F493452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1374 | 506 | 2748 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0063403|Ga0495654_0063403_341_1348 |
| Length | 335 |
| Sequence | MLAGPERKKKVDVLPGLGGREQKWWALLQLILVNKSNTVTFFVPWLAARPLRRLVCGFARGVLDGGRLASQLVAEHWQVHGLRRTVSNLPAGVIGVAGDLFSEQCPAAWPTGSLDYLVYSAAATDHDEAGYRTAYVEGLQHVLSWLKQHGQQPKRLLFVSSSSVYGQQQGEWVDETSPTVVGGYSGRLMLEAEQVALDSGIPASRVRLTGIYGPGREWLLSQVRQGYRVVIDPPLYANRIHADDAAGLLAFLLEADRQGQVLDDCYIGVDDAPAPLAEVVGWLREYMGVTDWAEDASVRRAGSKRCSNARAKALGWTPRYPSFREGYAAILEGRC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 38 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 39 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 40 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 98 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 104 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 105 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 108 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 121 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 122 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 123 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 124 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 125 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 126 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 127 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 129 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 130 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 133 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 134 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 135 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 136 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 137 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 138 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 139 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 140 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 141 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 142 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 143 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 144 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 145 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 146 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 147 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 148 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 149 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 150 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 151 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 152 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 153 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 154 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 155 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 156 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 157 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 158 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 159 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 160 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 161 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 162 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 163 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 164 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 259 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 278 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 279 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 280 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 281 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 282 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 283 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 284 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 285 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 286 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 287 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 288 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 289 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 290 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 291 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 292 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 293 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 294 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 295 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 296 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 297 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 298 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 299 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 300 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 301 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 302 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 303 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 304 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 305 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 306 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 307 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 308 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 309 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 310 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 311 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 312 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 313 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 314 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 315 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 316 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 317 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 318 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 319 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 320 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 321 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 322 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 323 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 324 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 325 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 326 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 327 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 328 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 329 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 330 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 331 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 332 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 333 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 334 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 335 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 336 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 337 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 338 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 339 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 340 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 341 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 342 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 343 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 344 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 345 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 346 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 347 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 348 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 349 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 350 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 351 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 352 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 353 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 354 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 355 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 356 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 357 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 358 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 359 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 360 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 361 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 362 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 363 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 364 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 365 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 366 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 367 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 368 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 369 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 370 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 371 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 372 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 373 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 374 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 375 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 376 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 377 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 378 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 379 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 380 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 381 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 382 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 383 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 384 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 385 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 386 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 387 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 388 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 389 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 390 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 391 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 392 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 393 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 394 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 395 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 396 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 397 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 398 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 399 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 400 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 401 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 402 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 403 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 404 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 405 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 406 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 407 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 408 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 409 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 410 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 411 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 412 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 413 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 414 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 415 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 416 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 417 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 418 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 419 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 420 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 421 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 422 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 423 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 424 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 425 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 426 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 427 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 428 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 429 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 430 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 431 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 432 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 433 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 434 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 435 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 436 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 437 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 438 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 439 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 440 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 441 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 442 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 443 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 444 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 445 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 446 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 447 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 448 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 449 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 450 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 451 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 452 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 453 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 454 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 455 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 456 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 457 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 458 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 459 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 460 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 461 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 462 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 463 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 464 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 465 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 466 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 467 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 468 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 469 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 470 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 471 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 472 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 473 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 474 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 475 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 476 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 477 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 478 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 479 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 480 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 481 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 482 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 483 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 484 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 485 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 486 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 487 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 488 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 489 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 490 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 491 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 492 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 493 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 494 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 495 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 496 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 497 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 498 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 499 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 500 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 501 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 502 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 503 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 504 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 505 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 506 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.41 |
| Metatranscriptomes | 0 |
| Isolates | 16.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.07 |
| Bulb | 0 |
| Endosphere | 5.46 |
| Nodule | 2.11 |
| Rhizoplane | 5.09 |
| Rhizosphere | 74.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495654_0063403 | 3300046530 | Bacteria | 1769 |
| 2 | MRS2a_Contig_294 | 2124908027 | Bacteria | 12815 |
| 3 | MRS2a_Contig_9369 | 2124908027 | Bacteria | 2291 |
| 4 | SwRhRL2b_contig_1966799 | 2162886007 | Bacteria | 2057 |
| 5 | JGI24741J21665_1001809 | 3300001915 | Bacteria | 5870 |
| 6 | JGI25162J39368_1000134 | 3300002737 | Bacteria | 79787 |
| 7 | JGI25154J39366_1008903 | 3300002738 | Bacteria | 1265 |
| 8 | JGI25163J39215_1001114 | 3300002771 | Bacteria | 5451 |
| 9 | JGI25163J39215_1001154 | 3300002771 | Bacteria | 5164 |
| 10 | JGI25164J39214_1000058 | 3300002772 | Bacteria | 112599 |
| 11 | JGI25164J39214_1000108 | 3300002772 | Bacteria | 79787 |
| 12 | JGI25165J46597_1000154 | 3300003214 | Bacteria | 112599 |
| 13 | JGI25165J46597_1000220 | 3300003214 | Bacteria | 79787 |
| 14 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 15 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 16 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 17 | Ga0055532_1000119 | 3300003758 | Bacteria | 83382 |
| 18 | Ga0055525_1000078 | 3300003759 | Bacteria | 165788 |
| 19 | Ga0055535_1006382 | 3300003761 | Bacteria | 2393 |
| 20 | Ga0055536_1007274 | 3300003781 | Bacteria | 4985 |
| 21 | Ga0055530_10001375 | 3300003791 | Bacteria | 18021 |
| 22 | Ga0055530_10001991 | 3300003791 | Bacteria | 13863 |
| 23 | Ga0055530_10007661 | 3300003791 | Bacteria | 4498 |
| 24 | Ga0055530_10027943 | 3300003791 | Bacteria | 1531 |
| 25 | Ga0055540_1000573 | 3300003792 | Bacteria | 27029 |
| 26 | Ga0055540_1001393 | 3300003792 | Bacteria | 14427 |
| 27 | Ga0055540_1001569 | 3300003792 | Bacteria | 13332 |
| 28 | Ga0055531_10000656 | 3300003794 | Bacteria | 29730 |
| 29 | Ga0055531_10001137 | 3300003794 | Bacteria | 20591 |
| 30 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 31 | Ga0058692_1003468 | 3300003856 | Bacteria | 4861 |
| 32 | Ga0065714_10009522 | 3300005288 | Bacteria | 3064 |
| 33 | Ga0065714_10015200 | 3300005288 | Bacteria | 1785 |
| 34 | Ga0065714_10065146 | 3300005288 | Bacteria | 12563 |
| 35 | Ga0065714_10066967 | 3300005288 | Bacteria | 6038 |
| 36 | Ga0065714_10072891 | 3300005288 | Bacteria | 3282 |
| 37 | Ga0065714_10079494 | 3300005288 | Bacteria | 2505 |
| 38 | Ga0065714_10143598 | 3300005288 | Bacteria | 1154 |
| 39 | Ga0065704_10010651 | 3300005289 | Bacteria | 2609 |
| 40 | Ga0065704_10077514 | 3300005289 | Bacteria | 4711 |
| 41 | Ga0065704_10137115 | 3300005289 | Bacteria | 1555 |
| 42 | Ga0065712_10001183 | 3300005290 | Bacteria | 7369 |
| 43 | Ga0065712_10082529 | 3300005290 | Bacteria | 2907 |
| 44 | Ga0070670_100019409 | 3300005331 | Bacteria | 5833 |
| 45 | Ga0070670_100027698 | 3300005331 | Bacteria | 4874 |
| 46 | Ga0070669_100002433 | 3300005353 | Bacteria | 13484 |
| 47 | Ga0070669_100003726 | 3300005353 | Bacteria | 11005 |
| 48 | Ga0070671_100499535 | 3300005355 | Bacteria | 1046 |
| 49 | Ga0070662_100000829 | 3300005457 | Bacteria | 19038 |
| 50 | Ga0068853_100000031 | 3300005539 | Bacteria | 116269 |
| 51 | Ga0070665_100148653 | 3300005548 | Bacteria | 2345 |
| 52 | Ga0070665_100185282 | 3300005548 | Bacteria | 2082 |
| 53 | Ga0070665_100207369 | 3300005548 | Bacteria | 1960 |
| 54 | Ga0070664_100001524 | 3300005564 | Bacteria | 18496 |
| 55 | Ga0070664_100044890 | 3300005564 | Bacteria | 3732 |
| 56 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 57 | Ga0075364_10046999 | 3300006051 | Bacteria | 2810 |
| 58 | Ga0075364_10088763 | 3300006051 | Bacteria | 2050 |
| 59 | Ga0075364_10110626 | 3300006051 | Bacteria | 1833 |
| 60 | Ga0075432_10000412 | 3300006058 | Bacteria | 12510 |
| 61 | Ga0075432_10006045 | 3300006058 | Bacteria | 4119 |
| 62 | Ga0075432_10008021 | 3300006058 | Bacteria | 3601 |
| 63 | Ga0075432_10017854 | 3300006058 | Bacteria | 2419 |
| 64 | Ga0075432_10120565 | 3300006058 | Bacteria | 985 |
| 65 | Ga0075362_10034071 | 3300006177 | Bacteria | 2218 |
| 66 | Ga0075369_10045574 | 3300006186 | Bacteria | 1886 |
| 67 | Ga0099823_1038305 | 3300006944 | Bacteria | 3582 |
| 68 | Ga0079104_1000284 | 3300006946 | Bacteria | 64795 |
| 69 | Ga0079104_1000886 | 3300006946 | Bacteria | 24528 |
| 70 | Ga0099826_10002232 | 3300006948 | Bacteria | 12374 |
| 71 | Ga0105251_10001196 | 3300009011 | Bacteria | 22461 |
| 72 | Ga0105251_10009478 | 3300009011 | Bacteria | 5747 |
| 73 | Ga0105251_10012583 | 3300009011 | Bacteria | 4781 |
| 74 | Ga0105251_10013465 | 3300009011 | Bacteria | 4576 |
| 75 | Ga0105251_10018627 | 3300009011 | Bacteria | 3685 |
| 76 | Ga0105251_10025492 | 3300009011 | Bacteria | 3024 |
| 77 | Ga0105251_10026343 | 3300009011 | Bacteria | 2961 |
| 78 | Ga0105251_10044876 | 3300009011 | Bacteria | 2133 |
| 79 | Ga0105251_10069214 | 3300009011 | Bacteria | 1646 |
| 80 | Ga0105251_10125263 | 3300009011 | Bacteria | 1166 |
| 81 | Ga0105244_10009507 | 3300009036 | Bacteria | 5972 |
| 82 | Ga0105244_10012536 | 3300009036 | Bacteria | 5001 |
| 83 | Ga0105244_10015359 | 3300009036 | Bacteria | 4393 |
| 84 | Ga0105244_10027116 | 3300009036 | Bacteria | 3091 |
| 85 | Ga0105244_10028468 | 3300009036 | Bacteria | 2996 |
| 86 | Ga0105244_10041959 | 3300009036 | Bacteria | 2369 |
| 87 | Ga0105244_10048944 | 3300009036 | Bacteria | 2162 |
| 88 | Ga0105244_10054751 | 3300009036 | Bacteria | 2023 |
| 89 | Ga0105244_10066152 | 3300009036 | Bacteria | 1810 |
| 90 | Ga0105244_10068381 | 3300009036 | Bacteria | 1775 |
| 91 | Ga0105244_10106032 | 3300009036 | Bacteria | 1371 |
| 92 | Ga0105250_10029995 | 3300009092 | Bacteria | 2187 |
| 93 | Ga0105250_10033832 | 3300009092 | Bacteria | 2052 |
| 94 | Ga0105250_10042322 | 3300009092 | Bacteria | 1825 |
| 95 | Ga0105250_10090839 | 3300009092 | Bacteria | 1242 |
| 96 | Ga0105243_10000232 | 3300009148 | Bacteria | 64359 |
| 97 | Ga0105243_10003694 | 3300009148 | Bacteria | 12301 |
| 98 | Ga0105243_10023482 | 3300009148 | Bacteria | 4696 |
| 99 | Ga0105243_10024566 | 3300009148 | Bacteria | 4597 |
| 100 | Ga0105243_10046467 | 3300009148 | Bacteria | 3415 |
| 101 | Ga0105242_10000836 | 3300009176 | Bacteria | 23975 |
| 102 | Ga0105242_10045090 | 3300009176 | Bacteria | 3572 |
| 103 | Ga0105248_10001345 | 3300009177 | Bacteria | 27389 |
| 104 | Ga0105237_10000838 | 3300009545 | Bacteria | 42017 |
| 105 | Ga0105237_10110977 | 3300009545 | Bacteria | 2734 |
| 106 | Ga0105249_10023854 | 3300009553 | Bacteria | 5495 |
| 107 | Ga0105246_10083743 | 3300011119 | Bacteria | 2280 |
| 108 | Ga0157345_1000496 | 3300012498 | Bacteria | 3698 |
| 109 | Ga0157373_10003336 | 3300013100 | Bacteria | 12129 |
| 110 | Ga0157373_10031756 | 3300013100 | Bacteria | 3801 |
| 111 | Ga0157373_10032030 | 3300013100 | Bacteria | 3785 |
| 112 | Ga0157373_10043856 | 3300013100 | Bacteria | 3194 |
| 113 | Ga0157373_10064652 | 3300013100 | Bacteria | 2589 |
| 114 | Ga0157373_10066311 | 3300013100 | Bacteria | 2554 |
| 115 | Ga0157373_10322362 | 3300013100 | Bacteria | 1099 |
| 116 | Ga0157371_10006749 | 3300013102 | Bacteria | 9382 |
| 117 | Ga0157371_10020411 | 3300013102 | Bacteria | 4875 |
| 118 | Ga0157371_10038180 | 3300013102 | Bacteria | 3436 |
| 119 | Ga0157371_10265330 | 3300013102 | Bacteria | 1238 |
| 120 | Ga0157370_10000264 | 3300013104 | Bacteria | 66688 |
| 121 | Ga0157370_10037001 | 3300013104 | Bacteria | 4734 |
| 122 | Ga0157370_10066626 | 3300013104 | Bacteria | 3405 |
| 123 | Ga0157370_10252106 | 3300013104 | Bacteria | 1632 |
| 124 | Ga0157369_10047326 | 3300013105 | Bacteria | 4671 |
| 125 | Ga0157369_10094899 | 3300013105 | Bacteria | 3184 |
| 126 | Ga0157369_10117536 | 3300013105 | Bacteria | 2823 |
| 127 | Ga0157369_10121166 | 3300013105 | Bacteria | 2776 |
| 128 | Ga0157369_10151810 | 3300013105 | Bacteria | 2448 |
| 129 | Ga0157369_10188416 | 3300013105 | Bacteria | 2168 |
| 130 | Ga0163162_10102254 | 3300013306 | Bacteria | 2959 |
| 131 | Ga0163162_10165677 | 3300013306 | Bacteria | 2333 |
| 132 | Ga0163162_10220488 | 3300013306 | Bacteria | 2026 |
| 133 | Ga0163162_10262650 | 3300013306 | Bacteria | 1858 |
| 134 | Ga0163162_10325168 | 3300013306 | Bacteria | 1670 |
| 135 | Ga0157372_10030791 | 3300013307 | Bacteria | 5871 |
| 136 | Ga0157372_10084730 | 3300013307 | Bacteria | 3593 |
| 137 | Ga0157372_10273440 | 3300013307 | Bacteria | 1963 |
| 138 | Ga0157375_10074465 | 3300013308 | Bacteria | 3417 |
| 139 | Ga0157375_10100250 | 3300013308 | Bacteria | 2976 |
| 140 | Ga0157375_10230912 | 3300013308 | Bacteria | 2009 |
| 141 | Ga0157375_10450870 | 3300013308 | Bacteria | 1452 |
| 142 | Ga0182008_10003338 | 3300014497 | Bacteria | 9748 |
| 143 | Ga0182008_10012571 | 3300014497 | Bacteria | 4468 |
| 144 | Ga0182008_10027576 | 3300014497 | Bacteria | 2876 |
| 145 | Ga0182008_10028252 | 3300014497 | Bacteria | 2837 |
| 146 | Ga0182008_10028418 | 3300014497 | Bacteria | 2827 |
| 147 | Ga0182008_10056372 | 3300014497 | Bacteria | 1942 |
| 148 | Ga0182008_10077973 | 3300014497 | Bacteria | 1630 |
| 149 | Ga0182008_10096590 | 3300014497 | Bacteria | 1458 |
| 150 | Ga0182008_10160369 | 3300014497 | Bacteria | 1131 |
| 151 | Ga0182006_1004840 | 3300015261 | Bacteria | 6539 |
| 152 | Ga0182006_1015794 | 3300015261 | Bacteria | 3230 |
| 153 | Ga0182006_1015814 | 3300015261 | Bacteria | 3227 |
| 154 | Ga0182006_1018657 | 3300015261 | Bacteria | 2927 |
| 155 | Ga0182006_1049327 | 3300015261 | Bacteria | 1625 |
| 156 | Ga0182006_1053537 | 3300015261 | Bacteria | 1546 |
| 157 | Ga0182007_10006593 | 3300015262 | Bacteria | 4970 |
| 158 | Ga0182007_10010025 | 3300015262 | Bacteria | 3772 |
| 159 | Ga0182007_10018041 | 3300015262 | Bacteria | 2565 |
| 160 | Ga0182005_1003805 | 3300015265 | Bacteria | 5013 |
| 161 | Ga0182005_1008094 | 3300015265 | Bacteria | 3115 |
| 162 | Ga0182005_1034406 | 3300015265 | Bacteria | 1378 |
| 163 | Ga0182005_1037026 | 3300015265 | Bacteria | 1327 |
| 164 | Ga0163161_10020778 | 3300017792 | Bacteria | 4609 |
| 165 | Ga0163161_10039851 | 3300017792 | Bacteria | 3374 |
| 166 | Ga0163161_10045982 | 3300017792 | Bacteria | 3149 |
| 167 | Ga0163161_10063423 | 3300017792 | Bacteria | 2693 |
| 168 | Ga0163161_10066199 | 3300017792 | Bacteria | 2638 |
| 169 | Ga0163161_10081759 | 3300017792 | Bacteria | 2379 |
| 170 | Ga0163161_10090500 | 3300017792 | Bacteria | 2264 |
| 171 | Ga0163161_10099265 | 3300017792 | Bacteria | 2165 |
| 172 | Ga0163161_10139633 | 3300017792 | Bacteria | 1834 |
| 173 | Ga0163161_10216435 | 3300017792 | Bacteria | 1482 |
| 174 | Ga0163161_10222496 | 3300017792 | Bacteria | 1462 |
| 175 | Ga0163161_10270759 | 3300017792 | Bacteria | 1329 |
| 176 | Ga0163161_10306884 | 3300017792 | Bacteria | 1251 |
| 177 | Ga0209435_101976 | 3300025206 | Bacteria | 2465 |
| 178 | Ga0209760_100045 | 3300025207 | Bacteria | 109664 |
| 179 | Ga0209760_100253 | 3300025207 | Bacteria | 21542 |
| 180 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 181 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 182 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 183 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 184 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 185 | Ga0209563_102247 | 3300025230 | Bacteria | 4463 |
| 186 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 187 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 188 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 189 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 190 | Ga0209437_106495 | 3300025233 | Bacteria | 1944 |
| 191 | Ga0209258_100249 | 3300025242 | Bacteria | 98135 |
| 192 | Ga0209646_1000298 | 3300025246 | Bacteria | 41044 |
| 193 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 194 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 195 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 196 | Ga0209675_1003304 | 3300025291 | Bacteria | 7745 |
| 197 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 198 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 199 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 200 | Ga0209676_1001560 | 3300025292 | Bacteria | 20528 |
| 201 | Ga0209676_1007800 | 3300025292 | Bacteria | 4927 |
| 202 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 203 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 204 | Ga0209050_1000553 | 3300025298 | Bacteria | 61622 |
| 205 | Ga0209050_1007961 | 3300025298 | Bacteria | 5798 |
| 206 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 207 | Ga0209051_1000426 | 3300025303 | Bacteria | 57797 |
| 208 | Ga0209051_1000719 | 3300025303 | Bacteria | 36150 |
| 209 | Ga0209257_1000262 | 3300025304 | Bacteria | 121021 |
| 210 | Ga0209257_1038941 | 3300025304 | Bacteria | 1434 |
| 211 | Ga0207656_10000015 | 3300025321 | Bacteria | 125447 |
| 212 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 213 | Ga0207696_1000080 | 3300025711 | Bacteria | 199217 |
| 214 | Ga0207696_1000204 | 3300025711 | Bacteria | 90602 |
| 215 | Ga0207696_1002401 | 3300025711 | Bacteria | 9210 |
| 216 | Ga0207696_1002424 | 3300025711 | Bacteria | 9153 |
| 217 | Ga0207696_1002551 | 3300025711 | Bacteria | 8865 |
| 218 | Ga0207696_1006417 | 3300025711 | Bacteria | 4744 |
| 219 | Ga0207696_1012224 | 3300025711 | Bacteria | 3044 |
| 220 | Ga0207696_1029950 | 3300025711 | Bacteria | 1658 |
| 221 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 222 | Ga0207655_1000116 | 3300025728 | Bacteria | 161950 |
| 223 | Ga0207655_1000541 | 3300025728 | Bacteria | 47787 |
| 224 | Ga0207655_1000783 | 3300025728 | Bacteria | 34896 |
| 225 | Ga0207655_1002543 | 3300025728 | Bacteria | 14607 |
| 226 | Ga0207655_1003443 | 3300025728 | Bacteria | 11772 |
| 227 | Ga0207655_1003544 | 3300025728 | Bacteria | 11563 |
| 228 | Ga0207655_1004194 | 3300025728 | Bacteria | 10342 |
| 229 | Ga0207655_1007513 | 3300025728 | Bacteria | 7061 |
| 230 | Ga0207655_1007842 | 3300025728 | Bacteria | 6869 |
| 231 | Ga0207655_1010546 | 3300025728 | Bacteria | 5590 |
| 232 | Ga0207655_1010919 | 3300025728 | Bacteria | 5461 |
| 233 | Ga0207655_1011798 | 3300025728 | Bacteria | 5165 |
| 234 | Ga0207655_1016936 | 3300025728 | Bacteria | 3958 |
| 235 | Ga0207655_1020362 | 3300025728 | Bacteria | 3413 |
| 236 | Ga0207655_1037073 | 3300025728 | Bacteria | 2152 |
| 237 | Ga0207655_1042721 | 3300025728 | Bacteria | 1927 |
| 238 | Ga0207655_1043988 | 3300025728 | Bacteria | 1881 |
| 239 | Ga0207655_1059961 | 3300025728 | Bacteria | 1477 |
| 240 | Ga0207713_1000249 | 3300025735 | Bacteria | 68771 |
| 241 | Ga0207713_1000835 | 3300025735 | Bacteria | 28378 |
| 242 | Ga0207713_1001660 | 3300025735 | Bacteria | 17242 |
| 243 | Ga0207713_1004313 | 3300025735 | Bacteria | 9268 |
| 244 | Ga0207713_1011733 | 3300025735 | Bacteria | 4734 |
| 245 | Ga0207713_1020781 | 3300025735 | Bacteria | 3168 |
| 246 | Ga0207713_1023358 | 3300025735 | Bacteria | 2911 |
| 247 | Ga0207713_1023498 | 3300025735 | Bacteria | 2900 |
| 248 | Ga0207713_1029565 | 3300025735 | Bacteria | 2452 |
| 249 | Ga0207713_1033816 | 3300025735 | Bacteria | 2228 |
| 250 | Ga0207713_1079761 | 3300025735 | Bacteria | 1181 |
| 251 | Ga0207671_10000027 | 3300025914 | Bacteria | 264907 |
| 252 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 253 | Ga0207681_10000059 | 3300025923 | Bacteria | 104079 |
| 254 | Ga0207681_10000600 | 3300025923 | Bacteria | 24430 |
| 255 | Ga0207650_10000044 | 3300025925 | Bacteria | 183146 |
| 256 | Ga0207650_10000390 | 3300025925 | Bacteria | 40097 |
| 257 | Ga0207706_10000212 | 3300025933 | Bacteria | 63975 |
| 258 | Ga0207706_10002126 | 3300025933 | Bacteria | 19400 |
| 259 | Ga0207686_10003616 | 3300025934 | Bacteria | 8279 |
| 260 | Ga0207709_10000061 | 3300025935 | Bacteria | 199097 |
| 261 | Ga0207709_10000063 | 3300025935 | Bacteria | 191397 |
| 262 | Ga0207709_10001634 | 3300025935 | Bacteria | 15234 |
| 263 | Ga0207709_10003026 | 3300025935 | Bacteria | 10214 |
| 264 | Ga0207709_10114771 | 3300025935 | Bacteria | 1808 |
| 265 | Ga0207711_10062581 | 3300025941 | Bacteria | 3210 |
| 266 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 267 | Ga0207712_10012867 | 3300025961 | Bacteria | 5353 |
| 268 | Ga0207640_10097767 | 3300025981 | Bacteria | 2050 |
| 269 | Ga0207639_10000157 | 3300026041 | Bacteria | 51718 |
| 270 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 271 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 272 | Ga0209281_1010911 | 3300027111 | Bacteria | 2053 |
| 273 | Ga0209281_1017440 | 3300027111 | Bacteria | 1455 |
| 274 | Ga0209389_1000036 | 3300027296 | Bacteria | 126146 |
| 275 | Ga0209389_1058390 | 3300027296 | Bacteria | 2451 |
| 276 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 277 | Ga0209371_1000775 | 3300027312 | Bacteria | 26456 |
| 278 | Ga0207428_10062560 | 3300027907 | Bacteria | 2943 |
| 279 | Ga0207428_10063323 | 3300027907 | Bacteria | 2922 |
| 280 | Ga0207428_10066045 | 3300027907 | Bacteria | 2851 |
| 281 | Ga0207428_10077413 | 3300027907 | Bacteria | 2604 |
| 282 | Ga0207428_10090703 | 3300027907 | Bacteria | 2374 |
| 283 | Ga0207428_10116873 | 3300027907 | Bacteria | 2048 |
| 284 | Ga0207428_10194568 | 3300027907 | Bacteria | 1528 |
| 285 | Ga0207428_10238983 | 3300027907 | Bacteria | 1358 |
| 286 | Ga0268266_10034327 | 3300028379 | Bacteria | 4314 |
| 287 | Ga0268266_10138787 | 3300028379 | Bacteria | 2180 |
| 288 | Ga0307517_10215768 | 3300028786 | Bacteria | 1174 |
| 289 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 290 | Ga0268256_1000247 | 3300030500 | Bacteria | 57439 |
| 291 | Ga0307511_10032246 | 3300030521 | Bacteria | 4661 |
| 292 | Ga0307511_10138765 | 3300030521 | Bacteria | 1437 |
| 293 | Ga0314311_1048969 | 3300030733 | Bacteria | 3054 |
| 294 | Ga0316179_1083517 | 3300030734 | Bacteria | 1194 |
| 295 | Ga0316178_1047147 | 3300030735 | Bacteria | 102800 |
| 296 | Ga0316183_1121205 | 3300030742 | Bacteria | 2025 |
| 297 | Ga0316181_1199165 | 3300030744 | Bacteria | 4742 |
| 298 | Ga0265316_10141450 | 3300031344 | Bacteria | 1807 |
| 299 | Ga0307509_10114279 | 3300031507 | Bacteria | 2695 |
| 300 | Ga0307408_100020165 | 3300031548 | Bacteria | 4495 |
| 301 | Ga0307408_100040505 | 3300031548 | Bacteria | 3298 |
| 302 | Ga0307408_100046153 | 3300031548 | Bacteria | 3115 |
| 303 | Ga0307408_100544131 | 3300031548 | Bacteria | 1023 |
| 304 | Ga0307516_10198015 | 3300031730 | Bacteria | 1730 |
| 305 | Ga0307405_10012530 | 3300031731 | Bacteria | 4493 |
| 306 | Ga0307405_10040286 | 3300031731 | Bacteria | 2828 |
| 307 | Ga0307405_10070700 | 3300031731 | Bacteria | 2242 |
| 308 | Ga0307405_10091965 | 3300031731 | Bacteria | 2011 |
| 309 | Ga0307406_10014933 | 3300031901 | Bacteria | 4480 |
| 310 | Ga0307412_10012175 | 3300031911 | Bacteria | 5002 |
| 311 | Ga0307412_10032114 | 3300031911 | Bacteria | 3322 |
| 312 | Ga0307412_10039613 | 3300031911 | Bacteria | 3043 |
| 313 | Ga0307412_10039843 | 3300031911 | Bacteria | 3036 |
| 314 | Ga0307412_10514918 | 3300031911 | Bacteria | 998 |
| 315 | Ga0307409_100033587 | 3300031995 | Bacteria | 3735 |
| 316 | Ga0307409_100265374 | 3300031995 | Bacteria | 1578 |
| 317 | Ga0307416_100794854 | 3300032002 | Bacteria | 1041 |
| 318 | Ga0307416_100945623 | 3300032002 | Bacteria | 963 |
| 319 | Ga0307414_10011654 | 3300032004 | Bacteria | 5166 |
| 320 | Ga0307414_10156564 | 3300032004 | Bacteria | 1804 |
| 321 | Ga0307414_10223433 | 3300032004 | Bacteria | 1547 |
| 322 | Ga0307414_10514375 | 3300032004 | Bacteria | 1061 |
| 323 | Ga0307411_10149156 | 3300032005 | Bacteria | 1735 |
| 324 | Ga0307411_10182120 | 3300032005 | Bacteria | 1595 |
| 325 | Ga0307411_10185688 | 3300032005 | Bacteria | 1582 |
| 326 | Ga0307510_10041980 | 3300033180 | Bacteria | 4990 |
| 327 | Ga0307510_10179177 | 3300033180 | Bacteria | 1685 |
| 328 | Ga0237819_00423 | 3300038705 | Bacteria | 14546 |
| 329 | Ga0439436_0000358 | 3300041404 | Bacteria | 11315 |
| 330 | Ga0439438_003527 | 3300041405 | Bacteria | 6299 |
| 331 | Ga0439438_005526 | 3300041405 | Bacteria | 4630 |
| 332 | Ga0439438_007602 | 3300041405 | Bacteria | 3684 |
| 333 | Ga0439438_007798 | 3300041405 | Bacteria | 3616 |
| 334 | Ga0439438_010047 | 3300041405 | Bacteria | 3023 |
| 335 | Ga0439438_011429 | 3300041405 | Bacteria | 2764 |
| 336 | Ga0439438_012849 | 3300041405 | Bacteria | 2549 |
| 337 | Ga0439438_014093 | 3300041405 | Bacteria | 2387 |
| 338 | Ga0439438_014343 | 3300041405 | Bacteria | 2361 |
| 339 | Ga0439438_014887 | 3300041405 | Bacteria | 2303 |
| 340 | Ga0439438_016852 | 3300041405 | Bacteria | 2117 |
| 341 | Ga0439438_017291 | 3300041405 | Bacteria | 2079 |
| 342 | Ga0439438_023430 | 3300041405 | Bacteria | 1701 |
| 343 | Ga0439438_036743 | 3300041405 | Bacteria | 1283 |
| 344 | Ga0439447_004297 | 3300041407 | Bacteria | 4938 |
| 345 | Ga0439447_007631 | 3300041407 | Bacteria | 3410 |
| 346 | Ga0439447_010026 | 3300041407 | Bacteria | 2835 |
| 347 | Ga0439447_017852 | 3300041407 | Bacteria | 1925 |
| 348 | Ga0439447_020901 | 3300041407 | Bacteria | 1729 |
| 349 | Ga0439447_032135 | 3300041407 | Bacteria | 1313 |
| 350 | Ga0439447_034991 | 3300041407 | Bacteria | 1246 |
| 351 | Ga0439447_041042 | 3300041407 | Bacteria | 1127 |
| 352 | Ga0439447_051890 | 3300041407 | Bacteria | 977 |
| 353 | Ga0439466_0000651 | 3300041411 | Bacteria | 13074 |
| 354 | Ga0439466_0006327 | 3300041411 | Bacteria | 4507 |
| 355 | Ga0439466_0010243 | 3300041411 | Bacteria | 3486 |
| 356 | Ga0439466_0012563 | 3300041411 | Bacteria | 3117 |
| 357 | Ga0439466_0014272 | 3300041411 | Bacteria | 2895 |
| 358 | Ga0439466_0027680 | 3300041411 | Bacteria | 1962 |
| 359 | Ga0439466_0044060 | 3300041411 | Bacteria | 1479 |
| 360 | Ga0439465_0008789 | 3300041413 | Bacteria | 3181 |
| 361 | Ga0451807_0448583 | 3300041486 | Bacteria | 1454 |
| 362 | Ga0439431_0008307 | 3300041997 | Bacteria | 2331 |
| 363 | Ga0439437_001501 | 3300042000 | Bacteria | 2456 |
| 364 | Ga0439442_026508 | 3300042002 | Bacteria | 1206 |
| 365 | Ga0439445_0005814 | 3300042004 | Bacteria | 2819 |
| 366 | Ga0439432_000192 | 3300042006 | Bacteria | 21898 |
| 367 | Ga0439432_000317 | 3300042006 | Bacteria | 17455 |
| 368 | Ga0439432_002102 | 3300042006 | Bacteria | 7521 |
| 369 | Ga0439432_011457 | 3300042006 | Bacteria | 3056 |
| 370 | Ga0439432_019373 | 3300042006 | Bacteria | 2267 |
| 371 | Ga0439432_035435 | 3300042006 | Bacteria | 1598 |
| 372 | Ga0439451_004065 | 3300042009 | Bacteria | 2971 |
| 373 | Ga0439451_005947 | 3300042009 | Bacteria | 2492 |
| 374 | Ga0439451_009907 | 3300042009 | Bacteria | 1923 |
| 375 | Ga0439451_011967 | 3300042009 | Bacteria | 1750 |
| 376 | Ga0439452_001699 | 3300042010 | Bacteria | 8654 |
| 377 | Ga0439452_005144 | 3300042010 | Bacteria | 4256 |
| 378 | Ga0439452_005794 | 3300042010 | Bacteria | 3944 |
| 379 | Ga0439452_006443 | 3300042010 | Bacteria | 3678 |
| 380 | Ga0439452_007448 | 3300042010 | Bacteria | 3352 |
| 381 | Ga0439452_009936 | 3300042010 | Bacteria | 2787 |
| 382 | Ga0439452_031663 | 3300042010 | Bacteria | 1296 |
| 383 | Ga0439456_000903 | 3300042013 | Bacteria | 5948 |
| 384 | Ga0439456_001136 | 3300042013 | Bacteria | 5272 |
| 385 | Ga0439456_003880 | 3300042013 | Bacteria | 3034 |
| 386 | Ga0439456_007780 | 3300042013 | Bacteria | 2205 |
| 387 | Ga0439456_008878 | 3300042013 | Bacteria | 2076 |
| 388 | Ga0439456_009344 | 3300042013 | Bacteria | 2025 |
| 389 | Ga0439456_010126 | 3300042013 | Bacteria | 1946 |
| 390 | Ga0439456_010153 | 3300042013 | Bacteria | 1944 |
| 391 | Ga0439456_011782 | 3300042013 | Bacteria | 1809 |
| 392 | Ga0439456_017482 | 3300042013 | Bacteria | 1503 |
| 393 | Ga0439456_023011 | 3300042013 | Bacteria | 1320 |
| 394 | Ga0439456_026809 | 3300042013 | Bacteria | 1226 |
| 395 | Ga0439463_002256 | 3300042016 | Bacteria | 4946 |
| 396 | Ga0439463_009457 | 3300042016 | Bacteria | 2399 |
| 397 | Ga0439463_014568 | 3300042016 | Bacteria | 1939 |
| 398 | Ga0439463_014843 | 3300042016 | Bacteria | 1924 |
| 399 | Ga0450911_000934 | 3300042115 | Bacteria | 7692 |
| 400 | Ga0450911_003930 | 3300042115 | Bacteria | 2514 |
| 401 | Ga0450911_004312 | 3300042115 | Bacteria | 2348 |
| 402 | Ga0450911_005613 | 3300042115 | Bacteria | 1928 |
| 403 | Ga0450919_000675 | 3300042121 | Bacteria | 4297 |
| 404 | Ga0450919_002455 | 3300042121 | Bacteria | 2402 |
| 405 | Ga0450921_000122 | 3300042123 | Bacteria | 2607 |
| 406 | Ga0450922_000717 | 3300042124 | Bacteria | 3416 |
| 407 | Ga0450922_001084 | 3300042124 | Bacteria | 2716 |
| 408 | Ga0450922_001819 | 3300042124 | Bacteria | 2053 |
| 409 | Ga0450923_004772 | 3300042125 | Bacteria | 2146 |
| 410 | Ga0450923_005481 | 3300042125 | Bacteria | 2052 |
| 411 | Ga0450890_002000 | 3300042127 | Bacteria | 2875 |
| 412 | Ga0450891_000333 | 3300042129 | Bacteria | 4846 |
| 413 | Ga0450900_002789 | 3300042136 | Bacteria | 1884 |
| 414 | Ga0450900_006697 | 3300042136 | Bacteria | 1400 |
| 415 | Ga0450902_000055 | 3300042137 | Bacteria | 10761 |
| 416 | Ga0450902_003376 | 3300042137 | Bacteria | 2327 |
| 417 | Ga0450902_005123 | 3300042137 | Bacteria | 1972 |
| 418 | Ga0450902_011933 | 3300042137 | Bacteria | 1386 |
| 419 | Ga0450903_002213 | 3300042138 | Bacteria | 3475 |
| 420 | Ga0450903_002858 | 3300042138 | Bacteria | 3017 |
| 421 | Ga0450903_004567 | 3300042138 | Bacteria | 2354 |
| 422 | Ga0450903_010435 | 3300042138 | Bacteria | 1503 |
| 423 | Ga0450903_018288 | 3300042138 | Bacteria | 1091 |
| 424 | Ga0450904_001950 | 3300042139 | Bacteria | 2632 |
| 425 | Ga0450904_002613 | 3300042139 | Bacteria | 2093 |
| 426 | Ga0450905_000361 | 3300042142 | Bacteria | 5438 |
| 427 | Ga0450905_001346 | 3300042142 | Bacteria | 3120 |
| 428 | Ga0450905_007447 | 3300042142 | Bacteria | 1490 |
| 429 | Ga0450889_003922 | 3300042144 | Bacteria | 1471 |
| 430 | Ga0450906_003382 | 3300042145 | Bacteria | 3433 |
| 431 | Ga0450906_004721 | 3300042145 | Bacteria | 2838 |
| 432 | Ga0450907_001462 | 3300042146 | Bacteria | 5088 |
| 433 | Ga0450907_001555 | 3300042146 | Bacteria | 4885 |
| 434 | Ga0450907_011530 | 3300042146 | Bacteria | 1467 |
| 435 | Ga0450907_026627 | 3300042146 | Bacteria | 980 |
| 436 | Ga0450910_000780 | 3300042147 | Bacteria | 3837 |
| 437 | Ga0450910_001861 | 3300042147 | Bacteria | 2728 |
| 438 | Ga0450910_002757 | 3300042147 | Bacteria | 2312 |
| 439 | Ga0439446_0000616 | 3300042156 | Bacteria | 7340 |
| 440 | Ga0439446_0001997 | 3300042156 | Bacteria | 4822 |
| 441 | Ga0439446_0003246 | 3300042156 | Bacteria | 4013 |
| 442 | Ga0439446_0014395 | 3300042156 | Bacteria | 2183 |
| 443 | Ga0439446_0017277 | 3300042156 | Bacteria | 2014 |
| 444 | Ga0439446_0029441 | 3300042156 | Bacteria | 1585 |
| 445 | Ga0439446_0037604 | 3300042156 | Bacteria | 1417 |
| 446 | Ga0450908_001947 | 3300042184 | Bacteria | 4042 |
| 447 | Ga0450908_019585 | 3300042184 | Bacteria | 1190 |
| 448 | Ga0450909_001617 | 3300042185 | Bacteria | 3146 |
| 449 | Ga0450909_003038 | 3300042185 | Bacteria | 2386 |
| 450 | Ga0450909_006496 | 3300042185 | Bacteria | 1685 |
| 451 | Ga0450909_013648 | 3300042185 | Bacteria | 1195 |
| 452 | Ga0439434_0000118 | 3300042435 | Bacteria | 20853 |
| 453 | Ga0439434_0002809 | 3300042435 | Bacteria | 5082 |
| 454 | Ga0439434_0022621 | 3300042435 | Bacteria | 1889 |
| 455 | Ga0439459_0019608 | 3300042438 | Bacteria | 1283 |
| 456 | Ga0439464_0001288 | 3300042439 | Bacteria | 5834 |
| 457 | Ga0439464_0007873 | 3300042439 | Bacteria | 2789 |
| 458 | Ga0439460_0003840 | 3300042461 | Bacteria | 3639 |
| 459 | Ga0439460_0006220 | 3300042461 | Bacteria | 2954 |
| 460 | Ga0439460_0008144 | 3300042461 | Bacteria | 2643 |
| 461 | Ga0439460_0013978 | 3300042461 | Bacteria | 2106 |
| 462 | Ga0450918_007545 | 3300042531 | Bacteria | 1923 |
| 463 | Ga0450918_009406 | 3300042531 | Bacteria | 1713 |
| 464 | Ga0450893_0004019 | 3300042532 | Bacteria | 2336 |
| 465 | Ga0450893_0019534 | 3300042532 | Bacteria | 1159 |
| 466 | Ga0450901_000152 | 3300042533 | Bacteria | 7822 |
| 467 | Ga0439440_0004171 | 3300042993 | Bacteria | 2828 |
| 468 | Ga0439440_0005050 | 3300042993 | Bacteria | 2606 |
| 469 | Ga0439440_0008514 | 3300042993 | Bacteria | 2107 |
| 470 | Ga0495617_004749 | 3300046452 | Bacteria | 4906 |
| 471 | Ga0495617_005529 | 3300046452 | Bacteria | 4474 |
| 472 | Ga0495617_008798 | 3300046452 | Bacteria | 3476 |
| 473 | Ga0495617_012836 | 3300046452 | Bacteria | 2856 |
| 474 | Ga0495617_015098 | 3300046452 | Bacteria | 2620 |
| 475 | Ga0495617_021574 | 3300046452 | Bacteria | 2175 |
| 476 | Ga0495617_022137 | 3300046452 | Bacteria | 2148 |
| 477 | Ga0495617_030410 | 3300046452 | Bacteria | 1815 |
| 478 | Ga0495617_032742 | 3300046452 | Bacteria | 1745 |
| 479 | Ga0495617_045012 | 3300046452 | Bacteria | 1472 |
| 480 | Ga0495617_061859 | 3300046452 | Bacteria | 1237 |
| 481 | Ga0495627_002702 | 3300046453 | Bacteria | 8293 |
| 482 | Ga0495627_010957 | 3300046453 | Bacteria | 3271 |
| 483 | Ga0495627_013787 | 3300046453 | Bacteria | 2838 |
| 484 | Ga0495627_016819 | 3300046453 | Bacteria | 2497 |
| 485 | Ga0495627_022069 | 3300046453 | Bacteria | 2099 |
| 486 | Ga0495627_034511 | 3300046453 | Bacteria | 1580 |
| 487 | Ga0495603_0070065 | 3300046455 | Bacteria | 2061 |
| 488 | Ga0495603_0086004 | 3300046455 | Bacteria | 1840 |
| 489 | Ga0495603_0291473 | 3300046455 | Bacteria | 937 |
| 490 | Ga0495590_0004489 | 3300046457 | Bacteria | 5629 |
| 491 | Ga0495590_0006573 | 3300046457 | Bacteria | 4533 |
| 492 | Ga0495590_0010822 | 3300046457 | Bacteria | 3418 |
| 493 | Ga0495590_0035257 | 3300046457 | Bacteria | 1747 |
| 494 | Ga0495590_0035284 | 3300046457 | Bacteria | 1746 |
| 495 | Ga0495591_009416 | 3300046458 | Bacteria | 3887 |
| 496 | Ga0495591_010936 | 3300046458 | Bacteria | 3470 |
| 497 | Ga0495591_014473 | 3300046458 | Bacteria | 2833 |
| 498 | Ga0495591_016964 | 3300046458 | Bacteria | 2515 |
| 499 | Ga0495591_017310 | 3300046458 | Bacteria | 2479 |
| 500 | Ga0495591_024295 | 3300046458 | Bacteria | 1923 |
| 501 | Ga0495591_025578 | 3300046458 | Bacteria | 1849 |
| 502 | Ga0495591_028406 | 3300046458 | Bacteria | 1711 |
| 503 | Ga0495591_037480 | 3300046458 | Bacteria | 1403 |
| 504 | Ga0495591_050855 | 3300046458 | Bacteria | 1133 |
| 505 | Ga0495638_0015465 | 3300046460 | Bacteria | 5122 |
| 506 | Ga0495638_0025574 | 3300046460 | Bacteria | 3834 |
| 507 | Ga0495638_0028462 | 3300046460 | Bacteria | 3608 |
| 508 | Ga0495638_0033128 | 3300046460 | Bacteria | 3305 |
| 509 | Ga0495638_0036373 | 3300046460 | Bacteria | 3137 |
| 510 | Ga0495638_0043221 | 3300046460 | Bacteria | 2844 |
| 511 | Ga0495638_0049841 | 3300046460 | Bacteria | 2616 |
| 512 | Ga0495638_0058357 | 3300046460 | Bacteria | 2391 |
| 513 | Ga0495638_0065483 | 3300046460 | Bacteria | 2236 |
| 514 | Ga0495638_0081609 | 3300046460 | Bacteria | 1962 |
| 515 | Ga0495638_0100322 | 3300046460 | Bacteria | 1732 |
| 516 | Ga0495638_0119130 | 3300046460 | Bacteria | 1561 |
| 517 | Ga0495638_0153293 | 3300046460 | Bacteria | 1335 |
| 518 | Ga0495653_0026278 | 3300046463 | Bacteria | 4670 |
| 519 | Ga0495653_0028367 | 3300046463 | Bacteria | 4474 |
| 520 | Ga0495653_0069329 | 3300046463 | Bacteria | 2642 |
| 521 | Ga0495653_0122412 | 3300046463 | Bacteria | 1851 |
| 522 | Ga0495650_0012341 | 3300046471 | Bacteria | 4602 |
| 523 | Ga0495650_0019211 | 3300046471 | Bacteria | 3374 |
| 524 | Ga0495650_0020665 | 3300046471 | Bacteria | 3203 |
| 525 | Ga0495650_0026607 | 3300046471 | Bacteria | 2687 |
| 526 | Ga0495650_0026919 | 3300046471 | Bacteria | 2665 |
| 527 | Ga0495650_0032550 | 3300046471 | Bacteria | 2330 |
| 528 | Ga0495650_0038353 | 3300046471 | Bacteria | 2076 |
| 529 | Ga0495650_0041295 | 3300046471 | Bacteria | 1974 |
| 530 | Ga0495582_0012541 | 3300046473 | Bacteria | 4670 |
| 531 | Ga0495605_0012869 | 3300046474 | Bacteria | 4630 |
| 532 | Ga0495605_0019264 | 3300046474 | Bacteria | 3649 |
| 533 | Ga0495605_0036026 | 3300046474 | Bacteria | 2497 |
| 534 | Ga0495605_0036585 | 3300046474 | Bacteria | 2474 |
| 535 | Ga0495605_0045626 | 3300046474 | Bacteria | 2159 |
| 536 | Ga0495605_0068585 | 3300046474 | Bacteria | 1680 |
| 537 | Ga0495639_0008671 | 3300046475 | Bacteria | 4358 |
| 538 | Ga0495639_0012590 | 3300046475 | Bacteria | 3649 |
| 539 | Ga0495639_0058564 | 3300046475 | Bacteria | 1762 |
| 540 | Ga0495584_0009431 | 3300046491 | Bacteria | 5027 |
| 541 | Ga0495584_0011369 | 3300046491 | Bacteria | 4559 |
| 542 | Ga0495584_0015066 | 3300046491 | Bacteria | 3940 |
| 543 | Ga0495584_0022111 | 3300046491 | Bacteria | 3227 |
| 544 | Ga0495584_0027384 | 3300046491 | Bacteria | 2888 |
| 545 | Ga0495584_0030627 | 3300046491 | Bacteria | 2724 |
| 546 | Ga0495584_0033621 | 3300046491 | Bacteria | 2594 |
| 547 | Ga0495584_0050988 | 3300046491 | Bacteria | 2084 |
| 548 | Ga0495584_0059240 | 3300046491 | Bacteria | 1926 |
| 549 | Ga0495584_0087920 | 3300046491 | Bacteria | 1566 |
| 550 | Ga0495584_0124586 | 3300046491 | Bacteria | 1305 |
| 551 | Ga0495585_0000543 | 3300046492 | Bacteria | 35647 |
| 552 | Ga0495585_0019204 | 3300046492 | Bacteria | 3943 |
| 553 | Ga0495585_0030207 | 3300046492 | Bacteria | 3082 |
| 554 | Ga0495585_0037838 | 3300046492 | Bacteria | 2716 |
| 555 | Ga0495585_0038969 | 3300046492 | Bacteria | 2673 |
| 556 | Ga0495585_0045785 | 3300046492 | Bacteria | 2441 |
| 557 | Ga0495594_0019440 | 3300046499 | Bacteria | 3608 |
| 558 | Ga0495594_0024309 | 3300046499 | Bacteria | 3253 |
| 559 | Ga0495594_0042705 | 3300046499 | Bacteria | 2483 |
| 560 | Ga0495596_0001223 | 3300046500 | Bacteria | 14977 |
| 561 | Ga0495596_0036999 | 3300046500 | Bacteria | 1931 |
| 562 | Ga0495607_0009650 | 3300046501 | Bacteria | 6522 |
| 563 | Ga0495607_0011085 | 3300046501 | Bacteria | 6018 |
| 564 | Ga0495607_0016321 | 3300046501 | Bacteria | 4793 |
| 565 | Ga0495607_0022915 | 3300046501 | Bacteria | 3915 |
| 566 | Ga0495607_0028921 | 3300046501 | Bacteria | 3413 |
| 567 | Ga0495607_0033176 | 3300046501 | Bacteria | 3142 |
| 568 | Ga0495607_0042557 | 3300046501 | Bacteria | 2691 |
| 569 | Ga0495607_0064623 | 3300046501 | Bacteria | 2066 |
| 570 | Ga0495607_0070174 | 3300046501 | Bacteria | 1959 |
| 571 | Ga0495607_0071361 | 3300046501 | Bacteria | 1936 |
| 572 | Ga0495607_0090418 | 3300046501 | Bacteria | 1659 |
| 573 | Ga0495607_0103861 | 3300046501 | Bacteria | 1517 |
| 574 | Ga0495607_0133379 | 3300046501 | Bacteria | 1289 |
| 575 | Ga0495583_0002028 | 3300046506 | Bacteria | 18435 |
| 576 | Ga0495583_0022582 | 3300046506 | Bacteria | 3205 |
| 577 | Ga0495583_0023690 | 3300046506 | Bacteria | 3100 |
| 578 | Ga0495583_0028183 | 3300046506 | Bacteria | 2764 |
| 579 | Ga0495583_0044392 | 3300046506 | Bacteria | 2062 |
| 580 | Ga0495583_0051880 | 3300046506 | Bacteria | 1868 |
| 581 | Ga0495583_0120997 | 3300046506 | Bacteria | 1102 |
| 582 | Ga0495606_0000204 | 3300046507 | Bacteria | 103880 |
| 583 | Ga0495606_0022292 | 3300046507 | Bacteria | 4616 |
| 584 | Ga0495606_0039742 | 3300046507 | Bacteria | 3166 |
| 585 | Ga0495606_0040969 | 3300046507 | Bacteria | 3108 |
| 586 | Ga0495606_0041365 | 3300046507 | Bacteria | 3091 |
| 587 | Ga0495606_0048712 | 3300046507 | Bacteria | 2784 |
| 588 | Ga0495606_0056039 | 3300046507 | Bacteria | 2545 |
| 589 | Ga0495606_0064184 | 3300046507 | Bacteria | 2338 |
| 590 | Ga0495606_0108533 | 3300046507 | Bacteria | 1677 |
| 591 | Ga0495610_0010868 | 3300046512 | Bacteria | 5620 |
| 592 | Ga0495610_0013134 | 3300046512 | Bacteria | 4937 |
| 593 | Ga0495610_0016793 | 3300046512 | Bacteria | 4199 |
| 594 | Ga0495610_0023496 | 3300046512 | Bacteria | 3349 |
| 595 | Ga0495610_0023635 | 3300046512 | Bacteria | 3334 |
| 596 | Ga0495610_0028493 | 3300046512 | Bacteria | 2953 |
| 597 | Ga0495610_0029527 | 3300046512 | Bacteria | 2885 |
| 598 | Ga0495610_0046473 | 3300046512 | Bacteria | 2141 |
| 599 | Ga0495610_0058701 | 3300046512 | Bacteria | 1839 |
| 600 | Ga0495610_0072687 | 3300046512 | Bacteria | 1600 |
| 601 | Ga0495610_0093925 | 3300046512 | Bacteria | 1354 |
| 602 | Ga0495610_0112061 | 3300046512 | Bacteria | 1207 |
| 603 | Ga0495616_0011744 | 3300046513 | Bacteria | 5004 |
| 604 | Ga0495616_0012404 | 3300046513 | Bacteria | 4840 |
| 605 | Ga0495616_0019748 | 3300046513 | Bacteria | 3674 |
| 606 | Ga0495616_0019925 | 3300046513 | Bacteria | 3654 |
| 607 | Ga0495616_0022965 | 3300046513 | Bacteria | 3361 |
| 608 | Ga0495616_0038868 | 3300046513 | Bacteria | 2440 |
| 609 | Ga0495616_0042625 | 3300046513 | Bacteria | 2309 |
| 610 | Ga0495616_0043783 | 3300046513 | Bacteria | 2272 |
| 611 | Ga0495616_0064962 | 3300046513 | Bacteria | 1779 |
| 612 | Ga0495616_0089022 | 3300046513 | Bacteria | 1465 |
| 613 | Ga0495620_0000032 | 3300046515 | Bacteria | 119164 |
| 614 | Ga0495620_0015873 | 3300046515 | Bacteria | 3793 |
| 615 | Ga0495620_0023048 | 3300046515 | Bacteria | 2985 |
| 616 | Ga0495620_0028603 | 3300046515 | Bacteria | 2589 |
| 617 | Ga0495620_0029212 | 3300046515 | Bacteria | 2554 |
| 618 | Ga0495620_0029330 | 3300046515 | Bacteria | 2547 |
| 619 | Ga0495620_0031872 | 3300046515 | Bacteria | 2408 |
| 620 | Ga0495620_0043021 | 3300046515 | Bacteria | 1969 |
| 621 | Ga0495620_0047448 | 3300046515 | Bacteria | 1848 |
| 622 | Ga0495620_0067899 | 3300046515 | Bacteria | 1465 |
| 623 | Ga0495628_0096034 | 3300046516 | Bacteria | 2290 |
| 624 | Ga0495630_0023357 | 3300046517 | Bacteria | 4571 |
| 625 | Ga0495630_0073792 | 3300046517 | Bacteria | 2569 |
| 626 | Ga0495630_0234432 | 3300046517 | Bacteria | 1402 |
| 627 | Ga0495631_0009546 | 3300046518 | Bacteria | 4842 |
| 628 | Ga0495631_0011117 | 3300046518 | Bacteria | 4436 |
| 629 | Ga0495631_0024973 | 3300046518 | Bacteria | 2755 |
| 630 | Ga0495631_0025639 | 3300046518 | Bacteria | 2712 |
| 631 | Ga0495631_0030436 | 3300046518 | Bacteria | 2448 |
| 632 | Ga0495631_0051947 | 3300046518 | Bacteria | 1790 |
| 633 | Ga0495632_0001747 | 3300046519 | Bacteria | 17599 |
| 634 | Ga0495632_0004029 | 3300046519 | Bacteria | 10143 |
| 635 | Ga0495632_0010107 | 3300046519 | Bacteria | 5618 |
| 636 | Ga0495632_0012110 | 3300046519 | Bacteria | 4989 |
| 637 | Ga0495632_0012442 | 3300046519 | Bacteria | 4909 |
| 638 | Ga0495632_0012652 | 3300046519 | Bacteria | 4855 |
| 639 | Ga0495632_0020458 | 3300046519 | Bacteria | 3582 |
| 640 | Ga0495632_0024911 | 3300046519 | Bacteria | 3171 |
| 641 | Ga0495632_0025758 | 3300046519 | Bacteria | 3107 |
| 642 | Ga0495632_0028063 | 3300046519 | Bacteria | 2940 |
| 643 | Ga0495632_0032099 | 3300046519 | Bacteria | 2708 |
| 644 | Ga0495632_0035457 | 3300046519 | Bacteria | 2545 |
| 645 | Ga0495632_0039473 | 3300046519 | Bacteria | 2382 |
| 646 | Ga0495632_0047809 | 3300046519 | Bacteria | 2120 |
| 647 | Ga0495632_0048622 | 3300046519 | Bacteria | 2099 |
| 648 | Ga0495632_0132461 | 3300046519 | Bacteria | 1159 |
| 649 | Ga0495637_0001563 | 3300046520 | Bacteria | 13330 |
| 650 | Ga0495637_0007825 | 3300046520 | Bacteria | 5275 |
| 651 | Ga0495637_0008284 | 3300046520 | Bacteria | 5111 |
| 652 | Ga0495637_0011474 | 3300046520 | Bacteria | 4257 |
| 653 | Ga0495637_0017345 | 3300046520 | Bacteria | 3356 |
| 654 | Ga0495637_0018125 | 3300046520 | Bacteria | 3269 |
| 655 | Ga0495637_0019423 | 3300046520 | Bacteria | 3142 |
| 656 | Ga0495637_0020549 | 3300046520 | Bacteria | 3038 |
| 657 | Ga0495637_0022424 | 3300046520 | Bacteria | 2879 |
| 658 | Ga0495637_0024691 | 3300046520 | Bacteria | 2718 |
| 659 | Ga0495637_0027663 | 3300046520 | Bacteria | 2534 |
| 660 | Ga0495637_0033364 | 3300046520 | Bacteria | 2261 |
| 661 | Ga0495637_0038591 | 3300046520 | Bacteria | 2067 |
| 662 | Ga0495637_0039434 | 3300046520 | Bacteria | 2038 |
| 663 | Ga0495637_0065880 | 3300046520 | Bacteria | 1473 |
| 664 | Ga0495637_0123837 | 3300046520 | Bacteria | 992 |
| 665 | Ga0495643_0000084 | 3300046522 | Bacteria | 158427 |
| 666 | Ga0495643_0000763 | 3300046522 | Bacteria | 36080 |
| 667 | Ga0495643_0001670 | 3300046522 | Bacteria | 19438 |
| 668 | Ga0495643_0004766 | 3300046522 | Bacteria | 9368 |
| 669 | Ga0495643_0014624 | 3300046522 | Bacteria | 4663 |
| 670 | Ga0495643_0025122 | 3300046522 | Bacteria | 3374 |
| 671 | Ga0495643_0030703 | 3300046522 | Bacteria | 2998 |
| 672 | Ga0495643_0041015 | 3300046522 | Bacteria | 2525 |
| 673 | Ga0495643_0053859 | 3300046522 | Bacteria | 2155 |
| 674 | Ga0495643_0055377 | 3300046522 | Bacteria | 2120 |
| 675 | Ga0495643_0059017 | 3300046522 | Bacteria | 2040 |
| 676 | Ga0495643_0061524 | 3300046522 | Bacteria | 1990 |
| 677 | Ga0495643_0103155 | 3300046522 | Bacteria | 1459 |
| 678 | Ga0495643_0184015 | 3300046522 | Bacteria | 1013 |
| 679 | Ga0495644_0005394 | 3300046523 | Bacteria | 4994 |
| 680 | Ga0495644_0009493 | 3300046523 | Bacteria | 3750 |
| 681 | Ga0495644_0017294 | 3300046523 | Bacteria | 2757 |
| 682 | Ga0495644_0025062 | 3300046523 | Bacteria | 2266 |
| 683 | Ga0495644_0027155 | 3300046523 | Bacteria | 2169 |
| 684 | Ga0495644_0032114 | 3300046523 | Bacteria | 1984 |
| 685 | Ga0495648_0014437 | 3300046524 | Bacteria | 5783 |
| 686 | Ga0495648_0021206 | 3300046524 | Bacteria | 4506 |
| 687 | Ga0495648_0022192 | 3300046524 | Bacteria | 4376 |
| 688 | Ga0495648_0023453 | 3300046524 | Bacteria | 4225 |
| 689 | Ga0495648_0029903 | 3300046524 | Bacteria | 3609 |
| 690 | Ga0495648_0031209 | 3300046524 | Bacteria | 3511 |
| 691 | Ga0495648_0057617 | 3300046524 | Bacteria | 2328 |
| 692 | Ga0495648_0066268 | 3300046524 | Bacteria | 2117 |
| 693 | Ga0495648_0094635 | 3300046524 | Bacteria | 1663 |
| 694 | Ga0495648_0126203 | 3300046524 | Bacteria | 1367 |
| 695 | Ga0495648_0130533 | 3300046524 | Bacteria | 1336 |
| 696 | Ga0495648_0142902 | 3300046524 | Bacteria | 1257 |
| 697 | Ga0495648_0177610 | 3300046524 | Bacteria | 1085 |
| 698 | Ga0495648_0184962 | 3300046524 | Bacteria | 1056 |
| 699 | Ga0495666_0017984 | 3300046526 | Bacteria | 3520 |
| 700 | Ga0495666_0023975 | 3300046526 | Bacteria | 3017 |
| 701 | Ga0495666_0029794 | 3300046526 | Bacteria | 2684 |
| 702 | Ga0495666_0034256 | 3300046526 | Bacteria | 2478 |
| 703 | Ga0495642_0005110 | 3300046528 | Bacteria | 5051 |
| 704 | Ga0495642_0006661 | 3300046528 | Bacteria | 4435 |
| 705 | Ga0495642_0018942 | 3300046528 | Bacteria | 2696 |
| 706 | Ga0495652_0161676 | 3300046529 | Bacteria | 1738 |
| 707 | Ga0495654_0008517 | 3300046530 | Bacteria | 5656 |
| 708 | Ga0495654_0012834 | 3300046530 | Bacteria | 4494 |
| 709 | Ga0495654_0017469 | 3300046530 | Bacteria | 3773 |
| 710 | Ga0495654_0018885 | 3300046530 | Bacteria | 3607 |
| 711 | Ga0495654_0020181 | 3300046530 | Bacteria | 3475 |
| 712 | Ga0495654_0023801 | 3300046530 | Bacteria | 3169 |
| 713 | Ga0495654_0027261 | 3300046530 | Bacteria | 2930 |
| 714 | Ga0495654_0032099 | 3300046530 | Bacteria | 2663 |
| 715 | Ga0495654_0039110 | 3300046530 | Bacteria | 2368 |
| 716 | Ga0495654_0040074 | 3300046530 | Bacteria | 2336 |
| 717 | Ga0495654_0040776 | 3300046530 | Bacteria | 2311 |
| 718 | Ga0495654_0046484 | 3300046530 | Bacteria | 2137 |
| 719 | Ga0495654_0047464 | 3300046530 | Bacteria | 2110 |
| 720 | Ga0495654_0057919 | 3300046530 | Bacteria | 1870 |
| 721 | Ga0495654_0066904 | 3300046530 | Bacteria | 1711 |
| 722 | Ga0495654_0067579 | 3300046530 | Bacteria | 1701 |
| 723 | Ga0495654_0068943 | 3300046530 | Bacteria | 1680 |
| 724 | Ga0495654_0076432 | 3300046530 | Bacteria | 1578 |
| 725 | Ga0495654_0083297 | 3300046530 | Bacteria | 1495 |
| 726 | Ga0495654_0105649 | 3300046530 | Bacteria | 1290 |
| 727 | Ga0495586_0033531 | 3300046535 | Bacteria | 2755 |
| 728 | Ga0495587_0026424 | 3300046536 | Bacteria | 3541 |
| 729 | Ga0495587_0043694 | 3300046536 | Bacteria | 2668 |
| 730 | Ga0495587_0102334 | 3300046536 | Bacteria | 1649 |
| 731 | Ga0495609_0016502 | 3300046538 | Bacteria | 3441 |
| 732 | Ga0495609_0019195 | 3300046538 | Bacteria | 3165 |
| 733 | Ga0495609_0024312 | 3300046538 | Bacteria | 2779 |
| 734 | Ga0495609_0031239 | 3300046538 | Bacteria | 2422 |
| 735 | Ga0495609_0034907 | 3300046538 | Bacteria | 2278 |
| 736 | Ga0495609_0045492 | 3300046538 | Bacteria | 1967 |
| 737 | Ga0495609_0066205 | 3300046538 | Bacteria | 1591 |
| 738 | Ga0495597_0007089 | 3300046542 | Bacteria | 5736 |
| 739 | Ga0495597_0010607 | 3300046542 | Bacteria | 4494 |
| 740 | Ga0495597_0024224 | 3300046542 | Bacteria | 2803 |
| 741 | Ga0495597_0028588 | 3300046542 | Bacteria | 2551 |
| 742 | Ga0495597_0030203 | 3300046542 | Bacteria | 2470 |
| 743 | Ga0495597_0037590 | 3300046542 | Bacteria | 2173 |
| 744 | Ga0495597_0045229 | 3300046542 | Bacteria | 1954 |
| 745 | Ga0495597_0064166 | 3300046542 | Bacteria | 1595 |
| 746 | Ga0495597_0097216 | 3300046542 | Bacteria | 1244 |
| 747 | Ga0495645_0081576 | 3300046543 | Bacteria | 2320 |
| 748 | Ga0495622_0005522 | 3300046557 | Bacteria | 5863 |
| 749 | Ga0495622_0007990 | 3300046557 | Bacteria | 4905 |
| 750 | Ga0495622_0013394 | 3300046557 | Bacteria | 3803 |
| 751 | Ga0495622_0014505 | 3300046557 | Bacteria | 3659 |
| 752 | Ga0495633_0008445 | 3300046558 | Bacteria | 5794 |
| 753 | Ga0495633_0018791 | 3300046558 | Bacteria | 3504 |
| 754 | Ga0495633_0027528 | 3300046558 | Bacteria | 2779 |
| 755 | Ga0495633_0041912 | 3300046558 | Bacteria | 2175 |
| 756 | Ga0495656_0030901 | 3300046615 | Bacteria | 2167 |
| 757 | Ga0495656_0040977 | 3300046615 | Bacteria | 1932 |
| 758 | Ga0495668_0025275 | 3300046616 | Bacteria | 3376 |
| 759 | Ga0495668_0031569 | 3300046616 | Bacteria | 2985 |
| 760 | Ga0495668_0051825 | 3300046616 | Bacteria | 2271 |
| 761 | Ga0495668_0067520 | 3300046616 | Bacteria | 1967 |
| 762 | Ga0495634_0016005 | 3300046642 | Bacteria | 5372 |
| 763 | Ga0495634_0070461 | 3300046642 | Bacteria | 2304 |
| 764 | Ga0495611_0009433 | 3300046648 | Bacteria | 4124 |
| 765 | Ga0495611_0013574 | 3300046648 | Bacteria | 3470 |
| 766 | Ga0495611_0017275 | 3300046648 | Bacteria | 3084 |
| 767 | Ga0495611_0046368 | 3300046648 | Bacteria | 1948 |
| 768 | Ga0495611_0077389 | 3300046648 | Bacteria | 1525 |
| 769 | Ga0495611_0128371 | 3300046648 | Bacteria | 1183 |
| 770 | Ga0495611_0168330 | 3300046648 | Bacteria | 1024 |
| 771 | Ga0495625_0021670 | 3300046660 | Bacteria | 4943 |
| 772 | Ga0495625_0024003 | 3300046660 | Bacteria | 4649 |
| 773 | Ga0495625_0038711 | 3300046660 | Bacteria | 3488 |
| 774 | Ga0495625_0046572 | 3300046660 | Bacteria | 3129 |
| 775 | Ga0495625_0048582 | 3300046660 | Bacteria | 3054 |
| 776 | Ga0495625_0052771 | 3300046660 | Bacteria | 2910 |
| 777 | Ga0495625_0081084 | 3300046660 | Bacteria | 2258 |
| 778 | Ga0495625_0088413 | 3300046660 | Bacteria | 2146 |
| 779 | Ga0495625_0113791 | 3300046660 | Bacteria | 1847 |
| 780 | Ga0495625_0125560 | 3300046660 | Bacteria | 1742 |
| 781 | Ga0495625_0137368 | 3300046660 | Bacteria | 1651 |
| 782 | Ga0495625_0147815 | 3300046660 | Bacteria | 1581 |
| 783 | Ga0495635_0028623 | 3300046663 | Bacteria | 3872 |
| 784 | Ga0495635_0028636 | 3300046663 | Bacteria | 3871 |
| 785 | Ga0495659_0007794 | 3300046664 | Bacteria | 3396 |
| 786 | Ga0495659_0052598 | 3300046664 | Bacteria | 1487 |
| 787 | Ga0495659_0061041 | 3300046664 | Bacteria | 1392 |
| 788 | Ga0495661_0000050 | 3300046665 | Bacteria | 143435 |
| 789 | Ga0495661_0000237 | 3300046665 | Bacteria | 63564 |
| 790 | Ga0495661_0023796 | 3300046665 | Bacteria | 3971 |
| 791 | Ga0495661_0023908 | 3300046665 | Bacteria | 3959 |
| 792 | Ga0495661_0028403 | 3300046665 | Bacteria | 3581 |
| 793 | Ga0495661_0046873 | 3300046665 | Bacteria | 2636 |
| 794 | Ga0495661_0047089 | 3300046665 | Bacteria | 2627 |
| 795 | Ga0495661_0067822 | 3300046665 | Bacteria | 2094 |
| 796 | Ga0495661_0084649 | 3300046665 | Bacteria | 1819 |
| 797 | Ga0495661_0113343 | 3300046665 | Bacteria | 1508 |
| 798 | Ga0495661_0123045 | 3300046665 | Bacteria | 1430 |
| 799 | Ga0495661_0145817 | 3300046665 | Bacteria | 1283 |
| 800 | Ga0495661_0173421 | 3300046665 | Bacteria | 1148 |
| 801 | Ga0495588_0025015 | 3300046674 | Bacteria | 2971 |
| 802 | Ga0495588_0039193 | 3300046674 | Bacteria | 2413 |
| 803 | Ga0495588_0070584 | 3300046674 | Bacteria | 1815 |
| 804 | Ga0495623_0037082 | 3300046679 | Bacteria | 3122 |
| 805 | Ga0495623_0063477 | 3300046679 | Bacteria | 2312 |
| 806 | Ga0495646_0010023 | 3300046680 | Bacteria | 6023 |
| 807 | Ga0495646_0028442 | 3300046680 | Bacteria | 3499 |
| 808 | Ga0495646_0030240 | 3300046680 | Bacteria | 3382 |
| 809 | Ga0495669_0006920 | 3300046684 | Bacteria | 4750 |
| 810 | Ga0495669_0029183 | 3300046684 | Bacteria | 2418 |
| 811 | Ga0495613_0041157 | 3300046689 | Bacteria | 3422 |
| 812 | Ga0495613_0042723 | 3300046689 | Bacteria | 3353 |
| 813 | Ga0495613_0070301 | 3300046689 | Bacteria | 2552 |
| 814 | Ga0495624_0027419 | 3300046690 | Bacteria | 3730 |
| 815 | Ga0495670_0009067 | 3300046691 | Bacteria | 4895 |
| 816 | Ga0495670_0009336 | 3300046691 | Bacteria | 4825 |
| 817 | Ga0495670_0020346 | 3300046691 | Bacteria | 3271 |
| 818 | Ga0495670_0021856 | 3300046691 | Bacteria | 3157 |
| 819 | Ga0495670_0022275 | 3300046691 | Bacteria | 3127 |
| 820 | Ga0495670_0034988 | 3300046691 | Bacteria | 2502 |
| 821 | Ga0495670_0035106 | 3300046691 | Bacteria | 2498 |
| 822 | Ga0495671_0007812 | 3300046692 | Bacteria | 6055 |
| 823 | Ga0495671_0008688 | 3300046692 | Bacteria | 5707 |
| 824 | Ga0495671_0017992 | 3300046692 | Bacteria | 3758 |
| 825 | Ga0495671_0018476 | 3300046692 | Bacteria | 3699 |
| 826 | Ga0495671_0022446 | 3300046692 | Bacteria | 3307 |
| 827 | Ga0495671_0023534 | 3300046692 | Bacteria | 3217 |
| 828 | Ga0495671_0032216 | 3300046692 | Bacteria | 2676 |
| 829 | Ga0495671_0033439 | 3300046692 | Bacteria | 2619 |
| 830 | Ga0495671_0037741 | 3300046692 | Bacteria | 2442 |
| 831 | Ga0495671_0037877 | 3300046692 | Bacteria | 2437 |
| 832 | Ga0495671_0038719 | 3300046692 | Bacteria | 2409 |
| 833 | Ga0495671_0052803 | 3300046692 | Bacteria | 2019 |
| 834 | Ga0495671_0064184 | 3300046692 | Bacteria | 1808 |
| 835 | Ga0495671_0072676 | 3300046692 | Bacteria | 1688 |
| 836 | Ga0495671_0095992 | 3300046692 | Bacteria | 1450 |
| 837 | Ga0495649_0000725 | 3300046694 | Bacteria | 26788 |
| 838 | Ga0495649_0007869 | 3300046694 | Bacteria | 6449 |
| 839 | Ga0495649_0022116 | 3300046694 | Bacteria | 3559 |
| 840 | Ga0495649_0023594 | 3300046694 | Bacteria | 3436 |
| 841 | Ga0495649_0023789 | 3300046694 | Bacteria | 3420 |
| 842 | Ga0495649_0027128 | 3300046694 | Bacteria | 3178 |
| 843 | Ga0495649_0037698 | 3300046694 | Bacteria | 2653 |
| 844 | Ga0495649_0043531 | 3300046694 | Bacteria | 2450 |
| 845 | Ga0495649_0043991 | 3300046694 | Bacteria | 2438 |
| 846 | Ga0495649_0051156 | 3300046694 | Bacteria | 2240 |
| 847 | Ga0495649_0059341 | 3300046694 | Bacteria | 2059 |
| 848 | Ga0495649_0069878 | 3300046694 | Bacteria | 1883 |
| 849 | Ga0495649_0071085 | 3300046694 | Bacteria | 1865 |
| 850 | Ga0495649_0130415 | 3300046694 | Bacteria | 1326 |
| 851 | Ga0495649_0142756 | 3300046694 | Bacteria | 1259 |
| 852 | Ga0495589_0028196 | 3300046794 | Bacteria | 2834 |
| 853 | Ga0495589_0031931 | 3300046794 | Bacteria | 2649 |
| 854 | Ga0495589_0043350 | 3300046794 | Bacteria | 2239 |
| 855 | Ga0495589_0055307 | 3300046794 | Bacteria | 1956 |
| 856 | Ga0495589_0072609 | 3300046794 | Bacteria | 1680 |
| 857 | Ga0495589_0187826 | 3300046794 | Bacteria | 978 |
| 858 | Ga0495600_0034535 | 3300046809 | Bacteria | 3283 |
| 859 | Ga0495600_0082743 | 3300046809 | Bacteria | 2094 |
| 860 | Ga0495660_0013927 | 3300046810 | Bacteria | 4661 |
| 861 | Ga0495660_0017989 | 3300046810 | Bacteria | 4066 |
| 862 | Ga0495660_0031394 | 3300046810 | Bacteria | 2986 |
| 863 | Ga0495660_0033288 | 3300046810 | Bacteria | 2891 |
| 864 | Ga0495660_0035527 | 3300046810 | Bacteria | 2783 |
| 865 | Ga0495660_0036155 | 3300046810 | Bacteria | 2755 |
| 866 | Ga0495660_0037136 | 3300046810 | Bacteria | 2714 |
| 867 | Ga0495660_0038752 | 3300046810 | Bacteria | 2648 |
| 868 | Ga0495660_0040351 | 3300046810 | Bacteria | 2588 |
| 869 | Ga0495660_0040857 | 3300046810 | Bacteria | 2569 |
| 870 | Ga0495660_0040989 | 3300046810 | Bacteria | 2565 |
| 871 | Ga0495660_0044744 | 3300046810 | Bacteria | 2433 |
| 872 | Ga0495660_0049835 | 3300046810 | Bacteria | 2283 |
| 873 | Ga0495660_0057402 | 3300046810 | Bacteria | 2100 |
| 874 | Ga0495660_0058325 | 3300046810 | Bacteria | 2080 |
| 875 | Ga0495660_0084457 | 3300046810 | Bacteria | 1660 |
| 876 | Ga0495660_0096745 | 3300046810 | Bacteria | 1525 |
| 877 | Ga0495660_0123159 | 3300046810 | Bacteria | 1309 |
| 878 | Ga0495581_0030603 | 3300047315 | Bacteria | 3118 |
| 879 | Ga0495581_0051768 | 3300047315 | Bacteria | 2371 |
| 880 | Ga0495604_0019031 | 3300047317 | Bacteria | 5499 |
| 881 | Ga0495604_0032278 | 3300047317 | Bacteria | 4152 |
| 882 | Ga0495604_0042220 | 3300047317 | Bacteria | 3575 |
| 883 | Ga0495604_0048852 | 3300047317 | Bacteria | 3290 |
| 884 | Ga0495636_0009441 | 3300047318 | Bacteria | 3842 |
| 885 | Ga0495636_0036031 | 3300047318 | Bacteria | 2039 |
| 886 | Ga0495674_0064236 | 3300047319 | Bacteria | 3191 |
| 887 | Ga0495672_0014794 | 3300047320 | Bacteria | 5322 |
| 888 | Ga0495672_0018590 | 3300047320 | Bacteria | 4608 |
| 889 | Ga0495672_0025302 | 3300047320 | Bacteria | 3802 |
| 890 | Ga0495672_0026154 | 3300047320 | Bacteria | 3725 |
| 891 | Ga0495672_0035308 | 3300047320 | Bacteria | 3079 |
| 892 | Ga0495672_0039135 | 3300047320 | Bacteria | 2885 |
| 893 | Ga0495672_0044455 | 3300047320 | Bacteria | 2664 |
| 894 | Ga0495672_0045385 | 3300047320 | Bacteria | 2629 |
| 895 | Ga0495672_0057754 | 3300047320 | Bacteria | 2252 |
| 896 | Ga0495672_0075429 | 3300047320 | Bacteria | 1896 |
| 897 | Ga0495672_0087343 | 3300047320 | Bacteria | 1722 |
| 898 | Ga0495672_0088476 | 3300047320 | Bacteria | 1706 |
| 899 | Ga0495672_0091741 | 3300047320 | Bacteria | 1666 |
| 900 | Ga0495672_0159046 | 3300047320 | Bacteria | 1163 |
| 901 | Ga0495672_0226650 | 3300047320 | Bacteria | 919 |
| 902 | Ga0495676_0031366 | 3300047321 | Bacteria | 4496 |
| 903 | Ga0495676_0052426 | 3300047321 | Bacteria | 3256 |
| 904 | Ga0495680_0032403 | 3300047322 | Bacteria | 4242 |
| 905 | Ga0495680_0036330 | 3300047322 | Bacteria | 3956 |
| 906 | Ga0495680_0054574 | 3300047322 | Bacteria | 3102 |
| 907 | Ga0495680_0076351 | 3300047322 | Bacteria | 2540 |
| 908 | Ga0495680_0083323 | 3300047322 | Bacteria | 2412 |
| 909 | Ga0495683_0010175 | 3300047323 | Bacteria | 4982 |
| 910 | Ga0495683_0012543 | 3300047323 | Bacteria | 4448 |
| 911 | Ga0495683_0016882 | 3300047323 | Bacteria | 3788 |
| 912 | Ga0495683_0020848 | 3300047323 | Bacteria | 3379 |
| 913 | Ga0495683_0024261 | 3300047323 | Bacteria | 3113 |
| 914 | Ga0495683_0030420 | 3300047323 | Bacteria | 2754 |
| 915 | Ga0495683_0035681 | 3300047323 | Bacteria | 2527 |
| 916 | Ga0495683_0037379 | 3300047323 | Bacteria | 2461 |
| 917 | Ga0495683_0047155 | 3300047323 | Bacteria | 2162 |
| 918 | Ga0495683_0052197 | 3300047323 | Bacteria | 2041 |
| 919 | Ga0495683_0052885 | 3300047323 | Bacteria | 2026 |
| 920 | Ga0495683_0053528 | 3300047323 | Bacteria | 2012 |
| 921 | Ga0495683_0101895 | 3300047323 | Bacteria | 1379 |
| 922 | Ga0495687_017480 | 3300047443 | Bacteria | 3576 |
| 923 | Ga0495687_017526 | 3300047443 | Bacteria | 3570 |
| 924 | Ga0495687_033272 | 3300047443 | Bacteria | 2340 |
| 925 | Ga0495687_123173 | 3300047443 | Bacteria | 931 |
| 926 | Ga0495675_0044823 | 3300047444 | Bacteria | 2817 |
| 927 | Ga0495675_0046665 | 3300047444 | Bacteria | 2757 |
| 928 | Ga0495675_0116536 | 3300047444 | Bacteria | 1665 |
| 929 | Ga0495677_0004678 | 3300047445 | Bacteria | 5218 |
| 930 | Ga0495679_009197 | 3300047446 | Bacteria | 3970 |
| 931 | Ga0495679_012685 | 3300047446 | Bacteria | 3193 |
| 932 | Ga0495679_013111 | 3300047446 | Bacteria | 3125 |
| 933 | Ga0495679_013223 | 3300047446 | Bacteria | 3107 |
| 934 | Ga0495679_017211 | 3300047446 | Bacteria | 2592 |
| 935 | Ga0495679_022547 | 3300047446 | Bacteria | 2152 |
| 936 | Ga0495679_025617 | 3300047446 | Bacteria | 1969 |
| 937 | Ga0495685_015937 | 3300047447 | Bacteria | 2567 |
| 938 | Ga0495673_0012237 | 3300047469 | Bacteria | 4565 |
| 939 | Ga0495673_0016330 | 3300047469 | Bacteria | 3797 |
| 940 | Ga0495673_0020204 | 3300047469 | Bacteria | 3320 |
| 941 | Ga0495673_0021446 | 3300047469 | Bacteria | 3188 |
| 942 | Ga0495673_0023010 | 3300047469 | Bacteria | 3042 |
| 943 | Ga0495673_0025625 | 3300047469 | Bacteria | 2827 |
| 944 | Ga0495673_0027578 | 3300047469 | Bacteria | 2700 |
| 945 | Ga0495673_0031430 | 3300047469 | Bacteria | 2485 |
| 946 | Ga0495673_0043200 | 3300047469 | Bacteria | 2018 |
| 947 | Ga0495673_0047314 | 3300047469 | Bacteria | 1901 |
| 948 | Ga0495673_0054855 | 3300047469 | Bacteria | 1731 |
| 949 | Ga0495673_0059139 | 3300047469 | Bacteria | 1648 |
| 950 | Ga0495673_0075104 | 3300047469 | Bacteria | 1412 |
| 951 | Ga0495673_0109797 | 3300047469 | Bacteria | 1104 |
| 952 | Ga0495681_0011206 | 3300047470 | Bacteria | 5359 |
| 953 | Ga0495681_0012925 | 3300047470 | Bacteria | 4880 |
| 954 | Ga0495681_0013057 | 3300047470 | Bacteria | 4846 |
| 955 | Ga0495681_0013405 | 3300047470 | Bacteria | 4757 |
| 956 | Ga0495681_0013515 | 3300047470 | Bacteria | 4730 |
| 957 | Ga0495681_0014772 | 3300047470 | Bacteria | 4456 |
| 958 | Ga0495681_0016174 | 3300047470 | Bacteria | 4196 |
| 959 | Ga0495681_0020907 | 3300047470 | Bacteria | 3538 |
| 960 | Ga0495681_0026039 | 3300047470 | Bacteria | 3054 |
| 961 | Ga0495681_0028323 | 3300047470 | Bacteria | 2883 |
| 962 | Ga0495681_0028746 | 3300047470 | Bacteria | 2855 |
| 963 | Ga0495681_0029270 | 3300047470 | Bacteria | 2821 |
| 964 | Ga0495681_0029661 | 3300047470 | Bacteria | 2796 |
| 965 | Ga0495681_0035755 | 3300047470 | Bacteria | 2463 |
| 966 | Ga0495681_0046943 | 3300047470 | Bacteria | 2056 |
| 967 | Ga0495681_0057781 | 3300047470 | Bacteria | 1800 |
| 968 | Ga0495681_0105391 | 3300047470 | Bacteria | 1227 |
| 969 | Ga0495681_0140587 | 3300047470 | Bacteria | 1020 |
| 970 | Ga0495684_0061164 | 3300047471 | Bacteria | 2865 |
| 971 | Ga0495684_0076248 | 3300047471 | Bacteria | 2546 |
| 972 | Ga0495686_0029421 | 3300047472 | Bacteria | 3573 |
| 973 | Ga0495686_0031611 | 3300047472 | Bacteria | 3432 |
| 974 | Ga0495686_0060339 | 3300047472 | Bacteria | 2357 |
| 975 | Ga0495686_0076311 | 3300047472 | Bacteria | 2053 |
| 976 | Ga0495686_0087504 | 3300047472 | Bacteria | 1895 |
| 977 | Ga0495686_0266360 | 3300047472 | Bacteria | 957 |
| 978 | Ga0495593_0020773 | 3300047673 | Bacteria | 3672 |
| 979 | Ga0495593_0021361 | 3300047673 | Bacteria | 3617 |
| 980 | Ga0495593_0032767 | 3300047673 | Bacteria | 2831 |
| 981 | Ga0495593_0037327 | 3300047673 | Bacteria | 2629 |
| 982 | Ga0495593_0054077 | 3300047673 | Bacteria | 2117 |
| 983 | Ga0495593_0095593 | 3300047673 | Bacteria | 1528 |
| 984 | Ga0495602_0054159 | 3300048088 | Bacteria | 3544 |
| 985 | Ga0495602_0207948 | 3300048088 | Bacteria | 1488 |
| 986 | Ga0495614_0107475 | 3300048089 | Bacteria | 1223 |
| 987 | Ga0495626_0008198 | 3300048091 | Bacteria | 5753 |
| 988 | Ga0495626_0010089 | 3300048091 | Bacteria | 5069 |
| 989 | Ga0495626_0014194 | 3300048091 | Bacteria | 4116 |
| 990 | Ga0495626_0017785 | 3300048091 | Bacteria | 3584 |
| 991 | Ga0495626_0019419 | 3300048091 | Bacteria | 3401 |
| 992 | Ga0495626_0022212 | 3300048091 | Bacteria | 3135 |
| 993 | Ga0495626_0022802 | 3300048091 | Bacteria | 3090 |
| 994 | Ga0495626_0033920 | 3300048091 | Bacteria | 2444 |
| 995 | Ga0495626_0041113 | 3300048091 | Bacteria | 2180 |
| 996 | Ga0496100_0456818 | 3300048903 | Bacteria | 980 |
| 997 | Ga0496102_0024125 | 3300048905 | Bacteria | 5406 |
| 998 | Ga0496103_0032165 | 3300048906 | Bacteria | 3200 |
| 999 | Ga0496106_0176044 | 3300048909 | Bacteria | 1697 |
| 1000 | Ga0496106_0233057 | 3300048909 | Bacteria | 1470 |
| 1001 | Ga0496110_0027114 | 3300048913 | Bacteria | 4908 |
| 1002 | Ga0496110_0048363 | 3300048913 | Bacteria | 3728 |
| 1003 | Ga0496110_0114370 | 3300048913 | Bacteria | 2428 |
| 1004 | Ga0496111_0143312 | 3300048914 | Bacteria | 1771 |
| 1005 | Ga0496112_0048846 | 3300048915 | Bacteria | 4146 |
| 1006 | Ga0496114_0232401 | 3300048917 | Bacteria | 1620 |
| 1007 | Ga0496116_0000553 | 3300048919 | Bacteria | 50128 |
| 1008 | Ga0496116_0020330 | 3300048919 | Bacteria | 5045 |
| 1009 | Ga0496116_0021053 | 3300048919 | Bacteria | 4929 |
| 1010 | Ga0496116_0023212 | 3300048919 | Bacteria | 4626 |
| 1011 | Ga0496116_0030167 | 3300048919 | Bacteria | 3900 |
| 1012 | Ga0496116_0049567 | 3300048919 | Bacteria | 2806 |
| 1013 | Ga0496117_0004706 | 3300048920 | Bacteria | 14813 |
| 1014 | Ga0496117_0010887 | 3300048920 | Bacteria | 8201 |
| 1015 | Ga0496117_0011746 | 3300048920 | Bacteria | 7807 |
| 1016 | Ga0496117_0022788 | 3300048920 | Bacteria | 5016 |
| 1017 | Ga0496117_0026451 | 3300048920 | Bacteria | 4539 |
| 1018 | Ga0496117_0030790 | 3300048920 | Bacteria | 4108 |
| 1019 | Ga0496117_0044470 | 3300048920 | Bacteria | 3217 |
| 1020 | Ga0496117_0055628 | 3300048920 | Bacteria | 2763 |
| 1021 | Ga0496117_0064053 | 3300048920 | Bacteria | 2508 |
| 1022 | Ga0496117_0067604 | 3300048920 | Bacteria | 2417 |
| 1023 | Ga0496117_0083226 | 3300048920 | Bacteria | 2092 |
| 1024 | Ga0496117_0086557 | 3300048920 | Bacteria | 2035 |
| 1025 | Ga0496117_0095788 | 3300048920 | Bacteria | 1895 |
| 1026 | Ga0496117_0105643 | 3300048920 | Bacteria | 1769 |
| 1027 | Ga0496117_0136768 | 3300048920 | Bacteria | 1474 |
| 1028 | Ga0496118_0021266 | 3300048921 | Bacteria | 5718 |
| 1029 | Ga0496118_0030327 | 3300048921 | Bacteria | 4516 |
| 1030 | Ga0496118_0038175 | 3300048921 | Bacteria | 3853 |
| 1031 | Ga0496118_0046068 | 3300048921 | Bacteria | 3396 |
| 1032 | Ga0496118_0051016 | 3300048921 | Bacteria | 3169 |
| 1033 | Ga0496118_0053707 | 3300048921 | Bacteria | 3059 |
| 1034 | Ga0496118_0054259 | 3300048921 | Bacteria | 3037 |
| 1035 | Ga0496118_0065381 | 3300048921 | Bacteria | 2661 |
| 1036 | Ga0496118_0073766 | 3300048921 | Bacteria | 2442 |
| 1037 | Ga0496118_0098634 | 3300048921 | Bacteria | 1983 |
| 1038 | Ga0496118_0101442 | 3300048921 | Bacteria | 1943 |
| 1039 | Ga0496118_0131982 | 3300048921 | Bacteria | 1602 |
| 1040 | Ga0496118_0273243 | 3300048921 | Bacteria | 945 |
| 1041 | Ga0496119_0039114 | 3300048922 | Bacteria | 3051 |
| 1042 | Ga0496119_0058122 | 3300048922 | Bacteria | 2332 |
| 1043 | Ga0496119_0125009 | 3300048922 | Bacteria | 1408 |
| 1044 | Ga0496120_0032866 | 3300048923 | Bacteria | 3122 |
| 1045 | Ga0496120_0050085 | 3300048923 | Bacteria | 2393 |
| 1046 | Ga0496120_0076334 | 3300048923 | Bacteria | 1826 |
| 1047 | Ga0496120_0093334 | 3300048923 | Bacteria | 1603 |
| 1048 | Ga0496121_0002156 | 3300048924 | Bacteria | 30791 |
| 1049 | Ga0496121_0051557 | 3300048924 | Bacteria | 3464 |
| 1050 | Ga0496121_0059834 | 3300048924 | Bacteria | 3139 |
| 1051 | Ga0496121_0066410 | 3300048924 | Bacteria | 2929 |
| 1052 | Ga0496121_0072211 | 3300048924 | Bacteria | 2771 |
| 1053 | Ga0496121_0074470 | 3300048924 | Bacteria | 2716 |
| 1054 | Ga0496121_0119247 | 3300048924 | Bacteria | 1995 |
| 1055 | Ga0496121_0121353 | 3300048924 | Bacteria | 1973 |
| 1056 | Ga0496121_0129552 | 3300048924 | Bacteria | 1891 |
| 1057 | Ga0496122_0003147 | 3300048925 | Bacteria | 22087 |
| 1058 | Ga0496122_0019874 | 3300048925 | Bacteria | 6108 |
| 1059 | Ga0496122_0033022 | 3300048925 | Bacteria | 4264 |
| 1060 | Ga0496122_0044173 | 3300048925 | Bacteria | 3481 |
| 1061 | Ga0496122_0071230 | 3300048925 | Bacteria | 2478 |
| 1062 | Ga0496122_0076537 | 3300048925 | Bacteria | 2354 |
| 1063 | Ga0496122_0089469 | 3300048925 | Bacteria | 2105 |
| 1064 | Ga0496122_0127401 | 3300048925 | Bacteria | 1626 |
| 1065 | Ga0496122_0157989 | 3300048925 | Bacteria | 1387 |
| 1066 | Ga0496123_0005550 | 3300048926 | Bacteria | 12643 |
| 1067 | Ga0496123_0011769 | 3300048926 | Bacteria | 7537 |
| 1068 | Ga0496123_0062503 | 3300048926 | Bacteria | 2385 |
| 1069 | Ga0496123_0081146 | 3300048926 | Bacteria | 1972 |
| 1070 | Ga0496123_0082782 | 3300048926 | Bacteria | 1943 |
| 1071 | Ga0496123_0114739 | 3300048926 | Bacteria | 1530 |
| 1072 | Ga0496123_0117741 | 3300048926 | Bacteria | 1502 |
| 1073 | Ga0496124_0015776 | 3300048927 | Bacteria | 7218 |
| 1074 | Ga0496124_0016734 | 3300048927 | Bacteria | 6955 |
| 1075 | Ga0496124_0037065 | 3300048927 | Bacteria | 4244 |
| 1076 | Ga0496124_0040245 | 3300048927 | Bacteria | 4045 |
| 1077 | Ga0496124_0042770 | 3300048927 | Bacteria | 3898 |
| 1078 | Ga0496124_0053382 | 3300048927 | Bacteria | 3426 |
| 1079 | Ga0496124_0054775 | 3300048927 | Bacteria | 3374 |
| 1080 | Ga0496124_0060651 | 3300048927 | Bacteria | 3172 |
| 1081 | Ga0496124_0074938 | 3300048927 | Bacteria | 2796 |
| 1082 | Ga0496124_0096790 | 3300048927 | Bacteria | 2397 |
| 1083 | Ga0496124_0101166 | 3300048927 | Bacteria | 2335 |
| 1084 | Ga0496124_0118371 | 3300048927 | Bacteria | 2120 |
| 1085 | Ga0496124_0120772 | 3300048927 | Bacteria | 2094 |
| 1086 | Ga0496124_0137979 | 3300048927 | Bacteria | 1928 |
| 1087 | Ga0496124_0181579 | 3300048927 | Bacteria | 1618 |
| 1088 | Ga0496124_0391174 | 3300048927 | Bacteria | 968 |
| 1089 | Ga0496125_0001493 | 3300048928 | Bacteria | 33555 |
| 1090 | Ga0496125_0017205 | 3300048928 | Bacteria | 6910 |
| 1091 | Ga0496125_0026758 | 3300048928 | Bacteria | 5242 |
| 1092 | Ga0496125_0030680 | 3300048928 | Bacteria | 4805 |
| 1093 | Ga0496125_0032969 | 3300048928 | Bacteria | 4591 |
| 1094 | Ga0496125_0033332 | 3300048928 | Bacteria | 4558 |
| 1095 | Ga0496125_0033777 | 3300048928 | Bacteria | 4520 |
| 1096 | Ga0496125_0044072 | 3300048928 | Bacteria | 3778 |
| 1097 | Ga0496125_0065031 | 3300048928 | Bacteria | 2893 |
| 1098 | Ga0496125_0071078 | 3300048928 | Bacteria | 2720 |
| 1099 | Ga0496125_0143599 | 3300048928 | Bacteria | 1654 |
| 1100 | Ga0496125_0323505 | 3300048928 | Bacteria | 934 |
| 1101 | Ga0496126_0048258 | 3300048929 | Bacteria | 3892 |
| 1102 | Ga0496126_0080136 | 3300048929 | Bacteria | 2889 |
| 1103 | Ga0496126_0102267 | 3300048929 | Bacteria | 2505 |
| 1104 | Ga0495678_009808 | 3300049459 | Bacteria | 4702 |
| 1105 | Ga0495678_014879 | 3300049459 | Bacteria | 3603 |
| 1106 | Ga0495678_015484 | 3300049459 | Bacteria | 3505 |
| 1107 | Ga0495678_018110 | 3300049459 | Bacteria | 3174 |
| 1108 | Ga0495678_018414 | 3300049459 | Bacteria | 3140 |
| 1109 | Ga0495678_020524 | 3300049459 | Bacteria | 2922 |
| 1110 | Ga0495678_024213 | 3300049459 | Bacteria | 2625 |
| 1111 | Ga0495678_029482 | 3300049459 | Bacteria | 2303 |
| 1112 | Ga0495678_035817 | 3300049459 | Bacteria | 2030 |
| 1113 | Ga0495678_042029 | 3300049459 | Bacteria | 1825 |
| 1114 | Ga0495678_042644 | 3300049459 | Bacteria | 1807 |
| 1115 | Ga0495678_063171 | 3300049459 | Bacteria | 1384 |
| 1116 | Ga0495682_0011288 | 3300049460 | Bacteria | 3437 |
| 1117 | Ga0495682_0013801 | 3300049460 | Bacteria | 3070 |
| 1118 | Ga0495682_0016055 | 3300049460 | Bacteria | 2833 |
| 1119 | Ga0495682_0018212 | 3300049460 | Bacteria | 2646 |
| 1120 | Ga0495682_0045992 | 3300049460 | Bacteria | 1594 |
| 1121 | Ga0495682_0067142 | 3300049460 | Bacteria | 1292 |
| 1122 | Ga0495682_0105090 | 3300049460 | Bacteria | 1012 |
| 1123 | Ga0495682_0112085 | 3300049460 | Bacteria | 977 |
| 1124 | Ga0501032_0074296 | 3300049569 | Bacteria | 2265 |
| 1125 | Ga0501034_0000136 | 3300049571 | Bacteria | 136835 |
| 1126 | Ga0501034_0137574 | 3300049571 | Bacteria | 2423 |
| 1127 | Ga0501037_0129371 | 3300049573 | Bacteria | 1811 |
| 1128 | Ga0501039_0499613 | 3300049575 | Bacteria | 955 |
| 1129 | Ga0501241_003143 | 3300049758 | Bacteria | 3145 |
| 1130 | Ga0501226_008915 | 3300049853 | Bacteria | 1118 |
| 1131 | nmdc:mga03683_49051_c1 | 3300050489 | Bacteria | 1756 |
| 1132 | nmdc:mga03683_73931_c1 | 3300050489 | Bacteria | 1462 |
| 1133 | nmdc:mga00v17_141526_c1 | 3300050491 | Bacteria | 1543 |
| 1134 | nmdc:mga00v17_48241_c1 | 3300050491 | Bacteria | 2581 |
| 1135 | nmdc:mga00v17_83941_c1 | 3300050491 | Bacteria | 1993 |
| 1136 | nmdc:mga00v17_86173_c2 | 3300050491 | Bacteria | 1517 |
| 1137 | nmdc:mga00v17_92322_c1 | 3300050491 | Bacteria | 1903 |
| 1138 | nmdc:mga00v17_98593_c1 | 3300050491 | Bacteria | 1843 |
| 1139 | nmdc:mga08x19_258699_c1 | 3300050514 | Bacteria | 1203 |
| 1140 | nmdc:mga08x19_74779_c1 | 3300050514 | Bacteria | 2214 |
| 1141 | nmdc:mga0sz30_11261_c1 | 3300050516 | Bacteria | 3448 |
| 1142 | Ga0500641_0107163 | 3300053096 | Bacteria | 1201 |
| 1143 | Ga0500572_004522 | 3300053111 | Bacteria | 3156 |
| 1144 | Ga0500572_089784 | 3300053111 | Bacteria | 972 |
| 1145 | Ga0500659_0000714 | 3300053135 | Bacteria | 21442 |
| 1146 | Ga0500634_0023548 | 3300053161 | Bacteria | 3346 |
| 1147 | 2510293635 | 2510065055 | Bacteria | 5037935 |
| 1148 | 2510310759 | 2510065058 | Bacteria | 5005894 |
| 1149 | 2511252650 | 2511231004 | Bacteria | 6669789 |
| 1150 | 2511263251 | 2511231006 | Bacteria | 6794709 |
| 1151 | 2511269960 | 2511231007 | Bacteria | 6306603 |
| 1152 | 2511275613 | 2511231008 | Bacteria | 6624100 |
| 1153 | 2511289876 | 2511231010 | Bacteria | 6373152 |
| 1154 | 2511294376 | 2511231011 | Bacteria | 6149768 |
| 1155 | 2511302029 | 2511231012 | Bacteria | 6738011 |
| 1156 | 2511315367 | 2511231014 | Bacteria | 6462302 |
| 1157 | 2511321265 | 2511231015 | Bacteria | 6598026 |
| 1158 | 2511325040 | 2511231016 | Bacteria | 6704427 |
| 1159 | 2511332098 | 2511231017 | Bacteria | 6503007 |
| 1160 | 2511339169 | 2511231018 | Bacteria | 6436256 |
| 1161 | 2511343157 | 2511231019 | Bacteria | 6520662 |
| 1162 | 2511348670 | 2511231020 | Bacteria | 6115223 |
| 1163 | 2511358312 | 2511231021 | Bacteria | 7302637 |
| 1164 | 2511364225 | 2511231022 | Bacteria | 6719296 |
| 1165 | 2511373883 | 2511231024 | Bacteria | 5835885 |
| 1166 | 2511416502 | 2511231031 | Bacteria | 6558529 |
| 1167 | 2511827779 | 2511231156 | Bacteria | 6845832 |
| 1168 | 2512326537 | 2512047018 | Bacteria | 6663241 |
| 1169 | 2554818448 | 2554235132 | Bacteria | 6772433 |
| 1170 | 2555246437 | 2554235231 | Bacteria | 5215788 |
| 1171 | 2555672969 | 2554235341 | Bacteria | 6867980 |
| 1172 | 2583795586 | 2582580891 | Bacteria | 6800976 |
| 1173 | 2597861020 | 2597489887 | Bacteria | 6666321 |
| 1174 | 2597866762 | 2597489888 | Bacteria | 6179543 |
| 1175 | 2597872622 | 2597489889 | Bacteria | 6297495 |
| 1176 | 2599355824 | 2599185160 | Bacteria | 6844013 |
| 1177 | 2599362774 | 2599185161 | Bacteria | 6960462 |
| 1178 | 2599368920 | 2599185162 | Bacteria | 6957254 |
| 1179 | 2599375883 | 2599185163 | Bacteria | 6995158 |
| 1180 | 2599380930 | 2599185164 | Bacteria | 6841688 |
| 1181 | 2599387554 | 2599185165 | Bacteria | 6843250 |
| 1182 | 2599394741 | 2599185166 | Bacteria | 6959206 |
| 1183 | 2599406506 | 2599185168 | Bacteria | 6997636 |
| 1184 | 2599462658 | 2599185181 | Bacteria | 6844519 |
| 1185 | 2599467920 | 2599185182 | Bacteria | 6883168 |
| 1186 | 2599485746 | 2599185185 | Bacteria | 6652270 |
| 1187 | 2599491675 | 2599185186 | Bacteria | 6831633 |
| 1188 | 2599500394 | 2599185188 | Bacteria | 6164180 |
| 1189 | 2599505884 | 2599185189 | Bacteria | 5862825 |
| 1190 | 2599615977 | 2599185212 | Bacteria | 6765997 |
| 1191 | 2599768008 | 2599185248 | Bacteria | 6696816 |
| 1192 | 2599804525 | 2599185257 | Bacteria | 6492581 |
| 1193 | 2599879173 | 2599185288 | Bacteria | 6666191 |
| 1194 | 2599885446 | 2599185289 | Bacteria | 6778765 |
| 1195 | 2599897160 | 2599185291 | Bacteria | 6775623 |
| 1196 | 2599930583 | 2599185300 | Bacteria | 6062622 |
| 1197 | 2599942220 | 2599185302 | Bacteria | 5954930 |
| 1198 | 2599948880 | 2599185303 | Bacteria | 6512725 |
| 1199 | 2599954366 | 2599185304 | Bacteria | 5951361 |
| 1200 | 2599963028 | 2599185305 | Bacteria | 6748700 |
| 1201 | 2599966085 | 2599185306 | Bacteria | 6637356 |
| 1202 | 2599977865 | 2599185308 | Bacteria | 6621546 |
| 1203 | 2599982788 | 2599185309 | Bacteria | 5969593 |
| 1204 | 2599988459 | 2599185310 | Bacteria | 6014457 |
| 1205 | 2599994120 | 2599185311 | Bacteria | 6354990 |
| 1206 | 2599999257 | 2599185312 | Bacteria | 5912071 |
| 1207 | 2600004171 | 2599185313 | Bacteria | 6658188 |
| 1208 | 2600012032 | 2599185314 | Bacteria | 6621749 |
| 1209 | 2600019899 | 2599185315 | Bacteria | 6771107 |
| 1210 | 2600026200 | 2599185316 | Bacteria | 6320029 |
| 1211 | 2600031271 | 2599185317 | Bacteria | 6435722 |
| 1212 | 2600036113 | 2599185318 | Bacteria | 6961590 |
| 1213 | 2600044344 | 2599185319 | Bacteria | 6637840 |
| 1214 | 2600046787 | 2599185320 | Bacteria | 5963263 |
| 1215 | 2600054467 | 2599185321 | Bacteria | 6764560 |
| 1216 | 2600062210 | 2599185322 | Bacteria | 6763055 |
| 1217 | 2600067876 | 2599185323 | Bacteria | 6688755 |
| 1218 | 2600072005 | 2599185324 | Bacteria | 6590677 |
| 1219 | 2600076407 | 2599185325 | Bacteria | 6324919 |
| 1220 | 2600215282 | 2599185356 | Bacteria | 6843884 |
| 1221 | 2600359504 | 2600254930 | Bacteria | 6431253 |
| 1222 | 2600363415 | 2600254931 | Bacteria | 6734225 |
| 1223 | 2601693120 | 2600255296 | Bacteria | 5784754 |
| 1224 | 2601775448 | 2600255313 | Bacteria | 6842543 |
| 1225 | 2601798416 | 2600255318 | Bacteria | 6383414 |
| 1226 | 2606077310 | 2603880185 | Bacteria | 6379190 |
| 1227 | 2606129444 | 2603880199 | Bacteria | 6377649 |
| 1228 | 2608385101 | 2606217733 | Bacteria | 6360972 |
| 1229 | 2621296712 | 2619619299 | Bacteria | 6649820 |
| 1230 | 2624483550 | 2623620443 | Bacteria | 6427864 |
| 1231 | 2624495099 | 2623620446 | Bacteria | 6500345 |
| 1232 | 2643843099 | 2643221565 | Bacteria | 6216018 |
| 1233 | 2643873343 | 2643221571 | Bacteria | 6228673 |
| 1234 | 2643956177 | 2643221589 | Bacteria | 6250934 |
| 1235 | 2644020297 | 2643221602 | Bacteria | 6249926 |
| 1236 | 2644184337 | 2643221633 | Bacteria | 6733554 |
| 1237 | 2644283094 | 2643221650 | Bacteria | 7029547 |
| 1238 | 2644624597 | 2643221713 | Bacteria | 6554480 |
| 1239 | 2652547061 | 2651869719 | Bacteria | 6047974 |
| 1240 | 2671089691 | 2667528170 | Bacteria | 6786960 |
| 1241 | 2671099415 | 2667528171 | Bacteria | 6900659 |
| 1242 | 2671129500 | 2667528176 | Bacteria | 6724917 |
| 1243 | 2671771532 | 2671180172 | Bacteria | 6495783 |
| 1244 | 2677900613 | 2675903420 | Bacteria | 6247433 |
| 1245 | 2678266281 | 2675903515 | Bacteria | 6580491 |
| 1246 | 2715749698 | 2713897148 | Bacteria | 5883533 |
| 1247 | 2715754707 | 2713897149 | Bacteria | 6506249 |
| 1248 | 2718636754 | 2718217725 | Bacteria | 5758958 |
| 1249 | 2723251497 | 2721755607 | Bacteria | 5841722 |
| 1250 | 2729147107 | 2728369097 | Bacteria | 4333476 |
| 1251 | 2738675393 | 2738541265 | Bacteria | 6594665 |
| 1252 | 2738753796 | 2738541282 | Bacteria | 6593925 |
| 1253 | 2738807389 | 2738541294 | Bacteria | 6925949 |
| 1254 | 2738862785 | 2738541303 | Bacteria | 6591772 |
| 1255 | 2738894749 | 2738541309 | Bacteria | 6926455 |
| 1256 | 2739199190 | 2738543004 | Bacteria | 6381073 |
| 1257 | 2739260542 | 2738543015 | Bacteria | 6750701 |
| 1258 | 2739285805 | 2738543020 | Bacteria | 5718238 |
| 1259 | 2739291118 | 2738543021 | Bacteria | 5718241 |
| 1260 | 2739312368 | 2738543025 | Bacteria | 6600348 |
| 1261 | 2743740561 | 2740892503 | Bacteria | 6855563 |
| 1262 | 2745007513 | 2744054620 | Bacteria | 6551379 |
| 1263 | 2765586707 | 2765235841 | Bacteria | 6137024 |
| 1264 | 2774118211 | 2773857670 | Bacteria | 6407454 |
| 1265 | 2774128994 | 2773857672 | Bacteria | 4993178 |
| 1266 | 2774136329 | 2773857673 | Bacteria | 6513460 |
| 1267 | 2784261677 | 2784132063 | Bacteria | 6262788 |
| 1268 | 2784313736 | 2784132072 | Bacteria | 6596533 |
| 1269 | 2794593706 | 2791355520 | Bacteria | 5948615 |
| 1270 | 2807459242 | 2806310745 | Bacteria | 5742165 |
| 1271 | 2808856729 | 2808606361 | Bacteria | 6136259 |
| 1272 | 2808906129 | 2808606373 | Bacteria | 4423627 |
| 1273 | 2808926126 | 2808606376 | Bacteria | 6248667 |
| 1274 | 2808928301 | 2808606377 | Bacteria | 6646337 |
| 1275 | 2808936694 | 2808606378 | Bacteria | 6177535 |
| 1276 | 2808948227 | 2808606380 | Bacteria | 6248705 |
| 1277 | 2808950516 | 2808606381 | Bacteria | 6646461 |
| 1278 | 2808959935 | 2808606382 | Bacteria | 6841132 |
| 1279 | 2808965012 | 2808606383 | Bacteria | 6138645 |
| 1280 | 2808976287 | 2808606385 | Bacteria | 6711065 |
| 1281 | 2808994251 | 2808606388 | Bacteria | 6706662 |
| 1282 | 2808999904 | 2808606389 | Bacteria | 6138126 |
| 1283 | 2809217344 | 2808606445 | Bacteria | 6057339 |
| 1284 | 2817494175 | 2816332298 | Bacteria | 6852809 |
| 1285 | 2819655269 | 2818991456 | Bacteria | 6123676 |
| 1286 | 2819704561 | 2818991464 | Bacteria | 6907494 |
| 1287 | 2825654934 | 2825651385 | Bacteria | 6715909 |
| 1288 | 2834031086 | 2834028612 | Bacteria | 6354979 |
| 1289 | 2842807708 | 2842805378 | Bacteria | 5385175 |
| 1290 | 2842828636 | 2842826826 | Bacteria | 5974129 |
| 1291 | 2842833598 | 2842832357 | Bacteria | 5959113 |
| 1292 | 2842838031 | 2842837860 | Bacteria | 6066181 |
| 1293 | 2842845821 | 2842843487 | Bacteria | 6004777 |
| 1294 | 2842855758 | 2842854478 | Bacteria | 6143501 |
| 1295 | 2844667233 | 2844665904 | Bacteria | 6817974 |
| 1296 | 2852616486 | 2852612431 | Bacteria | 6885235 |
| 1297 | 2852659950 | 2852657418 | Bacteria | 6472974 |
| 1298 | 2852671454 | 2852667396 | Bacteria | 6885555 |
| 1299 | 2860341866 | 2860339153 | Bacteria | 6846989 |
| 1300 | 2860873155 | 2860867994 | Bacteria | 5645326 |
| 1301 | 2878029555 | 2878029506 | Bacteria | 6418441 |
| 1302 | 2880236135 | 2880230671 | Bacteria | 6140320 |
| 1303 | 2904518812 | 2904518522 | Bacteria | 6068986 |
| 1304 | 2904551492 | 2904550169 | Bacteria | 6221258 |
| 1305 | 2908452750 | 2908446538 | Bacteria | 6829095 |
| 1306 | 2912969019 | 2912963787 | Bacteria | 5646108 |
| 1307 | 2913042662 | 2913036834 | Bacteria | 6704877 |
| 1308 | 2917076870 | 2917070673 | Bacteria | 6868303 |
| 1309 | 2919065373 | 2919063839 | Bacteria | 6302690 |
| 1310 | 2919129763 | 2919125081 | Bacteria | 5385106 |
| 1311 | 2919389057 | 2919385768 | Bacteria | 5897293 |
| 1312 | 2919457719 | 2919456309 | Bacteria | 6586567 |
| 1313 | 2919485789 | 2919481497 | Bacteria | 6907839 |
| 1314 | 2919487984 | 2919487758 | Bacteria | 5929766 |
| 1315 | 2919700438 | 2919697872 | Bacteria | 6553725 |
| 1316 | 2923159653 | 2923153595 | Bacteria | 6870622 |
| 1317 | 2923589134 | 2923586266 | Bacteria | 6565975 |
| 1318 | 2929150055 | 2929144301 | Bacteria | 6622272 |
| 1319 | 2929195281 | 2929189879 | Bacteria | 5930554 |
| 1320 | 2931372501 | 2931369376 | Bacteria | 6847892 |
| 1321 | 2931390788 | 2931390751 | Bacteria | 6273349 |
| 1322 | 2931398252 | 2931396565 | Bacteria | 7251677 |
| 1323 | 2935358163 | 2935353572 | Unclassified | 6955622 |
| 1324 | 2939640664 | 2939636861 | Bacteria | 6297853 |
| 1325 | 2939654279 | 2939651529 | Bacteria | 5895393 |
| 1326 | 2945930783 | 2945928738 | Bacteria | 6053221 |
| 1327 | 2946013131 | 2946006987 | Bacteria | 6705746 |
| 1328 | 2946028035 | 2946027586 | Bacteria | 6049274 |
| 1329 | 2947234561 | 2947233263 | Bacteria | 6439278 |
| 1330 | 2969310343 | 2969304461 | Bacteria | 6601805 |
| 1331 | 2974293945 | 2974289157 | Bacteria | 6080362 |
| 1332 | 2974302591 | 2974298342 | Bacteria | 4840922 |
| 1333 | 2984286461 | 2984286254 | Bacteria | 6702062 |
| 1334 | 2984499823 | 2984499530 | Bacteria | 5020881 |
| 1335 | 2988731613 | 2988728565 | Bacteria | 6124362 |
| 1336 | 2998139883 | 2998139840 | Bacteria | 6073514 |
| 1337 | 3007255194 | 3007252601 | Bacteria | 4559114 |
| 1338 | 3007316010 | 3007315729 | Bacteria | 5076637 |
| 1339 | 3007399259 | 3007395558 | Bacteria | 6755444 |
| 1340 | 3007419408 | 3007419365 | Bacteria | 7026924 |
| 1341 | 3007517318 | 3007511990 | Bacteria | 6481491 |
| 1342 | 3007615751 | 3007614139 | Bacteria | 6053559 |
| 1343 | 3007624575 | 3007619802 | Bacteria | 6411688 |
| 1344 | 3007719574 | 3007718800 | Bacteria | 5971527 |
| 1345 | 3007807350 | 3007803356 | Bacteria | 5931491 |
| 1346 | 3007859331 | 3007855910 | Bacteria | 5637581 |
| 1347 | 3007864967 | 3007861166 | Bacteria | 6045338 |
| 1348 | 3007866646 | 3007866637 | Bacteria | 5899198 |
| 1349 | 637323401 | 637000220 | Bacteria | 7074893 |
| 1350 | 8011352214 | 8011350971 | Bacteria | 6158957 |
| 1351 | 8015693751 | 8015687852 | Bacteria | 6613826 |
| 1352 | 8019769636 | 8019769354 | Bacteria | 6924660 |
| 1353 | 8019781388 | 8019775933 | Bacteria | 6858656 |
| 1354 | 8029995372 | 8029995093 | Bacteria | 5990776 |
| 1355 | 8052494717 | 8052494512 | Bacteria | 5765634 |
| 1356 | 8054290391 | 8054285046 | Bacteria | 6919322 |
| 1357 | 8054349451 | 8054347763 | Bacteria | 5901107 |
| 1358 | 8054929763 | 8054929484 | Bacteria | 5599761 |
| 1359 | 8055777009 | 8055770955 | Bacteria | 6827675 |
| 1360 | 8055824043 | 8055817908 | Bacteria | 6609162 |
| 1361 | 8055881759 | 8055878733 | Bacteria | 5907058 |
| 1362 | 8056116415 | 8056115690 | Bacteria | 5527654 |
| 1363 | 8056125816 | 8056120720 | Bacteria | 5758328 |
| 1364 | 8056125961 | 8056125926 | Bacteria | 6228218 |
| 1365 | 8056131741 | 8056131705 | Bacteria | 6107031 |
| 1366 | 8056143088 | 8056143049 | Bacteria | 6307666 |
| 1367 | 8056151359 | 8056148874 | Bacteria | 6479865 |
| 1368 | 8056159845 | 8056155041 | Bacteria | 6486948 |
| 1369 | 8056163757 | 8056161164 | Bacteria | 6106669 |
| 1370 | 8056171172 | 8056166840 | Bacteria | 5820959 |
| 1371 | 8056177282 | 8056172158 | Bacteria | 6133900 |
| 1372 | 8056182131 | 8056177738 | Bacteria | 6748268 |
| 1373 | 8056570606 | 8056569372 | Bacteria | 5997322 |
| 1374 | 8057802077 | 8057798959 | Bacteria | 6713499 |
| 1375 | Ga0495654_0063403 | |||
| 1376 | MRS2a_Contig_294 | |||
| 1377 | MRS2a_Contig_9369 | |||
| 1378 | SwRhRL2b_contig_1966799 | |||
| 1379 | JGI24741J21665_1001809 | |||
| 1380 | JGI25162J39368_1000134 | |||
| 1381 | JGI25154J39366_1008903 | |||
| 1382 | JGI25163J39215_1001114 | |||
| 1383 | JGI25163J39215_1001154 | |||
| 1384 | JGI25164J39214_1000058 | |||
| 1385 | JGI25164J39214_1000108 | |||
| 1386 | JGI25165J46597_1000154 | |||
| 1387 | JGI25165J46597_1000220 | |||
| 1388 | Ga0055538_1000012 | |||
| 1389 | Ga0055539_1000017 | |||
| 1390 | Ga0055533_1000021 | |||
| 1391 | Ga0055532_1000119 | |||
| 1392 | Ga0055525_1000078 | |||
| 1393 | Ga0055535_1006382 | |||
| 1394 | Ga0055536_1007274 | |||
| 1395 | Ga0055530_10001375 | |||
| 1396 | Ga0055530_10001991 | |||
| 1397 | Ga0055530_10007661 | |||
| 1398 | Ga0055530_10027943 | |||
| 1399 | Ga0055540_1000573 | |||
| 1400 | Ga0055540_1001393 | |||
| 1401 | Ga0055540_1001569 | |||
| 1402 | Ga0055531_10000656 | |||
| 1403 | Ga0055531_10001137 | |||
| 1404 | Ga0055541_1000012 | |||
| 1405 | Ga0058692_1003468 | |||
| 1406 | Ga0065714_10009522 | |||
| 1407 | Ga0065714_10015200 | |||
| 1408 | Ga0065714_10065146 | |||
| 1409 | Ga0065714_10066967 | |||
| 1410 | Ga0065714_10072891 | |||
| 1411 | Ga0065714_10079494 | |||
| 1412 | Ga0065714_10143598 | |||
| 1413 | Ga0065704_10010651 | |||
| 1414 | Ga0065704_10077514 | |||
| 1415 | Ga0065704_10137115 | |||
| 1416 | Ga0065712_10001183 | |||
| 1417 | Ga0065712_10082529 | |||
| 1418 | Ga0070670_100019409 | |||
| 1419 | Ga0070670_100027698 | |||
| 1420 | Ga0070669_100002433 | |||
| 1421 | Ga0070669_100003726 | |||
| 1422 | Ga0070671_100499535 | |||
| 1423 | Ga0070662_100000829 | |||
| 1424 | Ga0068853_100000031 | |||
| 1425 | Ga0070665_100148653 | |||
| 1426 | Ga0070665_100185282 | |||
| 1427 | Ga0070665_100207369 | |||
| 1428 | Ga0070664_100001524 | |||
| 1429 | Ga0070664_100044890 | |||
| 1430 | Ga0068851_10000007 | |||
| 1431 | Ga0075364_10046999 | |||
| 1432 | Ga0075364_10088763 | |||
| 1433 | Ga0075364_10110626 | |||
| 1434 | Ga0075432_10000412 | |||
| 1435 | Ga0075432_10006045 | |||
| 1436 | Ga0075432_10008021 | |||
| 1437 | Ga0075432_10017854 | |||
| 1438 | Ga0075432_10120565 | |||
| 1439 | Ga0075362_10034071 | |||
| 1440 | Ga0075369_10045574 | |||
| 1441 | Ga0099823_1038305 | |||
| 1442 | Ga0079104_1000284 | |||
| 1443 | Ga0079104_1000886 | |||
| 1444 | Ga0099826_10002232 | |||
| 1445 | Ga0105251_10001196 | |||
| 1446 | Ga0105251_10009478 | |||
| 1447 | Ga0105251_10012583 | |||
| 1448 | Ga0105251_10013465 | |||
| 1449 | Ga0105251_10018627 | |||
| 1450 | Ga0105251_10025492 | |||
| 1451 | Ga0105251_10026343 | |||
| 1452 | Ga0105251_10044876 | |||
| 1453 | Ga0105251_10069214 | |||
| 1454 | Ga0105251_10125263 | |||
| 1455 | Ga0105244_10009507 | |||
| 1456 | Ga0105244_10012536 | |||
| 1457 | Ga0105244_10015359 | |||
| 1458 | Ga0105244_10027116 | |||
| 1459 | Ga0105244_10028468 | |||
| 1460 | Ga0105244_10041959 | |||
| 1461 | Ga0105244_10048944 | |||
| 1462 | Ga0105244_10054751 | |||
| 1463 | Ga0105244_10066152 | |||
| 1464 | Ga0105244_10068381 | |||
| 1465 | Ga0105244_10106032 | |||
| 1466 | Ga0105250_10029995 | |||
| 1467 | Ga0105250_10033832 | |||
| 1468 | Ga0105250_10042322 | |||
| 1469 | Ga0105250_10090839 | |||
| 1470 | Ga0105243_10000232 | |||
| 1471 | Ga0105243_10003694 | |||
| 1472 | Ga0105243_10023482 | |||
| 1473 | Ga0105243_10024566 | |||
| 1474 | Ga0105243_10046467 | |||
| 1475 | Ga0105242_10000836 | |||
| 1476 | Ga0105242_10045090 | |||
| 1477 | Ga0105248_10001345 | |||
| 1478 | Ga0105237_10000838 | |||
| 1479 | Ga0105237_10110977 | |||
| 1480 | Ga0105249_10023854 | |||
| 1481 | Ga0105246_10083743 | |||
| 1482 | Ga0157345_1000496 | |||
| 1483 | Ga0157373_10003336 | |||
| 1484 | Ga0157373_10031756 | |||
| 1485 | Ga0157373_10032030 | |||
| 1486 | Ga0157373_10043856 | |||
| 1487 | Ga0157373_10064652 | |||
| 1488 | Ga0157373_10066311 | |||
| 1489 | Ga0157373_10322362 | |||
| 1490 | Ga0157371_10006749 | |||
| 1491 | Ga0157371_10020411 | |||
| 1492 | Ga0157371_10038180 | |||
| 1493 | Ga0157371_10265330 | |||
| 1494 | Ga0157370_10000264 | |||
| 1495 | Ga0157370_10037001 | |||
| 1496 | Ga0157370_10066626 | |||
| 1497 | Ga0157370_10252106 | |||
| 1498 | Ga0157369_10047326 | |||
| 1499 | Ga0157369_10094899 | |||
| 1500 | Ga0157369_10117536 | |||
| 1501 | Ga0157369_10121166 | |||
| 1502 | Ga0157369_10151810 | |||
| 1503 | Ga0157369_10188416 | |||
| 1504 | Ga0163162_10102254 | |||
| 1505 | Ga0163162_10165677 | |||
| 1506 | Ga0163162_10220488 | |||
| 1507 | Ga0163162_10262650 | |||
| 1508 | Ga0163162_10325168 | |||
| 1509 | Ga0157372_10030791 | |||
| 1510 | Ga0157372_10084730 | |||
| 1511 | Ga0157372_10273440 | |||
| 1512 | Ga0157375_10074465 | |||
| 1513 | Ga0157375_10100250 | |||
| 1514 | Ga0157375_10230912 | |||
| 1515 | Ga0157375_10450870 | |||
| 1516 | Ga0182008_10003338 | |||
| 1517 | Ga0182008_10012571 | |||
| 1518 | Ga0182008_10027576 | |||
| 1519 | Ga0182008_10028252 | |||
| 1520 | Ga0182008_10028418 | |||
| 1521 | Ga0182008_10056372 | |||
| 1522 | Ga0182008_10077973 | |||
| 1523 | Ga0182008_10096590 | |||
| 1524 | Ga0182008_10160369 | |||
| 1525 | Ga0182006_1004840 | |||
| 1526 | Ga0182006_1015794 | |||
| 1527 | Ga0182006_1015814 | |||
| 1528 | Ga0182006_1018657 | |||
| 1529 | Ga0182006_1049327 | |||
| 1530 | Ga0182006_1053537 | |||
| 1531 | Ga0182007_10006593 | |||
| 1532 | Ga0182007_10010025 | |||
| 1533 | Ga0182007_10018041 | |||
| 1534 | Ga0182005_1003805 | |||
| 1535 | Ga0182005_1008094 | |||
| 1536 | Ga0182005_1034406 | |||
| 1537 | Ga0182005_1037026 | |||
| 1538 | Ga0163161_10020778 | |||
| 1539 | Ga0163161_10039851 | |||
| 1540 | Ga0163161_10045982 | |||
| 1541 | Ga0163161_10063423 | |||
| 1542 | Ga0163161_10066199 | |||
| 1543 | Ga0163161_10081759 | |||
| 1544 | Ga0163161_10090500 | |||
| 1545 | Ga0163161_10099265 | |||
| 1546 | Ga0163161_10139633 | |||
| 1547 | Ga0163161_10216435 | |||
| 1548 | Ga0163161_10222496 | |||
| 1549 | Ga0163161_10270759 | |||
| 1550 | Ga0163161_10306884 | |||
| 1551 | Ga0209435_101976 | |||
| 1552 | Ga0209760_100045 | |||
| 1553 | Ga0209760_100253 | |||
| 1554 | Ga0209784_100007 | |||
| 1555 | Ga0209566_100009 | |||
| 1556 | Ga0209674_100021 | |||
| 1557 | Ga0209147_100009 | |||
| 1558 | Ga0209563_100018 | |||
| 1559 | Ga0209563_102247 | |||
| 1560 | Ga0207427_100005 | |||
| 1561 | Ga0207427_100006 | |||
| 1562 | Ga0209437_100013 | |||
| 1563 | Ga0209437_100018 | |||
| 1564 | Ga0209437_106495 | |||
| 1565 | Ga0209258_100249 | |||
| 1566 | Ga0209646_1000298 | |||
| 1567 | Ga0209677_100012 | |||
| 1568 | Ga0209233_1000021 | |||
| 1569 | Ga0209233_1000022 | |||
| 1570 | Ga0209675_1003304 | |||
| 1571 | Ga0209676_1000015 | |||
| 1572 | Ga0209676_1000030 | |||
| 1573 | Ga0209676_1000041 | |||
| 1574 | Ga0209676_1001560 | |||
| 1575 | Ga0209676_1007800 | |||
| 1576 | Ga0209050_1000024 | |||
| 1577 | Ga0209050_1000030 | |||
| 1578 | Ga0209050_1000553 | |||
| 1579 | Ga0209050_1007961 | |||
| 1580 | Ga0209051_1000012 | |||
| 1581 | Ga0209051_1000426 | |||
| 1582 | Ga0209051_1000719 | |||
| 1583 | Ga0209257_1000262 | |||
| 1584 | Ga0209257_1038941 | |||
| 1585 | Ga0207656_10000015 | |||
| 1586 | Ga0207696_1000055 | |||
| 1587 | Ga0207696_1000080 | |||
| 1588 | Ga0207696_1000204 | |||
| 1589 | Ga0207696_1002401 | |||
| 1590 | Ga0207696_1002424 | |||
| 1591 | Ga0207696_1002551 | |||
| 1592 | Ga0207696_1006417 | |||
| 1593 | Ga0207696_1012224 | |||
| 1594 | Ga0207696_1029950 | |||
| 1595 | Ga0207655_1000033 | |||
| 1596 | Ga0207655_1000116 | |||
| 1597 | Ga0207655_1000541 | |||
| 1598 | Ga0207655_1000783 | |||
| 1599 | Ga0207655_1002543 | |||
| 1600 | Ga0207655_1003443 | |||
| 1601 | Ga0207655_1003544 | |||
| 1602 | Ga0207655_1004194 | |||
| 1603 | Ga0207655_1007513 | |||
| 1604 | Ga0207655_1007842 | |||
| 1605 | Ga0207655_1010546 | |||
| 1606 | Ga0207655_1010919 | |||
| 1607 | Ga0207655_1011798 | |||
| 1608 | Ga0207655_1016936 | |||
| 1609 | Ga0207655_1020362 | |||
| 1610 | Ga0207655_1037073 | |||
| 1611 | Ga0207655_1042721 | |||
| 1612 | Ga0207655_1043988 | |||
| 1613 | Ga0207655_1059961 | |||
| 1614 | Ga0207713_1000249 | |||
| 1615 | Ga0207713_1000835 | |||
| 1616 | Ga0207713_1001660 | |||
| 1617 | Ga0207713_1004313 | |||
| 1618 | Ga0207713_1011733 | |||
| 1619 | Ga0207713_1020781 | |||
| 1620 | Ga0207713_1023358 | |||
| 1621 | Ga0207713_1023498 | |||
| 1622 | Ga0207713_1029565 | |||
| 1623 | Ga0207713_1033816 | |||
| 1624 | Ga0207713_1079761 | |||
| 1625 | Ga0207671_10000027 | |||
| 1626 | Ga0207649_10000012 | |||
| 1627 | Ga0207681_10000059 | |||
| 1628 | Ga0207681_10000600 | |||
| 1629 | Ga0207650_10000044 | |||
| 1630 | Ga0207650_10000390 | |||
| 1631 | Ga0207706_10000212 | |||
| 1632 | Ga0207706_10002126 | |||
| 1633 | Ga0207686_10003616 | |||
| 1634 | Ga0207709_10000061 | |||
| 1635 | Ga0207709_10000063 | |||
| 1636 | Ga0207709_10001634 | |||
| 1637 | Ga0207709_10003026 | |||
| 1638 | Ga0207709_10114771 | |||
| 1639 | Ga0207711_10062581 | |||
| 1640 | Ga0207679_10000015 | |||
| 1641 | Ga0207712_10012867 | |||
| 1642 | Ga0207640_10097767 | |||
| 1643 | Ga0207639_10000157 | |||
| 1644 | Ga0209281_1000016 | |||
| 1645 | Ga0209281_1000019 | |||
| 1646 | Ga0209281_1010911 | |||
| 1647 | Ga0209281_1017440 | |||
| 1648 | Ga0209389_1000036 | |||
| 1649 | Ga0209389_1058390 | |||
| 1650 | Ga0209371_1000032 | |||
| 1651 | Ga0209371_1000775 | |||
| 1652 | Ga0207428_10062560 | |||
| 1653 | Ga0207428_10063323 | |||
| 1654 | Ga0207428_10066045 | |||
| 1655 | Ga0207428_10077413 | |||
| 1656 | Ga0207428_10090703 | |||
| 1657 | Ga0207428_10116873 | |||
| 1658 | Ga0207428_10194568 | |||
| 1659 | Ga0207428_10238983 | |||
| 1660 | Ga0268266_10034327 | |||
| 1661 | Ga0268266_10138787 | |||
| 1662 | Ga0307517_10215768 | |||
| 1663 | Ga0268256_1000050 | |||
| 1664 | Ga0268256_1000247 | |||
| 1665 | Ga0307511_10032246 | |||
| 1666 | Ga0307511_10138765 | |||
| 1667 | Ga0314311_1048969 | |||
| 1668 | Ga0316179_1083517 | |||
| 1669 | Ga0316178_1047147 | |||
| 1670 | Ga0316183_1121205 | |||
| 1671 | Ga0316181_1199165 | |||
| 1672 | Ga0265316_10141450 | |||
| 1673 | Ga0307509_10114279 | |||
| 1674 | Ga0307408_100020165 | |||
| 1675 | Ga0307408_100040505 | |||
| 1676 | Ga0307408_100046153 | |||
| 1677 | Ga0307408_100544131 | |||
| 1678 | Ga0307516_10198015 | |||
| 1679 | Ga0307405_10012530 | |||
| 1680 | Ga0307405_10040286 | |||
| 1681 | Ga0307405_10070700 | |||
| 1682 | Ga0307405_10091965 | |||
| 1683 | Ga0307406_10014933 | |||
| 1684 | Ga0307412_10012175 | |||
| 1685 | Ga0307412_10032114 | |||
| 1686 | Ga0307412_10039613 | |||
| 1687 | Ga0307412_10039843 | |||
| 1688 | Ga0307412_10514918 | |||
| 1689 | Ga0307409_100033587 | |||
| 1690 | Ga0307409_100265374 | |||
| 1691 | Ga0307416_100794854 | |||
| 1692 | Ga0307416_100945623 | |||
| 1693 | Ga0307414_10011654 | |||
| 1694 | Ga0307414_10156564 | |||
| 1695 | Ga0307414_10223433 | |||
| 1696 | Ga0307414_10514375 | |||
| 1697 | Ga0307411_10149156 | |||
| 1698 | Ga0307411_10182120 | |||
| 1699 | Ga0307411_10185688 | |||
| 1700 | Ga0307510_10041980 | |||
| 1701 | Ga0307510_10179177 | |||
| 1702 | Ga0237819_00423 | |||
| 1703 | Ga0439436_0000358 | |||
| 1704 | Ga0439438_003527 | |||
| 1705 | Ga0439438_005526 | |||
| 1706 | Ga0439438_007602 | |||
| 1707 | Ga0439438_007798 | |||
| 1708 | Ga0439438_010047 | |||
| 1709 | Ga0439438_011429 | |||
| 1710 | Ga0439438_012849 | |||
| 1711 | Ga0439438_014093 | |||
| 1712 | Ga0439438_014343 | |||
| 1713 | Ga0439438_014887 | |||
| 1714 | Ga0439438_016852 | |||
| 1715 | Ga0439438_017291 | |||
| 1716 | Ga0439438_023430 | |||
| 1717 | Ga0439438_036743 | |||
| 1718 | Ga0439447_004297 | |||
| 1719 | Ga0439447_007631 | |||
| 1720 | Ga0439447_010026 | |||
| 1721 | Ga0439447_017852 | |||
| 1722 | Ga0439447_020901 | |||
| 1723 | Ga0439447_032135 | |||
| 1724 | Ga0439447_034991 | |||
| 1725 | Ga0439447_041042 | |||
| 1726 | Ga0439447_051890 | |||
| 1727 | Ga0439466_0000651 | |||
| 1728 | Ga0439466_0006327 | |||
| 1729 | Ga0439466_0010243 | |||
| 1730 | Ga0439466_0012563 | |||
| 1731 | Ga0439466_0014272 | |||
| 1732 | Ga0439466_0027680 | |||
| 1733 | Ga0439466_0044060 | |||
| 1734 | Ga0439465_0008789 | |||
| 1735 | Ga0451807_0448583 | |||
| 1736 | Ga0439431_0008307 | |||
| 1737 | Ga0439437_001501 | |||
| 1738 | Ga0439442_026508 | |||
| 1739 | Ga0439445_0005814 | |||
| 1740 | Ga0439432_000192 | |||
| 1741 | Ga0439432_000317 | |||
| 1742 | Ga0439432_002102 | |||
| 1743 | Ga0439432_011457 | |||
| 1744 | Ga0439432_019373 | |||
| 1745 | Ga0439432_035435 | |||
| 1746 | Ga0439451_004065 | |||
| 1747 | Ga0439451_005947 | |||
| 1748 | Ga0439451_009907 | |||
| 1749 | Ga0439451_011967 | |||
| 1750 | Ga0439452_001699 | |||
| 1751 | Ga0439452_005144 | |||
| 1752 | Ga0439452_005794 | |||
| 1753 | Ga0439452_006443 | |||
| 1754 | Ga0439452_007448 | |||
| 1755 | Ga0439452_009936 | |||
| 1756 | Ga0439452_031663 | |||
| 1757 | Ga0439456_000903 | |||
| 1758 | Ga0439456_001136 | |||
| 1759 | Ga0439456_003880 | |||
| 1760 | Ga0439456_007780 | |||
| 1761 | Ga0439456_008878 | |||
| 1762 | Ga0439456_009344 | |||
| 1763 | Ga0439456_010126 | |||
| 1764 | Ga0439456_010153 | |||
| 1765 | Ga0439456_011782 | |||
| 1766 | Ga0439456_017482 | |||
| 1767 | Ga0439456_023011 | |||
| 1768 | Ga0439456_026809 | |||
| 1769 | Ga0439463_002256 | |||
| 1770 | Ga0439463_009457 | |||
| 1771 | Ga0439463_014568 | |||
| 1772 | Ga0439463_014843 | |||
| 1773 | Ga0450911_000934 | |||
| 1774 | Ga0450911_003930 | |||
| 1775 | Ga0450911_004312 | |||
| 1776 | Ga0450911_005613 | |||
| 1777 | Ga0450919_000675 | |||
| 1778 | Ga0450919_002455 | |||
| 1779 | Ga0450921_000122 | |||
| 1780 | Ga0450922_000717 | |||
| 1781 | Ga0450922_001084 | |||
| 1782 | Ga0450922_001819 | |||
| 1783 | Ga0450923_004772 | |||
| 1784 | Ga0450923_005481 | |||
| 1785 | Ga0450890_002000 | |||
| 1786 | Ga0450891_000333 | |||
| 1787 | Ga0450900_002789 | |||
| 1788 | Ga0450900_006697 | |||
| 1789 | Ga0450902_000055 | |||
| 1790 | Ga0450902_003376 | |||
| 1791 | Ga0450902_005123 | |||
| 1792 | Ga0450902_011933 | |||
| 1793 | Ga0450903_002213 | |||
| 1794 | Ga0450903_002858 | |||
| 1795 | Ga0450903_004567 | |||
| 1796 | Ga0450903_010435 | |||
| 1797 | Ga0450903_018288 | |||
| 1798 | Ga0450904_001950 | |||
| 1799 | Ga0450904_002613 | |||
| 1800 | Ga0450905_000361 | |||
| 1801 | Ga0450905_001346 | |||
| 1802 | Ga0450905_007447 | |||
| 1803 | Ga0450889_003922 | |||
| 1804 | Ga0450906_003382 | |||
| 1805 | Ga0450906_004721 | |||
| 1806 | Ga0450907_001462 | |||
| 1807 | Ga0450907_001555 | |||
| 1808 | Ga0450907_011530 | |||
| 1809 | Ga0450907_026627 | |||
| 1810 | Ga0450910_000780 | |||
| 1811 | Ga0450910_001861 | |||
| 1812 | Ga0450910_002757 | |||
| 1813 | Ga0439446_0000616 | |||
| 1814 | Ga0439446_0001997 | |||
| 1815 | Ga0439446_0003246 | |||
| 1816 | Ga0439446_0014395 | |||
| 1817 | Ga0439446_0017277 | |||
| 1818 | Ga0439446_0029441 | |||
| 1819 | Ga0439446_0037604 | |||
| 1820 | Ga0450908_001947 | |||
| 1821 | Ga0450908_019585 | |||
| 1822 | Ga0450909_001617 | |||
| 1823 | Ga0450909_003038 | |||
| 1824 | Ga0450909_006496 | |||
| 1825 | Ga0450909_013648 | |||
| 1826 | Ga0439434_0000118 | |||
| 1827 | Ga0439434_0002809 | |||
| 1828 | Ga0439434_0022621 | |||
| 1829 | Ga0439459_0019608 | |||
| 1830 | Ga0439464_0001288 | |||
| 1831 | Ga0439464_0007873 | |||
| 1832 | Ga0439460_0003840 | |||
| 1833 | Ga0439460_0006220 | |||
| 1834 | Ga0439460_0008144 | |||
| 1835 | Ga0439460_0013978 | |||
| 1836 | Ga0450918_007545 | |||
| 1837 | Ga0450918_009406 | |||
| 1838 | Ga0450893_0004019 | |||
| 1839 | Ga0450893_0019534 | |||
| 1840 | Ga0450901_000152 | |||
| 1841 | Ga0439440_0004171 | |||
| 1842 | Ga0439440_0005050 | |||
| 1843 | Ga0439440_0008514 | |||
| 1844 | Ga0495617_004749 | |||
| 1845 | Ga0495617_005529 | |||
| 1846 | Ga0495617_008798 | |||
| 1847 | Ga0495617_012836 | |||
| 1848 | Ga0495617_015098 | |||
| 1849 | Ga0495617_021574 | |||
| 1850 | Ga0495617_022137 | |||
| 1851 | Ga0495617_030410 | |||
| 1852 | Ga0495617_032742 | |||
| 1853 | Ga0495617_045012 | |||
| 1854 | Ga0495617_061859 | |||
| 1855 | Ga0495627_002702 | |||
| 1856 | Ga0495627_010957 | |||
| 1857 | Ga0495627_013787 | |||
| 1858 | Ga0495627_016819 | |||
| 1859 | Ga0495627_022069 | |||
| 1860 | Ga0495627_034511 | |||
| 1861 | Ga0495603_0070065 | |||
| 1862 | Ga0495603_0086004 | |||
| 1863 | Ga0495603_0291473 | |||
| 1864 | Ga0495590_0004489 | |||
| 1865 | Ga0495590_0006573 | |||
| 1866 | Ga0495590_0010822 | |||
| 1867 | Ga0495590_0035257 | |||
| 1868 | Ga0495590_0035284 | |||
| 1869 | Ga0495591_009416 | |||
| 1870 | Ga0495591_010936 | |||
| 1871 | Ga0495591_014473 | |||
| 1872 | Ga0495591_016964 | |||
| 1873 | Ga0495591_017310 | |||
| 1874 | Ga0495591_024295 | |||
| 1875 | Ga0495591_025578 | |||
| 1876 | Ga0495591_028406 | |||
| 1877 | Ga0495591_037480 | |||
| 1878 | Ga0495591_050855 | |||
| 1879 | Ga0495638_0015465 | |||
| 1880 | Ga0495638_0025574 | |||
| 1881 | Ga0495638_0028462 | |||
| 1882 | Ga0495638_0033128 | |||
| 1883 | Ga0495638_0036373 | |||
| 1884 | Ga0495638_0043221 | |||
| 1885 | Ga0495638_0049841 | |||
| 1886 | Ga0495638_0058357 | |||
| 1887 | Ga0495638_0065483 | |||
| 1888 | Ga0495638_0081609 | |||
| 1889 | Ga0495638_0100322 | |||
| 1890 | Ga0495638_0119130 | |||
| 1891 | Ga0495638_0153293 | |||
| 1892 | Ga0495653_0026278 | |||
| 1893 | Ga0495653_0028367 | |||
| 1894 | Ga0495653_0069329 | |||
| 1895 | Ga0495653_0122412 | |||
| 1896 | Ga0495650_0012341 | |||
| 1897 | Ga0495650_0019211 | |||
| 1898 | Ga0495650_0020665 | |||
| 1899 | Ga0495650_0026607 | |||
| 1900 | Ga0495650_0026919 | |||
| 1901 | Ga0495650_0032550 | |||
| 1902 | Ga0495650_0038353 | |||
| 1903 | Ga0495650_0041295 | |||
| 1904 | Ga0495582_0012541 | |||
| 1905 | Ga0495605_0012869 | |||
| 1906 | Ga0495605_0019264 | |||
| 1907 | Ga0495605_0036026 | |||
| 1908 | Ga0495605_0036585 | |||
| 1909 | Ga0495605_0045626 | |||
| 1910 | Ga0495605_0068585 | |||
| 1911 | Ga0495639_0008671 | |||
| 1912 | Ga0495639_0012590 | |||
| 1913 | Ga0495639_0058564 | |||
| 1914 | Ga0495584_0009431 | |||
| 1915 | Ga0495584_0011369 | |||
| 1916 | Ga0495584_0015066 | |||
| 1917 | Ga0495584_0022111 | |||
| 1918 | Ga0495584_0027384 | |||
| 1919 | Ga0495584_0030627 | |||
| 1920 | Ga0495584_0033621 | |||
| 1921 | Ga0495584_0050988 | |||
| 1922 | Ga0495584_0059240 | |||
| 1923 | Ga0495584_0087920 | |||
| 1924 | Ga0495584_0124586 | |||
| 1925 | Ga0495585_0000543 | |||
| 1926 | Ga0495585_0019204 | |||
| 1927 | Ga0495585_0030207 | |||
| 1928 | Ga0495585_0037838 | |||
| 1929 | Ga0495585_0038969 | |||
| 1930 | Ga0495585_0045785 | |||
| 1931 | Ga0495594_0019440 | |||
| 1932 | Ga0495594_0024309 | |||
| 1933 | Ga0495594_0042705 | |||
| 1934 | Ga0495596_0001223 | |||
| 1935 | Ga0495596_0036999 | |||
| 1936 | Ga0495607_0009650 | |||
| 1937 | Ga0495607_0011085 | |||
| 1938 | Ga0495607_0016321 | |||
| 1939 | Ga0495607_0022915 | |||
| 1940 | Ga0495607_0028921 | |||
| 1941 | Ga0495607_0033176 | |||
| 1942 | Ga0495607_0042557 | |||
| 1943 | Ga0495607_0064623 | |||
| 1944 | Ga0495607_0070174 | |||
| 1945 | Ga0495607_0071361 | |||
| 1946 | Ga0495607_0090418 | |||
| 1947 | Ga0495607_0103861 | |||
| 1948 | Ga0495607_0133379 | |||
| 1949 | Ga0495583_0002028 | |||
| 1950 | Ga0495583_0022582 | |||
| 1951 | Ga0495583_0023690 | |||
| 1952 | Ga0495583_0028183 | |||
| 1953 | Ga0495583_0044392 | |||
| 1954 | Ga0495583_0051880 | |||
| 1955 | Ga0495583_0120997 | |||
| 1956 | Ga0495606_0000204 | |||
| 1957 | Ga0495606_0022292 | |||
| 1958 | Ga0495606_0039742 | |||
| 1959 | Ga0495606_0040969 | |||
| 1960 | Ga0495606_0041365 | |||
| 1961 | Ga0495606_0048712 | |||
| 1962 | Ga0495606_0056039 | |||
| 1963 | Ga0495606_0064184 | |||
| 1964 | Ga0495606_0108533 | |||
| 1965 | Ga0495610_0010868 | |||
| 1966 | Ga0495610_0013134 | |||
| 1967 | Ga0495610_0016793 | |||
| 1968 | Ga0495610_0023496 | |||
| 1969 | Ga0495610_0023635 | |||
| 1970 | Ga0495610_0028493 | |||
| 1971 | Ga0495610_0029527 | |||
| 1972 | Ga0495610_0046473 | |||
| 1973 | Ga0495610_0058701 | |||
| 1974 | Ga0495610_0072687 | |||
| 1975 | Ga0495610_0093925 | |||
| 1976 | Ga0495610_0112061 | |||
| 1977 | Ga0495616_0011744 | |||
| 1978 | Ga0495616_0012404 | |||
| 1979 | Ga0495616_0019748 | |||
| 1980 | Ga0495616_0019925 | |||
| 1981 | Ga0495616_0022965 | |||
| 1982 | Ga0495616_0038868 | |||
| 1983 | Ga0495616_0042625 | |||
| 1984 | Ga0495616_0043783 | |||
| 1985 | Ga0495616_0064962 | |||
| 1986 | Ga0495616_0089022 | |||
| 1987 | Ga0495620_0000032 | |||
| 1988 | Ga0495620_0015873 | |||
| 1989 | Ga0495620_0023048 | |||
| 1990 | Ga0495620_0028603 | |||
| 1991 | Ga0495620_0029212 | |||
| 1992 | Ga0495620_0029330 | |||
| 1993 | Ga0495620_0031872 | |||
| 1994 | Ga0495620_0043021 | |||
| 1995 | Ga0495620_0047448 | |||
| 1996 | Ga0495620_0067899 | |||
| 1997 | Ga0495628_0096034 | |||
| 1998 | Ga0495630_0023357 | |||
| 1999 | Ga0495630_0073792 | |||
| 2000 | Ga0495630_0234432 | |||
| 2001 | Ga0495631_0009546 | |||
| 2002 | Ga0495631_0011117 | |||
| 2003 | Ga0495631_0024973 | |||
| 2004 | Ga0495631_0025639 | |||
| 2005 | Ga0495631_0030436 | |||
| 2006 | Ga0495631_0051947 | |||
| 2007 | Ga0495632_0001747 | |||
| 2008 | Ga0495632_0004029 | |||
| 2009 | Ga0495632_0010107 | |||
| 2010 | Ga0495632_0012110 | |||
| 2011 | Ga0495632_0012442 | |||
| 2012 | Ga0495632_0012652 | |||
| 2013 | Ga0495632_0020458 | |||
| 2014 | Ga0495632_0024911 | |||
| 2015 | Ga0495632_0025758 | |||
| 2016 | Ga0495632_0028063 | |||
| 2017 | Ga0495632_0032099 | |||
| 2018 | Ga0495632_0035457 | |||
| 2019 | Ga0495632_0039473 | |||
| 2020 | Ga0495632_0047809 | |||
| 2021 | Ga0495632_0048622 | |||
| 2022 | Ga0495632_0132461 | |||
| 2023 | Ga0495637_0001563 | |||
| 2024 | Ga0495637_0007825 | |||
| 2025 | Ga0495637_0008284 | |||
| 2026 | Ga0495637_0011474 | |||
| 2027 | Ga0495637_0017345 | |||
| 2028 | Ga0495637_0018125 | |||
| 2029 | Ga0495637_0019423 | |||
| 2030 | Ga0495637_0020549 | |||
| 2031 | Ga0495637_0022424 | |||
| 2032 | Ga0495637_0024691 | |||
| 2033 | Ga0495637_0027663 | |||
| 2034 | Ga0495637_0033364 | |||
| 2035 | Ga0495637_0038591 | |||
| 2036 | Ga0495637_0039434 | |||
| 2037 | Ga0495637_0065880 | |||
| 2038 | Ga0495637_0123837 | |||
| 2039 | Ga0495643_0000084 | |||
| 2040 | Ga0495643_0000763 | |||
| 2041 | Ga0495643_0001670 | |||
| 2042 | Ga0495643_0004766 | |||
| 2043 | Ga0495643_0014624 | |||
| 2044 | Ga0495643_0025122 | |||
| 2045 | Ga0495643_0030703 | |||
| 2046 | Ga0495643_0041015 | |||
| 2047 | Ga0495643_0053859 | |||
| 2048 | Ga0495643_0055377 | |||
| 2049 | Ga0495643_0059017 | |||
| 2050 | Ga0495643_0061524 | |||
| 2051 | Ga0495643_0103155 | |||
| 2052 | Ga0495643_0184015 | |||
| 2053 | Ga0495644_0005394 | |||
| 2054 | Ga0495644_0009493 | |||
| 2055 | Ga0495644_0017294 | |||
| 2056 | Ga0495644_0025062 | |||
| 2057 | Ga0495644_0027155 | |||
| 2058 | Ga0495644_0032114 | |||
| 2059 | Ga0495648_0014437 | |||
| 2060 | Ga0495648_0021206 | |||
| 2061 | Ga0495648_0022192 | |||
| 2062 | Ga0495648_0023453 | |||
| 2063 | Ga0495648_0029903 | |||
| 2064 | Ga0495648_0031209 | |||
| 2065 | Ga0495648_0057617 | |||
| 2066 | Ga0495648_0066268 | |||
| 2067 | Ga0495648_0094635 | |||
| 2068 | Ga0495648_0126203 | |||
| 2069 | Ga0495648_0130533 | |||
| 2070 | Ga0495648_0142902 | |||
| 2071 | Ga0495648_0177610 | |||
| 2072 | Ga0495648_0184962 | |||
| 2073 | Ga0495666_0017984 | |||
| 2074 | Ga0495666_0023975 | |||
| 2075 | Ga0495666_0029794 | |||
| 2076 | Ga0495666_0034256 | |||
| 2077 | Ga0495642_0005110 | |||
| 2078 | Ga0495642_0006661 | |||
| 2079 | Ga0495642_0018942 | |||
| 2080 | Ga0495652_0161676 | |||
| 2081 | Ga0495654_0008517 | |||
| 2082 | Ga0495654_0012834 | |||
| 2083 | Ga0495654_0017469 | |||
| 2084 | Ga0495654_0018885 | |||
| 2085 | Ga0495654_0020181 | |||
| 2086 | Ga0495654_0023801 | |||
| 2087 | Ga0495654_0027261 | |||
| 2088 | Ga0495654_0032099 | |||
| 2089 | Ga0495654_0039110 | |||
| 2090 | Ga0495654_0040074 | |||
| 2091 | Ga0495654_0040776 | |||
| 2092 | Ga0495654_0046484 | |||
| 2093 | Ga0495654_0047464 | |||
| 2094 | Ga0495654_0057919 | |||
| 2095 | Ga0495654_0066904 | |||
| 2096 | Ga0495654_0067579 | |||
| 2097 | Ga0495654_0068943 | |||
| 2098 | Ga0495654_0076432 | |||
| 2099 | Ga0495654_0083297 | |||
| 2100 | Ga0495654_0105649 | |||
| 2101 | Ga0495586_0033531 | |||
| 2102 | Ga0495587_0026424 | |||
| 2103 | Ga0495587_0043694 | |||
| 2104 | Ga0495587_0102334 | |||
| 2105 | Ga0495609_0016502 | |||
| 2106 | Ga0495609_0019195 | |||
| 2107 | Ga0495609_0024312 | |||
| 2108 | Ga0495609_0031239 | |||
| 2109 | Ga0495609_0034907 | |||
| 2110 | Ga0495609_0045492 | |||
| 2111 | Ga0495609_0066205 | |||
| 2112 | Ga0495597_0007089 | |||
| 2113 | Ga0495597_0010607 | |||
| 2114 | Ga0495597_0024224 | |||
| 2115 | Ga0495597_0028588 | |||
| 2116 | Ga0495597_0030203 | |||
| 2117 | Ga0495597_0037590 | |||
| 2118 | Ga0495597_0045229 | |||
| 2119 | Ga0495597_0064166 | |||
| 2120 | Ga0495597_0097216 | |||
| 2121 | Ga0495645_0081576 | |||
| 2122 | Ga0495622_0005522 | |||
| 2123 | Ga0495622_0007990 | |||
| 2124 | Ga0495622_0013394 | |||
| 2125 | Ga0495622_0014505 | |||
| 2126 | Ga0495633_0008445 | |||
| 2127 | Ga0495633_0018791 | |||
| 2128 | Ga0495633_0027528 | |||
| 2129 | Ga0495633_0041912 | |||
| 2130 | Ga0495656_0030901 | |||
| 2131 | Ga0495656_0040977 | |||
| 2132 | Ga0495668_0025275 | |||
| 2133 | Ga0495668_0031569 | |||
| 2134 | Ga0495668_0051825 | |||
| 2135 | Ga0495668_0067520 | |||
| 2136 | Ga0495634_0016005 | |||
| 2137 | Ga0495634_0070461 | |||
| 2138 | Ga0495611_0009433 | |||
| 2139 | Ga0495611_0013574 | |||
| 2140 | Ga0495611_0017275 | |||
| 2141 | Ga0495611_0046368 | |||
| 2142 | Ga0495611_0077389 | |||
| 2143 | Ga0495611_0128371 | |||
| 2144 | Ga0495611_0168330 | |||
| 2145 | Ga0495625_0021670 | |||
| 2146 | Ga0495625_0024003 | |||
| 2147 | Ga0495625_0038711 | |||
| 2148 | Ga0495625_0046572 | |||
| 2149 | Ga0495625_0048582 | |||
| 2150 | Ga0495625_0052771 | |||
| 2151 | Ga0495625_0081084 | |||
| 2152 | Ga0495625_0088413 | |||
| 2153 | Ga0495625_0113791 | |||
| 2154 | Ga0495625_0125560 | |||
| 2155 | Ga0495625_0137368 | |||
| 2156 | Ga0495625_0147815 | |||
| 2157 | Ga0495635_0028623 | |||
| 2158 | Ga0495635_0028636 | |||
| 2159 | Ga0495659_0007794 | |||
| 2160 | Ga0495659_0052598 | |||
| 2161 | Ga0495659_0061041 | |||
| 2162 | Ga0495661_0000050 | |||
| 2163 | Ga0495661_0000237 | |||
| 2164 | Ga0495661_0023796 | |||
| 2165 | Ga0495661_0023908 | |||
| 2166 | Ga0495661_0028403 | |||
| 2167 | Ga0495661_0046873 | |||
| 2168 | Ga0495661_0047089 | |||
| 2169 | Ga0495661_0067822 | |||
| 2170 | Ga0495661_0084649 | |||
| 2171 | Ga0495661_0113343 | |||
| 2172 | Ga0495661_0123045 | |||
| 2173 | Ga0495661_0145817 | |||
| 2174 | Ga0495661_0173421 | |||
| 2175 | Ga0495588_0025015 | |||
| 2176 | Ga0495588_0039193 | |||
| 2177 | Ga0495588_0070584 | |||
| 2178 | Ga0495623_0037082 | |||
| 2179 | Ga0495623_0063477 | |||
| 2180 | Ga0495646_0010023 | |||
| 2181 | Ga0495646_0028442 | |||
| 2182 | Ga0495646_0030240 | |||
| 2183 | Ga0495669_0006920 | |||
| 2184 | Ga0495669_0029183 | |||
| 2185 | Ga0495613_0041157 | |||
| 2186 | Ga0495613_0042723 | |||
| 2187 | Ga0495613_0070301 | |||
| 2188 | Ga0495624_0027419 | |||
| 2189 | Ga0495670_0009067 | |||
| 2190 | Ga0495670_0009336 | |||
| 2191 | Ga0495670_0020346 | |||
| 2192 | Ga0495670_0021856 | |||
| 2193 | Ga0495670_0022275 | |||
| 2194 | Ga0495670_0034988 | |||
| 2195 | Ga0495670_0035106 | |||
| 2196 | Ga0495671_0007812 | |||
| 2197 | Ga0495671_0008688 | |||
| 2198 | Ga0495671_0017992 | |||
| 2199 | Ga0495671_0018476 | |||
| 2200 | Ga0495671_0022446 | |||
| 2201 | Ga0495671_0023534 | |||
| 2202 | Ga0495671_0032216 | |||
| 2203 | Ga0495671_0033439 | |||
| 2204 | Ga0495671_0037741 | |||
| 2205 | Ga0495671_0037877 | |||
| 2206 | Ga0495671_0038719 | |||
| 2207 | Ga0495671_0052803 | |||
| 2208 | Ga0495671_0064184 | |||
| 2209 | Ga0495671_0072676 | |||
| 2210 | Ga0495671_0095992 | |||
| 2211 | Ga0495649_0000725 | |||
| 2212 | Ga0495649_0007869 | |||
| 2213 | Ga0495649_0022116 | |||
| 2214 | Ga0495649_0023594 | |||
| 2215 | Ga0495649_0023789 | |||
| 2216 | Ga0495649_0027128 | |||
| 2217 | Ga0495649_0037698 | |||
| 2218 | Ga0495649_0043531 | |||
| 2219 | Ga0495649_0043991 | |||
| 2220 | Ga0495649_0051156 | |||
| 2221 | Ga0495649_0059341 | |||
| 2222 | Ga0495649_0069878 | |||
| 2223 | Ga0495649_0071085 | |||
| 2224 | Ga0495649_0130415 | |||
| 2225 | Ga0495649_0142756 | |||
| 2226 | Ga0495589_0028196 | |||
| 2227 | Ga0495589_0031931 | |||
| 2228 | Ga0495589_0043350 | |||
| 2229 | Ga0495589_0055307 | |||
| 2230 | Ga0495589_0072609 | |||
| 2231 | Ga0495589_0187826 | |||
| 2232 | Ga0495600_0034535 | |||
| 2233 | Ga0495600_0082743 | |||
| 2234 | Ga0495660_0013927 | |||
| 2235 | Ga0495660_0017989 | |||
| 2236 | Ga0495660_0031394 | |||
| 2237 | Ga0495660_0033288 | |||
| 2238 | Ga0495660_0035527 | |||
| 2239 | Ga0495660_0036155 | |||
| 2240 | Ga0495660_0037136 | |||
| 2241 | Ga0495660_0038752 | |||
| 2242 | Ga0495660_0040351 | |||
| 2243 | Ga0495660_0040857 | |||
| 2244 | Ga0495660_0040989 | |||
| 2245 | Ga0495660_0044744 | |||
| 2246 | Ga0495660_0049835 | |||
| 2247 | Ga0495660_0057402 | |||
| 2248 | Ga0495660_0058325 | |||
| 2249 | Ga0495660_0084457 | |||
| 2250 | Ga0495660_0096745 | |||
| 2251 | Ga0495660_0123159 | |||
| 2252 | Ga0495581_0030603 | |||
| 2253 | Ga0495581_0051768 | |||
| 2254 | Ga0495604_0019031 | |||
| 2255 | Ga0495604_0032278 | |||
| 2256 | Ga0495604_0042220 | |||
| 2257 | Ga0495604_0048852 | |||
| 2258 | Ga0495636_0009441 | |||
| 2259 | Ga0495636_0036031 | |||
| 2260 | Ga0495674_0064236 | |||
| 2261 | Ga0495672_0014794 | |||
| 2262 | Ga0495672_0018590 | |||
| 2263 | Ga0495672_0025302 | |||
| 2264 | Ga0495672_0026154 | |||
| 2265 | Ga0495672_0035308 | |||
| 2266 | Ga0495672_0039135 | |||
| 2267 | Ga0495672_0044455 | |||
| 2268 | Ga0495672_0045385 | |||
| 2269 | Ga0495672_0057754 | |||
| 2270 | Ga0495672_0075429 | |||
| 2271 | Ga0495672_0087343 | |||
| 2272 | Ga0495672_0088476 | |||
| 2273 | Ga0495672_0091741 | |||
| 2274 | Ga0495672_0159046 | |||
| 2275 | Ga0495672_0226650 | |||
| 2276 | Ga0495676_0031366 | |||
| 2277 | Ga0495676_0052426 | |||
| 2278 | Ga0495680_0032403 | |||
| 2279 | Ga0495680_0036330 | |||
| 2280 | Ga0495680_0054574 | |||
| 2281 | Ga0495680_0076351 | |||
| 2282 | Ga0495680_0083323 | |||
| 2283 | Ga0495683_0010175 | |||
| 2284 | Ga0495683_0012543 | |||
| 2285 | Ga0495683_0016882 | |||
| 2286 | Ga0495683_0020848 | |||
| 2287 | Ga0495683_0024261 | |||
| 2288 | Ga0495683_0030420 | |||
| 2289 | Ga0495683_0035681 | |||
| 2290 | Ga0495683_0037379 | |||
| 2291 | Ga0495683_0047155 | |||
| 2292 | Ga0495683_0052197 | |||
| 2293 | Ga0495683_0052885 | |||
| 2294 | Ga0495683_0053528 | |||
| 2295 | Ga0495683_0101895 | |||
| 2296 | Ga0495687_017480 | |||
| 2297 | Ga0495687_017526 | |||
| 2298 | Ga0495687_033272 | |||
| 2299 | Ga0495687_123173 | |||
| 2300 | Ga0495675_0044823 | |||
| 2301 | Ga0495675_0046665 | |||
| 2302 | Ga0495675_0116536 | |||
| 2303 | Ga0495677_0004678 | |||
| 2304 | Ga0495679_009197 | |||
| 2305 | Ga0495679_012685 | |||
| 2306 | Ga0495679_013111 | |||
| 2307 | Ga0495679_013223 | |||
| 2308 | Ga0495679_017211 | |||
| 2309 | Ga0495679_022547 | |||
| 2310 | Ga0495679_025617 | |||
| 2311 | Ga0495685_015937 | |||
| 2312 | Ga0495673_0012237 | |||
| 2313 | Ga0495673_0016330 | |||
| 2314 | Ga0495673_0020204 | |||
| 2315 | Ga0495673_0021446 | |||
| 2316 | Ga0495673_0023010 | |||
| 2317 | Ga0495673_0025625 | |||
| 2318 | Ga0495673_0027578 | |||
| 2319 | Ga0495673_0031430 | |||
| 2320 | Ga0495673_0043200 | |||
| 2321 | Ga0495673_0047314 | |||
| 2322 | Ga0495673_0054855 | |||
| 2323 | Ga0495673_0059139 | |||
| 2324 | Ga0495673_0075104 | |||
| 2325 | Ga0495673_0109797 | |||
| 2326 | Ga0495681_0011206 | |||
| 2327 | Ga0495681_0012925 | |||
| 2328 | Ga0495681_0013057 | |||
| 2329 | Ga0495681_0013405 | |||
| 2330 | Ga0495681_0013515 | |||
| 2331 | Ga0495681_0014772 | |||
| 2332 | Ga0495681_0016174 | |||
| 2333 | Ga0495681_0020907 | |||
| 2334 | Ga0495681_0026039 | |||
| 2335 | Ga0495681_0028323 | |||
| 2336 | Ga0495681_0028746 | |||
| 2337 | Ga0495681_0029270 | |||
| 2338 | Ga0495681_0029661 | |||
| 2339 | Ga0495681_0035755 | |||
| 2340 | Ga0495681_0046943 | |||
| 2341 | Ga0495681_0057781 | |||
| 2342 | Ga0495681_0105391 | |||
| 2343 | Ga0495681_0140587 | |||
| 2344 | Ga0495684_0061164 | |||
| 2345 | Ga0495684_0076248 | |||
| 2346 | Ga0495686_0029421 | |||
| 2347 | Ga0495686_0031611 | |||
| 2348 | Ga0495686_0060339 | |||
| 2349 | Ga0495686_0076311 | |||
| 2350 | Ga0495686_0087504 | |||
| 2351 | Ga0495686_0266360 | |||
| 2352 | Ga0495593_0020773 | |||
| 2353 | Ga0495593_0021361 | |||
| 2354 | Ga0495593_0032767 | |||
| 2355 | Ga0495593_0037327 | |||
| 2356 | Ga0495593_0054077 | |||
| 2357 | Ga0495593_0095593 | |||
| 2358 | Ga0495602_0054159 | |||
| 2359 | Ga0495602_0207948 | |||
| 2360 | Ga0495614_0107475 | |||
| 2361 | Ga0495626_0008198 | |||
| 2362 | Ga0495626_0010089 | |||
| 2363 | Ga0495626_0014194 | |||
| 2364 | Ga0495626_0017785 | |||
| 2365 | Ga0495626_0019419 | |||
| 2366 | Ga0495626_0022212 | |||
| 2367 | Ga0495626_0022802 | |||
| 2368 | Ga0495626_0033920 | |||
| 2369 | Ga0495626_0041113 | |||
| 2370 | Ga0496100_0456818 | |||
| 2371 | Ga0496102_0024125 | |||
| 2372 | Ga0496103_0032165 | |||
| 2373 | Ga0496106_0176044 | |||
| 2374 | Ga0496106_0233057 | |||
| 2375 | Ga0496110_0027114 | |||
| 2376 | Ga0496110_0048363 | |||
| 2377 | Ga0496110_0114370 | |||
| 2378 | Ga0496111_0143312 | |||
| 2379 | Ga0496112_0048846 | |||
| 2380 | Ga0496114_0232401 | |||
| 2381 | Ga0496116_0000553 | |||
| 2382 | Ga0496116_0020330 | |||
| 2383 | Ga0496116_0021053 | |||
| 2384 | Ga0496116_0023212 | |||
| 2385 | Ga0496116_0030167 | |||
| 2386 | Ga0496116_0049567 | |||
| 2387 | Ga0496117_0004706 | |||
| 2388 | Ga0496117_0010887 | |||
| 2389 | Ga0496117_0011746 | |||
| 2390 | Ga0496117_0022788 | |||
| 2391 | Ga0496117_0026451 | |||
| 2392 | Ga0496117_0030790 | |||
| 2393 | Ga0496117_0044470 | |||
| 2394 | Ga0496117_0055628 | |||
| 2395 | Ga0496117_0064053 | |||
| 2396 | Ga0496117_0067604 | |||
| 2397 | Ga0496117_0083226 | |||
| 2398 | Ga0496117_0086557 | |||
| 2399 | Ga0496117_0095788 | |||
| 2400 | Ga0496117_0105643 | |||
| 2401 | Ga0496117_0136768 | |||
| 2402 | Ga0496118_0021266 | |||
| 2403 | Ga0496118_0030327 | |||
| 2404 | Ga0496118_0038175 | |||
| 2405 | Ga0496118_0046068 | |||
| 2406 | Ga0496118_0051016 | |||
| 2407 | Ga0496118_0053707 | |||
| 2408 | Ga0496118_0054259 | |||
| 2409 | Ga0496118_0065381 | |||
| 2410 | Ga0496118_0073766 | |||
| 2411 | Ga0496118_0098634 | |||
| 2412 | Ga0496118_0101442 | |||
| 2413 | Ga0496118_0131982 | |||
| 2414 | Ga0496118_0273243 | |||
| 2415 | Ga0496119_0039114 | |||
| 2416 | Ga0496119_0058122 | |||
| 2417 | Ga0496119_0125009 | |||
| 2418 | Ga0496120_0032866 | |||
| 2419 | Ga0496120_0050085 | |||
| 2420 | Ga0496120_0076334 | |||
| 2421 | Ga0496120_0093334 | |||
| 2422 | Ga0496121_0002156 | |||
| 2423 | Ga0496121_0051557 | |||
| 2424 | Ga0496121_0059834 | |||
| 2425 | Ga0496121_0066410 | |||
| 2426 | Ga0496121_0072211 | |||
| 2427 | Ga0496121_0074470 | |||
| 2428 | Ga0496121_0119247 | |||
| 2429 | Ga0496121_0121353 | |||
| 2430 | Ga0496121_0129552 | |||
| 2431 | Ga0496122_0003147 | |||
| 2432 | Ga0496122_0019874 | |||
| 2433 | Ga0496122_0033022 | |||
| 2434 | Ga0496122_0044173 | |||
| 2435 | Ga0496122_0071230 | |||
| 2436 | Ga0496122_0076537 | |||
| 2437 | Ga0496122_0089469 | |||
| 2438 | Ga0496122_0127401 | |||
| 2439 | Ga0496122_0157989 | |||
| 2440 | Ga0496123_0005550 | |||
| 2441 | Ga0496123_0011769 | |||
| 2442 | Ga0496123_0062503 | |||
| 2443 | Ga0496123_0081146 | |||
| 2444 | Ga0496123_0082782 | |||
| 2445 | Ga0496123_0114739 | |||
| 2446 | Ga0496123_0117741 | |||
| 2447 | Ga0496124_0015776 | |||
| 2448 | Ga0496124_0016734 | |||
| 2449 | Ga0496124_0037065 | |||
| 2450 | Ga0496124_0040245 | |||
| 2451 | Ga0496124_0042770 | |||
| 2452 | Ga0496124_0053382 | |||
| 2453 | Ga0496124_0054775 | |||
| 2454 | Ga0496124_0060651 | |||
| 2455 | Ga0496124_0074938 | |||
| 2456 | Ga0496124_0096790 | |||
| 2457 | Ga0496124_0101166 | |||
| 2458 | Ga0496124_0118371 | |||
| 2459 | Ga0496124_0120772 | |||
| 2460 | Ga0496124_0137979 | |||
| 2461 | Ga0496124_0181579 | |||
| 2462 | Ga0496124_0391174 | |||
| 2463 | Ga0496125_0001493 | |||
| 2464 | Ga0496125_0017205 | |||
| 2465 | Ga0496125_0026758 | |||
| 2466 | Ga0496125_0030680 | |||
| 2467 | Ga0496125_0032969 | |||
| 2468 | Ga0496125_0033332 | |||
| 2469 | Ga0496125_0033777 | |||
| 2470 | Ga0496125_0044072 | |||
| 2471 | Ga0496125_0065031 | |||
| 2472 | Ga0496125_0071078 | |||
| 2473 | Ga0496125_0143599 | |||
| 2474 | Ga0496125_0323505 | |||
| 2475 | Ga0496126_0048258 | |||
| 2476 | Ga0496126_0080136 | |||
| 2477 | Ga0496126_0102267 | |||
| 2478 | Ga0495678_009808 | |||
| 2479 | Ga0495678_014879 | |||
| 2480 | Ga0495678_015484 | |||
| 2481 | Ga0495678_018110 | |||
| 2482 | Ga0495678_018414 | |||
| 2483 | Ga0495678_020524 | |||
| 2484 | Ga0495678_024213 | |||
| 2485 | Ga0495678_029482 | |||
| 2486 | Ga0495678_035817 | |||
| 2487 | Ga0495678_042029 | |||
| 2488 | Ga0495678_042644 | |||
| 2489 | Ga0495678_063171 | |||
| 2490 | Ga0495682_0011288 | |||
| 2491 | Ga0495682_0013801 | |||
| 2492 | Ga0495682_0016055 | |||
| 2493 | Ga0495682_0018212 | |||
| 2494 | Ga0495682_0045992 | |||
| 2495 | Ga0495682_0067142 | |||
| 2496 | Ga0495682_0105090 | |||
| 2497 | Ga0495682_0112085 | |||
| 2498 | Ga0501032_0074296 | |||
| 2499 | Ga0501034_0000136 | |||
| 2500 | Ga0501034_0137574 | |||
| 2501 | Ga0501037_0129371 | |||
| 2502 | Ga0501039_0499613 | |||
| 2503 | Ga0501241_003143 | |||
| 2504 | Ga0501226_008915 | |||
| 2505 | nmdc:mga03683_49051_c1 | |||
| 2506 | nmdc:mga03683_73931_c1 | |||
| 2507 | nmdc:mga00v17_141526_c1 | |||
| 2508 | nmdc:mga00v17_48241_c1 | |||
| 2509 | nmdc:mga00v17_83941_c1 | |||
| 2510 | nmdc:mga00v17_86173_c2 | |||
| 2511 | nmdc:mga00v17_92322_c1 | |||
| 2512 | nmdc:mga00v17_98593_c1 | |||
| 2513 | nmdc:mga08x19_258699_c1 | |||
| 2514 | nmdc:mga08x19_74779_c1 | |||
| 2515 | nmdc:mga0sz30_11261_c1 | |||
| 2516 | Ga0500641_0107163 | |||
| 2517 | Ga0500572_004522 | |||
| 2518 | Ga0500572_089784 | |||
| 2519 | Ga0500659_0000714 | |||
| 2520 | Ga0500634_0023548 | |||
| 2521 | 2510293635 | |||
| 2522 | 2510310759 | |||
| 2523 | 2511252650 | |||
| 2524 | 2511263251 | |||
| 2525 | 2511269960 | |||
| 2526 | 2511275613 | |||
| 2527 | 2511289876 | |||
| 2528 | 2511294376 | |||
| 2529 | 2511302029 | |||
| 2530 | 2511315367 | |||
| 2531 | 2511321265 | |||
| 2532 | 2511325040 | |||
| 2533 | 2511332098 | |||
| 2534 | 2511339169 | |||
| 2535 | 2511343157 | |||
| 2536 | 2511348670 | |||
| 2537 | 2511358312 | |||
| 2538 | 2511364225 | |||
| 2539 | 2511373883 | |||
| 2540 | 2511416502 | |||
| 2541 | 2511827779 | |||
| 2542 | 2512326537 | |||
| 2543 | 2554818448 | |||
| 2544 | 2555246437 | |||
| 2545 | 2555672969 | |||
| 2546 | 2583795586 | |||
| 2547 | 2597861020 | |||
| 2548 | 2597866762 | |||
| 2549 | 2597872622 | |||
| 2550 | 2599355824 | |||
| 2551 | 2599362774 | |||
| 2552 | 2599368920 | |||
| 2553 | 2599375883 | |||
| 2554 | 2599380930 | |||
| 2555 | 2599387554 | |||
| 2556 | 2599394741 | |||
| 2557 | 2599406506 | |||
| 2558 | 2599462658 | |||
| 2559 | 2599467920 | |||
| 2560 | 2599485746 | |||
| 2561 | 2599491675 | |||
| 2562 | 2599500394 | |||
| 2563 | 2599505884 | |||
| 2564 | 2599615977 | |||
| 2565 | 2599768008 | |||
| 2566 | 2599804525 | |||
| 2567 | 2599879173 | |||
| 2568 | 2599885446 | |||
| 2569 | 2599897160 | |||
| 2570 | 2599930583 | |||
| 2571 | 2599942220 | |||
| 2572 | 2599948880 | |||
| 2573 | 2599954366 | |||
| 2574 | 2599963028 | |||
| 2575 | 2599966085 | |||
| 2576 | 2599977865 | |||
| 2577 | 2599982788 | |||
| 2578 | 2599988459 | |||
| 2579 | 2599994120 | |||
| 2580 | 2599999257 | |||
| 2581 | 2600004171 | |||
| 2582 | 2600012032 | |||
| 2583 | 2600019899 | |||
| 2584 | 2600026200 | |||
| 2585 | 2600031271 | |||
| 2586 | 2600036113 | |||
| 2587 | 2600044344 | |||
| 2588 | 2600046787 | |||
| 2589 | 2600054467 | |||
| 2590 | 2600062210 | |||
| 2591 | 2600067876 | |||
| 2592 | 2600072005 | |||
| 2593 | 2600076407 | |||
| 2594 | 2600215282 | |||
| 2595 | 2600359504 | |||
| 2596 | 2600363415 | |||
| 2597 | 2601693120 | |||
| 2598 | 2601775448 | |||
| 2599 | 2601798416 | |||
| 2600 | 2606077310 | |||
| 2601 | 2606129444 | |||
| 2602 | 2608385101 | |||
| 2603 | 2621296712 | |||
| 2604 | 2624483550 | |||
| 2605 | 2624495099 | |||
| 2606 | 2643843099 | |||
| 2607 | 2643873343 | |||
| 2608 | 2643956177 | |||
| 2609 | 2644020297 | |||
| 2610 | 2644184337 | |||
| 2611 | 2644283094 | |||
| 2612 | 2644624597 | |||
| 2613 | 2652547061 | |||
| 2614 | 2671089691 | |||
| 2615 | 2671099415 | |||
| 2616 | 2671129500 | |||
| 2617 | 2671771532 | |||
| 2618 | 2677900613 | |||
| 2619 | 2678266281 | |||
| 2620 | 2715749698 | |||
| 2621 | 2715754707 | |||
| 2622 | 2718636754 | |||
| 2623 | 2723251497 | |||
| 2624 | 2729147107 | |||
| 2625 | 2738675393 | |||
| 2626 | 2738753796 | |||
| 2627 | 2738807389 | |||
| 2628 | 2738862785 | |||
| 2629 | 2738894749 | |||
| 2630 | 2739199190 | |||
| 2631 | 2739260542 | |||
| 2632 | 2739285805 | |||
| 2633 | 2739291118 | |||
| 2634 | 2739312368 | |||
| 2635 | 2743740561 | |||
| 2636 | 2745007513 | |||
| 2637 | 2765586707 | |||
| 2638 | 2774118211 | |||
| 2639 | 2774128994 | |||
| 2640 | 2774136329 | |||
| 2641 | 2784261677 | |||
| 2642 | 2784313736 | |||
| 2643 | 2794593706 | |||
| 2644 | 2807459242 | |||
| 2645 | 2808856729 | |||
| 2646 | 2808906129 | |||
| 2647 | 2808926126 | |||
| 2648 | 2808928301 | |||
| 2649 | 2808936694 | |||
| 2650 | 2808948227 | |||
| 2651 | 2808950516 | |||
| 2652 | 2808959935 | |||
| 2653 | 2808965012 | |||
| 2654 | 2808976287 | |||
| 2655 | 2808994251 | |||
| 2656 | 2808999904 | |||
| 2657 | 2809217344 | |||
| 2658 | 2817494175 | |||
| 2659 | 2819655269 | |||
| 2660 | 2819704561 | |||
| 2661 | 2825654934 | |||
| 2662 | 2834031086 | |||
| 2663 | 2842807708 | |||
| 2664 | 2842828636 | |||
| 2665 | 2842833598 | |||
| 2666 | 2842838031 | |||
| 2667 | 2842845821 | |||
| 2668 | 2842855758 | |||
| 2669 | 2844667233 | |||
| 2670 | 2852616486 | |||
| 2671 | 2852659950 | |||
| 2672 | 2852671454 | |||
| 2673 | 2860341866 | |||
| 2674 | 2860873155 | |||
| 2675 | 2878029555 | |||
| 2676 | 2880236135 | |||
| 2677 | 2904518812 | |||
| 2678 | 2904551492 | |||
| 2679 | 2908452750 | |||
| 2680 | 2912969019 | |||
| 2681 | 2913042662 | |||
| 2682 | 2917076870 | |||
| 2683 | 2919065373 | |||
| 2684 | 2919129763 | |||
| 2685 | 2919389057 | |||
| 2686 | 2919457719 | |||
| 2687 | 2919485789 | |||
| 2688 | 2919487984 | |||
| 2689 | 2919700438 | |||
| 2690 | 2923159653 | |||
| 2691 | 2923589134 | |||
| 2692 | 2929150055 | |||
| 2693 | 2929195281 | |||
| 2694 | 2931372501 | |||
| 2695 | 2931390788 | |||
| 2696 | 2931398252 | |||
| 2697 | 2935358163 | |||
| 2698 | 2939640664 | |||
| 2699 | 2939654279 | |||
| 2700 | 2945930783 | |||
| 2701 | 2946013131 | |||
| 2702 | 2946028035 | |||
| 2703 | 2947234561 | |||
| 2704 | 2969310343 | |||
| 2705 | 2974293945 | |||
| 2706 | 2974302591 | |||
| 2707 | 2984286461 | |||
| 2708 | 2984499823 | |||
| 2709 | 2988731613 | |||
| 2710 | 2998139883 | |||
| 2711 | 3007255194 | |||
| 2712 | 3007316010 | |||
| 2713 | 3007399259 | |||
| 2714 | 3007419408 | |||
| 2715 | 3007517318 | |||
| 2716 | 3007615751 | |||
| 2717 | 3007624575 | |||
| 2718 | 3007719574 | |||
| 2719 | 3007807350 | |||
| 2720 | 3007859331 | |||
| 2721 | 3007864967 | |||
| 2722 | 3007866646 | |||
| 2723 | 637323401 | |||
| 2724 | 8011352214 | |||
| 2725 | 8015693751 | |||
| 2726 | 8019769636 | |||
| 2727 | 8019781388 | |||
| 2728 | 8029995372 | |||
| 2729 | 8052494717 | |||
| 2730 | 8054290391 | |||
| 2731 | 8054349451 | |||
| 2732 | 8054929763 | |||
| 2733 | 8055777009 | |||
| 2734 | 8055824043 | |||
| 2735 | 8055881759 | |||
| 2736 | 8056116415 | |||
| 2737 | 8056125816 | |||
| 2738 | 8056125961 | |||
| 2739 | 8056131741 | |||
| 2740 | 8056143088 | |||
| 2741 | 8056151359 | |||
| 2742 | 8056159845 | |||
| 2743 | 8056163757 | |||
| 2744 | 8056171172 | |||
| 2745 | 8056177282 | |||
| 2746 | 8056182131 | |||
| 2747 | 8056570606 | |||
| 2748 | 8057802077 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j39-assembly1.cif.gz_A | crystal structure of cmis2 with inhibitor | 0.9346 | 5 | 35 |
| 4bk3-assembly1.cif.gz_A-2 | crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant | 0.9293 | 4 | 34 |
| 7rt0-assembly1.cif.gz_A | 1.80 a resolution structure of mao from p. nicotinovorans in complex with fad | 0.9183 | 5 | 33 |
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.912 | 5 | 34 |
| 3inr-assembly1.cif.gz_B | structure of udp-galactopyranose mutase bound to udp-galactose (oxidized) | 0.8971 | 2 | 32 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37127_327_452_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9397 | 4 | 34 | 3.50.50.60 |
| af_A0A1D6E3F3_39_301_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9381 | 2 | 32 | 3.50.50.60 |
| af_B0G160_35_582_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9224 | 6 | 32 | 3.50.50.60 |
| af_P49086_94_556_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.912 | 1 | 33 | 3.50.50.60 |
| 2v3bA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9107 | 4 | 32 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656JMS0-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9975 | 1 | 96 |
|
| AF-A0A3M2XX85-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9967 | 1 | 156 |
GO:0004029
GO:0005737 |
| AF-A0A3M5AW77-F1-model_v4 | deleted | 0.9952 | 1 | 108 |
|
| AF-A0A836ZNE0-F1-model_v4 | deleted | 0.9923 | 1 | 222 |
|
| AF-A0A3M6D0W9-F1-model_v4 | ActC protein | 0.9893 | 1 | 279 |
GO:0004029
GO:0005737 |