_0513683_91_474 118
947 3300048915 Ga0496112_0164303 Ga0496112_0164303_287_658 118
948 3300048915 Ga0496112_0716751 Ga0496112_0716751_440_829 118
949 3300048917 Ga0496114_0066173 Ga0496114_0066173_864_1235 118
950 3300048918 Ga0496115_0191882 Ga0496115_0191882_1251_1628 118
951 3300048918 Ga0496115_0221916 Ga0496115_0221916_1071_1436 118
952 3300049568 Ga0501031_0777790 Ga0501031_0777790_167_523 118
953 3300049578 Ga0501042_1414901 Ga0501042_1414901_87_443 118
954 3300049591 Ga0501075_1421471 Ga0501075_1421471_99_455 118
955 3300049742 Ga0501080_1182316 Ga0501080_1182316_135_506 118
956 3300049743 Ga0501081_0771382 Ga0501081_0771382_25_408 118
957 3300050514 nmdc:mga08x19_588129_c1 nmdc:mga08x19_588129_c1_392_775 118
958 3300053085 Ga0495619_0045013 Ga0495619_0045013_913_1296 118
959 3300059652 Ga0587107_127080 Ga0587107_127080_125_514 118
960 3300061734 Ga0530510_0063356 Ga0530510_0063356_28_399 118
961 3300000041 ARcpr5oldR_c018612 ARcpr5oldR_0186122 120
962 3300000044 ARSoilOldRDRAFT_c014836 ARSoilOldRDRAFT_0148362 120
963 3300001989 JGI24739J22299_10043588 JGI24739J22299_100435883 120
964 3300001991 JGI24743J22301_10041519 JGI24743J22301_100415191 120
965 3300002073 JGI24745J21846_1013727 JGI24745J21846_10137272 120
966 3300002073 JGI24745J21846_1016072 JGI24745J21846_10160721 120
967 3300002075 JGI24738J21930_10009170 JGI24738J21930_100091704 120
968 3300002077 JGI24744J21845_10012243 JGI24744J21845_100122431 120
969 3300003203 JGI25406J46586_10016584 JGI25406J46586_100165844 120
970 3300005327 Ga0070658_10029938 Ga0070658_100299384 120
971 3300005328 Ga0070676_10214378 Ga0070676_102143781 120
972 3300005329 Ga0070683_100124901 Ga0070683_1001249013 120
973 3300005329 Ga0070683_100280578 Ga0070683_1002805782 120
974 3300005331 Ga0070670_100599445 Ga0070670_1005994451 120
975 3300005333 Ga0070677_10623654 Ga0070677_106236541 120
976 3300005334 Ga0068869_100072127 Ga0068869_1000721274 120
977 3300005334 Ga0068869_101066398 Ga0068869_1010663981 120
978 3300005336 Ga0070680_100618691 Ga0070680_1006186912 120
979 3300005337 Ga0070682_101105258 Ga0070682_1011052582 120
980 3300005338 Ga0068868_100153201 Ga0068868_1001532014 120
981 3300005339 Ga0070660_100088230 Ga0070660_1000882303 120
982 3300005340 Ga0070689_100048614 Ga0070689_1000486144 120
983 3300005341 Ga0070691_10010224 Ga0070691_100102244 120
984 3300005343 Ga0070687_100055214 Ga0070687_1000552141 120
985 3300005344 Ga0070661_100136430 Ga0070661_1001364304 120
986 3300005345 Ga0070692_10016994 Ga0070692_100169944 120
987 3300005345 Ga0070692_10075547 Ga0070692_100755472 120
988 3300005345 Ga0070692_10242160 Ga0070692_102421602 120
989 3300005347 Ga0070668_100162934 Ga0070668_1001629343 120
990 3300005347 Ga0070668_100223003 Ga0070668_1002230033 120
991 3300005353 Ga0070669_100367195 Ga0070669_1003671952 120
992 3300005354 Ga0070675_100045693 Ga0070675_1000456933 120
993 3300005354 Ga0070675_100349785 Ga0070675_1003497852 120
994 3300005354 Ga0070675_100528356 Ga0070675_1005283562 120
995 3300005356 Ga0070674_100056971 Ga0070674_1000569713 120
996 3300005356 Ga0070674_100422954 Ga0070674_1004229542 120
997 3300005364 Ga0070673_100088994 Ga0070673_1000889942 120
998 3300005364 Ga0070673_100280897 Ga0070673_1002808972 120
999 3300005365 Ga0070688_100061436 Ga0070688_1000614364 120
1000 3300005365 Ga0070688_100344828 Ga0070688_1003448282 120
1001 3300005366 Ga0070659_100058795 Ga0070659_1000587954 120
1002 3300005366 Ga0070659_100316783 Ga0070659_1003167831 120
1003 3300005366 Ga0070659_100695711 Ga0070659_1006957111 120
1004 3300005438 Ga0070701_10397838 Ga0070701_103978382 120
1005 3300005440 Ga0070705_100087954 Ga0070705_1000879542 120
1006 3300005441 Ga0070700_100099828 Ga0070700_1000998283 120
1007 3300005441 Ga0070700_101723793 Ga0070700_1017237931 120
1008 3300005456 Ga0070678_100570611 Ga0070678_1005706111 120
1009 3300005456 Ga0070678_101498927 Ga0070678_1014989272 120
1010 3300005457 Ga0070662_100034293 Ga0070662_1000342934 120
1011 3300005457 Ga0070662_100178742 Ga0070662_1001787422 120
1012 3300005457 Ga0070662_100749667 Ga0070662_1007496671 120
1013 3300005458 Ga0070681_10089523 Ga0070681_100895234 120
1014 3300005458 Ga0070681_10327004 Ga0070681_103270043 120
1015 3300005458 Ga0070681_11022020 Ga0070681_110220202 120
1016 3300005467 Ga0070706_100772351 Ga0070706_1007723511 120
1017 3300005530 Ga0070679_101091612 Ga0070679_1010916122 120
1018 3300005535 Ga0070684_100023810 Ga0070684_1000238103 120
1019 3300005535 Ga0070684_100161577 Ga0070684_1001615772 120
1020 3300005535 Ga0070684_100203231 Ga0070684_1002032312 120
1021 3300005535 Ga0070684_101078195 Ga0070684_1010781952 120
1022 3300005539 Ga0068853_100108159 Ga0068853_1001081592 120
1023 3300005539 Ga0068853_100118772 Ga0068853_1001187723 120
1024 3300005543 Ga0070672_100040791 Ga0070672_1000407914 120
1025 3300005543 Ga0070672_100495475 Ga0070672_1004954752 120
1026 3300005543 Ga0070672_100682032 Ga0070672_1006820322 120
1027 3300005544 Ga0070686_100072561 Ga0070686_1000725614 120
1028 3300005544 Ga0070686_100693319 Ga0070686_1006933192 120
1029 3300005545 Ga0070695_101128024 Ga0070695_1011280241 120
1030 3300005547 Ga0070693_100028406 Ga0070693_1000284064 120
1031 3300005547 Ga0070693_100442881 Ga0070693_1004428812 120
1032 3300005548 Ga0070665_100102205 Ga0070665_1001022053 120
1033 3300005548 Ga0070665_100721772 Ga0070665_1007217721 120
1034 3300005549 Ga0070704_100081925 Ga0070704_1000819253 120
1035 3300005563 Ga0068855_100052751 Ga0068855_1000527514 120
1036 3300005564 Ga0070664_100109412 Ga0070664_1001094124 120
1037 3300005564 Ga0070664_100141117 Ga0070664_1001411174 120
1038 3300005564 Ga0070664_100466168 Ga0070664_1004661682 120
1039 3300005577 Ga0068857_100750415 Ga0068857_1007504152 120
1040 3300005577 Ga0068857_101349131 Ga0068857_1013491312 120
1041 3300005578 Ga0068854_100092207 Ga0068854_1000922071 120
1042 3300005578 Ga0068854_100593144 Ga0068854_1005931442 120
1043 3300005578 Ga0068854_100614220 Ga0068854_1006142202 120
1044 3300005615 Ga0070702_100063509 Ga0070702_1000635093 120
1045 3300005615 Ga0070702_100507449 Ga0070702_1005074492 120
1046 3300005616 Ga0068852_100070976 Ga0068852_1000709764 120
1047 3300005616 Ga0068852_100099570 Ga0068852_1000995703 120
1048 3300005617 Ga0068859_101091363 Ga0068859_1010913632 120
1049 3300005618 Ga0068864_100584236 Ga0068864_1005842361 120
1050 3300005618 Ga0068864_100817564 Ga0068864_1008175641 120
1051 3300005718 Ga0068866_10016635 Ga0068866_100166352 120
1052 3300005718 Ga0068866_10136568 Ga0068866_101365682 120
1053 3300005834 Ga0068851_10033473 Ga0068851_100334734 120
1054 3300005834 Ga0068851_10455370 Ga0068851_104553702 120
1055 3300005840 Ga0068870_10225408 Ga0068870_102254082 120
1056 3300005840 Ga0068870_10388004 Ga0068870_103880041 120
1057 3300005840 Ga0068870_10611433 Ga0068870_106114332 120
1058 3300005841 Ga0068863_100539658 Ga0068863_1005396583 120
1059 3300005842 Ga0068858_100839874 Ga0068858_1008398742 120
1060 3300005842 Ga0068858_101226178 Ga0068858_1012261782 120
1061 3300005843 Ga0068860_100044311 Ga0068860_1000443116 120
1062 3300005844 Ga0068862_100376068 Ga0068862_1003760682 120
1063 3300005844 Ga0068862_100818003 Ga0068862_1008180032 120
1064 3300005937 Ga0081455_10094945 Ga0081455_100949454 120
1065 3300005985 Ga0081539_10000200 Ga0081539_1000020029 120
1066 3300006042 Ga0075368_10094774 Ga0075368_100947742 120
1067 3300006048 Ga0075363_100205666 Ga0075363_1002056662 120
1068 3300006058 Ga0075432_10003840 Ga0075432_100038404 120
1069 3300006058 Ga0075432_10123707 Ga0075432_101237072 120
1070 3300006058 Ga0075432_10358228 Ga0075432_103582281 120
1071 3300006178 Ga0075367_10065198 Ga0075367_100651984 120
1072 3300006237 Ga0097621_100074987 Ga0097621_1000749873 120
1073 3300006237 Ga0097621_100303055 Ga0097621_1003030552 120
1074 3300006358 Ga0068871_101046338 Ga0068871_1010463381 120
1075 3300006844 Ga0075428_100007989 Ga0075428_1000079897 120
1076 3300006844 Ga0075428_100445810 Ga0075428_1004458102 120
1077 3300006852 Ga0075433_10055523 Ga0075433_100555234 120
1078 3300006881 Ga0068865_100048860 Ga0068865_1000488604 120
1079 3300006881 Ga0068865_101000886 Ga0068865_1010008861 120
1080 3300006931 Ga0097620_101091147 Ga0097620_1010911472 120
1081 3300009094 Ga0111539_10005906 Ga0111539_100059068 120
1082 3300009094 Ga0111539_10121293 Ga0111539_101212933 120
1083 3300009094 Ga0111539_10329889 Ga0111539_103298893 120
1084 3300009094 Ga0111539_11079746 Ga0111539_110797461 120
1085 3300009094 Ga0111539_11758956 Ga0111539_117589562 120
1086 3300009098 Ga0105245_10099412 Ga0105245_100994124 120
1087 3300009098 Ga0105245_10440039 Ga0105245_104400392 120
1088 3300009147 Ga0114129_10032301 Ga0114129_100323014 120
1089 3300009147 Ga0114129_10602774 Ga0114129_106027742 120
1090 3300009147 Ga0114129_11975623 Ga0114129_119756231 120
1091 3300009148 Ga0105243_10045850 Ga0105243_100458503 120
1092 3300009148 Ga0105243_10065608 Ga0105243_100656083 120
1093 3300009148 Ga0105243_10458573 Ga0105243_104585732 120
1094 3300009148 Ga0105243_11618832 Ga0105243_116188322 120
1095 3300009174 Ga0105241_10063555 Ga0105241_100635554 120
1096 3300009176 Ga0105242_10290555 Ga0105242_102905553 120
1097 3300009176 Ga0105242_10455064 Ga0105242_104550641 120
1098 3300009176 Ga0105242_11050675 Ga0105242_110506751 120
1099 3300009177 Ga0105248_10055520 Ga0105248_100555205 120
1100 3300009177 Ga0105248_10267784 Ga0105248_102677842 120
1101 3300009545 Ga0105237_10258715 Ga0105237_102587151 120
1102 3300009551 Ga0105238_10082188 Ga0105238_100821883 120
1103 3300009553 Ga0105249_10079948 Ga0105249_100799482 120
1104 3300009553 Ga0105249_13331295 Ga0105249_133312951 120
1105 3300010375 Ga0105239_10233302 Ga0105239_102333022 120
1106 3300010375 Ga0105239_10551793 Ga0105239_105517932 120
1107 3300011119 Ga0105246_10261586 Ga0105246_102615862 120
1108 3300013104 Ga0157370_10205076 Ga0157370_102050764 120
1109 3300013296 Ga0157374_10158520 Ga0157374_101585202 120
1110 3300013307 Ga0157372_10089598 Ga0157372_100895984 120
1111 3300013307 Ga0157372_10424498 Ga0157372_104244982 120
1112 3300013307 Ga0157372_11993383 Ga0157372_119933832 120
1113 3300013308 Ga0157375_10038081 Ga0157375_100380812 120
1114 3300013308 Ga0157375_10197601 Ga0157375_101976013 120
1115 3300013308 Ga0157375_10293606 Ga0157375_102936064 120
1116 3300014325 Ga0163163_10056026 Ga0163163_100560263 120
1117 3300014325 Ga0163163_10361202 Ga0163163_103612023 120
1118 3300014325 Ga0163163_11720790 Ga0163163_117207901 120
1119 3300014325 Ga0163163_11792278 Ga0163163_117922781 120
1120 3300014326 Ga0157380_10031685 Ga0157380_100316853 120
1121 3300014326 Ga0157380_10114211 Ga0157380_101142113 120
1122 3300014745 Ga0157377_10096751 Ga0157377_100967513 120
1123 3300014745 Ga0157377_10175205 Ga0157377_101752052 120
1124 3300014745 Ga0157377_11063525 Ga0157377_110635251 120
1125 3300014968 Ga0157379_10379133 Ga0157379_103791333 120
1126 3300014968 Ga0157379_12492212 Ga0157379_124922121 120
1127 3300014969 Ga0157376_10091007 Ga0157376_100910072 120
1128 3300014969 Ga0157376_10684308 Ga0157376_106843082 120
1129 3300014969 Ga0157376_10893563 Ga0157376_108935632 120
1130 3300017792 Ga0163161_10202882 Ga0163161_102028823 120
1131 3300025321 Ga0207656_10099563 Ga0207656_100995631 120
1132 3300025885 Ga0207653_10325785 Ga0207653_103257851 120
1133 3300025893 Ga0207682_10387583 Ga0207682_103875831 120
1134 3300025899 Ga0207642_10010352 Ga0207642_100103522 120
1135 3300025901 Ga0207688_10013564 Ga0207688_100135645 120
1136 3300025901 Ga0207688_10059697 Ga0207688_100596973 120
1137 3300025903 Ga0207680_10459245 Ga0207680_104592452 120
1138 3300025907 Ga0207645_10108585 Ga0207645_101085853 120
1139 3300025907 Ga0207645_10258496 Ga0207645_102584962 120
1140 3300025908 Ga0207643_10033195 Ga0207643_100331954 120
1141 3300025908 Ga0207643_10049089 Ga0207643_100490892 120
1142 3300025908 Ga0207643_10230264 Ga0207643_102302642 120
1143 3300025909 Ga0207705_11501303 Ga0207705_115013031 120
1144 3300025912 Ga0207707_11156135 Ga0207707_111561351 120
1145 3300025918 Ga0207662_10082152 Ga0207662_100821524 120
1146 3300025919 Ga0207657_10024564 Ga0207657_100245644 120
1147 3300025919 Ga0207657_10377706 Ga0207657_103777062 120
1148 3300025921 Ga0207652_10195518 Ga0207652_101955184 120
1149 3300025921 Ga0207652_10214056 Ga0207652_102140564 120
1150 3300025923 Ga0207681_10297453 Ga0207681_102974532 120
1151 3300025924 Ga0207694_10133467 Ga0207694_101334674 120
1152 3300025924 Ga0207694_10844290 Ga0207694_108442902 120
1153 3300025925 Ga0207650_10207686 Ga0207650_102076863 120
1154 3300025926 Ga0207659_11159924 Ga0207659_111599242 120
1155 3300025926 Ga0207659_11438065 Ga0207659_114380652 120
1156 3300025927 Ga0207687_10026498 Ga0207687_100264984 120
1157 3300025927 Ga0207687_10205192 Ga0207687_102051922 120
1158 3300025927 Ga0207687_10304971 Ga0207687_103049713 120
1159 3300025931 Ga0207644_10241726 Ga0207644_102417262 120
1160 3300025931 Ga0207644_10450718 Ga0207644_104507181 120
1161 3300025932 Ga0207690_10118310 Ga0207690_101183102 120
1162 3300025932 Ga0207690_10151441 Ga0207690_101514412 120
1163 3300025932 Ga0207690_10160963 Ga0207690_101609631 120
1164 3300025933 Ga0207706_10040968 Ga0207706_100409684 120
1165 3300025933 Ga0207706_10149522 Ga0207706_101495222 120
1166 3300025933 Ga0207706_10203550 Ga0207706_102035502 120
1167 3300025933 Ga0207706_10213715 Ga0207706_102137153 120
1168 3300025934 Ga0207686_10073981 Ga0207686_100739814 120
1169 3300025934 Ga0207686_10081334 Ga0207686_100813343 120
1170 3300025935 Ga0207709_10026050 Ga0207709_100260505 120
1171 3300025935 Ga0207709_10104363 Ga0207709_101043631 120
1172 3300025935 Ga0207709_10457446 Ga0207709_104574461 120
1173 3300025936 Ga0207670_10076864 Ga0207670_100768644 120
1174 3300025936 Ga0207670_10091541 Ga0207670_100915414 120
1175 3300025937 Ga0207669_11239637 Ga0207669_112396371 120
1176 3300025938 Ga0207704_10148550 Ga0207704_101485504 120
1177 3300025940 Ga0207691_10104442 Ga0207691_101044422 120
1178 3300025941 Ga0207711_10554850 Ga0207711_105548502 120
1179 3300025942 Ga0207689_10096263 Ga0207689_100962634 120
1180 3300025942 Ga0207689_10109310 Ga0207689_101093103 120
1181 3300025942 Ga0207689_10225654 Ga0207689_102256542 120
1182 3300025944 Ga0207661_10220679 Ga0207661_102206794 120
1183 3300025944 Ga0207661_10321855 Ga0207661_103218553 120
1184 3300025944 Ga0207661_11910048 Ga0207661_119100482 120
1185 3300025945 Ga0207679_10201069 Ga0207679_102010694 120
1186 3300025945 Ga0207679_10449805 Ga0207679_104498052 120
1187 3300025945 Ga0207679_10553567 Ga0207679_105535672 120
1188 3300025949 Ga0207667_11075681 Ga0207667_110756811 120
1189 3300025961 Ga0207712_10572621 Ga0207712_105726212 120
1190 3300025972 Ga0207668_10154482 Ga0207668_101544824 120
1191 3300025972 Ga0207668_10384882 Ga0207668_103848822 120
1192 3300025972 Ga0207668_11846692 Ga0207668_118466921 120
1193 3300025981 Ga0207640_10200161 Ga0207640_102001613 120
1194 3300025981 Ga0207640_10657036 Ga0207640_106570362 120
1195 3300025986 Ga0207658_11847008 Ga0207658_118470081 120
1196 3300026023 Ga0207677_10137651 Ga0207677_101376513 120
1197 3300026023 Ga0207677_10647479 Ga0207677_106474792 120
1198 3300026035 Ga0207703_10149599 Ga0207703_101495993 120
1199 3300026035 Ga0207703_10298597 Ga0207703_102985972 120
1200 3300026041 Ga0207639_10159022 Ga0207639_101590224 120
1201 3300026041 Ga0207639_10340844 Ga0207639_103408443 120
1202 3300026041 Ga0207639_11529900 Ga0207639_115299002 120
1203 3300026067 Ga0207678_10073033 Ga0207678_100730334 120
1204 3300026067 Ga0207678_10175787 Ga0207678_101757873 120
1205 3300026067 Ga0207678_11172123 Ga0207678_111721231 120
1206 3300026075 Ga0207708_10019061 Ga0207708_100190615 120
1207 3300026075 Ga0207708_10517923 Ga0207708_105179231 120
1208 3300026075 Ga0207708_10591980 Ga0207708_105919802 120
1209 3300026088 Ga0207641_10155609 Ga0207641_101556094 120
1210 3300026088 Ga0207641_11178859 Ga0207641_111788592 120
1211 3300026089 Ga0207648_10115346 Ga0207648_101153463 120
1212 3300026089 Ga0207648_10203638 Ga0207648_102036383 120
1213 3300026089 Ga0207648_10763094 Ga0207648_107630941 120
1214 3300026089 Ga0207648_11863577 Ga0207648_118635771 120
1215 3300026095 Ga0207676_11386908 Ga0207676_113869081 120
1216 3300026116 Ga0207674_10279683 Ga0207674_102796834 120
1217 3300026118 Ga0207675_100398121 Ga0207675_1003981213 120
1218 3300026121 Ga0207683_10231428 Ga0207683_102314282 120
1219 3300026121 Ga0207683_10336592 Ga0207683_103365922 120
1220 3300026142 Ga0207698_10663964 Ga0207698_106639642 120
1221 3300027907 Ga0207428_10000244 Ga0207428_1000024448 120
1222 3300027907 Ga0207428_10190763 Ga0207428_101907633 120
1223 3300027907 Ga0207428_10341436 Ga0207428_103414362 120
1224 3300028379 Ga0268266_10127491 Ga0268266_101274911 120
1225 3300028380 Ga0268265_10224947 Ga0268265_102249473 120
1226 3300028380 Ga0268265_10837575 Ga0268265_108375752 120
1227 3300028381 Ga0268264_10288350 Ga0268264_102883502 120
1228 3300031995 Ga0307409_102512958 Ga0307409_1025129582 120
1229 3300032002 Ga0307416_100259067 Ga0307416_1002590672 120
1230 3300034816 Ga0373930_0085012 Ga0373930_0085012_348_710 120
1231 3300034819 Ga0373958_0164461 Ga0373958_0164461_31_393 120
1232 3300034957 Ga0373938_0017268 Ga0373938_0017268_185_547 120
1233 3300035088 Ga0373940_0088428 Ga0373940_0088428_500_862 120
1234 3300035090 Ga0373949_0024504 Ga0373949_0024504_969_1331 120
1235 3300035092 Ga0373952_0045527 Ga0373952_0045527_76_438 120
1236 3300035114 Ga0373939_0057850 Ga0373939_0057850_457_819 120
1237 3300035121 Ga0373960_0007134 Ga0373960_0007134_1457_1819 120
1238 3300035207 Ga0373942_0077751 Ga0373942_0077751_275_637 120
1239 3300035241 Ga0373961_0363333 Ga0373961_0363333_124_486 120
1240 3300035242 Ga0373962_0066725 Ga0373962_0066725_635_997 120
1241 3300035691 Ga0373931_0080509 Ga0373931_0080509_128_490 120
1242 3300037471 Ga0395905_1791465 Ga0395905_1791465_39_401 120
1243 3300038443 Ga0395901_1515472 Ga0395901_1515472_157_519 120
1244 3300041492 Ga0451835_0827331 Ga0451835_0827331_61_423 120
1245 3300041501 Ga0451845_0252246 Ga0451845_0252246_725_1087 120
1246 3300042016 Ga0439463_186578 Ga0439463_186578_155_517 120
1247 3300042115 Ga0450911_053899 Ga0450911_053899_58_420 120
1248 3300042122 Ga0450920_045646 Ga0450920_045646_180_542 120
1249 3300042125 Ga0450923_002353 Ga0450923_002353_1394_1756 120
1250 3300042145 Ga0450906_007163 Ga0450906_007163_1476_1838 120
1251 3300042146 Ga0450907_032012 Ga0450907_032012_76_438 120
1252 3300042147 Ga0450910_021902 Ga0450910_021902_449_811 120
1253 3300042184 Ga0450908_021794 Ga0450908_021794_367_729 120
1254 3300045051 Ga0451576_1846427 Ga0451576_1846427_57_419 120
1255 3300046491 Ga0495584_0301353 Ga0495584_0301353_320_682 120
1256 3300046500 Ga0495596_0070800 Ga0495596_0070800_357_719 120
1257 3300046513 Ga0495616_0223921 Ga0495616_0223921_303_665 120
1258 3300046518 Ga0495631_0403611 Ga0495631_0403611_174_536 120
1259 3300046523 Ga0495644_0091022 Ga0495644_0091022_75_437 120
1260 3300046525 Ga0495663_0059385 Ga0495663_0059385_478_840 120
1261 3300046538 Ga0495609_0302068 Ga0495609_0302068_97_459 120
1262 3300046810 Ga0495660_0173154 Ga0495660_0173154_377_739 120
1263 3300047446 Ga0495679_196837 Ga0495679_196837_130_492 120
1264 3300048903 Ga0496100_0545393 Ga0496100_0545393_387_749 120
1265 3300048903 Ga0496100_1162324 Ga0496100_1162324_140_502 120
1266 3300048904 Ga0496101_0185344 Ga0496101_0185344_106_468 120
1267 3300048904 Ga0496101_1068342 Ga0496101_1068342_146_508 120
1268 3300048905 Ga0496102_0832623 Ga0496102_0832623_41_403 120
1269 3300048905 Ga0496102_1873517 Ga0496102_1873517_112_474 120
1270 3300048909 Ga0496106_0065489 Ga0496106_0065489_1689_2051 120
1271 3300048911 Ga0496108_0005258 Ga0496108_0005258_9662_10024 120
1272 3300048911 Ga0496108_0377813 Ga0496108_0377813_489_851 120
1273 3300048912 Ga0496109_0495362 Ga0496109_0495362_112_474 120
1274 3300048912 Ga0496109_0610129 Ga0496109_0610129_236_598 120
1275 3300048913 Ga0496110_0051862 Ga0496110_0051862_418_780 120
1276 3300048913 Ga0496110_0194078 Ga0496110_0194078_980_1342 120
1277 3300048913 Ga0496110_0426227 Ga0496110_0426227_480_842 120
1278 3300048914 Ga0496111_0023057 Ga0496111_0023057_1877_2239 120
1279 3300048917 Ga0496114_0399995 Ga0496114_0399995_818_1180 120
1280 3300049568 Ga0501031_0003668 Ga0501031_0003668_5947_6309 120
1281 3300049568 Ga0501031_0388328 Ga0501031_0388328_293_655 120
1282 3300049569 Ga0501032_0067586 Ga0501032_0067586_1950_2312 120
1283 3300049569 Ga0501032_0755398 Ga0501032_0755398_198_560 120
1284 3300049570 Ga0501033_0020560 Ga0501033_0020560_286_648 120
1285 3300049572 Ga0501036_0004682 Ga0501036_0004682_5148_5510 120
1286 3300049572 Ga0501036_0249966 Ga0501036_0249966_1093_1455 120
1287 3300049573 Ga0501037_0546047 Ga0501037_0546047_124_486 120
1288 3300049573 Ga0501037_0879299 Ga0501037_0879299_117_479 120
1289 3300049574 Ga0501038_0028547 Ga0501038_0028547_3973_4335 120
1290 3300049574 Ga0501038_0094451 Ga0501038_0094451_136_498 120
1291 3300049574 Ga0501038_0229671 Ga0501038_0229671_95_457 120
1292 3300049574 Ga0501038_0773725 Ga0501038_0773725_158_520 120
1293 3300049575 Ga0501039_0087912 Ga0501039_0087912_79_441 120
1294 3300049576 Ga0501040_0062753 Ga0501040_0062753_897_1259 120
1295 3300049576 Ga0501040_0116265 Ga0501040_0116265_417_779 120
1296 3300049576 Ga0501040_0516588 Ga0501040_0516588_232_594 120
1297 3300049577 Ga0501041_0285222 Ga0501041_0285222_47_409 120
1298 3300049578 Ga0501042_0400622 Ga0501042_0400622_579_941 120
1299 3300049578 Ga0501042_0531251 Ga0501042_0531251_184_546 120
1300 3300049579 Ga0501043_0278632 Ga0501043_0278632_505_867 120
1301 3300049580 Ga0501046_0030209 Ga0501046_0030209_1778_2140 120
1302 3300049580 Ga0501046_0655076 Ga0501046_0655076_121_483 120
1303 3300049581 Ga0501047_1239987 Ga0501047_1239987_184_546 120
1304 3300049582 Ga0501048_0036518 Ga0501048_0036518_1153_1515 120
1305 3300049584 Ga0501068_0152090 Ga0501068_0152090_363_725 120
1306 3300049584 Ga0501068_0324915 Ga0501068_0324915_37_399 120
1307 3300049584 Ga0501068_0411074 Ga0501068_0411074_273_635 120
1308 3300049584 Ga0501068_0828180 Ga0501068_0828180_148_510 120
1309 3300049585 Ga0501069_0010100 Ga0501069_0010100_3847_4209 120
1310 3300049585 Ga0501069_0042030 Ga0501069_0042030_924_1286 120
1311 3300049585 Ga0501069_0280448 Ga0501069_0280448_520_882 120
1312 3300049586 Ga0501070_0042585 Ga0501070_0042585_3173_3535 120
1313 3300049586 Ga0501070_0189033 Ga0501070_0189033_701_1063 120
1314 3300049587 Ga0501071_0026831 Ga0501071_0026831_2996_3358 120
1315 3300049587 Ga0501071_0038822 Ga0501071_0038822_1823_2185 120
1316 3300049587 Ga0501071_0400128 Ga0501071_0400128_311_673 120
1317 3300049587 Ga0501071_1129309 Ga0501071_1129309_43_405 120
1318 3300049588 Ga0501072_0031320 Ga0501072_0031320_3704_4066 120
1319 3300049588 Ga0501072_0091769 Ga0501072_0091769_669_1031 120
1320 3300049588 Ga0501072_0341212 Ga0501072_0341212_623_985 120
1321 3300049588 Ga0501072_0349265 Ga0501072_0349265_550_912 120
1322 3300049589 Ga0501073_0024570 Ga0501073_0024570_108_470 120
1323 3300049589 Ga0501073_0166950 Ga0501073_0166950_919_1281 120
1324 3300049590 Ga0501074_0010330 Ga0501074_0010330_1952_2314 120
1325 3300049590 Ga0501074_0223282 Ga0501074_0223282_275_637 120
1326 3300049591 Ga0501075_0078782 Ga0501075_0078782_753_1115 120
1327 3300049591 Ga0501075_0179517 Ga0501075_0179517_1131_1493 120
1328 3300049592 Ga0501076_0033353 Ga0501076_0033353_2376_2738 120
1329 3300049592 Ga0501076_0397219 Ga0501076_0397219_273_635 120
1330 3300049592 Ga0501076_1063426 Ga0501076_1063426_140_502 120
1331 3300049593 Ga0501077_0001392 Ga0501077_0001392_5872_6234 120
1332 3300049593 Ga0501077_0021877 Ga0501077_0021877_3591_3953 120
1333 3300049593 Ga0501077_0029897 Ga0501077_0029897_493_855 120
1334 3300049741 Ga0501079_0014430 Ga0501079_0014430_5376_5738 120
1335 3300049741 Ga0501079_0040024 Ga0501079_0040024_1975_2337 120
1336 3300049741 Ga0501079_0105914 Ga0501079_0105914_661_1023 120
1337 3300049741 Ga0501079_0548029 Ga0501079_0548029_157_519 120
1338 3300049741 Ga0501079_0602552 Ga0501079_0602552_96_458 120
1339 3300049742 Ga0501080_0013819 Ga0501080_0013819_5827_6189 120
1340 3300049742 Ga0501080_0031642 Ga0501080_0031642_214_576 120
1341 3300049742 Ga0501080_0642827 Ga0501080_0642827_540_902 120
1342 3300049742 Ga0501080_1403301 Ga0501080_1403301_66_428 120
1343 3300049743 Ga0501081_0015196 Ga0501081_0015196_1928_2290 120
1344 3300049743 Ga0501081_0049214 Ga0501081_0049214_1131_1493 120
1345 3300049743 Ga0501081_0076587 Ga0501081_0076587_755_1117 120
1346 3300049744 Ga0501083_0100326 Ga0501083_0100326_976_1338 120
1347 3300049822 Ga0501035_0004073 Ga0501035_0004073_8760_9122 120
1348 3300049823 Ga0501044_0264982 Ga0501044_0264982_1153_1515 120
1349 3300049824 Ga0501045_0012901 Ga0501045_0012901_4376_4738 120
1350 3300049824 Ga0501045_0241394 Ga0501045_0241394_307_669 120
1351 3300049824 Ga0501045_0984534 Ga0501045_0984534_209_571 120
1352 3300050490 nmdc:mga03n38_253063_c1 nmdc:mga03n38_253063_c1_189_551 120
1353 3300050491 nmdc:mga00v17_22035_c1 nmdc:mga00v17_22035_c1_2275_2637 120
1354 3300050492 nmdc:mga0yw44_22599_c1 nmdc:mga0yw44_22599_c1_2506_2868 120
1355 3300050507 nmdc:mga05p37_2214_c1 nmdc:mga05p37_2214_c1_15188_15550 120
1356 3300050507 nmdc:mga05p37_783995_c1 nmdc:mga05p37_783995_c1_331_693 120
1357 3300050511 nmdc:mga08y16_1835783_c1 nmdc:mga08y16_1835783_c1_10_372 120
1358 3300050511 nmdc:mga08y16_193359_c1 nmdc:mga08y16_193359_c1_1163_1525 120
1359 3300050511 nmdc:mga08y16_22993_c1 nmdc:mga08y16_22993_c1_5105_5467 120
1360 3300050513 nmdc:mga0rr50_1502412_c1 nmdc:mga0rr50_1502412_c1_90_452 120
1361 3300050515 nmdc:mga0a205_45194_c1 nmdc:mga0a205_45194_c1_1503_1865 120
1362 3300054114 Ga0501084_0008860 Ga0501084_0008860_3105_3467 120
1363 3300054114 Ga0501084_0019282 Ga0501084_0019282_2027_2389 120
1364 3300054114 Ga0501084_0910798 Ga0501084_0910798_151_513 120
1365 3300060353 Ga0501082_0144147 Ga0501082_0144147_1553_1915 120
1366 3300060353 Ga0501082_0193382 Ga0501082_0193382_255_617 120
1367 3300060353 Ga0501082_0269290 Ga0501082_0269290_38_400 120
1368 3300061734 Ga0530510_0008183 Ga0530510_0008183_1381_1743 120
1369 3300061734 Ga0530510_0198191 Ga0530510_0198191_608_970 120
1370 3300061734 Ga0530510_0900785 Ga0530510_0900785_16_378 120

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t62-assembly1.cif.gz_B crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984 0.7392 13 115
5y6c-assembly2.cif.gz_B crystal structure of zmasch s128a mutant protein from zymomonas mobilis 0.7336 5 114
3iuw-assembly1.cif.gz_A crystal structure of activating signal cointegrator (np_814290.1) from enterococcus faecalis v583 at 1.58 a resolution 0.721 2 115
5y6b-assembly4.cif.gz_D crystal structure of zmasch y47f mutant protein from zymomonas mobilis 0.7114 5 114
3s9x-assembly1.cif.gz_A high resolution crystal structure of asch domain from lactobacillus crispatus jv v101 0.7106 3 114
ID Description Score Start End Superfamily
af_Q57810_4_114_2.30.130.30 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7757 3 115 2.30.130.30
af_C7FZY0_1_99_2.30.130.30 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7743 3 115 2.30.130.30
af_Q57810_4_114_2.30.130.30 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7694 3 115 2.30.130.30
af_C7FZY0_1_99_2.30.130.30 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7677 3 115 2.30.130.30
af_Q9SRN6_105_211_2.30.130.30 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7247 3 115 2.30.130.30
ID Description Score Start End GO Terms
AF-A0A538J6V7-F1-model_v4 RNA-binding protein 0.9888 3 117
AF-A0A538J6V7-F1-model_v4 RNA-binding protein 0.9804 3 117
AF-A0A6J4TXZ1-F1-model_v4 ASCH domain-containing protein 0.9766 2 118
AF-A0A7W1GMC0-F1-model_v4 RNA-binding protein 0.9736 3 80
AF-A0A7V9KYV1-F1-model_v4 RNA-binding protein 0.9706 3 118

Feature Viewer

pLDDT pTM Quality
91.93 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map