F493472

General Info

Members Datasets Scaffolds Average Seq Length
1376 712 1144 305

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0062730|Ga0373925_0062730_59_1183
Length 374
Sequence MDGILFVALSHALATRPSRDTRLLVWHDLRANASRLSEGKPVSTFPDHAQEPKPSEDAGLTRNLREHRMPEAAVQRPRVAVIGLGSMGMGMAISLRRAGFDVTGCDVSAEAVARFVAEGGRGAKTPAEAARQSGIVISVVVNAAQTETILFGSNGAAETMAEEAVFVSSATMDPDVARRLAKQLEATGRHYLDAPISGGAQRAAQGELTILASGSPAAFAKARPALDAMAAKLYELGDAAGQGAAFKMINQLLAGVHIAAASEAITFAAKQGLDIRKVYEVVTASAGNSWMFENRMPHVLDGDYAPRSAVEIFVKDLGIIQDMARTAKFPVPVASAALQMFLMTAASGMGRDDDASVARMYARVTGTQLPGEPT

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
23 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2643221651 Afipia sp. Root123D2 Isolate Unclassified
27 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2734482264 Dyella sp. AD052 Isolate Unclassified
30 2738543009 Luteibacter sp. OK325 Isolate Unclassified
31 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
50 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
53 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
54 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
55 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2842694124 Methylopila sp. R-72369 Isolate Unclassified
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
73 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
74 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
75 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
76 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
77 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
78 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
79 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
80 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
81 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
82 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
85 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
86 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
87 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
88 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
89 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
90 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
91 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
92 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
93 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
94 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
95 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
96 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
97 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
98 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
99 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
100 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
101 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
102 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
103 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
104 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
105 2902330777 Methylobacterium sp. 2A Isolate Unclassified
106 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
107 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
108 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
109 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
110 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
111 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
112 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
113 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
116 2922368715
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
131 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
132 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
133 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
134 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
135 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
136 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
137 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
138 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
139 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
140 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
141 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
142 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
143 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
144 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
145 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
146 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
147 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
148 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
149 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
150 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
151 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
152 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
153 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
154 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
155 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
156 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
157 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
158 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
159 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
160 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
161 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
162 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
163 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
164 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
165 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
166 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
167 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
168 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
169 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
170 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
171 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
172 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
173 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
174 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
175 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
176 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
179 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
180 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
181 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
182 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
183 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
184 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
185 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
186 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
187 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
188 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
189 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
190 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
191 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
192 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
193 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
194 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
195 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
196 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
197 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
198 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
199 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
200 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
201 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
202 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
203 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
204 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
205 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
206 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
207 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
208 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
209 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
210 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
211 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
212 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
213 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
214 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
215 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
216 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
217 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
218 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
219 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
220 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
221 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
222 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
223 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
224 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
225 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
226 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
227 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
228 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
229 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
230 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
231 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
232 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
233 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
234 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
235 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
236 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
237 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
238 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
239 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
240 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
241 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
242 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
243 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
244 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
245 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
246 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
247 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
248 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
249 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
250 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
251 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
252 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
253 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
254 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
255 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
256 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
257 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
258 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
259 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
260 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
261 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
262 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
263 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
264 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
265 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
266 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
267 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
268 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
269 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
270 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
271 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
272 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
273 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
274 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
275 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
276 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
277 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
278 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
279 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
280 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
281 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
283 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
284 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
285 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
286 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
287 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
288 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
289 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
290 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
291 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
292 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
293 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
294 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
295 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
296 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
297 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
298 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
299 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
300 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
301 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
302 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
303 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
304 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
305 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
306 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
307 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
308 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
309 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
310 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
311 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
312 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
313 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
314 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
315 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
316 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
317 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
318 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
319 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
320 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
321 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
322 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
323 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
326 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
327 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
331 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
333 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
388 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
389 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
390 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
391 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
394 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
398 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
399 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
400 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
401 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
402 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
403 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
404 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
405 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
406 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
407 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
408 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
409 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
410 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
411 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
412 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
413 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
414 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
415 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
416 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
417 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
418 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
419 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
420 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
421 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
422 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
423 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
424 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
425 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
426 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
427 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
428 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
429 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
430 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
431 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
432 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
433 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
434 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
435 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
436 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
437 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
438 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
439 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
440 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
441 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
442 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
443 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
444 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
445 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
446 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
447 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
448 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
449 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
450 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
451 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
452 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
453 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
454 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
455 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
456 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
457 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
458 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
459 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
460 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
461 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
462 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
463 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
464 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
465 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
466 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
467 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
468 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
469 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
470 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
471 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
472 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
473 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
474 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
475 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
476 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
477 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
478 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
479 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
480 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
481 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
482 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
483 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
484 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
485 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
488 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
489 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
490 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
491 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
492 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
493 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
494 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
495 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
496 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
497 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
498 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
499 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
500 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
501 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
502 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
503 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
504 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
505 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
506 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
507 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
508 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
509 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
510 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
511 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
512 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
513 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
514 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
515 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
516 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
517 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
518 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
519 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
520 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
521 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
522 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
523 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
524 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
525 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
526 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
527 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
528 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
529 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
530 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
531 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
532 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
533 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
534 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
535 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
536 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
537 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
538 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
539 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
540 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
541 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
542 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
543 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
544 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
545 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
546 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
547 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
548 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
549 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
550 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
551 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
552 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
553 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
554 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
555 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
556 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
557 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
558 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
559 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
560 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
561 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
562 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
563 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
564 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
565 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
566 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
567 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
568 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
569 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
570 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
571 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
572 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
573 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
574 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
575 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
576 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
577 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
578 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
579 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
580 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
581 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
582 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
583 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
584 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
585 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
586 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
600 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
601 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
602 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
603 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
604 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
605 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
606 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
607 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
608 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
609 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
610 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
611 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
614 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
615 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
616 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
617 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
618 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
619 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
620 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
621 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
622 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
623 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
624 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
625 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
626 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
627 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
628 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
629 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
630 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
631 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
632 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
633 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
634 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
635 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
636 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
637 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
638 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
639 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
640 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
641 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
642 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
643 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
644 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
645 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
646 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
647 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
648 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
649 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
650 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
651 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
652 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
653 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
654 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
655 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
656 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
657 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
658 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
659 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
660 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
661 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
662 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
663 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
664 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
665 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
666 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
667 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
668 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
669 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
670 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
671 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
672 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
673 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
674 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
675 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
676 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
677 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
678 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
679 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
680 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
681 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
682 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
683 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
684 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
685 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
686 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
687 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
688 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
689 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
690 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
691 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
692 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
693 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
694 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
695 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
696 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
697 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
698 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
699 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
700 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
701 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
702 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
703 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
704 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
705 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
706 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
707 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
708 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
709 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
710 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
711 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
712 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.11
Metatranscriptomes 0.15
Isolates 16.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.67
Nodule 13.01
Rhizoplane 5.01
Rhizosphere 60.97
Stem 0
Stem Tuber 0
Unclassified 11.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002636 3300003187 Bacteria 10556
2 JGI25406J46586_10003417 3300003203 Bacteria 7474
3 JGI25406J46586_10006092 3300003203 Bacteria 5571
4 JGI25153J46596_10000952 3300003215 Bacteria 17565
5 JGI25153J46596_10001884 3300003215 Bacteria 12431
6 rootH1_10365848 3300003323 Unclassified 1656
7 JGI25160J50197_1002766 3300003354 Bacteria 8042
8 JGI25160J50197_1003726 3300003354 Bacteria 6720
9 JGI25160J50197_1006214 3300003354 Bacteria 4860
10 JGI25160J50197_1030839 3300003354 Bacteria 1391
11 JGI25160J50197_1031023 3300003354 Bacteria 1383
12 JGI25404J52841_10007977 3300003659 Bacteria 2247
13 JGI25404J52841_10026578 3300003659 Bacteria 1245
14 JGI25404J52841_10037615 3300003659 Bacteria 1028
15 Ga0055539_1002463 3300003752 Bacteria 2813
16 Ga0055542_1013235 3300003762 Bacteria 1396
17 Ga0055531_10008008 3300003794 Bacteria 5651
18 Ga0065165_1004449 3300005262 Bacteria 8687
19 Ga0065165_1004595 3300005262 Bacteria 8409
20 Ga0065165_1005514 3300005262 Bacteria 7075
21 Ga0065165_1008347 3300005262 Bacteria 4867
22 Ga0070658_10406454 3300005327 Bacteria 1170
23 Ga0070683_100005150 3300005329 Bacteria 10876
24 Ga0068869_100015050 3300005334 Bacteria 5178
25 Ga0068869_100023837 3300005334 Bacteria 4234
26 Ga0068869_100058281 3300005334 Bacteria 2823
27 Ga0070680_100008704 3300005336 Bacteria 7779
28 Ga0070680_100014277 3300005336 Bacteria 6203
29 Ga0070680_100395881 3300005336 Bacteria 1177
30 Ga0070682_100116584 3300005337 Bacteria 1787
31 Ga0070682_100176007 3300005337 Bacteria 1490
32 Ga0070660_100047303 3300005339 Bacteria 3300
33 Ga0070689_100106246 3300005340 Bacteria 2227
34 Ga0070691_10114389 3300005341 Bacteria 1353
35 Ga0070661_100024069 3300005344 Bacteria 4368
36 Ga0070661_100122022 3300005344 Bacteria 1953
37 Ga0070692_10060822 3300005345 Unclassified 1989
38 Ga0070668_100037793 3300005347 Bacteria 3688
39 Ga0070668_100083103 3300005347 Bacteria 2513
40 Ga0070668_100232245 3300005347 Bacteria 1525
41 Ga0070668_100512793 3300005347 Bacteria 1039
42 Ga0070675_100255976 3300005354 Bacteria 1533
43 Ga0070671_100036506 3300005355 Bacteria 4075
44 Ga0070671_100261884 3300005355 Bacteria 1470
45 Ga0070673_100408276 3300005364 Bacteria 1216
46 Ga0070659_100117117 3300005366 Bacteria 2154
47 Ga0070667_100184773 3300005367 Bacteria 1845
48 Ga0070667_100233170 3300005367 Bacteria 1642
49 Ga0070667_100260544 3300005367 Bacteria 1552
50 Ga0070709_10000900 3300005434 Bacteria 16554
51 Ga0070714_100039125 3300005435 Bacteria 3991
52 Ga0070714_100049342 3300005435 Bacteria 3582
53 Ga0070714_100389789 3300005435 Bacteria 1315
54 Ga0070713_100003714 3300005436 Bacteria 10103
55 Ga0070713_100006598 3300005436 Bacteria 8063
56 Ga0070713_100030680 3300005436 Bacteria 4272
57 Ga0070713_100037885 3300005436 Bacteria 3901
58 Ga0070713_100517810 3300005436 Bacteria 1127
59 Ga0070713_100609448 3300005436 Bacteria 1038
60 Ga0070710_10000221 3300005437 Bacteria 26514
61 Ga0070701_10022506 3300005438 Bacteria 3021
62 Ga0070711_100002818 3300005439 Bacteria 9977
63 Ga0070711_100011819 3300005439 Bacteria 5432
64 Ga0070711_100037529 3300005439 Bacteria 3252
65 Ga0070711_100133917 3300005439 Bacteria 1849
66 Ga0070705_100066294 3300005440 Bacteria 2164
67 Ga0070700_100002411 3300005441 Bacteria 9532
68 Ga0070700_100127190 3300005441 Bacteria 1715
69 Ga0070708_100236693 3300005445 Bacteria 1714
70 Ga0070663_100026611 3300005455 Bacteria 3920
71 Ga0070663_100057740 3300005455 Bacteria 2785
72 Ga0070663_100267226 3300005455 Bacteria 1359
73 Ga0070663_100345222 3300005455 Bacteria 1204
74 Ga0070678_100064537 3300005456 Bacteria 2714
75 Ga0070678_100101721 3300005456 Bacteria 2228
76 Ga0070662_100162508 3300005457 Bacteria 1748
77 Ga0070662_100365725 3300005457 Bacteria 1184
78 Ga0068867_100070765 3300005459 Bacteria 2608
79 Ga0068867_100093789 3300005459 Bacteria 2282
80 Ga0068867_100381336 3300005459 Bacteria 1184
81 Ga0070685_10175755 3300005466 Bacteria 1375
82 Ga0070679_100079100 3300005530 Bacteria 3277
83 Ga0070684_100003497 3300005535 Bacteria 11794
84 Ga0070684_100065035 3300005535 Bacteria 3200
85 Ga0068853_100055518 3300005539 Bacteria 3414
86 Ga0068853_100203223 3300005539 Bacteria 1803
87 Ga0068853_100312664 3300005539 Bacteria 1455
88 Ga0070672_100121938 3300005543 Bacteria 2135
89 Ga0070672_100242415 3300005543 Bacteria 1516
90 Ga0070686_100002442 3300005544 Bacteria 10238
91 Ga0070686_100211036 3300005544 Bacteria 1398
92 Ga0070696_100012771 3300005546 Bacteria 5639
93 Ga0070665_100008803 3300005548 Bacteria 10217
94 Ga0070665_100043157 3300005548 Bacteria 4532
95 Ga0070665_100062271 3300005548 Bacteria 3741
96 Ga0070665_100141313 3300005548 Bacteria 2410
97 Ga0070665_100147619 3300005548 Bacteria 2354
98 Ga0070665_100177949 3300005548 Bacteria 2128
99 Ga0070665_100347803 3300005548 Bacteria 1488
100 Ga0068855_100120294 3300005563 Bacteria 3005
101 Ga0068855_100121344 3300005563 Bacteria 2991
102 Ga0068855_100279475 3300005563 Bacteria 1854
103 Ga0068855_100304107 3300005563 Bacteria 1766
104 Ga0068855_100372676 3300005563 Bacteria 1569
105 Ga0070664_100196369 3300005564 Bacteria 1799
106 Ga0068857_100013693 3300005577 Bacteria 7068
107 Ga0068857_100430756 3300005577 Bacteria 1231
108 Ga0068854_100062848 3300005578 Bacteria 2694
109 Ga0068854_100081760 3300005578 Bacteria 2387
110 Ga0068856_100009329 3300005614 Bacteria 9530
111 Ga0068856_100036241 3300005614 Bacteria 4836
112 Ga0068856_100221455 3300005614 Bacteria 1907
113 Ga0068856_100237100 3300005614 Bacteria 1840
114 Ga0068856_100410673 3300005614 Bacteria 1374
115 Ga0070702_100001701 3300005615 Bacteria 9132
116 Ga0068852_100011643 3300005616 Bacteria 6635
117 Ga0068852_100251038 3300005616 Bacteria 1695
118 Ga0068859_100048271 3300005617 Bacteria 4276
119 Ga0068866_10002218 3300005718 Bacteria 8062
120 Ga0068861_100034910 3300005719 Bacteria 3721
121 Ga0068861_100059216 3300005719 Bacteria 2931
122 Ga0068861_100169834 3300005719 Bacteria 1807
123 Ga0068851_10035787 3300005834 Bacteria 2484
124 Ga0068870_10029561 3300005840 Unclassified 2761
125 Ga0068870_10098006 3300005840 Bacteria 1651
126 Ga0068863_100380668 3300005841 Bacteria 1378
127 Ga0068863_100380715 3300005841 Bacteria 1378
128 Ga0068858_100099471 3300005842 Bacteria 2712
129 Ga0068858_100100635 3300005842 Bacteria 2695
130 Ga0068858_100137131 3300005842 Bacteria 2296
131 Ga0068860_100000081 3300005843 Bacteria 170066
132 Ga0068860_100096257 3300005843 Bacteria 2822
133 Ga0068860_100221004 3300005843 Bacteria 1840
134 Ga0068860_100499257 3300005843 Bacteria 1214
135 Ga0068862_100007926 3300005844 Bacteria 8786
136 Ga0068862_100131326 3300005844 Bacteria 2215
137 Ga0068862_100332613 3300005844 Bacteria 1405
138 Ga0081455_10000043 3300005937 Bacteria 132283
139 Ga0081455_10011860 3300005937 Bacteria 8725
140 Ga0081455_10052548 3300005937 Bacteria 3487
141 Ga0081455_10082536 3300005937 Bacteria 2629
142 Ga0081455_10099099 3300005937 Bacteria 2345
143 Ga0081538_10066586 3300005981 Bacteria 2018
144 Ga0081540_1000884 3300005983 Bacteria 27058
145 Ga0081540_1003783 3300005983 Bacteria 11839
146 Ga0081540_1004220 3300005983 Bacteria 11042
147 Ga0081540_1005132 3300005983 Bacteria 9811
148 Ga0081540_1012953 3300005983 Bacteria 5449
149 Ga0081540_1014508 3300005983 Bacteria 5041
150 Ga0081540_1019658 3300005983 Bacteria 4094
151 Ga0081540_1025835 3300005983 Bacteria 3368
152 Ga0081539_10006229 3300005985 Bacteria 11559
153 Ga0081539_10010493 3300005985 Bacteria 7513
154 Ga0081539_10053017 3300005985 Bacteria 2274
155 Ga0081539_10063223 3300005985 Bacteria 2020
156 Ga0070717_10003635 3300006028 Bacteria 11063
157 Ga0070717_10005810 3300006028 Bacteria 9034
158 Ga0070717_10292090 3300006028 Bacteria 1447
159 Ga0075365_10007730 3300006038 Bacteria 6051
160 Ga0075363_100017124 3300006048 Bacteria 3588
161 Ga0075363_100072858 3300006048 Bacteria 1868
162 Ga0075364_10046279 3300006051 Bacteria 2832
163 Ga0075364_10329003 3300006051 Bacteria 1041
164 Ga0070715_10001911 3300006163 Bacteria 6264
165 Ga0070716_100001730 3300006173 Bacteria 9850
166 Ga0070712_100021309 3300006175 Bacteria 4256
167 Ga0075367_10060179 3300006178 Bacteria 2264
168 Ga0075366_10013043 3300006195 Bacteria 4726
169 Ga0075366_10095579 3300006195 Bacteria 1781
170 Ga0097621_100054607 3300006237 Bacteria 3259
171 Ga0075370_10044333 3300006353 Bacteria 2514
172 Ga0075370_10141513 3300006353 Bacteria 1406
173 Ga0068871_100012232 3300006358 Bacteria 6319
174 Ga0075428_100013369 3300006844 Bacteria 9130
175 Ga0075428_100460985 3300006844 Bacteria 1361
176 Ga0075430_100344885 3300006846 Bacteria 1230
177 Ga0075431_100010844 3300006847 Bacteria 9167
178 Ga0075431_100318778 3300006847 Bacteria 1568
179 Ga0075434_100004782 3300006871 Bacteria 12262
180 Ga0075434_100043289 3300006871 Bacteria 4465
181 Ga0075434_100368345 3300006871 Bacteria 1458
182 Ga0068865_100043959 3300006881 Bacteria 3055
183 Ga0097620_100048271 3300006931 Bacteria 4276
184 Ga0099824_1011798 3300006942 Bacteria 9748
185 Ga0099824_1013115 3300006942 Bacteria 8742
186 Ga0099822_1000072 3300006943 Bacteria 55118
187 Ga0075435_100015198 3300007076 Bacteria 5781
188 Ga0099794_10122087 3300007265 Bacteria 1311
189 Ga0099795_10022343 3300007788 Bacteria 2087
190 Ga0099795_10040428 3300007788 Bacteria 1656
191 Ga0099795_10104640 3300007788 Bacteria 1115
192 Ga0105240_10002746 3300009093 Bacteria 27840
193 Ga0105240_10010472 3300009093 Bacteria 13035
194 Ga0105240_10030277 3300009093 Bacteria 7034
195 Ga0105240_10052653 3300009093 Bacteria 5114
196 Ga0105240_10306338 3300009093 Bacteria 1816
197 Ga0105240_10571886 3300009093 Bacteria 1248
198 Ga0111539_10000096 3300009094 Bacteria 92188
199 Ga0111539_10030047 3300009094 Bacteria 6610
200 Ga0111539_10076396 3300009094 Bacteria 3944
201 Ga0105245_10021491 3300009098 Bacteria 5662
202 Ga0105247_10310904 3300009101 Bacteria 1096
203 Ga0114129_10092011 3300009147 Bacteria 4201
204 Ga0114129_10532211 3300009147 Bacteria 1531
205 Ga0105243_10247646 3300009148 Bacteria 1589
206 Ga0105243_10542532 3300009148 Bacteria 1110
207 Ga0105241_10028754 3300009174 Bacteria 4143
208 Ga0105241_10034445 3300009174 Bacteria 3804
209 Ga0105248_10117215 3300009177 Bacteria 3003
210 Ga0105248_10517023 3300009177 Bacteria 1346
211 Ga0105237_10002979 3300009545 Bacteria 20474
212 Ga0105237_10004025 3300009545 Bacteria 17170
213 Ga0105237_10043095 3300009545 Bacteria 4548
214 Ga0105237_10097146 3300009545 Bacteria 2936
215 Ga0105237_10238000 3300009545 Bacteria 1822
216 Ga0105237_10508237 3300009545 Bacteria 1212
217 Ga0105238_10098901 3300009551 Bacteria 2901
218 Ga0105238_10275191 3300009551 Bacteria 1664
219 Ga0105249_10026940 3300009553 Bacteria 5183
220 Ga0123341_1000054 3300009765 Bacteria 48678
221 Ga0099796_10024830 3300010159 Bacteria 1885
222 Ga0105239_10002039 3300010375 Bacteria 26201
223 Ga0105239_10088799 3300010375 Bacteria 3408
224 Ga0105239_10150875 3300010375 Bacteria 2594
225 Ga0105239_10224672 3300010375 Bacteria 2106
226 Ga0105239_10291284 3300010375 Bacteria 1838
227 Ga0105239_10313566 3300010375 Bacteria 1768
228 Ga0105239_10601272 3300010375 Bacteria 1254
229 Ga0105239_10656089 3300010375 Bacteria 1199
230 Ga0105239_10660041 3300010375 Bacteria 1195
231 Ga0105246_10020341 3300011119 Bacteria 4255
232 Ga0105246_10232918 3300011119 Bacteria 1451
233 Ga0157373_10001338 3300013100 Bacteria 18862
234 Ga0157371_10086913 3300013102 Bacteria 2214
235 Ga0157369_10006461 3300013105 Bacteria 13590
236 Ga0157369_10017188 3300013105 Bacteria 8128
237 Ga0157369_10039801 3300013105 Bacteria 5136
238 Ga0157369_10167802 3300013105 Bacteria 2314
239 Ga0157374_10418799 3300013296 Bacteria 1338
240 Ga0157378_10153034 3300013297 Bacteria 2150
241 Ga0157378_10246331 3300013297 Bacteria 1709
242 Ga0163162_10118943 3300013306 Bacteria 2744
243 Ga0163162_10192939 3300013306 Bacteria 2165
244 Ga0163162_10459239 3300013306 Bacteria 1405
245 Ga0157372_10101368 3300013307 Bacteria 3287
246 Ga0157372_10161234 3300013307 Bacteria 2592
247 Ga0157375_10058051 3300013308 Bacteria 3827
248 Ga0157375_10083511 3300013308 Bacteria 3239
249 Ga0157375_10148248 3300013308 Bacteria 2479
250 Ga0157375_10183660 3300013308 Bacteria 2244
251 Ga0163163_10045337 3300014325 Bacteria 4315
252 Ga0163163_10089620 3300014325 Bacteria 3088
253 Ga0163163_10777310 3300014325 Bacteria 1021
254 Ga0157380_10048809 3300014326 Bacteria 3336
255 Ga0157380_10112042 3300014326 Bacteria 2295
256 Ga0157376_10012173 3300014969 Bacteria 6374
257 Ga0157376_10148203 3300014969 Bacteria 2113
258 Ga0157376_10156358 3300014969 Bacteria 2062
259 Ga0182007_10034693 3300015262 Bacteria 1703
260 Ga0163161_10004973 3300017792 Bacteria 9253
261 Ga0206356_11198058 3300020070 Bacteria 1289
262 Ga0214544_1000001 3300021320 Bacteria 783667
263 Ga0214542_1000037 3300021321 Bacteria 159256
264 Ga0214545_1000003 3300021324 Bacteria 720274
265 Ga0214543_1003164 3300021327 Bacteria 32141
266 Ga0213873_10001660 3300021358 Bacteria 3728
267 Ga0213876_10009083 3300021384 Bacteria 5351
268 Ga0213876_10048676 3300021384 Bacteria 2239
269 Ga0213876_10051082 3300021384 Bacteria 2185
270 Ga0213876_10157207 3300021384 Bacteria 1209
271 Ga0213875_10002147 3300021388 Bacteria 12036
272 Ga0213875_10002587 3300021388 Bacteria 10766
273 Ga0213875_10031932 3300021388 Bacteria 2489
274 Ga0209677_100908 3300025253 Bacteria 14482
275 Ga0209677_106221 3300025253 Bacteria 2883
276 Ga0209148_1000699 3300025254 Bacteria 27192
277 Ga0209129_1000016 3300025258 Bacteria 485491
278 Ga0209233_1001449 3300025261 Bacteria 9377
279 Ga0209233_1002356 3300025261 Bacteria 7030
280 Ga0209233_1011713 3300025261 Bacteria 2575
281 Ga0209233_1012838 3300025261 Bacteria 2412
282 Ga0209455_1004211 3300025272 Bacteria 4798
283 Ga0209025_1000126 3300025294 Bacteria 200866
284 Ga0209025_1000224 3300025294 Bacteria 133328
285 Ga0209564_1001822 3300025295 Bacteria 19558
286 Ga0209564_1009146 3300025295 Bacteria 4764
287 Ga0209758_1000011 3300025297 Bacteria 1049685
288 Ga0209758_1000133 3300025297 Bacteria 182442
289 Ga0209758_1001786 3300025297 Bacteria 23762
290 Ga0209758_1001858 3300025297 Bacteria 23145
291 Ga0209758_1002537 3300025297 Bacteria 18401
292 Ga0209758_1006910 3300025297 Bacteria 7926
293 Ga0209758_1011139 3300025297 Bacteria 5252
294 Ga0209256_1005335 3300025299 Bacteria 7472
295 Ga0209256_1035539 3300025299 Bacteria 1315
296 Ga0207426_1000151 3300025302 Bacteria 185103
297 Ga0207426_1001289 3300025302 Bacteria 21656
298 Ga0207426_1002137 3300025302 Bacteria 13493
299 Ga0207426_1002396 3300025302 Bacteria 12077
300 Ga0209051_1006374 3300025303 Bacteria 6670
301 Ga0209257_1006326 3300025304 Bacteria 7704
302 Ga0207656_10015273 3300025321 Bacteria 2970
303 Ga0207656_10048015 3300025321 Bacteria 1837
304 Ga0207692_10000364 3300025898 Bacteria 15516
305 Ga0207692_10005642 3300025898 Bacteria 5026
306 Ga0207710_10042705 3300025900 Bacteria 2014
307 Ga0207688_10108501 3300025901 Bacteria 1609
308 Ga0207688_10131512 3300025901 Bacteria 1467
309 Ga0207688_10184203 3300025901 Bacteria 1246
310 Ga0207688_10185181 3300025901 Bacteria 1243
311 Ga0207680_10114777 3300025903 Bacteria 1753
312 Ga0207647_10000406 3300025904 Bacteria 35299
313 Ga0207647_10019836 3300025904 Bacteria 4515
314 Ga0207699_10000319 3300025906 Bacteria 25750
315 Ga0207699_10002988 3300025906 Bacteria 8041
316 Ga0207645_10072196 3300025907 Bacteria 2209
317 Ga0207643_10112698 3300025908 Bacteria 1604
318 Ga0207654_10003032 3300025911 Bacteria 8518
319 Ga0207654_10100931 3300025911 Bacteria 1778
320 Ga0207707_10000378 3300025912 Bacteria 46582
321 Ga0207707_10004078 3300025912 Bacteria 12936
322 Ga0207707_10080028 3300025912 Bacteria 2853
323 Ga0207695_10000008 3300025913 Bacteria 1058268
324 Ga0207695_10007868 3300025913 Bacteria 13458
325 Ga0207695_10048138 3300025913 Bacteria 4505
326 Ga0207695_10051139 3300025913 Bacteria 4341
327 Ga0207695_10158677 3300025913 Bacteria 2195
328 Ga0207695_10207041 3300025913 Bacteria 1874
329 Ga0207671_10004403 3300025914 Bacteria 13492
330 Ga0207671_10028846 3300025914 Bacteria 4146
331 Ga0207671_10044648 3300025914 Bacteria 3278
332 Ga0207671_10086765 3300025914 Bacteria 2353
333 Ga0207671_10150587 3300025914 Bacteria 1797
334 Ga0207671_10157263 3300025914 Bacteria 1759
335 Ga0207671_10211504 3300025914 Bacteria 1517
336 Ga0207671_10389942 3300025914 Bacteria 1107
337 Ga0207693_10009252 3300025915 Bacteria 8044
338 Ga0207693_10043239 3300025915 Bacteria 3545
339 Ga0207663_10000417 3300025916 Bacteria 18473
340 Ga0207663_10015030 3300025916 Bacteria 4259
341 Ga0207663_10328661 3300025916 Bacteria 1151
342 Ga0207660_10003159 3300025917 Bacteria 10789
343 Ga0207660_10372938 3300025917 Bacteria 1146
344 Ga0207657_10002402 3300025919 Bacteria 20250
345 Ga0207657_10004372 3300025919 Bacteria 14956
346 Ga0207652_10004828 3300025921 Bacteria 10918
347 Ga0207652_10186135 3300025921 Bacteria 1867
348 Ga0207681_10151435 3300025923 Bacteria 1739
349 Ga0207694_10293618 3300025924 Bacteria 1337
350 Ga0207687_10046879 3300025927 Bacteria 2994
351 Ga0207687_10102387 3300025927 Bacteria 2109
352 Ga0207687_10119174 3300025927 Bacteria 1971
353 Ga0207700_10013002 3300025928 Bacteria 5395
354 Ga0207700_10025289 3300025928 Bacteria 4121
355 Ga0207700_10081431 3300025928 Bacteria 2528
356 Ga0207700_10252975 3300025928 Bacteria 1506
357 Ga0207664_10040468 3300025929 Bacteria 3625
358 Ga0207644_10099161 3300025931 Bacteria 2185
359 Ga0207644_10446221 3300025931 Bacteria 1062
360 Ga0207706_10081774 3300025933 Bacteria 2838
361 Ga0207686_10163393 3300025934 Bacteria 1563
362 Ga0207709_10095240 3300025935 Bacteria 1956
363 Ga0207709_10199986 3300025935 Bacteria 1426
364 Ga0207709_10295360 3300025935 Bacteria 1203
365 Ga0207669_10211307 3300025937 Bacteria 1416
366 Ga0207704_10062387 3300025938 Bacteria 2317
367 Ga0207704_10091800 3300025938 Bacteria 1997
368 Ga0207704_10238137 3300025938 Bacteria 1358
369 Ga0207704_10288326 3300025938 Bacteria 1251
370 Ga0207665_10000190 3300025939 Bacteria 41515
371 Ga0207665_10016066 3300025939 Bacteria 4916
372 Ga0207691_10079196 3300025940 Bacteria 2957
373 Ga0207691_10115388 3300025940 Bacteria 2385
374 Ga0207691_10167890 3300025940 Bacteria 1923
375 Ga0207711_10121288 3300025941 Bacteria 2334
376 Ga0207711_10335540 3300025941 Bacteria 1399
377 Ga0207689_10000498 3300025942 Bacteria 37073
378 Ga0207689_10001020 3300025942 Bacteria 26905
379 Ga0207689_10013133 3300025942 Bacteria 7068
380 Ga0207689_10112409 3300025942 Bacteria 2239
381 Ga0207689_10156514 3300025942 Bacteria 1878
382 Ga0207661_10000217 3300025944 Bacteria 37415
383 Ga0207661_10007635 3300025944 Bacteria 7690
384 Ga0207661_10013657 3300025944 Bacteria 5930
385 Ga0207661_10260162 3300025944 Bacteria 1545
386 Ga0207679_10031445 3300025945 Bacteria 3715
387 Ga0207667_10003983 3300025949 Bacteria 18156
388 Ga0207667_10005778 3300025949 Bacteria 15094
389 Ga0207667_10058635 3300025949 Bacteria 4036
390 Ga0207667_10122118 3300025949 Bacteria 2684
391 Ga0207667_10293395 3300025949 Bacteria 1661
392 Ga0207667_10438642 3300025949 Bacteria 1328
393 Ga0207651_10181677 3300025960 Bacteria 1669
394 Ga0207651_10212524 3300025960 Bacteria 1558
395 Ga0207668_10059335 3300025972 Bacteria 2680
396 Ga0207668_10061439 3300025972 Bacteria 2642
397 Ga0207640_10129322 3300025981 Bacteria 1823
398 Ga0207640_10136772 3300025981 Bacteria 1780
399 Ga0207640_10160435 3300025981 Bacteria 1663
400 Ga0207640_10236370 3300025981 Bacteria 1409
401 Ga0207658_10145331 3300025986 Bacteria 1925
402 Ga0207658_10306924 3300025986 Bacteria 1369
403 Ga0207677_10066181 3300026023 Bacteria 2525
404 Ga0207703_10039547 3300026035 Bacteria 3769
405 Ga0207703_10108150 3300026035 Bacteria 2368
406 Ga0207639_10073699 3300026041 Bacteria 2677
407 Ga0207639_10107575 3300026041 Bacteria 2265
408 Ga0207639_10405447 3300026041 Bacteria 1229
409 Ga0207678_10048644 3300026067 Bacteria 3665
410 Ga0207678_10063124 3300026067 Bacteria 3183
411 Ga0207678_10068316 3300026067 Bacteria 3050
412 Ga0207678_10125182 3300026067 Bacteria 2193
413 Ga0207678_10232327 3300026067 Bacteria 1579
414 Ga0207708_10002775 3300026075 Bacteria 12869
415 Ga0207708_10117705 3300026075 Bacteria 2068
416 Ga0207708_10174169 3300026075 Bacteria 1705
417 Ga0207702_10000779 3300026078 Bacteria 33703
418 Ga0207702_10691314 3300026078 Bacteria 1005
419 Ga0207641_10128613 3300026088 Bacteria 2271
420 Ga0207648_10114081 3300026089 Bacteria 2374
421 Ga0207648_10167678 3300026089 Bacteria 1941
422 Ga0207648_10168528 3300026089 Bacteria 1935
423 Ga0207674_10046213 3300026116 Bacteria 4472
424 Ga0207674_10109148 3300026116 Bacteria 2743
425 Ga0207674_10205149 3300026116 Bacteria 1920
426 Ga0207675_100004332 3300026118 Bacteria 13714
427 Ga0207675_100772183 3300026118 Bacteria 973
428 Ga0207683_10008222 3300026121 Bacteria 8926
429 Ga0207683_10020311 3300026121 Bacteria 5680
430 Ga0207683_10031453 3300026121 Bacteria 4606
431 Ga0207683_10112708 3300026121 Bacteria 2436
432 Ga0207683_10148222 3300026121 Bacteria 2117
433 Ga0207698_10047807 3300026142 Bacteria 3245
434 Ga0207698_10074151 3300026142 Bacteria 2713
435 Ga0209389_1000001 3300027296 Bacteria 463799
436 Ga0209389_1000014 3300027296 Bacteria 188621
437 Ga0209589_1000011 3300027357 Bacteria 236981
438 Ga0209589_1000020 3300027357 Bacteria 188617
439 Ga0209489_100012 3300027361 Bacteria 236981
440 Ga0209489_100060 3300027361 Bacteria 147091
441 Ga0209489_100612 3300027361 Bacteria 69168
442 Ga0209700_100007 3300027363 Bacteria 454608
443 Ga0209700_100019 3300027363 Bacteria 236981
444 Ga0209179_1021838 3300027512 Bacteria 1252
445 Ga0209588_1014042 3300027671 Bacteria 2450
446 Ga0209588_1051125 3300027671 Bacteria 1337
447 Ga0207428_10000120 3300027907 Bacteria 106231
448 Ga0207428_10256890 3300027907 Bacteria 1302
449 Ga0268266_10001082 3300028379 Bacteria 34140
450 Ga0268266_10018792 3300028379 Bacteria 5889
451 Ga0268266_10020256 3300028379 Bacteria 5671
452 Ga0268266_10022851 3300028379 Bacteria 5323
453 Ga0268266_10068666 3300028379 Bacteria 3069
454 Ga0268266_10142512 3300028379 Bacteria 2152
455 Ga0268266_10177582 3300028379 Bacteria 1937
456 Ga0268266_10186986 3300028379 Bacteria 1889
457 Ga0268266_10303435 3300028379 Bacteria 1490
458 Ga0268265_10209060 3300028380 Bacteria 1699
459 Ga0268264_10000048 3300028381 Bacteria 334457
460 Ga0265337_1006052 3300028556 Bacteria 4718
461 Ga0265326_10003632 3300028558 Bacteria 5041
462 Ga0265319_1009562 3300028563 Bacteria 4118
463 Ga0265334_10018461 3300028573 Bacteria 2875
464 Ga0265318_10014529 3300028577 Bacteria 3304
465 Ga0265323_10002008 3300028653 Bacteria 9596
466 Ga0265322_10022080 3300028654 Bacteria 1822
467 Ga0265336_10002276 3300028666 Bacteria 8031
468 Ga0307517_10004833 3300028786 Bacteria 20547
469 Ga0307515_10025331 3300028794 Bacteria 10271
470 Ga0307515_10343633 3300028794 Bacteria 1143
471 Ga0265338_10007046 3300028800 Bacteria 14103
472 Ga0265324_10012696 3300029957 Bacteria 3168
473 Ga0307511_10059327 3300030521 Bacteria 2944
474 Ga0265330_10008271 3300031235 Bacteria 5014
475 Ga0265332_10006592 3300031238 Bacteria 5262
476 Ga0265332_10011731 3300031238 Bacteria 3893
477 Ga0265325_10004296 3300031241 Bacteria 9033
478 Ga0265340_10003690 3300031247 Bacteria 8619
479 Ga0265339_10001505 3300031249 Bacteria 17219
480 Ga0265331_10014784 3300031250 Bacteria 4143
481 Ga0265316_10110918 3300031344 Bacteria 2077
482 Ga0307513_10084452 3300031456 Bacteria 3261
483 Ga0307509_10009225 3300031507 Bacteria 12382
484 Ga0307509_10082147 3300031507 Bacteria 3325
485 Ga0307508_10000032 3300031616 Bacteria 163293
486 Ga0307508_10288874 3300031616 Bacteria 1233
487 Ga0316579_10000229 3300031691 Bacteria 16998
488 Ga0265314_10002744 3300031711 Bacteria 17602
489 Ga0265314_10012438 3300031711 Bacteria 6945
490 Ga0265314_10140265 3300031711 Bacteria 1495
491 Ga0265342_10057586 3300031712 Bacteria 2299
492 Ga0316578_10028219 3300031728 Bacteria 3177
493 Ga0307516_10033133 3300031730 Bacteria 5200
494 Ga0307516_10056839 3300031730 Bacteria 3813
495 Ga0307516_10064792 3300031730 Bacteria 3532
496 Ga0307413_10055476 3300031824 Bacteria 2411
497 Ga0307413_10176186 3300031824 Bacteria 1519
498 Ga0307518_10137357 3300031838 Bacteria 1710
499 Ga0307410_10073292 3300031852 Bacteria 2381
500 Ga0307409_100325739 3300031995 Bacteria 1440
501 Ga0307409_100552428 3300031995 Bacteria 1130
502 Ga0307416_100324786 3300032002 Bacteria 1543
503 Ga0316583_10001141 3300032133 Bacteria 8669
504 Ga0307507_10007449 3300033179 Bacteria 15914
505 Ga0307510_10022493 3300033180 Bacteria 7322
506 Ga0307510_10063819 3300033180 Bacteria 3746
507 Ga0315911_1000002 3300033442 Bacteria 926833
508 Ga0373959_0033648 3300034820 Bacteria 1047
509 Ga0373934_0016121 3300035086 Bacteria 2838
510 Ga0373923_0000289 3300035111 Bacteria 11095
511 Ga0373936_0015885 3300035113 Bacteria 2888
512 Ga0373936_0109198 3300035113 Bacteria 1173
513 Ga0373936_0148917 3300035113 Bacteria 1014
514 Ga0373953_0019685 3300035117 Bacteria 2513
515 Ga0373954_0015594 3300035118 Bacteria 3398
516 Ga0373954_0099424 3300035118 Bacteria 1402
517 Ga0373956_0010705 3300035119 Bacteria 3765
518 Ga0373956_0086044 3300035119 Bacteria 1446
519 Ga0373957_0009960 3300035120 Bacteria 3125
520 Ga0373943_0033284 3300035170 Bacteria 2454
521 Ga0373943_0068086 3300035170 Bacteria 1797
522 Ga0373946_0003713 3300035171 Bacteria 5411
523 Ga0373955_0023258 3300035172 Bacteria 3154
524 Ga0373955_0092995 3300035172 Bacteria 1721
525 Ga0373955_0287716 3300035172 Bacteria 989
526 Ga0373924_0006636 3300035410 Bacteria 4151
527 Ga0373924_0012573 3300035410 Bacteria 3166
528 Ga0373935_0000499 3300035692 Bacteria 20274
529 Ga0373935_0039296 3300035692 Bacteria 2967
530 Ga0373935_0068682 3300035692 Bacteria 2280
531 Ga0373927_0000437 3300035695 Bacteria 31976
532 Ga0373927_0028546 3300035695 Bacteria 3640
533 Ga0373927_0061213 3300035695 Bacteria 2435
534 Ga0373933_0001296 3300035724 Bacteria 14709
535 Ga0373933_0001914 3300035724 Bacteria 12012
536 Ga0373933_0028125 3300035724 Bacteria 3241
537 Ga0373933_0127537 3300035724 Bacteria 1597
538 Ga0373947_0001481 3300035725 Bacteria 14428
539 Ga0373947_0009460 3300035725 Bacteria 5597
540 Ga0373947_0104142 3300035725 Bacteria 1786
541 Ga0373947_0125977 3300035725 Bacteria 1631
542 Ga0373947_0139127 3300035725 Bacteria 1556
543 Ga0373937_0004047 3300036401 Bacteria 12416
544 Ga0373937_0014169 3300036401 Bacteria 7033
545 Ga0373937_0113131 3300036401 Bacteria 2525
546 Ga0372808_015058 3300036459 Bacteria 1105
547 Ga0316582_0011480 3300036647 Bacteria 4899
548 Ga0316582_0134341 3300036647 Bacteria 1664
549 Ga0373925_0010291 3300037068 Bacteria 6783
550 Ga0373925_0062730 3300037068 Bacteria 2795
551 Ga0373925_0063599 3300037068 Bacteria 2776
552 Ga0373925_0120691 3300037068 Bacteria 2034
553 Ga0373925_0139625 3300037068 Bacteria 1896
554 Ga0373925_0139802 3300037068 Bacteria 1894
555 Ga0395899_0075081 3300037312 Bacteria 2469
556 Ga0395899_0094459 3300037312 Bacteria 2164
557 Ga0395899_0132606 3300037312 Bacteria 1778
558 Ga0395899_0166010 3300037312 Bacteria 1557
559 Ga0395900_0000851 3300037418 Bacteria 40239
560 Ga0395900_0232358 3300037418 Bacteria 1854
561 Ga0395898_0047986 3300037466 Bacteria 4189
562 Ga0395898_0157231 3300037466 Bacteria 2174
563 Ga0395898_0167177 3300037466 Bacteria 2103
564 Ga0395898_0309150 3300037466 Bacteria 1508
565 Ga0395905_0000972 3300037471 Bacteria 36749
566 Ga0395905_0005304 3300037471 Bacteria 13182
567 Ga0395905_0005689 3300037471 Bacteria 12668
568 Ga0395905_0070968 3300037471 Bacteria 3265
569 Ga0436364_0416519 3300037853 Bacteria 115750
570 Ga0436364_0639208 3300037853 Bacteria 10717
571 Ga0436364_1189271 3300037853 Bacteria 2075
572 Ga0395901_0009809 3300038443 Bacteria 9710
573 Ga0395901_0102446 3300038443 Bacteria 3004
574 Ga0395901_0116985 3300038443 Bacteria 2801
575 Ga0436365_0109783 3300039437 Bacteria 28002
576 Ga0436365_0627243 3300039437 Bacteria 2814
577 Ga0436365_0802449 3300039437 Bacteria 1251
578 Ga0436365_1890002 3300039437 Bacteria 1270
579 Ga0436360_0063161 3300039438 Bacteria 1911
580 Ga0436361_0265242 3300039447 Bacteria 3580
581 Ga0436361_0989106 3300039447 Bacteria 1373
582 Ga0436362_0328324 3300039453 Bacteria 3150
583 Ga0436362_0928995 3300039453 Bacteria 2865
584 Ga0439448_0001260 3300042005 Bacteria 6475
585 Ga0466969_0027572 3300044656 Bacteria 2908
586 Ga0466969_0038255 3300044656 Bacteria 2415
587 Ga0466969_0045804 3300044656 Bacteria 2170
588 Ga0466972_0000325 3300044658 Bacteria 26886
589 Ga0466972_0028367 3300044658 Bacteria 2761
590 Ga0453683_0107497 3300044673 Bacteria 1754
591 Ga0466965_0006371 3300044683 Bacteria 5353
592 Ga0466965_0019908 3300044683 Bacteria 3222
593 Ga0466966_0012258 3300044684 Bacteria 5680
594 Ga0466966_0118327 3300044684 Bacteria 1629
595 Ga0466961_0000132 3300044693 Bacteria 49595
596 Ga0466961_0071535 3300044693 Bacteria 2201
597 Ga0466963_0021127 3300044694 Bacteria 4102
598 Ga0466964_0013052 3300044706 Bacteria 3148
599 Ga0453684_0001209 3300044712 Bacteria 79474
600 Ga0453684_0018189 3300044712 Bacteria 10812
601 Ga0453684_0397884 3300044712 Bacteria 1543
602 Ga0466968_0004242 3300044735 Bacteria 5346
603 Ga0466957_0045106 3300044842 Bacteria 2673
604 Ga0466957_0108073 3300044842 Bacteria 1761
605 Ga0466960_0007335 3300044901 Bacteria 4474
606 Ga0466959_0000295 3300045049 Bacteria 29676
607 Ga0466959_0007796 3300045049 Bacteria 7532
608 Ga0466959_0089733 3300045049 Bacteria 2208
609 Ga0466967_0021340 3300045976 Bacteria 5258
610 Ga0466967_0073807 3300045976 Bacteria 3061
611 Ga0466967_0344879 3300045976 Bacteria 1441
612 Ga0495617_027153 3300046452 Bacteria 1927
613 Ga0495617_052860 3300046452 Bacteria 1349
614 Ga0495592_0003354 3300046454 Bacteria 11465
615 Ga0495592_0018326 3300046454 Bacteria 5322
616 Ga0495592_0023956 3300046454 Bacteria 4643
617 Ga0495592_0149639 3300046454 Bacteria 1615
618 Ga0495603_0000040 3300046455 Bacteria 55056
619 Ga0495603_0002873 3300046455 Bacteria 10184
620 Ga0495603_0044454 3300046455 Bacteria 2650
621 Ga0495603_0089349 3300046455 Bacteria 1802
622 Ga0495603_0091424 3300046455 Bacteria 1779
623 Ga0495603_0102118 3300046455 Bacteria 1674
624 Ga0495590_0053509 3300046457 Bacteria 1409
625 Ga0495629_0000077 3300046459 Bacteria 85931
626 Ga0495629_0000188 3300046459 Bacteria 56009
627 Ga0495629_0106813 3300046459 Bacteria 1953
628 Ga0495638_0013009 3300046460 Bacteria 5682
629 Ga0495638_0179570 3300046460 Bacteria 1208
630 Ga0495641_0008119 3300046461 Bacteria 6447
631 Ga0495641_0132254 3300046461 Bacteria 1114
632 Ga0495651_0000271 3300046462 Bacteria 40231
633 Ga0495651_0023165 3300046462 Bacteria 4829
634 Ga0495651_0023797 3300046462 Bacteria 4763
635 Ga0495651_0074528 3300046462 Bacteria 2574
636 Ga0495653_0004244 3300046463 Bacteria 11611
637 Ga0495653_0104811 3300046463 Bacteria 2043
638 Ga0495653_0175933 3300046463 Bacteria 1473
639 Ga0495650_0060222 3300046471 Bacteria 1525
640 Ga0495580_0003456 3300046472 Bacteria 13444
641 Ga0495580_0004422 3300046472 Bacteria 11810
642 Ga0495580_0298139 3300046472 Bacteria 1098
643 Ga0495582_0000020 3300046473 Bacteria 88349
644 Ga0495582_0052261 3300046473 Bacteria 2253
645 Ga0495605_0008346 3300046474 Bacteria 5858
646 Ga0495639_0000011 3300046475 Bacteria 92268
647 Ga0495639_0020094 3300046475 Bacteria 2917
648 Ga0495662_0000229 3300046476 Bacteria 23341
649 Ga0495662_0084561 3300046476 Bacteria 1544
650 Ga0495662_0189151 3300046476 Bacteria 1015
651 Ga0495664_0006970 3300046477 Bacteria 6261
652 Ga0495664_0028905 3300046477 Bacteria 3239
653 Ga0495664_0066710 3300046477 Bacteria 2146
654 Ga0495584_0133370 3300046491 Bacteria 1260
655 Ga0495585_0001246 3300046492 Bacteria 20537
656 Ga0495585_0062171 3300046492 Bacteria 2051
657 Ga0495585_0084374 3300046492 Bacteria 1718
658 Ga0495596_0071301 3300046500 Bacteria 1349
659 Ga0495607_0039575 3300046501 Bacteria 2815
660 Ga0495583_0024110 3300046506 Bacteria 3064
661 Ga0495606_0000186 3300046507 Bacteria 109172
662 Ga0495606_0001881 3300046507 Bacteria 26299
663 Ga0495606_0027650 3300046507 Bacteria 4016
664 Ga0495606_0043102 3300046507 Bacteria 3013
665 Ga0495608_0006190 3300046511 Bacteria 8495
666 Ga0495608_0026863 3300046511 Bacteria 3921
667 Ga0495608_0131387 3300046511 Bacteria 1602
668 Ga0495610_0002153 3300046512 Bacteria 16753
669 Ga0495616_0025893 3300046513 Bacteria 3128
670 Ga0495616_0039835 3300046513 Bacteria 2404
671 Ga0495616_0108459 3300046513 Bacteria 1292
672 Ga0495616_0126353 3300046513 Bacteria 1176
673 Ga0495618_0036142 3300046514 Bacteria 3100
674 Ga0495618_0256246 3300046514 Bacteria 1096
675 Ga0495620_0026829 3300046515 Bacteria 2704
676 Ga0495620_0044658 3300046515 Bacteria 1924
677 Ga0495628_0036603 3300046516 Bacteria 3937
678 Ga0495628_0050238 3300046516 Bacteria 3299
679 Ga0495630_0005419 3300046517 Bacteria 9006
680 Ga0495630_0197713 3300046517 Bacteria 1534
681 Ga0495631_0016680 3300046518 Bacteria 3494
682 Ga0495631_0041980 3300046518 Bacteria 2022
683 Ga0495632_0018833 3300046519 Bacteria 3775
684 Ga0495632_0090724 3300046519 Bacteria 1449
685 Ga0495643_0024447 3300046522 Bacteria 3426
686 Ga0495643_0131436 3300046522 Bacteria 1256
687 Ga0495648_0001821 3300046524 Bacteria 20522
688 Ga0495648_0006381 3300046524 Bacteria 9639
689 Ga0495648_0075054 3300046524 Bacteria 1946
690 Ga0495648_0097879 3300046524 Bacteria 1626
691 Ga0495652_0004764 3300046529 Bacteria 12908
692 Ga0495652_0020613 3300046529 Bacteria 5859
693 Ga0495652_0055109 3300046529 Bacteria 3382
694 Ga0495652_0112922 3300046529 Bacteria 2182
695 Ga0495665_0000133 3300046531 Bacteria 35771
696 Ga0495665_0165372 3300046531 Bacteria 1152
697 Ga0495640_0006645 3300046533 Bacteria 9127
698 Ga0495640_0010408 3300046533 Bacteria 7193
699 Ga0495640_0050384 3300046533 Bacteria 2868
700 Ga0495640_0223939 3300046533 Bacteria 1185
701 Ga0495586_0052280 3300046535 Bacteria 2212
702 Ga0495587_0003226 3300046536 Bacteria 10906
703 Ga0495587_0044816 3300046536 Bacteria 2630
704 Ga0495587_0045939 3300046536 Bacteria 2594
705 Ga0495598_0009153 3300046537 Bacteria 2331
706 Ga0495609_0047167 3300046538 Bacteria 1928
707 Ga0495621_0003331 3300046539 Bacteria 4428
708 Ga0495645_0008894 3300046543 Bacteria 7016
709 Ga0495645_0013345 3300046543 Bacteria 5807
710 Ga0495645_0024316 3300046543 Bacteria 4395
711 Ga0495645_0037041 3300046543 Bacteria 3555
712 Ga0495622_0008052 3300046557 Bacteria 4886
713 Ga0495622_0021201 3300046557 Bacteria 3027
714 Ga0495622_0119717 3300046557 Bacteria 1202
715 Ga0495667_0001104 3300046559 Bacteria 17551
716 Ga0495667_0007596 3300046559 Bacteria 7358
717 Ga0495667_0010094 3300046559 Bacteria 6395
718 Ga0495667_0026308 3300046559 Bacteria 3921
719 Ga0495667_0035944 3300046559 Bacteria 3309
720 Ga0495667_0252021 3300046559 Bacteria 1123
721 Ga0495656_0005561 3300046615 Bacteria 4355
722 Ga0495656_0028536 3300046615 Bacteria 2239
723 Ga0495656_0050930 3300046615 Bacteria 1770
724 Ga0495668_0006779 3300046616 Bacteria 7442
725 Ga0495668_0010958 3300046616 Bacteria 5457
726 Ga0495668_0032597 3300046616 Bacteria 2930
727 Ga0495668_0051728 3300046616 Bacteria 2274
728 Ga0495668_0117269 3300046616 Bacteria 1456
729 Ga0495634_0000402 3300046642 Bacteria 42617
730 Ga0495634_0009196 3300046642 Bacteria 7295
731 Ga0495634_0047380 3300046642 Bacteria 2897
732 Ga0495634_0053945 3300046642 Bacteria 2691
733 Ga0495634_0074637 3300046642 Bacteria 2228
734 Ga0495611_0033915 3300046648 Bacteria 2254
735 Ga0495625_0001536 3300046660 Bacteria 27569
736 Ga0495625_0002662 3300046660 Bacteria 19020
737 Ga0495625_0084999 3300046660 Bacteria 2197
738 Ga0495625_0307521 3300046660 Bacteria 1012
739 Ga0495635_0000196 3300046663 Bacteria 38194
740 Ga0495635_0012249 3300046663 Bacteria 6009
741 Ga0495635_0015570 3300046663 Bacteria 5315
742 Ga0495635_0050962 3300046663 Bacteria 2853
743 Ga0495635_0257922 3300046663 Bacteria 1174
744 Ga0495659_0040465 3300046664 Bacteria 1661
745 Ga0495588_0001382 3300046674 Bacteria 10366
746 Ga0495588_0010446 3300046674 Bacteria 4318
747 Ga0495657_0001347 3300046675 Bacteria 21368
748 Ga0495657_0003332 3300046675 Bacteria 13159
749 Ga0495657_0054766 3300046675 Bacteria 2663
750 Ga0495657_0138339 3300046675 Bacteria 1520
751 Ga0495657_0159888 3300046675 Bacteria 1394
752 Ga0495599_0015309 3300046678 Bacteria 4759
753 Ga0495599_0019003 3300046678 Bacteria 4284
754 Ga0495599_0036386 3300046678 Bacteria 3091
755 Ga0495599_0170988 3300046678 Bacteria 1341
756 Ga0495623_0004419 3300046679 Bacteria 9239
757 Ga0495623_0037495 3300046679 Bacteria 3101
758 Ga0495623_0090059 3300046679 Bacteria 1884
759 Ga0495646_0009557 3300046680 Bacteria 6156
760 Ga0495646_0025141 3300046680 Bacteria 3747
761 Ga0495646_0043300 3300046680 Bacteria 2758
762 Ga0495646_0044961 3300046680 Bacteria 2698
763 Ga0495646_0060392 3300046680 Bacteria 2261
764 Ga0495647_0010003 3300046681 Bacteria 3223
765 Ga0495647_0042605 3300046681 Bacteria 1734
766 Ga0495658_0000538 3300046683 Bacteria 20615
767 Ga0495658_0019954 3300046683 Bacteria 3507
768 Ga0495658_0193917 3300046683 Bacteria 1264
769 Ga0495669_0008807 3300046684 Bacteria 4251
770 Ga0495613_0000873 3300046689 Bacteria 23135
771 Ga0495613_0001148 3300046689 Bacteria 20201
772 Ga0495613_0027935 3300046689 Bacteria 4200
773 Ga0495613_0052618 3300046689 Bacteria 2998
774 Ga0495613_0169878 3300046689 Bacteria 1548
775 Ga0495613_0269400 3300046689 Bacteria 1185
776 Ga0495624_0000819 3300046690 Bacteria 24553
777 Ga0495624_0044349 3300046690 Bacteria 2835
778 Ga0495624_0119709 3300046690 Bacteria 1617
779 Ga0495671_0082806 3300046692 Bacteria 1572
780 Ga0495671_0124526 3300046692 Bacteria 1257
781 Ga0495649_0040650 3300046694 Bacteria 2545
782 Ga0495600_0001932 3300046809 Bacteria 11640
783 Ga0495600_0012427 3300046809 Bacteria 5323
784 Ga0495600_0030740 3300046809 Bacteria 3478
785 Ga0495600_0103745 3300046809 Bacteria 1853
786 Ga0495600_0188945 3300046809 Bacteria 1325
787 Ga0495581_0000518 3300047315 Bacteria 19734
788 Ga0495581_0007817 3300047315 Bacteria 6192
789 Ga0495581_0129026 3300047315 Bacteria 1473
790 Ga0495581_0142230 3300047315 Bacteria 1400
791 Ga0495604_0002485 3300047317 Bacteria 14722
792 Ga0495604_0004984 3300047317 Bacteria 10513
793 Ga0495604_0017542 3300047317 Bacteria 5732
794 Ga0495604_0020026 3300047317 Bacteria 5346
795 Ga0495604_0121713 3300047317 Bacteria 1888
796 Ga0495604_0146058 3300047317 Bacteria 1685
797 Ga0495674_0001070 3300047319 Bacteria 26357
798 Ga0495674_0013696 3300047319 Bacteria 7618
799 Ga0495674_0041838 3300047319 Bacteria 4090
800 Ga0495674_0066903 3300047319 Bacteria 3115
801 Ga0495674_0211732 3300047319 Bacteria 1605
802 Ga0495674_0334735 3300047319 Bacteria 1231
803 Ga0495676_0033175 3300047321 Bacteria 4351
804 Ga0495680_0001198 3300047322 Bacteria 28460
805 Ga0495680_0013711 3300047322 Bacteria 7055
806 Ga0495680_0089446 3300047322 Bacteria 2311
807 Ga0495683_0000532 3300047323 Bacteria 28893
808 Ga0495683_0021057 3300047323 Bacteria 3361
809 Ga0495687_025008 3300047443 Bacteria 2829
810 Ga0495675_0000638 3300047444 Bacteria 22292
811 Ga0495675_0003907 3300047444 Bacteria 9025
812 Ga0495675_0058177 3300047444 Bacteria 2451
813 Ga0495675_0145751 3300047444 Bacteria 1465
814 Ga0495675_0206245 3300047444 Bacteria 1195
815 Ga0495677_0056715 3300047445 Bacteria 1447
816 Ga0495673_0006897 3300047469 Bacteria 6621
817 Ga0495684_0000068 3300047471 Bacteria 70808
818 Ga0495684_0025140 3300047471 Bacteria 4579
819 Ga0495684_0063761 3300047471 Bacteria 2801
820 Ga0495684_0088205 3300047471 Bacteria 2351
821 Ga0495684_0117110 3300047471 Bacteria 2008
822 Ga0495686_0004768 3300047472 Bacteria 10971
823 Ga0495686_0025525 3300047472 Bacteria 3872
824 Ga0495686_0119814 3300047472 Bacteria 1570
825 Ga0495686_0155136 3300047472 Bacteria 1341
826 Ga0495593_0000006 3300047673 Bacteria 90370
827 Ga0495593_0007104 3300047673 Bacteria 6565
828 Ga0495593_0031542 3300047673 Bacteria 2894
829 Ga0495593_0074513 3300047673 Bacteria 1760
830 Ga0495602_0001578 3300048088 Bacteria 22679
831 Ga0495602_0011453 3300048088 Bacteria 9169
832 Ga0495602_0015304 3300048088 Bacteria 7750
833 Ga0495602_0066086 3300048088 Bacteria 3117
834 Ga0495614_0004871 3300048089 Bacteria 6061
835 Ga0495614_0088486 3300048089 Bacteria 1346
836 Ga0495614_0177202 3300048089 Bacteria 958
837 Ga0495615_0007661 3300048090 Bacteria 2058
838 Ga0496100_0066259 3300048903 Bacteria 2395
839 Ga0496100_0077186 3300048903 Bacteria 2239
840 Ga0496100_0245954 3300048903 Bacteria 1321
841 Ga0496101_0026205 3300048904 Bacteria 4053
842 Ga0496101_0161563 3300048904 Bacteria 1718
843 Ga0496102_0003559 3300048905 Bacteria 13195
844 Ga0496102_0036626 3300048905 Bacteria 4421
845 Ga0496102_0056022 3300048905 Bacteria 3595
846 Ga0496102_0057999 3300048905 Bacteria 3537
847 Ga0496103_0030094 3300048906 Bacteria 3302
848 Ga0496104_0001744 3300048907 Bacteria 18783
849 Ga0496104_0035142 3300048907 Bacteria 4678
850 Ga0496104_0078243 3300048907 Bacteria 3151
851 Ga0496104_0082553 3300048907 Bacteria 3064
852 Ga0496104_0107877 3300048907 Bacteria 2668
853 Ga0496104_0122241 3300048907 Bacteria 2499
854 Ga0496105_0002142 3300048908 Bacteria 14301
855 Ga0496105_0011609 3300048908 Bacteria 6969
856 Ga0496105_0083831 3300048908 Bacteria 2632
857 Ga0496106_0000627 3300048909 Bacteria 25272
858 Ga0496106_0006300 3300048909 Bacteria 8785
859 Ga0496106_0006841 3300048909 Bacteria 8439
860 Ga0496106_0085203 3300048909 Bacteria 2433
861 Ga0496106_0113709 3300048909 Bacteria 2110
862 Ga0496107_0005103 3300048910 Bacteria 8953
863 Ga0496107_0011833 3300048910 Bacteria 6093
864 Ga0496107_0013020 3300048910 Bacteria 5811
865 Ga0496107_0091698 3300048910 Bacteria 2221
866 Ga0496107_0171468 3300048910 Bacteria 1610
867 Ga0496108_0000259 3300048911 Bacteria 45599
868 Ga0496108_0127426 3300048911 Bacteria 2186
869 Ga0496109_0000250 3300048912 Bacteria 51687
870 Ga0496109_0017185 3300048912 Bacteria 6335
871 Ga0496109_0037911 3300048912 Bacteria 4356
872 Ga0496109_0096845 3300048912 Bacteria 2734
873 Ga0496110_0010988 3300048913 Bacteria 7387
874 Ga0496110_0018274 3300048913 Bacteria 5878
875 Ga0496110_0037452 3300048913 Bacteria 4216
876 Ga0496110_0048968 3300048913 Bacteria 3706
877 Ga0496110_0094810 3300048913 Bacteria 2672
878 Ga0496110_0106383 3300048913 Bacteria 2517
879 Ga0496110_0150182 3300048913 Bacteria 2109
880 Ga0496110_0224236 3300048913 Bacteria 1709
881 Ga0496111_0020268 3300048914 Bacteria 4627
882 Ga0496111_0029410 3300048914 Bacteria 3903
883 Ga0496111_0186563 3300048914 Bacteria 1542
884 Ga0496111_0192179 3300048914 Bacteria 1518
885 Ga0496111_0314913 3300048914 Bacteria 1159
886 Ga0496112_0000017 3300048915 Bacteria 191284
887 Ga0496112_0052717 3300048915 Bacteria 3993
888 Ga0496112_0082096 3300048915 Bacteria 3188
889 Ga0496112_0180320 3300048915 Bacteria 2076
890 Ga0496112_0202931 3300048915 Bacteria 1941
891 Ga0496112_0631898 3300048915 Bacteria 1001
892 Ga0496113_0029385 3300048916 Bacteria 3968
893 Ga0496113_0036230 3300048916 Bacteria 3613
894 Ga0496113_0059155 3300048916 Bacteria 2886
895 Ga0496113_0081737 3300048916 Bacteria 2477
896 Ga0496113_0174718 3300048916 Bacteria 1702
897 Ga0496113_0395442 3300048916 Bacteria 1109
898 Ga0496114_0053748 3300048917 Bacteria 3357
899 Ga0496114_0135248 3300048917 Bacteria 2131
900 Ga0496114_0173409 3300048917 Bacteria 1881
901 Ga0496115_0003885 3300048918 Bacteria 10774
902 Ga0496115_0015437 3300048918 Bacteria 5794
903 Ga0496115_0040567 3300048918 Bacteria 3702
904 Ga0496115_0051006 3300048918 Bacteria 3317
905 Ga0496115_0067618 3300048918 Bacteria 2890
906 Ga0496115_0335258 3300048918 Bacteria 1235
907 Ga0496116_0001079 3300048919 Bacteria 32822
908 Ga0496116_0027016 3300048919 Bacteria 4183
909 Ga0496117_0027627 3300048920 Bacteria 4415
910 Ga0496117_0044446 3300048920 Bacteria 3218
911 Ga0496117_0100523 3300048920 Bacteria 1831
912 Ga0496117_0119834 3300048920 Bacteria 1619
913 Ga0496118_0005263 3300048921 Bacteria 14775
914 Ga0496118_0047345 3300048921 Bacteria 3333
915 Ga0496118_0076350 3300048921 Bacteria 2383
916 Ga0496118_0129688 3300048921 Bacteria 1622
917 Ga0496119_0096025 3300048922 Bacteria 1673
918 Ga0496119_0108049 3300048922 Bacteria 1550
919 Ga0496119_0162604 3300048922 Bacteria 1185
920 Ga0496120_0009024 3300048923 Bacteria 7126
921 Ga0496120_0079037 3300048923 Bacteria 1786
922 Ga0496120_0101831 3300048923 Bacteria 1516
923 Ga0496121_0000041 3300048924 Bacteria 346686
924 Ga0496121_0001488 3300048924 Bacteria 39493
925 Ga0496121_0007872 3300048924 Bacteria 12746
926 Ga0496121_0011984 3300048924 Bacteria 9533
927 Ga0496121_0014293 3300048924 Bacteria 8440
928 Ga0496121_0014476 3300048924 Bacteria 8365
929 Ga0496121_0025495 3300048924 Bacteria 5607
930 Ga0496121_0061849 3300048924 Bacteria 3070
931 Ga0496121_0103153 3300048924 Bacteria 2195
932 Ga0496121_0108787 3300048924 Bacteria 2120
933 Ga0496121_0256017 3300048924 Bacteria 1211
934 Ga0496121_0265938 3300048924 Bacteria 1181
935 Ga0496122_0019761 3300048925 Bacteria 6137
936 Ga0496122_0071868 3300048925 Bacteria 2463
937 Ga0496123_0053912 3300048926 Bacteria 2653
938 Ga0496123_0140078 3300048926 Bacteria 1324
939 Ga0496124_0001646 3300048927 Bacteria 31986
940 Ga0496124_0069807 3300048927 Bacteria 2916
941 Ga0496124_0105539 3300048927 Bacteria 2276
942 Ga0496124_0136445 3300048927 Bacteria 1942
943 Ga0496125_0018563 3300048928 Bacteria 6603
944 Ga0496125_0020254 3300048928 Bacteria 6247
945 Ga0496125_0048379 3300048928 Bacteria 3547
946 Ga0496125_0052034 3300048928 Bacteria 3371
947 Ga0496125_0059141 3300048928 Bacteria 3090
948 Ga0496125_0103617 3300048928 Bacteria 2087
949 Ga0496125_0131027 3300048928 Bacteria 1765
950 Ga0496126_0005288 3300048929 Bacteria 14814
951 Ga0496126_0005411 3300048929 Bacteria 14568
952 Ga0496126_0006081 3300048929 Bacteria 13538
953 Ga0496126_0020645 3300048929 Bacteria 6452
954 Ga0496126_0032207 3300048929 Bacteria 4941
955 Ga0496126_0065925 3300048929 Bacteria 3238
956 Ga0496126_0068821 3300048929 Bacteria 3159
957 Ga0496126_0090667 3300048929 Bacteria 2689
958 Ga0496126_0109374 3300048929 Bacteria 2409
959 Ga0496126_0122534 3300048929 Bacteria 2253
960 Ga0496126_0131606 3300048929 Bacteria 2161
961 Ga0496126_0135001 3300048929 Bacteria 2129
962 Ga0496126_0215692 3300048929 Bacteria 1614
963 Ga0496126_0235250 3300048929 Bacteria 1533
964 Ga0496126_0328725 3300048929 Bacteria 1255
965 Ga0501031_0000368 3300049568 Bacteria 26339
966 Ga0501032_0000392 3300049569 Bacteria 36103
967 Ga0501032_0000696 3300049569 Bacteria 27371
968 Ga0501033_0000232 3300049570 Bacteria 53703
969 Ga0501033_0002168 3300049570 Bacteria 16958
970 Ga0501033_0019714 3300049570 Bacteria 5097
971 Ga0501034_0000039 3300049571 Bacteria 237357
972 Ga0501034_0000487 3300049571 Bacteria 64548
973 Ga0501034_0000704 3300049571 Bacteria 50735
974 Ga0501034_0251834 3300049571 Bacteria 1710
975 Ga0501034_0479742 3300049571 Bacteria 1159
976 Ga0501036_0000007 3300049572 Bacteria 240500
977 Ga0501036_0000052 3300049572 Bacteria 74795
978 Ga0501037_0000025 3300049573 Bacteria 143276
979 Ga0501037_0000066 3300049573 Bacteria 96723
980 Ga0501038_0000026 3300049574 Bacteria 146493
981 Ga0501038_0000168 3300049574 Bacteria 55496
982 Ga0501039_0000005 3300049575 Bacteria 295471
983 Ga0501039_0001742 3300049575 Bacteria 16050
984 Ga0501039_0036113 3300049575 Bacteria 3813
985 Ga0501039_0286137 3300049575 Bacteria 1296
986 Ga0501042_0060090 3300049578 Bacteria 2715
987 Ga0501042_0087410 3300049578 Bacteria 2236
988 Ga0501042_0140884 3300049578 Bacteria 1739
989 Ga0501043_0000036 3300049579 Bacteria 132959
990 Ga0501043_0063197 3300049579 Bacteria 2907
991 Ga0501043_0175848 3300049579 Bacteria 1669
992 Ga0501046_0000147 3300049580 Bacteria 74186
993 Ga0501046_0000231 3300049580 Bacteria 57655
994 Ga0501046_0038560 3300049580 Bacteria 3833
995 Ga0501047_0000209 3300049581 Bacteria 70658
996 Ga0501047_0000379 3300049581 Bacteria 50147
997 Ga0501048_0000460 3300049582 Bacteria 28509
998 Ga0501048_0000585 3300049582 Bacteria 25849
999 Ga0501067_0000025 3300049583 Bacteria 91481
1000 Ga0501067_0038575 3300049583 Bacteria 2652
1001 Ga0501068_0000569 3300049584 Bacteria 18796
1002 Ga0501068_0000944 3300049584 Bacteria 15231
1003 Ga0501069_0001325 3300049585 Bacteria 12134
1004 Ga0501069_0109798 3300049585 Bacteria 1570
1005 Ga0501070_0000163 3300049586 Bacteria 60911
1006 Ga0501070_0077515 3300049586 Bacteria 2751
1007 Ga0501070_0174909 3300049586 Bacteria 1768
1008 Ga0501071_0018672 3300049587 Bacteria 4807
1009 Ga0501071_0036003 3300049587 Bacteria 3529
1010 Ga0501071_0108835 3300049587 Bacteria 2047
1011 Ga0501071_0135408 3300049587 Bacteria 1833
1012 Ga0501072_0001295 3300049588 Bacteria 18708
1013 Ga0501072_0026856 3300049588 Bacteria 4492
1014 Ga0501073_0000070 3300049589 Bacteria 63026
1015 Ga0501073_0000135 3300049589 Bacteria 47869
1016 Ga0501074_0001792 3300049590 Bacteria 14692
1017 Ga0501074_0006247 3300049590 Bacteria 8604
1018 Ga0501074_0094574 3300049590 Bacteria 2140
1019 Ga0501079_0017767 3300049741 Bacteria 5434
1020 Ga0501079_0299247 3300049741 Bacteria 1259
1021 Ga0501079_0316818 3300049741 Bacteria 1221
1022 Ga0501080_0000137 3300049742 Bacteria 51355
1023 Ga0501080_0001229 3300049742 Bacteria 21299
1024 Ga0501081_0163805 3300049743 Bacteria 1603
1025 Ga0501083_0001024 3300049744 Bacteria 18626
1026 Ga0501083_0003716 3300049744 Bacteria 10720
1027 Ga0501035_0000016 3300049822 Bacteria 243412
1028 Ga0501035_0000052 3300049822 Bacteria 143038
1029 Ga0501035_0325637 3300049822 Bacteria 1290
1030 Ga0501044_0000217 3300049823 Bacteria 73242
1031 Ga0501044_0000366 3300049823 Bacteria 56832
1032 Ga0501044_0006616 3300049823 Bacteria 12783
1033 Ga0501044_0277867 3300049823 Bacteria 1609
1034 Ga0501045_0006921 3300049824 Bacteria 7858
1035 nmdc:mga03n38_7548_c1 3300050490 Bacteria 3853
1036 nmdc:mga00v17_110651_c1 3300050491 Bacteria 1742
1037 nmdc:mga00v17_271279_c1 3300050491 Bacteria 1101
1038 nmdc:mga0yw44_160354_c1 3300050492 Bacteria 1472
1039 nmdc:mga0yw44_51827_c1 3300050492 Bacteria 2486
1040 nmdc:mga0k408_13681_c1 3300050493 Bacteria 4455
1041 nmdc:mga06z11_54938_c1 3300050494 Bacteria 2054
1042 nmdc:mga06z11_68549_c1 3300050494 Bacteria 1870
1043 nmdc:mga07m45_102699_c1 3300050496 Bacteria 1642
1044 nmdc:mga07m45_145902_c1 3300050496 Bacteria 1372
1045 nmdc:mga05p37_150674_c1 3300050507 Bacteria 2845
1046 nmdc:mga05p37_496891_c1 3300050507 Bacteria 1401
1047 nmdc:mga06r32_286815_c1 3300050510 Bacteria 1633
1048 nmdc:mga08y16_104785_c1 3300050511 Bacteria 2944
1049 nmdc:mga08y16_42_c1 3300050511 Bacteria 128353
1050 nmdc:mga08y16_86051_c1 3300050511 Bacteria 3276
1051 nmdc:mga0n895_2522_c1 3300050512 Bacteria 14348
1052 nmdc:mga0n895_687443_c1 3300050512 Bacteria 1020
1053 nmdc:mga0rr50_37517_c1 3300050513 Bacteria 3499
1054 nmdc:mga08x19_229594_c1 3300050514 Bacteria 1277
1055 nmdc:mga08x19_239436_c1 3300050514 Bacteria 1250
1056 nmdc:mga0sz30_25482_c1 3300050516 Bacteria 1683
1057 nmdc:mga0sz30_32419_c1 3300050516 Bacteria 2167
1058 Ga0495601_0071383 3300053077 Bacteria 2217
1059 Ga0495601_0077685 3300053077 Bacteria 2126
1060 Ga0495601_0102088 3300053077 Bacteria 1853
1061 Ga0495612_0151909 3300053078 Bacteria 1008
1062 Ga0500610_0002697 3300053079 Bacteria 6615
1063 Ga0500610_0040047 3300053079 Bacteria 2421
1064 Ga0500635_0001266 3300053080 Bacteria 6035
1065 Ga0495655_0053123 3300053083 Bacteria 1080
1066 Ga0495595_0011980 3300053084 Bacteria 3636
1067 Ga0495619_0000829 3300053085 Bacteria 20282
1068 Ga0495619_0018115 3300053085 Bacteria 4465
1069 Ga0495619_0039802 3300053085 Bacteria 3070
1070 Ga0495619_0118554 3300053085 Bacteria 1813
1071 Ga0495619_0208246 3300053085 Bacteria 1354
1072 Ga0495619_0234646 3300053085 Bacteria 1271
1073 Ga0500578_0077899 3300053086 Bacteria 2110
1074 Ga0500643_000069 3300053087 Bacteria 116366
1075 Ga0500643_013747 3300053087 Bacteria 2843
1076 Ga0500651_0037460 3300053093 Bacteria 3057
1077 Ga0500566_0000043 3300053094 Bacteria 62755
1078 Ga0500566_0000479 3300053094 Bacteria 22269
1079 Ga0500566_0001303 3300053094 Bacteria 14556
1080 Ga0500641_0005452 3300053096 Bacteria 4510
1081 Ga0500641_0006170 3300053096 Bacteria 4249
1082 Ga0500555_005858 3300053103 Bacteria 3486
1083 Ga0500555_016917 3300053103 Bacteria 2102
1084 Ga0500557_000003 3300053105 Bacteria 228429
1085 Ga0500562_017164 3300053108 Bacteria 1864
1086 Ga0500562_030941 3300053108 Bacteria 1411
1087 Ga0500562_046085 3300053108 Bacteria 1162
1088 Ga0500569_027465 3300053109 Bacteria 1568
1089 Ga0500572_001745 3300053111 Bacteria 5639
1090 Ga0500594_0003721 3300053118 Bacteria 3361
1091 Ga0500594_0015719 3300053118 Bacteria 1830
1092 Ga0500594_0072417 3300053118 Bacteria 1016
1093 Ga0500595_000722 3300053119 Bacteria 19637
1094 Ga0500595_001442 3300053119 Bacteria 12692
1095 Ga0500595_004127 3300053119 Bacteria 6589
1096 Ga0500595_049370 3300053119 Bacteria 1311
1097 Ga0500608_013224 3300053122 Bacteria 3651
1098 Ga0500608_018017 3300053122 Bacteria 3216
1099 Ga0500608_021825 3300053122 Bacteria 2962
1100 Ga0500642_0000114 3300053130 Bacteria 37434
1101 Ga0500642_0185555 3300053130 Bacteria 971
1102 Ga0500652_000620 3300053131 Bacteria 12220
1103 Ga0500658_0145375 3300053134 Bacteria 1066
1104 Ga0500559_0001123 3300053136 Bacteria 16112
1105 Ga0500559_0002307 3300053136 Bacteria 10015
1106 Ga0500559_0009193 3300053136 Bacteria 4290
1107 Ga0500559_0030298 3300053136 Bacteria 2319
1108 Ga0500559_0085045 3300053136 Bacteria 1442
1109 Ga0500568_0000331 3300053139 Bacteria 37235
1110 Ga0500573_0053716 3300053140 Bacteria 2314
1111 Ga0500577_0001256 3300053142 Bacteria 6490
1112 Ga0500590_049087 3300053148 Bacteria 2148
1113 Ga0500603_016007 3300053150 Bacteria 1773
1114 Ga0500604_0045811 3300053151 Bacteria 1336
1115 Ga0500616_0007504 3300053153 Bacteria 6910
1116 Ga0500619_013213 3300053154 Bacteria 2182
1117 Ga0500620_016047 3300053155 Bacteria 2132
1118 Ga0500622_0038867 3300053156 Bacteria 2482
1119 Ga0500627_0082826 3300053158 Bacteria 1431
1120 Ga0500630_001851 3300053159 Bacteria 10169
1121 Ga0500633_0037242 3300053160 Bacteria 1614
1122 Ga0500634_0109761 3300053161 Bacteria 1364
1123 Ga0500638_063273 3300053162 Bacteria 1776
1124 Ga0500638_070179 3300053162 Bacteria 1675
1125 Ga0500639_000099 3300053163 Bacteria 40200
1126 Ga0500636_0001860 3300053177 Bacteria 11559
1127 Ga0500636_0004209 3300053177 Bacteria 8147
1128 Ga0500636_0058733 3300053177 Bacteria 2248
1129 Ga0500636_0071286 3300053177 Bacteria 2015
1130 Ga0500637_0185181 3300053178 Bacteria 1191
1131 Ga0500576_052040 3300053725 Bacteria 1813
1132 Ga0500645_033245 3300053730 Bacteria 1544
1133 Ga0500552_001614 3300053733 Bacteria 2147
1134 Ga0500596_005195 3300053735 Bacteria 2316
1135 Ga0500599_006575 3300053736 Bacteria 1482
1136 Ga0500599_008745 3300053736 Bacteria 1319
1137 Ga0500601_000092 3300053737 Bacteria 18784
1138 Ga0501084_0012682 3300054114 Bacteria 6984
1139 Ga0501084_0110470 3300054114 Bacteria 2310
1140 Ga0501082_0099045 3300060353 Bacteria 2520
1141 Ga0501082_0232769 3300060353 Bacteria 1603
1142 Ga0501082_0266726 3300060353 Bacteria 1490
1143 Ga0466962_0061949 3300061719 Bacteria 1786
1144 Ga0466962_0136920 3300061719 Bacteria 1185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0000392 Ga0501032_0000392_12911_13900 275
2 3300049570 Ga0501033_0000232 Ga0501033_0000232_41162_42151 275
3 3300049571 Ga0501034_0000704 Ga0501034_0000704_37053_38042 275
4 3300049572 Ga0501036_0000007 Ga0501036_0000007_190272_191261 275
5 3300049573 Ga0501037_0000066 Ga0501037_0000066_84511_85500 275
6 3300049574 Ga0501038_0000026 Ga0501038_0000026_50567_51556 275
7 3300049575 Ga0501039_0000005 Ga0501039_0000005_60930_61919 275
8 3300049578 Ga0501042_0140884 Ga0501042_0140884_542_1531 275
9 3300049579 Ga0501043_0000036 Ga0501043_0000036_94450_95439 275
10 3300049580 Ga0501046_0000147 Ga0501046_0000147_44383_45372 275
11 3300049581 Ga0501047_0000209 Ga0501047_0000209_19660_20649 275
12 3300049582 Ga0501048_0000460 Ga0501048_0000460_1703_2692 275
13 3300049583 Ga0501067_0038575 Ga0501067_0038575_862_1851 275
14 3300049584 Ga0501068_0000569 Ga0501068_0000569_17760_18749 275
15 3300049586 Ga0501070_0000163 Ga0501070_0000163_46533_47522 275
16 3300049587 Ga0501071_0108835 Ga0501071_0108835_79_1068 275
17 3300049588 Ga0501072_0026856 Ga0501072_0026856_2952_3941 275
18 3300049589 Ga0501073_0000070 Ga0501073_0000070_8898_9887 275
19 3300049590 Ga0501074_0006247 Ga0501074_0006247_7597_8586 275
20 3300049742 Ga0501080_0000137 Ga0501080_0000137_10239_11228 275
21 3300049822 Ga0501035_0000016 Ga0501035_0000016_2913_3902 275
22 3300049823 Ga0501044_0000366 Ga0501044_0000366_43879_44868 275
23 3300026075 Ga0207708_10117705 Ga0207708_101177052 281
24 3300031711 Ga0265314_10140265 Ga0265314_101402652 283
25 3300031241 Ga0265325_10004296 Ga0265325_100042965 288
26 3300039437 Ga0436365_0109783 Ga0436365_0109783_8849_9718 288
27 3300039453 Ga0436362_0928995 Ga0436362_0928995_1095_1964 288
28 3300017792 Ga0163161_10004973 Ga0163161_100049736 290
29 3300046507 Ga0495606_0001881 Ga0495606_0001881_8991_9980 290
30 3300046660 Ga0495625_0001536 Ga0495625_0001536_20366_21355 290
31 3300006844 Ga0075428_100460985 Ga0075428_1004609851 292
32 3300006846 Ga0075430_100344885 Ga0075430_1003448852 292
33 3300006847 Ga0075431_100318778 Ga0075431_1003187782 292
34 3300006871 Ga0075434_100368345 Ga0075434_1003683452 292
35 3300009094 Ga0111539_10030047 Ga0111539_100300473 292
36 3300009147 Ga0114129_10092011 Ga0114129_100920112 292
37 3300014326 Ga0157380_10048809 Ga0157380_100488094 292
38 3300025907 Ga0207645_10072196 Ga0207645_100721962 292
39 3300026089 Ga0207648_10114081 Ga0207648_101140812 292
40 3300027907 Ga0207428_10256890 Ga0207428_102568901 292
41 3300048915 Ga0496112_0631898 Ga0496112_0631898_64_954 292
42 3300050507 nmdc:mga05p37_150674_c1 nmdc:mga05p37_150674_c1_759_1649 292
43 3300050510 nmdc:mga06r32_286815_c1 nmdc:mga06r32_286815_c1_239_1129 292
44 3300050511 nmdc:mga08y16_86051_c1 nmdc:mga08y16_86051_c1_990_1919 292
45 3300050512 nmdc:mga0n895_2522_c1 nmdc:mga0n895_2522_c1_333_1256 292
46 3300050513 nmdc:mga0rr50_37517_c1 nmdc:mga0rr50_37517_c1_792_1715 292
47 3300005334 Ga0068869_100015050 Ga0068869_1000150501 293
48 3300005345 Ga0070692_10060822 Ga0070692_100608222 293
49 3300005438 Ga0070701_10022506 Ga0070701_100225063 293
50 3300005459 Ga0068867_100070765 Ga0068867_1000707652 293
51 3300005544 Ga0070686_100002442 Ga0070686_1000024426 293
52 3300005546 Ga0070696_100012771 Ga0070696_1000127711 293
53 3300005615 Ga0070702_100001701 Ga0070702_1000017014 293
54 3300005844 Ga0068862_100007926 Ga0068862_1000079263 293
55 3300009553 Ga0105249_10026940 Ga0105249_100269404 293
56 3300025934 Ga0207686_10163393 Ga0207686_101633932 293
57 3300025938 Ga0207704_10062387 Ga0207704_100623872 293
58 3300025944 Ga0207661_10260162 Ga0207661_102601622 293
59 3300026118 Ga0207675_100004332 Ga0207675_10000433211 293
60 3300026121 Ga0207683_10020311 Ga0207683_100203112 293
61 3300048920 Ga0496117_0119834 Ga0496117_0119834_290_1198 293
62 3300048928 Ga0496125_0059141 Ga0496125_0059141_1387_2295 293
63 3300049571 Ga0501034_0000487 Ga0501034_0000487_63536_64453 293
64 3300006871 Ga0075434_100004782 Ga0075434_1000047824 294
65 3300007076 Ga0075435_100015198 Ga0075435_1000151982 294
66 3300014325 Ga0163163_10089620 Ga0163163_100896201 294
67 3300026088 Ga0207641_10128613 Ga0207641_101286132 294
68 3300037312 Ga0395899_0132606 Ga0395899_0132606_251_1153 294
69 3300037466 Ga0395898_0309150 Ga0395898_0309150_524_1426 294
70 3300037471 Ga0395905_0005689 Ga0395905_0005689_3527_4429 294
71 3300044712 Ga0453684_0001209 Ga0453684_0001209_51593_52498 294
72 3300044712 Ga0453684_0018189 Ga0453684_0018189_8499_9404 294
73 3300044712 Ga0453684_0397884 Ga0453684_0397884_612_1517 294
74 3300048907 Ga0496104_0082553 Ga0496104_0082553_565_1503 294
75 3300048913 Ga0496110_0018274 Ga0496110_0018274_906_1844 294
76 3300048915 Ga0496112_0180320 Ga0496112_0180320_25_963 294
77 3300005334 Ga0068869_100023837 Ga0068869_1000238375 295
78 3300005354 Ga0070675_100255976 Ga0070675_1002559761 295
79 3300005364 Ga0070673_100408276 Ga0070673_1004082761 295
80 3300005436 Ga0070713_100517810 Ga0070713_1005178101 295
81 3300005440 Ga0070705_100066294 Ga0070705_1000662942 295
82 3300005441 Ga0070700_100002411 Ga0070700_1000024116 295
83 3300005548 Ga0070665_100177949 Ga0070665_1001779492 295
84 3300005617 Ga0068859_100048271 Ga0068859_1000482712 295
85 3300005718 Ga0068866_10002218 Ga0068866_100022186 295
86 3300005719 Ga0068861_100034910 Ga0068861_1000349103 295
87 3300005840 Ga0068870_10029561 Ga0068870_100295612 295
88 3300005840 Ga0068870_10098006 Ga0068870_100980062 295
89 3300005842 Ga0068858_100100635 Ga0068858_1001006353 295
90 3300005843 Ga0068860_100096257 Ga0068860_1000962573 295
91 3300005844 Ga0068862_100332613 Ga0068862_1003326132 295
92 3300006237 Ga0097621_100054607 Ga0097621_1000546072 295
93 3300006358 Ga0068871_100012232 Ga0068871_1000122324 295
94 3300006844 Ga0075428_100013369 Ga0075428_1000133694 295
95 3300006847 Ga0075431_100010844 Ga0075431_1000108446 295
96 3300006931 Ga0097620_100048271 Ga0097620_1000482712 295
97 3300009093 Ga0105240_10002746 Ga0105240_1000274614 295
98 3300009147 Ga0114129_10532211 Ga0114129_105322112 295
99 3300009545 Ga0105237_10002979 Ga0105237_1000297911 295
100 3300010375 Ga0105239_10002039 Ga0105239_1000203911 295
101 3300010375 Ga0105239_10150875 Ga0105239_101508753 295
102 3300013100 Ga0157373_10001338 Ga0157373_100013384 295
103 3300013105 Ga0157369_10006461 Ga0157369_100064616 295
104 3300013297 Ga0157378_10153034 Ga0157378_101530342 295
105 3300013308 Ga0157375_10148248 Ga0157375_101482483 295
106 3300014326 Ga0157380_10112042 Ga0157380_101120423 295
107 3300014969 Ga0157376_10012173 Ga0157376_100121732 295
108 3300025904 Ga0207647_10000406 Ga0207647_1000040620 295
109 3300025908 Ga0207643_10112698 Ga0207643_101126982 295
110 3300025913 Ga0207695_10007868 Ga0207695_100078688 295
111 3300025914 Ga0207671_10028846 Ga0207671_100288462 295
112 3300025919 Ga0207657_10002402 Ga0207657_1000240215 295
113 3300025935 Ga0207709_10095240 Ga0207709_100952402 295
114 3300025938 Ga0207704_10091800 Ga0207704_100918001 295
115 3300025941 Ga0207711_10121288 Ga0207711_101212883 295
116 3300025942 Ga0207689_10000498 Ga0207689_1000049825 295
117 3300025942 Ga0207689_10001020 Ga0207689_100010207 295
118 3300025949 Ga0207667_10003983 Ga0207667_1000398314 295
119 3300025960 Ga0207651_10212524 Ga0207651_102125241 295
120 3300026035 Ga0207703_10108150 Ga0207703_101081502 295
121 3300026075 Ga0207708_10002775 Ga0207708_100027755 295
122 3300042005 Ga0439448_0001260 Ga0439448_0001260_2159_3076 295
123 3300044673 Ga0453683_0107497 Ga0453683_0107497_294_1202 295
124 3300049587 Ga0501071_0135408 Ga0501071_0135408_344_1294 295
125 3300050507 nmdc:mga05p37_496891_c1 nmdc:mga05p37_496891_c1_394_1326 295
126 3300053131 Ga0500652_000620 Ga0500652_000620_1474_2391 295
127 3300003354 JGI25160J50197_1002766 JGI25160J50197_10027666 296
128 3300009094 Ga0111539_10000096 Ga0111539_1000009660 296
129 3300013102 Ga0157371_10086913 Ga0157371_100869132 296
130 3300013307 Ga0157372_10161234 Ga0157372_101612342 296
131 3300025294 Ga0209025_1000224 Ga0209025_1000224115 296
132 3300025297 Ga0209758_1001786 Ga0209758_10017862 296
133 3300025302 Ga0207426_1000151 Ga0207426_1000151148 296
134 3300027907 Ga0207428_10000120 Ga0207428_1000012037 296
135 3300031730 Ga0307516_10056839 Ga0307516_100568394 296
136 3300046689 Ga0495613_0001148 Ga0495613_0001148_1115_2011 296
137 3300049568 Ga0501031_0000368 Ga0501031_0000368_13077_13979 296
138 3300049569 Ga0501032_0000696 Ga0501032_0000696_26179_27081 296
139 3300049570 Ga0501033_0002168 Ga0501033_0002168_10566_11468 296
140 3300049571 Ga0501034_0000039 Ga0501034_0000039_178275_179177 296
141 3300049572 Ga0501036_0000052 Ga0501036_0000052_6965_7867 296
142 3300049573 Ga0501037_0000025 Ga0501037_0000025_80844_81746 296
143 3300049574 Ga0501038_0000168 Ga0501038_0000168_15321_16223 296
144 3300049575 Ga0501039_0001742 Ga0501039_0001742_13348_14250 296
145 3300049578 Ga0501042_0087410 Ga0501042_0087410_1286_2188 296
146 3300049580 Ga0501046_0000231 Ga0501046_0000231_2786_3688 296
147 3300049581 Ga0501047_0000379 Ga0501047_0000379_48267_49169 296
148 3300049582 Ga0501048_0000585 Ga0501048_0000585_18012_18914 296
149 3300049583 Ga0501067_0000025 Ga0501067_0000025_56894_57796 296
150 3300049584 Ga0501068_0000944 Ga0501068_0000944_10578_11480 296
151 3300049585 Ga0501069_0001325 Ga0501069_0001325_169_1071 296
152 3300049587 Ga0501071_0018672 Ga0501071_0018672_2358_3260 296
153 3300049588 Ga0501072_0001295 Ga0501072_0001295_11332_12234 296
154 3300049589 Ga0501073_0000135 Ga0501073_0000135_13243_14145 296
155 3300049590 Ga0501074_0001792 Ga0501074_0001792_6826_7728 296
156 3300049741 Ga0501079_0017767 Ga0501079_0017767_2549_3451 296
157 3300049742 Ga0501080_0001229 Ga0501080_0001229_11269_12171 296
158 3300049744 Ga0501083_0001024 Ga0501083_0001024_10838_11740 296
159 3300049822 Ga0501035_0000052 Ga0501035_0000052_21467_22369 296
160 3300049823 Ga0501044_0000217 Ga0501044_0000217_5412_6314 296
161 3300049824 Ga0501045_0006921 Ga0501045_0006921_5049_5951 296
162 3300050511 nmdc:mga08y16_42_c1 nmdc:mga08y16_42_c1_14454_15356 296
163 3300054114 Ga0501084_0012682 Ga0501084_0012682_5831_6733 296
164 3300060353 Ga0501082_0099045 Ga0501082_0099045_702_1604 296
165 iso_pu_bacteria 2507262055 2507507641 296
166 iso_pu_bacteria 2508501009 2508541758 296
167 iso_pu_bacteria 2508501042 2508692698 296
168 iso_pu_bacteria 2511231028 2511395362 296
169 iso_pu_bacteria 2513237092 2513621845 296
170 iso_pu_bacteria 2513237094 2513636716 296
171 iso_pu_bacteria 2513237095 2513647536 296
172 iso_pu_bacteria 2513237102 2513701493 296
173 iso_pu_bacteria 2513237104 2513721272 296
174 iso_pu_bacteria 2513237139 2513878664 296
175 iso_pu_bacteria 2513237161 2514009409 296
176 iso_pu_bacteria 2515154112 2515626096 296
177 iso_pu_bacteria 2517093001 2517104177 296
178 iso_pu_bacteria 2524023205 2524436260 296
179 iso_pu_bacteria 2528768022 2528848960 296
180 iso_pu_bacteria 2617270735 2617346817 296
181 iso_pu_bacteria 2617270741 2617372749 296
182 iso_pu_bacteria 2744054633 2745080785 296
183 iso_pu_bacteria 2791355196 2793060895 296
184 iso_pu_bacteria 2802429603 2805921313 296
185 iso_pu_bacteria 2816332527 2818236573 296
186 iso_pu_bacteria 2824617872 2824620446 296
187 iso_pu_bacteria 2824626560 2824628506 296
188 iso_pu_bacteria 2824635225 2824637206 296
189 iso_pu_bacteria 2824644064 2824645871 296
190 iso_pu_bacteria 2824661429 2824666147 296
191 iso_pu_bacteria 2824671348 2824678373 296
192 iso_pu_bacteria 2824687955 2824694814 296
193 iso_pu_bacteria 2824696289 2824699603 296
194 iso_pu_bacteria 2824704595 2824711161 296
195 iso_pu_bacteria 2824723954 2824725599 296
196 iso_pu_bacteria 2824732956 2824737206 296
197 iso_pu_bacteria 2824746037 2824748844 296
198 iso_pu_bacteria 2824753945 2824756001 296
199 iso_pu_bacteria 2824763712 2824767539 296
200 iso_pu_bacteria 2824773399 2824775106 296
201 iso_pu_bacteria 2838122688 2838130457 296
202 iso_pu_bacteria 2841941048 2841948106 296
203 iso_pu_bacteria 2841949485 2841953499 296
204 iso_pu_bacteria 2841957949 2841962903 296
205 iso_pu_bacteria 2841966195 2841972023 296
206 iso_pu_bacteria 2841974524 2841978227 296
207 iso_pu_bacteria 2841983080 2841990969 296
208 iso_pu_bacteria 2842038055 2842040670 296
209 iso_pu_bacteria 2842045827 2842046384 296
210 iso_pu_bacteria 2844315083 2844320048 296
211 iso_pu_bacteria 2844533157 2844535928 296
212 iso_pu_bacteria 2847930680 2847937342 296
213 iso_pu_bacteria 2847939898 2847947766 296
214 iso_pu_bacteria 2849076700 2849078373 296
215 iso_pu_bacteria 2857509624 2857512750 296
216 iso_pu_bacteria 2874590934 2874598756 296
217 iso_pu_bacteria 2874612657 2874614551 296
218 iso_pu_bacteria 2874620515 2874628100 296
219 iso_pu_bacteria 2874628541 2874634985 296
220 iso_pu_bacteria 2874645413 2874652212 296
221 iso_pu_bacteria 2876761206 2876771058 296
222 iso_pu_bacteria 2876771140 2876778795 296
223 iso_pu_bacteria 2876818435 2876824310 296
224 iso_pu_bacteria 2879074833 2879082588 296
225 iso_pu_bacteria 2879083081 2879086643 296
226 iso_pu_bacteria 2879099564 2879107156 296
227 iso_pu_bacteria 2879127579 2879131505 296
228 iso_pu_bacteria 2879142872 2879147951 296
229 iso_pu_bacteria 2881364244 2881371437 296
230 iso_pu_bacteria 2881665667 2881666599 296
231 iso_pu_bacteria 2885366525 2885369986 296
232 iso_pu_bacteria 2885409591 2885417874 296
233 iso_pu_bacteria 2888378607 2888385473 296
234 iso_pu_bacteria 2888388044 2888392757 296
235 iso_pu_bacteria 2889306138 2889311895 296
236 iso_pu_bacteria 2902330777 2902335033 296
237 iso_pu_bacteria 2902405164 2902411377 296
238 iso_pu_bacteria 2903727486 2903730278 296
239 iso_pu_bacteria 2904666416 2904674282 296
240 iso_pu_bacteria 2904711408 2904711954 296
241 iso_pu_bacteria 2906602504 2906609873 296
242 iso_pu_bacteria 2906626472 2906629232 296
243 iso_pu_bacteria 2906643746 2906643967 296
244 iso_pu_bacteria 2908775508 2908781193 296
245 iso_pu_bacteria 2922368715 2922372384 296
246 iso_pu_bacteria 2929615660 2929621044 296
247 iso_pu_bacteria 2929624759 2929626125 296
248 iso_pu_bacteria 2932784394 2932784995 296
249 iso_pu_bacteria 2932794094 2932795132 296
250 iso_pu_bacteria 2932801729 2932805660 296
251 iso_pu_bacteria 2932809354 2932810029 296
252 iso_pu_bacteria 2932818245 2932827026 296
253 iso_pu_bacteria 2932828146 2932828832 296
254 iso_pu_bacteria 2933577622 2933583086 296
255 iso_pu_bacteria 2935608549 2935609849 296
256 iso_pu_bacteria 2935616580 2935619748 296
257 iso_pu_bacteria 2935638405 2935638729 296
258 iso_pu_bacteria 2935648319 2935652120 296
259 iso_pu_bacteria 2935656913 2935659907 296
260 iso_pu_bacteria 2935665750 2935666420 296
261 iso_pu_bacteria 2935675223 2935676532 296
262 iso_pu_bacteria 2935684952 2935690795 296
263 iso_pu_bacteria 2935694250 2935694614 296
264 iso_pu_bacteria 2935703347 2935703735 296
265 iso_pu_bacteria 2935713505 2935718176 296
266 iso_pu_bacteria 2935722832 2935727843 296
267 iso_pu_bacteria 2935732158 2935736547 296
268 iso_pu_bacteria 2935741537 2935745926 296
269 iso_pu_bacteria 2935750917 2935756307 296
270 iso_pu_bacteria 2935760218 2935760589 296
271 iso_pu_bacteria 2935769743 2935776977 296
272 iso_pu_bacteria 2935777560 2935783532 296
273 iso_pu_bacteria 2935785616 2935792822 296
274 iso_pu_bacteria 2935793552 2935800830 296
275 iso_pu_bacteria 2935801545 2935801872 296
276 iso_pu_bacteria 2935810662 2935814718 296
277 iso_pu_bacteria 2935819856 2935823010 296
278 iso_pu_bacteria 2935827899 2935828223 296
279 iso_pu_bacteria 2935837841 2935842427 296
280 iso_pu_bacteria 2935847175 2935848592 296
281 iso_pu_bacteria 2935855204 2935857937 296
282 iso_pu_bacteria 2935864058 2935868721 296
283 iso_pu_bacteria 2935873716 2935874136 296
284 iso_pu_bacteria 2935883170 2935883970 296
285 iso_pu_bacteria 2935908558 2935909601 296
286 iso_pu_bacteria 2935916978 2935917326 296
287 iso_pu_bacteria 2935926038 2935927082 296
288 iso_pu_bacteria 2935934488 2935937074 296
289 iso_pu_bacteria 2935942939 2935944623 296
290 iso_pu_bacteria 2935951376 2935953060 296
291 iso_pu_bacteria 2935959822 2935962737 296
292 iso_pu_bacteria 2935967501 2935969900 296
293 iso_pu_bacteria 2935975950 2935976496 296
294 iso_pu_bacteria 2935984226 2935987051 296
295 iso_pu_bacteria 2935992306 2935992939 296
296 iso_pu_bacteria 2936002035 2936002852 296
297 iso_pu_bacteria 2936011229 2936014323 296
298 iso_pu_bacteria 2936019824 2936023837 296
299 iso_pu_bacteria 2936028420 2936031480 296
300 iso_pu_bacteria 2936037263 2936040639 296
301 iso_pu_bacteria 2936046547 2936049429 296
302 iso_pu_bacteria 2936055302 2936062179 296
303 iso_pu_bacteria 2940556831 2940561718 296
304 iso_pu_bacteria 2941531003 2941531231 296
305 iso_pu_bacteria 2941538514 2941542476 296
306 iso_pu_bacteria 3005483717 3005484774 296
307 iso_pu_bacteria 3005506211 3005508412 296
308 iso_pu_bacteria 3005587118 3005588084 296
309 iso_pu_bacteria 3005594810 3005600335 296
310 iso_pu_bacteria 3005710791 3005715827 296
311 iso_pu_bacteria 3005718088 3005723184 296
312 iso_pu_bacteria 8006926726 8006928372 296
313 iso_pu_bacteria 8016511872 8016520637 296
314 iso_pu_bacteria 8016522445 8016528664 296
315 iso_pu_bacteria 8016530956 8016533838 296
316 iso_pu_bacteria 8016539877 8016547061 296
317 iso_pu_bacteria 8016548790 8016555059 296
318 iso_pu_bacteria 8016566248 8016572170 296
319 iso_pu_bacteria 8016575299 8016576369 296
320 iso_pu_bacteria 8016583857 8016594370 296
321 iso_pu_bacteria 8016595262 8016601172 296
322 iso_pu_bacteria 8016613128 8016615633 296
323 iso_pu_bacteria 8016622563 8016625590 296
324 iso_pu_bacteria 8016630954 8016639150 296
325 iso_pu_bacteria 8017057580 8017064942 296
326 iso_pu_bacteria 8019538911 8019546052 296
327 iso_pu_bacteria 8019547302 8019552668 296
328 iso_pu_bacteria 8019576017 8019584320 296
329 iso_pu_bacteria 8019586578 8019592089 296
330 iso_pu_bacteria 8019597564 8019599193 296
331 iso_pu_bacteria 8019608314 8019609163 296
332 iso_pu_bacteria 8019619141 8019619831 296
333 iso_pu_bacteria 8019629233 8019633284 296
334 iso_pu_bacteria 8019648815 8019649385 296
335 iso_pu_bacteria 8019678201 8019685525 296
336 iso_pu_bacteria 8055742211 8055745093 296
337 iso_pu_bacteria 8056967851 8056975045 296
338 3300005548 Ga0070665_100347803 Ga0070665_1003478032 297
339 3300014325 Ga0163163_10777310 Ga0163163_107773101 297
340 3300021358 Ga0213873_10001660 Ga0213873_100016603 297
341 3300021384 Ga0213876_10009083 Ga0213876_100090836 297
342 3300021388 Ga0213875_10002587 Ga0213875_100025878 297
343 3300021388 Ga0213875_10031932 Ga0213875_100319322 297
344 3300031691 Ga0316579_10000229 Ga0316579_1000022915 297
345 3300032133 Ga0316583_10001141 Ga0316583_100011419 297
346 3300037418 Ga0395900_0232358 Ga0395900_0232358_937_1839 297
347 3300037853 Ga0436364_0639208 Ga0436364_0639208_1277_2182 297
348 3300049579 Ga0501043_0175848 Ga0501043_0175848_18_953 297
349 iso_pu_bacteria 2508501128 2509149275 297
350 iso_pu_bacteria 2513237098 2513674808 297
351 iso_pu_bacteria 2513237101 2513697062 297
352 iso_pu_bacteria 2513237141 2513891228 297
353 iso_pu_bacteria 2524023210 2524471222 297
354 iso_pu_bacteria 2643221651 2644290037 297
355 iso_pu_bacteria 2721755755 2723843658 297
356 iso_pu_bacteria 2738543032 2739356732 297
357 iso_pu_bacteria 2791355199 2793083813 297
358 iso_pu_bacteria 2824600985 2824605244 297
359 iso_pu_bacteria 2824609381 2824615563 297
360 iso_pu_bacteria 2824653114 2824656453 297
361 iso_pu_bacteria 2842694124 2842696501 297
362 iso_pu_bacteria 2857524615 2857527020 297
363 iso_pu_bacteria 2874604998 2874607129 297
364 iso_pu_bacteria 2876808645 2876817681 297
365 iso_pu_bacteria 2879110137 2879111890 297
366 iso_pu_bacteria 2885383462 2885387473 297
367 iso_pu_bacteria 2888419890 2888425604 297
368 iso_pu_bacteria 2889033259 2889037986 297
369 iso_pu_bacteria 2893066018 2893068198 297
370 iso_pu_bacteria 2903768456 2903772194 297
371 iso_pu_bacteria 2922361189 2922365991 297
372 iso_pu_bacteria 2922386360 2922386846 297
373 iso_pu_bacteria 8006964411 8006968778 297
374 iso_pu_bacteria 8006984368 8006984463 297
375 iso_pu_bacteria 8006994254 8007000929 297
376 iso_pu_bacteria 8056673599 8056677449 297
377 iso_pu_bacteria 8056681323 8056684768 297
378 iso_pu_bacteria 8056689827 8056690769 297
379 3300003203 JGI25406J46586_10006092 JGI25406J46586_100060922 298
380 3300005344 Ga0070661_100024069 Ga0070661_1000240693 298
381 3300005435 Ga0070714_100049342 Ga0070714_1000493423 298
382 3300005436 Ga0070713_100037885 Ga0070713_1000378854 298
383 3300005937 Ga0081455_10000043 Ga0081455_1000004379 298
384 3300005985 Ga0081539_10006229 Ga0081539_100062297 298
385 3300005985 Ga0081539_10053017 Ga0081539_100530172 298
386 3300006028 Ga0070717_10005810 Ga0070717_100058105 298
387 3300009545 Ga0105237_10238000 Ga0105237_102380002 298
388 3300013308 Ga0157375_10083511 Ga0157375_100835113 298
389 3300025914 Ga0207671_10044648 Ga0207671_100446483 298
390 3300025928 Ga0207700_10013002 Ga0207700_100130024 298
391 3300025929 Ga0207664_10040468 Ga0207664_100404683 298
392 3300026041 Ga0207639_10073699 Ga0207639_100736992 298
393 3300039447 Ga0436361_0265242 Ga0436361_0265242_1771_2679 298
394 3300044656 Ga0466969_0027572 Ga0466969_0027572_753_1667 298
395 3300044683 Ga0466965_0006371 Ga0466965_0006371_2217_3131 298
396 3300044706 Ga0466964_0013052 Ga0466964_0013052_51_965 298
397 3300045049 Ga0466959_0007796 Ga0466959_0007796_2680_3594 298
398 3300049590 Ga0501074_0094574 Ga0501074_0094574_588_1496 298
399 3300049741 Ga0501079_0316818 Ga0501079_0316818_232_1140 298
400 3300049823 Ga0501044_0277867 Ga0501044_0277867_184_1092 298
401 3300053118 Ga0500594_0015719 Ga0500594_0015719_34_948 298
402 3300053119 Ga0500595_001442 Ga0500595_001442_5861_6775 298
403 3300053130 Ga0500642_0185555 Ga0500642_0185555_19_933 298
404 3300053158 Ga0500627_0082826 Ga0500627_0082826_236_1150 298
405 iso_pu_bacteria 2734482264 2735834694 298
406 iso_pu_bacteria 2939669807 2939670458 298
407 3300003203 JGI25406J46586_10003417 JGI25406J46586_100034173 299
408 3300003215 JGI25153J46596_10001884 JGI25153J46596_100018849 299
409 3300003354 JGI25160J50197_1003726 JGI25160J50197_10037263 299
410 3300003354 JGI25160J50197_1006214 JGI25160J50197_10062144 299
411 3300003354 JGI25160J50197_1030839 JGI25160J50197_10308391 299
412 3300003354 JGI25160J50197_1031023 JGI25160J50197_10310232 299
413 3300003659 JGI25404J52841_10007977 JGI25404J52841_100079773 299
414 3300003659 JGI25404J52841_10037615 JGI25404J52841_100376151 299
415 3300003762 Ga0055542_1013235 Ga0055542_10132352 299
416 3300003794 Ga0055531_10008008 Ga0055531_100080084 299
417 3300005262 Ga0065165_1004449 Ga0065165_10044494 299
418 3300005262 Ga0065165_1004595 Ga0065165_10045954 299
419 3300005262 Ga0065165_1005514 Ga0065165_10055144 299
420 3300005337 Ga0070682_100176007 Ga0070682_1001760071 299
421 3300005355 Ga0070671_100036506 Ga0070671_1000365063 299
422 3300005367 Ga0070667_100233170 Ga0070667_1002331701 299
423 3300005435 Ga0070714_100389789 Ga0070714_1003897892 299
424 3300005455 Ga0070663_100057740 Ga0070663_1000577402 299
425 3300005459 Ga0068867_100093789 Ga0068867_1000937892 299
426 3300005539 Ga0068853_100203223 Ga0068853_1002032232 299
427 3300005548 Ga0070665_100043157 Ga0070665_1000431572 299
428 3300005563 Ga0068855_100304107 Ga0068855_1003041072 299
429 3300005563 Ga0068855_100372676 Ga0068855_1003726762 299
430 3300005614 Ga0068856_100410673 Ga0068856_1004106731 299
431 3300005616 Ga0068852_100011643 Ga0068852_1000116436 299
432 3300005841 Ga0068863_100380668 Ga0068863_1003806681 299
433 3300005937 Ga0081455_10011860 Ga0081455_1001186010 299
434 3300005937 Ga0081455_10099099 Ga0081455_100990992 299
435 3300005983 Ga0081540_1004220 Ga0081540_10042205 299
436 3300005983 Ga0081540_1005132 Ga0081540_10051322 299
437 3300005983 Ga0081540_1012953 Ga0081540_10129534 299
438 3300005983 Ga0081540_1025835 Ga0081540_10258354 299
439 3300005985 Ga0081539_10010493 Ga0081539_100104933 299
440 3300006038 Ga0075365_10007730 Ga0075365_100077304 299
441 3300006051 Ga0075364_10046279 Ga0075364_100462793 299
442 3300006195 Ga0075366_10013043 Ga0075366_100130434 299
443 3300006942 Ga0099824_1011798 Ga0099824_10117982 299
444 3300006942 Ga0099824_1013115 Ga0099824_10131154 299
445 3300006943 Ga0099822_1000072 Ga0099822_100007249 299
446 3300009093 Ga0105240_10010472 Ga0105240_100104724 299
447 3300009093 Ga0105240_10571886 Ga0105240_105718862 299
448 3300009148 Ga0105243_10247646 Ga0105243_102476462 299
449 3300009174 Ga0105241_10028754 Ga0105241_100287542 299
450 3300009174 Ga0105241_10034445 Ga0105241_100344453 299
451 3300009177 Ga0105248_10517023 Ga0105248_105170232 299
452 3300009545 Ga0105237_10004025 Ga0105237_1000402514 299
453 3300009545 Ga0105237_10097146 Ga0105237_100971463 299
454 3300010375 Ga0105239_10088799 Ga0105239_100887992 299
455 3300010375 Ga0105239_10601272 Ga0105239_106012721 299
456 3300010375 Ga0105239_10656089 Ga0105239_106560892 299
457 3300010375 Ga0105239_10660041 Ga0105239_106600412 299
458 3300013105 Ga0157369_10039801 Ga0157369_100398013 299
459 3300013105 Ga0157369_10167802 Ga0157369_101678023 299
460 3300013306 Ga0163162_10192939 Ga0163162_101929392 299
461 3300013306 Ga0163162_10459239 Ga0163162_104592391 299
462 3300013307 Ga0157372_10101368 Ga0157372_101013684 299
463 3300013308 Ga0157375_10183660 Ga0157375_101836602 299
464 3300015262 Ga0182007_10034693 Ga0182007_100346932 299
465 3300021320 Ga0214544_1000001 Ga0214544_1000001741 299
466 3300021321 Ga0214542_1000037 Ga0214542_1000037126 299
467 3300021324 Ga0214545_1000003 Ga0214545_100000319 299
468 3300021327 Ga0214543_1003164 Ga0214543_100316419 299
469 3300021384 Ga0213876_10048676 Ga0213876_100486763 299
470 3300021384 Ga0213876_10051082 Ga0213876_100510823 299
471 3300021388 Ga0213875_10002147 Ga0213875_1000214711 299
472 3300025253 Ga0209677_106221 Ga0209677_1062213 299
473 3300025254 Ga0209148_1000699 Ga0209148_100069924 299
474 3300025261 Ga0209233_1002356 Ga0209233_10023566 299
475 3300025261 Ga0209233_1011713 Ga0209233_10117133 299
476 3300025261 Ga0209233_1012838 Ga0209233_10128383 299
477 3300025272 Ga0209455_1004211 Ga0209455_10042113 299
478 3300025295 Ga0209564_1009146 Ga0209564_10091464 299
479 3300025297 Ga0209758_1000011 Ga0209758_1000011348 299
480 3300025297 Ga0209758_1000133 Ga0209758_100013378 299
481 3300025297 Ga0209758_1001858 Ga0209758_100185818 299
482 3300025297 Ga0209758_1002537 Ga0209758_100253713 299
483 3300025297 Ga0209758_1006910 Ga0209758_10069105 299
484 3300025299 Ga0209256_1005335 Ga0209256_10053353 299
485 3300025299 Ga0209256_1035539 Ga0209256_10355391 299
486 3300025302 Ga0207426_1001289 Ga0207426_10012897 299
487 3300025302 Ga0207426_1002137 Ga0207426_100213713 299
488 3300025302 Ga0207426_1002396 Ga0207426_10023965 299
489 3300025304 Ga0209257_1006326 Ga0209257_10063265 299
490 3300025900 Ga0207710_10042705 Ga0207710_100427052 299
491 3300025901 Ga0207688_10131512 Ga0207688_101315122 299
492 3300025901 Ga0207688_10185181 Ga0207688_101851811 299
493 3300025903 Ga0207680_10114777 Ga0207680_101147772 299
494 3300025904 Ga0207647_10019836 Ga0207647_100198365 299
495 3300025911 Ga0207654_10003032 Ga0207654_100030323 299
496 3300025911 Ga0207654_10100931 Ga0207654_101009312 299
497 3300025913 Ga0207695_10000008 Ga0207695_10000008823 299
498 3300025913 Ga0207695_10051139 Ga0207695_100511394 299
499 3300025914 Ga0207671_10004403 Ga0207671_100044038 299
500 3300025914 Ga0207671_10150587 Ga0207671_101505872 299
501 3300025914 Ga0207671_10157263 Ga0207671_101572632 299
502 3300025923 Ga0207681_10151435 Ga0207681_101514352 299
503 3300025924 Ga0207694_10293618 Ga0207694_102936182 299
504 3300025927 Ga0207687_10102387 Ga0207687_101023872 299
505 3300025931 Ga0207644_10099161 Ga0207644_100991612 299
506 3300025933 Ga0207706_10081774 Ga0207706_100817743 299
507 3300025935 Ga0207709_10199986 Ga0207709_101999862 299
508 3300025942 Ga0207689_10156514 Ga0207689_101565142 299
509 3300025949 Ga0207667_10058635 Ga0207667_100586354 299
510 3300025981 Ga0207640_10129322 Ga0207640_101293222 299
511 3300025981 Ga0207640_10236370 Ga0207640_102363702 299
512 3300026067 Ga0207678_10063124 Ga0207678_100631242 299
513 3300026089 Ga0207648_10168528 Ga0207648_101685282 299
514 3300026116 Ga0207674_10205149 Ga0207674_102051493 299
515 3300026142 Ga0207698_10047807 Ga0207698_100478072 299
516 3300026142 Ga0207698_10074151 Ga0207698_100741512 299
517 3300027296 Ga0209389_1000001 Ga0209389_1000001133 299
518 3300027296 Ga0209389_1000014 Ga0209389_1000014163 299
519 3300027357 Ga0209589_1000011 Ga0209589_1000011192 299
520 3300027357 Ga0209589_1000020 Ga0209589_1000020163 299
521 3300027361 Ga0209489_100012 Ga0209489_100012192 299
522 3300027361 Ga0209489_100060 Ga0209489_100060122 299
523 3300027361 Ga0209489_100612 Ga0209489_10061213 299
524 3300027363 Ga0209700_100007 Ga0209700_100007292 299
525 3300027363 Ga0209700_100019 Ga0209700_100019192 299
526 3300028379 Ga0268266_10018792 Ga0268266_100187924 299
527 3300028379 Ga0268266_10303435 Ga0268266_103034352 299
528 3300031838 Ga0307518_10137357 Ga0307518_101373572 299
529 3300033180 Ga0307510_10022493 Ga0307510_100224935 299
530 3300033442 Ga0315911_1000002 Ga0315911_1000002110 299
531 3300035113 Ga0373936_0109198 Ga0373936_0109198_239_1150 299
532 3300035118 Ga0373954_0099424 Ga0373954_0099424_391_1302 299
533 3300035119 Ga0373956_0086044 Ga0373956_0086044_499_1410 299
534 3300035170 Ga0373943_0033284 Ga0373943_0033284_614_1525 299
535 3300035170 Ga0373943_0068086 Ga0373943_0068086_161_1153 299
536 3300035172 Ga0373955_0023258 Ga0373955_0023258_183_1094 299
537 3300035410 Ga0373924_0006636 Ga0373924_0006636_183_1094 299
538 3300035692 Ga0373935_0068682 Ga0373935_0068682_1221_2132 299
539 3300035695 Ga0373927_0061213 Ga0373927_0061213_1238_2149 299
540 3300037068 Ga0373925_0120691 Ga0373925_0120691_940_1851 299
541 3300037068 Ga0373925_0139625 Ga0373925_0139625_208_1200 299
542 3300037312 Ga0395899_0075081 Ga0395899_0075081_492_1409 299
543 3300037312 Ga0395899_0094459 Ga0395899_0094459_977_1888 299
544 3300037418 Ga0395900_0000851 Ga0395900_0000851_22452_23369 299
545 3300037466 Ga0395898_0157231 Ga0395898_0157231_948_1859 299
546 3300037471 Ga0395905_0005304 Ga0395905_0005304_7666_8583 299
547 3300037853 Ga0436364_0416519 Ga0436364_0416519_38677_39603 299
548 3300038443 Ga0395901_0009809 Ga0395901_0009809_698_1615 299
549 3300039437 Ga0436365_0627243 Ga0436365_0627243_1024_1935 299
550 3300044656 Ga0466969_0045804 Ga0466969_0045804_1228_2145 299
551 3300044658 Ga0466972_0000325 Ga0466972_0000325_9271_10188 299
552 3300044658 Ga0466972_0028367 Ga0466972_0028367_992_1909 299
553 3300044683 Ga0466965_0019908 Ga0466965_0019908_1611_2528 299
554 3300044684 Ga0466966_0012258 Ga0466966_0012258_3765_4682 299
555 3300044684 Ga0466966_0118327 Ga0466966_0118327_371_1282 299
556 3300044693 Ga0466961_0000132 Ga0466961_0000132_34237_35154 299
557 3300044693 Ga0466961_0071535 Ga0466961_0071535_619_1530 299
558 3300044694 Ga0466963_0021127 Ga0466963_0021127_2381_3298 299
559 3300044735 Ga0466968_0004242 Ga0466968_0004242_2750_3667 299
560 3300044842 Ga0466957_0045106 Ga0466957_0045106_655_1566 299
561 3300044842 Ga0466957_0108073 Ga0466957_0108073_814_1731 299
562 3300044901 Ga0466960_0007335 Ga0466960_0007335_2531_3448 299
563 3300045049 Ga0466959_0000295 Ga0466959_0000295_24674_25591 299
564 3300045049 Ga0466959_0089733 Ga0466959_0089733_500_1411 299
565 3300045976 Ga0466967_0073807 Ga0466967_0073807_1160_2077 299
566 3300046452 Ga0495617_027153 Ga0495617_027153_155_1072 299
567 3300046454 Ga0495592_0023956 Ga0495592_0023956_2121_3038 299
568 3300046455 Ga0495603_0102118 Ga0495603_0102118_24_941 299
569 3300046459 Ga0495629_0106813 Ga0495629_0106813_126_1118 299
570 3300046460 Ga0495638_0013009 Ga0495638_0013009_1285_2202 299
571 3300046461 Ga0495641_0132254 Ga0495641_0132254_129_1040 299
572 3300046462 Ga0495651_0000271 Ga0495651_0000271_11473_12390 299
573 3300046462 Ga0495651_0023165 Ga0495651_0023165_2775_3692 299
574 3300046472 Ga0495580_0004422 Ga0495580_0004422_2263_3174 299
575 3300046473 Ga0495582_0052261 Ga0495582_0052261_623_1534 299
576 3300046475 Ga0495639_0020094 Ga0495639_0020094_706_1617 299
577 3300046476 Ga0495662_0084561 Ga0495662_0084561_249_1160 299
578 3300046476 Ga0495662_0189151 Ga0495662_0189151_28_945 299
579 3300046477 Ga0495664_0028905 Ga0495664_0028905_789_1706 299
580 3300046477 Ga0495664_0066710 Ga0495664_0066710_613_1524 299
581 3300046511 Ga0495608_0026863 Ga0495608_0026863_1725_2642 299
582 3300046513 Ga0495616_0039835 Ga0495616_0039835_687_1604 299
583 3300046513 Ga0495616_0126353 Ga0495616_0126353_179_1096 299
584 3300046516 Ga0495628_0050238 Ga0495628_0050238_771_1688 299
585 3300046517 Ga0495630_0197713 Ga0495630_0197713_358_1275 299
586 3300046522 Ga0495643_0024447 Ga0495643_0024447_784_1701 299
587 3300046524 Ga0495648_0075054 Ga0495648_0075054_523_1440 299
588 3300046529 Ga0495652_0004764 Ga0495652_0004764_5389_6306 299
589 3300046531 Ga0495665_0165372 Ga0495665_0165372_182_1093 299
590 3300046533 Ga0495640_0010408 Ga0495640_0010408_2798_3715 299
591 3300046535 Ga0495586_0052280 Ga0495586_0052280_719_1630 299
592 3300046536 Ga0495587_0044816 Ga0495587_0044816_680_1597 299
593 3300046543 Ga0495645_0008894 Ga0495645_0008894_1764_2681 299
594 3300046543 Ga0495645_0024316 Ga0495645_0024316_2944_3855 299
595 3300046557 Ga0495622_0008052 Ga0495622_0008052_914_1831 299
596 3300046559 Ga0495667_0010094 Ga0495667_0010094_1960_2877 299
597 3300046559 Ga0495667_0035944 Ga0495667_0035944_1725_2636 299
598 3300046616 Ga0495668_0032597 Ga0495668_0032597_432_1349 299
599 3300046616 Ga0495668_0051728 Ga0495668_0051728_659_1576 299
600 3300046642 Ga0495634_0047380 Ga0495634_0047380_1152_2069 299
601 3300046642 Ga0495634_0053945 Ga0495634_0053945_385_1302 299
602 3300046642 Ga0495634_0074637 Ga0495634_0074637_164_1075 299
603 3300046660 Ga0495625_0084999 Ga0495625_0084999_778_1695 299
604 3300046663 Ga0495635_0015570 Ga0495635_0015570_2106_3023 299
605 3300046663 Ga0495635_0050962 Ga0495635_0050962_1516_2433 299
606 3300046663 Ga0495635_0257922 Ga0495635_0257922_146_1057 299
607 3300046674 Ga0495588_0001382 Ga0495588_0001382_8694_9611 299
608 3300046675 Ga0495657_0003332 Ga0495657_0003332_348_1265 299
609 3300046675 Ga0495657_0054766 Ga0495657_0054766_1722_2639 299
610 3300046678 Ga0495599_0019003 Ga0495599_0019003_600_1517 299
611 3300046679 Ga0495623_0004419 Ga0495623_0004419_3051_3968 299
612 3300046680 Ga0495646_0025141 Ga0495646_0025141_1092_2003 299
613 3300046680 Ga0495646_0043300 Ga0495646_0043300_351_1268 299
614 3300046681 Ga0495647_0042605 Ga0495647_0042605_397_1308 299
615 3300046683 Ga0495658_0019954 Ga0495658_0019954_1745_2656 299
616 3300046689 Ga0495613_0052618 Ga0495613_0052618_565_1482 299
617 3300046689 Ga0495613_0269400 Ga0495613_0269400_88_1005 299
618 3300046690 Ga0495624_0119709 Ga0495624_0119709_668_1579 299
619 3300046692 Ga0495671_0124526 Ga0495671_0124526_65_982 299
620 3300046694 Ga0495649_0040650 Ga0495649_0040650_498_1415 299
621 3300046809 Ga0495600_0001932 Ga0495600_0001932_8983_9900 299
622 3300046809 Ga0495600_0030740 Ga0495600_0030740_45_962 299
623 3300047315 Ga0495581_0007817 Ga0495581_0007817_1133_2044 299
624 3300047317 Ga0495604_0002485 Ga0495604_0002485_1295_2212 299
625 3300047317 Ga0495604_0004984 Ga0495604_0004984_8175_9092 299
626 3300047317 Ga0495604_0121713 Ga0495604_0121713_918_1829 299
627 3300047319 Ga0495674_0013696 Ga0495674_0013696_1487_2404 299
628 3300047319 Ga0495674_0041838 Ga0495674_0041838_2701_3612 299
629 3300047321 Ga0495676_0033175 Ga0495676_0033175_2422_3339 299
630 3300047322 Ga0495680_0001198 Ga0495680_0001198_22404_23321 299
631 3300047323 Ga0495683_0021057 Ga0495683_0021057_1511_2428 299
632 3300047443 Ga0495687_025008 Ga0495687_025008_754_1671 299
633 3300047444 Ga0495675_0003907 Ga0495675_0003907_7576_8493 299
634 3300047444 Ga0495675_0206245 Ga0495675_0206245_70_987 299
635 3300047471 Ga0495684_0025140 Ga0495684_0025140_369_1280 299
636 3300047471 Ga0495684_0117110 Ga0495684_0117110_137_1054 299
637 3300047472 Ga0495686_0119814 Ga0495686_0119814_180_1097 299
638 3300047673 Ga0495593_0031542 Ga0495593_0031542_493_1404 299
639 3300047673 Ga0495593_0074513 Ga0495593_0074513_609_1526 299
640 3300048088 Ga0495602_0001578 Ga0495602_0001578_13302_14219 299
641 3300048088 Ga0495602_0015304 Ga0495602_0015304_43_960 299
642 3300048089 Ga0495614_0088486 Ga0495614_0088486_402_1313 299
643 3300048089 Ga0495614_0177202 Ga0495614_0177202_19_936 299
644 3300048903 Ga0496100_0077186 Ga0496100_0077186_745_1662 299
645 3300048904 Ga0496101_0161563 Ga0496101_0161563_149_1066 299
646 3300048905 Ga0496102_0056022 Ga0496102_0056022_1148_2065 299
647 3300048907 Ga0496104_0001744 Ga0496104_0001744_6444_7361 299
648 3300048907 Ga0496104_0078243 Ga0496104_0078243_1316_2233 299
649 3300048908 Ga0496105_0002142 Ga0496105_0002142_980_1897 299
650 3300048910 Ga0496107_0011833 Ga0496107_0011833_330_1247 299
651 3300048911 Ga0496108_0127426 Ga0496108_0127426_668_1585 299
652 3300048912 Ga0496109_0037911 Ga0496109_0037911_1754_2671 299
653 3300048913 Ga0496110_0150182 Ga0496110_0150182_659_1576 299
654 3300048913 Ga0496110_0224236 Ga0496110_0224236_14_931 299
655 3300048914 Ga0496111_0192179 Ga0496111_0192179_98_1015 299
656 3300048914 Ga0496111_0314913 Ga0496111_0314913_56_973 299
657 3300048916 Ga0496113_0081737 Ga0496113_0081737_415_1332 299
658 3300048916 Ga0496113_0174718 Ga0496113_0174718_112_1077 299
659 3300048916 Ga0496113_0395442 Ga0496113_0395442_60_977 299
660 3300048917 Ga0496114_0135248 Ga0496114_0135248_1195_2112 299
661 3300048918 Ga0496115_0067618 Ga0496115_0067618_775_1692 299
662 3300048919 Ga0496116_0027016 Ga0496116_0027016_945_1862 299
663 3300048920 Ga0496117_0100523 Ga0496117_0100523_493_1410 299
664 3300048921 Ga0496118_0076350 Ga0496118_0076350_594_1511 299
665 3300048921 Ga0496118_0129688 Ga0496118_0129688_275_1192 299
666 3300048922 Ga0496119_0096025 Ga0496119_0096025_592_1509 299
667 3300048923 Ga0496120_0009024 Ga0496120_0009024_4676_5593 299
668 3300048923 Ga0496120_0079037 Ga0496120_0079037_273_1190 299
669 3300048923 Ga0496120_0101831 Ga0496120_0101831_232_1149 299
670 3300048924 Ga0496121_0025495 Ga0496121_0025495_3112_4029 299
671 3300048924 Ga0496121_0103153 Ga0496121_0103153_331_1242 299
672 3300048924 Ga0496121_0108787 Ga0496121_0108787_97_1014 299
673 3300048927 Ga0496124_0069807 Ga0496124_0069807_846_1763 299
674 3300048927 Ga0496124_0105539 Ga0496124_0105539_879_1796 299
675 3300048928 Ga0496125_0052034 Ga0496125_0052034_1920_2837 299
676 3300048928 Ga0496125_0103617 Ga0496125_0103617_225_1142 299
677 3300048929 Ga0496126_0020645 Ga0496126_0020645_1246_2163 299
678 3300048929 Ga0496126_0122534 Ga0496126_0122534_1236_2153 299
679 3300048929 Ga0496126_0131606 Ga0496126_0131606_628_1545 299
680 3300048929 Ga0496126_0215692 Ga0496126_0215692_67_984 299
681 3300048929 Ga0496126_0235250 Ga0496126_0235250_552_1469 299
682 3300049571 Ga0501034_0251834 Ga0501034_0251834_558_1553 299
683 3300049741 Ga0501079_0299247 Ga0501079_0299247_327_1238 299
684 3300050491 nmdc:mga00v17_110651_c1 nmdc:mga00v17_110651_c1_433_1350 299
685 3300050492 nmdc:mga0yw44_160354_c1 nmdc:mga0yw44_160354_c1_153_1070 299
686 3300050493 nmdc:mga0k408_13681_c1 nmdc:mga0k408_13681_c1_482_1399 299
687 3300050494 nmdc:mga06z11_68549_c1 nmdc:mga06z11_68549_c1_365_1297 299
688 3300050512 nmdc:mga0n895_687443_c1 nmdc:mga0n895_687443_c1_35_946 299
689 3300050514 nmdc:mga08x19_239436_c1 nmdc:mga08x19_239436_c1_103_1014 299
690 3300050516 nmdc:mga0sz30_32419_c1 nmdc:mga0sz30_32419_c1_841_1758 299
691 3300053077 Ga0495601_0102088 Ga0495601_0102088_870_1781 299
692 3300053078 Ga0495612_0151909 Ga0495612_0151909_73_984 299
693 3300053079 Ga0500610_0040047 Ga0500610_0040047_770_1687 299
694 3300053085 Ga0495619_0208246 Ga0495619_0208246_205_1116 299
695 3300053086 Ga0500578_0077899 Ga0500578_0077899_556_1473 299
696 3300053087 Ga0500643_000069 Ga0500643_000069_81941_82858 299
697 3300053094 Ga0500566_0000479 Ga0500566_0000479_11712_12629 299
698 3300053103 Ga0500555_005858 Ga0500555_005858_607_1524 299
699 3300053105 Ga0500557_000003 Ga0500557_000003_59994_60911 299
700 3300053122 Ga0500608_021825 Ga0500608_021825_363_1280 299
701 3300053130 Ga0500642_0000114 Ga0500642_0000114_24250_25167 299
702 3300053136 Ga0500559_0085045 Ga0500559_0085045_131_1048 299
703 3300053148 Ga0500590_049087 Ga0500590_049087_222_1139 299
704 3300053154 Ga0500619_013213 Ga0500619_013213_174_1091 299
705 3300053155 Ga0500620_016047 Ga0500620_016047_531_1448 299
706 3300053156 Ga0500622_0038867 Ga0500622_0038867_396_1313 299
707 3300053162 Ga0500638_070179 Ga0500638_070179_508_1425 299
708 3300053177 Ga0500636_0001860 Ga0500636_0001860_907_1824 299
709 3300053177 Ga0500636_0071286 Ga0500636_0071286_51_968 299
710 3300053733 Ga0500552_001614 Ga0500552_001614_450_1367 299
711 3300053736 Ga0500599_008745 Ga0500599_008745_121_1038 299
712 3300053737 Ga0500601_000092 Ga0500601_000092_6915_7832 299
713 3300061719 Ga0466962_0061949 Ga0466962_0061949_624_1541 299
714 3300061719 Ga0466962_0136920 Ga0466962_0136920_153_1064 299
715 iso_pu_bacteria 2517572143 2517891313 299
716 iso_pu_bacteria 2935732158 2935733556 299
717 3300003215 JGI25153J46596_10000952 JGI25153J46596_100009522 300
718 3300003659 JGI25404J52841_10026578 JGI25404J52841_100265781 300
719 3300003752 Ga0055539_1002463 Ga0055539_10024632 300
720 3300005329 Ga0070683_100005150 Ga0070683_1000051505 300
721 3300005334 Ga0068869_100058281 Ga0068869_1000582814 300
722 3300005336 Ga0070680_100014277 Ga0070680_1000142775 300
723 3300005336 Ga0070680_100395881 Ga0070680_1003958811 300
724 3300005337 Ga0070682_100116584 Ga0070682_1001165842 300
725 3300005340 Ga0070689_100106246 Ga0070689_1001062462 300
726 3300005347 Ga0070668_100037793 Ga0070668_1000377933 300
727 3300005347 Ga0070668_100083103 Ga0070668_1000831033 300
728 3300005347 Ga0070668_100232245 Ga0070668_1002322452 300
729 3300005347 Ga0070668_100512793 Ga0070668_1005127931 300
730 3300005355 Ga0070671_100261884 Ga0070671_1002618842 300
731 3300005366 Ga0070659_100117117 Ga0070659_1001171172 300
732 3300005367 Ga0070667_100184773 Ga0070667_1001847732 300
733 3300005367 Ga0070667_100260544 Ga0070667_1002605442 300
734 3300005434 Ga0070709_10000900 Ga0070709_100009003 300
735 3300005435 Ga0070714_100039125 Ga0070714_1000391253 300
736 3300005436 Ga0070713_100003714 Ga0070713_1000037146 300
737 3300005436 Ga0070713_100006598 Ga0070713_1000065985 300
738 3300005436 Ga0070713_100030680 Ga0070713_1000306802 300
739 3300005436 Ga0070713_100609448 Ga0070713_1006094481 300
740 3300005437 Ga0070710_10000221 Ga0070710_1000022125 300
741 3300005439 Ga0070711_100002818 Ga0070711_1000028186 300
742 3300005439 Ga0070711_100011819 Ga0070711_1000118193 300
743 3300005439 Ga0070711_100037529 Ga0070711_1000375292 300
744 3300005439 Ga0070711_100133917 Ga0070711_1001339172 300
745 3300005441 Ga0070700_100127190 Ga0070700_1001271902 300
746 3300005455 Ga0070663_100026611 Ga0070663_1000266113 300
747 3300005455 Ga0070663_100267226 Ga0070663_1002672262 300
748 3300005455 Ga0070663_100345222 Ga0070663_1003452222 300
749 3300005456 Ga0070678_100064537 Ga0070678_1000645373 300
750 3300005456 Ga0070678_100101721 Ga0070678_1001017213 300
751 3300005457 Ga0070662_100162508 Ga0070662_1001625081 300
752 3300005457 Ga0070662_100365725 Ga0070662_1003657251 300
753 3300005466 Ga0070685_10175755 Ga0070685_101757551 300
754 3300005530 Ga0070679_100079100 Ga0070679_1000791003 300
755 3300005535 Ga0070684_100003497 Ga0070684_1000034975 300
756 3300005539 Ga0068853_100312664 Ga0068853_1003126642 300
757 3300005543 Ga0070672_100121938 Ga0070672_1001219382 300
758 3300005543 Ga0070672_100242415 Ga0070672_1002424152 300
759 3300005544 Ga0070686_100211036 Ga0070686_1002110362 300
760 3300005548 Ga0070665_100062271 Ga0070665_1000622712 300
761 3300005548 Ga0070665_100141313 Ga0070665_1001413132 300
762 3300005548 Ga0070665_100147619 Ga0070665_1001476191 300
763 3300005563 Ga0068855_100279475 Ga0068855_1002794751 300
764 3300005564 Ga0070664_100196369 Ga0070664_1001963692 300
765 3300005578 Ga0068854_100062848 Ga0068854_1000628482 300
766 3300005578 Ga0068854_100081760 Ga0068854_1000817603 300
767 3300005614 Ga0068856_100009329 Ga0068856_1000093294 300
768 3300005614 Ga0068856_100036241 Ga0068856_1000362414 300
769 3300005614 Ga0068856_100221455 Ga0068856_1002214552 300
770 3300005614 Ga0068856_100237100 Ga0068856_1002371002 300
771 3300005719 Ga0068861_100059216 Ga0068861_1000592164 300
772 3300005719 Ga0068861_100169834 Ga0068861_1001698342 300
773 3300005841 Ga0068863_100380715 Ga0068863_1003807152 300
774 3300005842 Ga0068858_100099471 Ga0068858_1000994713 300
775 3300005842 Ga0068858_100137131 Ga0068858_1001371312 300
776 3300005843 Ga0068860_100000081 Ga0068860_10000008145 300
777 3300005843 Ga0068860_100221004 Ga0068860_1002210042 300
778 3300005843 Ga0068860_100499257 Ga0068860_1004992572 300
779 3300005844 Ga0068862_100131326 Ga0068862_1001313262 300
780 3300005937 Ga0081455_10052548 Ga0081455_100525483 300
781 3300005937 Ga0081455_10082536 Ga0081455_100825362 300
782 3300005981 Ga0081538_10066586 Ga0081538_100665862 300
783 3300005983 Ga0081540_1000884 Ga0081540_10008845 300
784 3300005983 Ga0081540_1003783 Ga0081540_10037833 300
785 3300005983 Ga0081540_1014508 Ga0081540_10145084 300
786 3300005983 Ga0081540_1019658 Ga0081540_10196581 300
787 3300005985 Ga0081539_10063223 Ga0081539_100632232 300
788 3300006028 Ga0070717_10003635 Ga0070717_100036357 300
789 3300006028 Ga0070717_10292090 Ga0070717_102920902 300
790 3300006048 Ga0075363_100017124 Ga0075363_1000171242 300
791 3300006048 Ga0075363_100072858 Ga0075363_1000728582 300
792 3300006051 Ga0075364_10329003 Ga0075364_103290031 300
793 3300006163 Ga0070715_10001911 Ga0070715_100019113 300
794 3300006173 Ga0070716_100001730 Ga0070716_1000017304 300
795 3300006175 Ga0070712_100021309 Ga0070712_1000213092 300
796 3300006178 Ga0075367_10060179 Ga0075367_100601792 300
797 3300006195 Ga0075366_10095579 Ga0075366_100955792 300
798 3300006353 Ga0075370_10044333 Ga0075370_100443333 300
799 3300006353 Ga0075370_10141513 Ga0075370_101415131 300
800 3300006881 Ga0068865_100043959 Ga0068865_1000439593 300
801 3300007265 Ga0099794_10122087 Ga0099794_101220871 300
802 3300007788 Ga0099795_10022343 Ga0099795_100223432 300
803 3300007788 Ga0099795_10104640 Ga0099795_101046401 300
804 3300009093 Ga0105240_10052653 Ga0105240_100526532 300
805 3300009093 Ga0105240_10306338 Ga0105240_103063382 300
806 3300009094 Ga0111539_10076396 Ga0111539_100763962 300
807 3300009098 Ga0105245_10021491 Ga0105245_100214914 300
808 3300009101 Ga0105247_10310904 Ga0105247_103109041 300
809 3300009148 Ga0105243_10542532 Ga0105243_105425321 300
810 3300009177 Ga0105248_10117215 Ga0105248_101172154 300
811 3300009545 Ga0105237_10043095 Ga0105237_100430952 300
812 3300009545 Ga0105237_10508237 Ga0105237_105082372 300
813 3300009551 Ga0105238_10098901 Ga0105238_100989012 300
814 3300009551 Ga0105238_10275191 Ga0105238_102751912 300
815 3300009765 Ga0123341_1000054 Ga0123341_100005417 300
816 3300010375 Ga0105239_10224672 Ga0105239_102246723 300
817 3300011119 Ga0105246_10020341 Ga0105246_100203412 300
818 3300011119 Ga0105246_10232918 Ga0105246_102329181 300
819 3300013105 Ga0157369_10017188 Ga0157369_100171885 300
820 3300013296 Ga0157374_10418799 Ga0157374_104187992 300
821 3300013297 Ga0157378_10246331 Ga0157378_102463312 300
822 3300013306 Ga0163162_10118943 Ga0163162_101189433 300
823 3300013308 Ga0157375_10058051 Ga0157375_100580513 300
824 3300014325 Ga0163163_10045337 Ga0163163_100453374 300
825 3300014969 Ga0157376_10148203 Ga0157376_101482031 300
826 3300014969 Ga0157376_10156358 Ga0157376_101563582 300
827 3300021384 Ga0213876_10157207 Ga0213876_101572071 300
828 3300025253 Ga0209677_100908 Ga0209677_1009084 300
829 3300025261 Ga0209233_1001449 Ga0209233_10014495 300
830 3300025295 Ga0209564_1001822 Ga0209564_100182214 300
831 3300025297 Ga0209758_1011139 Ga0209758_10111395 300
832 3300025321 Ga0207656_10048015 Ga0207656_100480152 300
833 3300025898 Ga0207692_10000364 Ga0207692_1000036412 300
834 3300025898 Ga0207692_10005642 Ga0207692_100056422 300
835 3300025901 Ga0207688_10108501 Ga0207688_101085012 300
836 3300025901 Ga0207688_10184203 Ga0207688_101842031 300
837 3300025906 Ga0207699_10000319 Ga0207699_1000031913 300
838 3300025906 Ga0207699_10002988 Ga0207699_100029885 300
839 3300025912 Ga0207707_10000378 Ga0207707_1000037823 300
840 3300025912 Ga0207707_10080028 Ga0207707_100800283 300
841 3300025913 Ga0207695_10158677 Ga0207695_101586773 300
842 3300025913 Ga0207695_10207041 Ga0207695_102070412 300
843 3300025914 Ga0207671_10086765 Ga0207671_100867652 300
844 3300025914 Ga0207671_10211504 Ga0207671_102115042 300
845 3300025914 Ga0207671_10389942 Ga0207671_103899421 300
846 3300025915 Ga0207693_10009252 Ga0207693_100092528 300
847 3300025915 Ga0207693_10043239 Ga0207693_100432392 300
848 3300025916 Ga0207663_10000417 Ga0207663_1000041712 300
849 3300025916 Ga0207663_10015030 Ga0207663_100150304 300
850 3300025916 Ga0207663_10328661 Ga0207663_103286611 300
851 3300025917 Ga0207660_10372938 Ga0207660_103729381 300
852 3300025921 Ga0207652_10004828 Ga0207652_100048281 300
853 3300025921 Ga0207652_10186135 Ga0207652_101861352 300
854 3300025927 Ga0207687_10046879 Ga0207687_100468793 300
855 3300025927 Ga0207687_10119174 Ga0207687_101191742 300
856 3300025928 Ga0207700_10025289 Ga0207700_100252895 300
857 3300025928 Ga0207700_10081431 Ga0207700_100814313 300
858 3300025928 Ga0207700_10252975 Ga0207700_102529752 300
859 3300025931 Ga0207644_10446221 Ga0207644_104462211 300
860 3300025935 Ga0207709_10295360 Ga0207709_102953602 300
861 3300025937 Ga0207669_10211307 Ga0207669_102113071 300
862 3300025938 Ga0207704_10238137 Ga0207704_102381372 300
863 3300025938 Ga0207704_10288326 Ga0207704_102883262 300
864 3300025939 Ga0207665_10000190 Ga0207665_1000019011 300
865 3300025939 Ga0207665_10016066 Ga0207665_100160664 300
866 3300025940 Ga0207691_10079196 Ga0207691_100791962 300
867 3300025940 Ga0207691_10115388 Ga0207691_101153882 300
868 3300025940 Ga0207691_10167890 Ga0207691_101678902 300
869 3300025941 Ga0207711_10335540 Ga0207711_103355402 300
870 3300025942 Ga0207689_10013133 Ga0207689_100131335 300
871 3300025942 Ga0207689_10112409 Ga0207689_101124092 300
872 3300025944 Ga0207661_10000217 Ga0207661_1000021721 300
873 3300025944 Ga0207661_10007635 Ga0207661_100076356 300
874 3300025945 Ga0207679_10031445 Ga0207679_100314452 300
875 3300025949 Ga0207667_10122118 Ga0207667_101221182 300
876 3300025949 Ga0207667_10293395 Ga0207667_102933952 300
877 3300025960 Ga0207651_10181677 Ga0207651_101816772 300
878 3300025972 Ga0207668_10059335 Ga0207668_100593352 300
879 3300025972 Ga0207668_10061439 Ga0207668_100614392 300
880 3300025981 Ga0207640_10136772 Ga0207640_101367721 300
881 3300025981 Ga0207640_10160435 Ga0207640_101604351 300
882 3300025986 Ga0207658_10145331 Ga0207658_101453313 300
883 3300025986 Ga0207658_10306924 Ga0207658_103069241 300
884 3300026023 Ga0207677_10066181 Ga0207677_100661812 300
885 3300026035 Ga0207703_10039547 Ga0207703_100395473 300
886 3300026041 Ga0207639_10107575 Ga0207639_101075752 300
887 3300026041 Ga0207639_10405447 Ga0207639_104054471 300
888 3300026067 Ga0207678_10048644 Ga0207678_100486442 300
889 3300026067 Ga0207678_10068316 Ga0207678_100683163 300
890 3300026067 Ga0207678_10125182 Ga0207678_101251822 300
891 3300026067 Ga0207678_10232327 Ga0207678_102323272 300
892 3300026075 Ga0207708_10174169 Ga0207708_101741691 300
893 3300026078 Ga0207702_10000779 Ga0207702_1000077923 300
894 3300026078 Ga0207702_10691314 Ga0207702_106913141 300
895 3300026089 Ga0207648_10167678 Ga0207648_101676782 300
896 3300026116 Ga0207674_10109148 Ga0207674_101091483 300
897 3300026118 Ga0207675_100772183 Ga0207675_1007721831 300
898 3300026121 Ga0207683_10008222 Ga0207683_100082226 300
899 3300026121 Ga0207683_10031453 Ga0207683_100314533 300
900 3300026121 Ga0207683_10112708 Ga0207683_101127082 300
901 3300026121 Ga0207683_10148222 Ga0207683_101482222 300
902 3300027671 Ga0209588_1051125 Ga0209588_10511251 300
903 3300028379 Ga0268266_10001082 Ga0268266_100010824 300
904 3300028379 Ga0268266_10020256 Ga0268266_100202564 300
905 3300028379 Ga0268266_10068666 Ga0268266_100686662 300
906 3300028379 Ga0268266_10142512 Ga0268266_101425122 300
907 3300028379 Ga0268266_10177582 Ga0268266_101775823 300
908 3300028379 Ga0268266_10186986 Ga0268266_101869862 300
909 3300028380 Ga0268265_10209060 Ga0268265_102090601 300
910 3300028381 Ga0268264_10000048 Ga0268264_1000004842 300
911 3300028556 Ga0265337_1006052 Ga0265337_10060525 300
912 3300028558 Ga0265326_10003632 Ga0265326_100036323 300
913 3300028563 Ga0265319_1009562 Ga0265319_10095623 300
914 3300028573 Ga0265334_10018461 Ga0265334_100184613 300
915 3300028577 Ga0265318_10014529 Ga0265318_100145293 300
916 3300028653 Ga0265323_10002008 Ga0265323_100020088 300
917 3300028654 Ga0265322_10022080 Ga0265322_100220801 300
918 3300028666 Ga0265336_10002276 Ga0265336_100022763 300
919 3300028786 Ga0307517_10004833 Ga0307517_1000483313 300
920 3300028794 Ga0307515_10025331 Ga0307515_100253315 300
921 3300028794 Ga0307515_10343633 Ga0307515_103436331 300
922 3300028800 Ga0265338_10007046 Ga0265338_100070466 300
923 3300029957 Ga0265324_10012696 Ga0265324_100126961 300
924 3300030521 Ga0307511_10059327 Ga0307511_100593272 300
925 3300031235 Ga0265330_10008271 Ga0265330_100082715 300
926 3300031238 Ga0265332_10006592 Ga0265332_100065925 300
927 3300031238 Ga0265332_10011731 Ga0265332_100117313 300
928 3300031247 Ga0265340_10003690 Ga0265340_100036903 300
929 3300031250 Ga0265331_10014784 Ga0265331_100147842 300
930 3300031456 Ga0307513_10084452 Ga0307513_100844523 300
931 3300031507 Ga0307509_10009225 Ga0307509_1000922510 300
932 3300031507 Ga0307509_10082147 Ga0307509_100821472 300
933 3300031616 Ga0307508_10288874 Ga0307508_102888741 300
934 3300031711 Ga0265314_10002744 Ga0265314_100027446 300
935 3300031711 Ga0265314_10012438 Ga0265314_100124387 300
936 3300031712 Ga0265342_10057586 Ga0265342_100575864 300
937 3300031730 Ga0307516_10033133 Ga0307516_100331333 300
938 3300031730 Ga0307516_10064792 Ga0307516_100647925 300
939 3300031824 Ga0307413_10055476 Ga0307413_100554762 300
940 3300031824 Ga0307413_10176186 Ga0307413_101761862 300
941 3300031995 Ga0307409_100325739 Ga0307409_1003257391 300
942 3300031995 Ga0307409_100552428 Ga0307409_1005524281 300
943 3300032002 Ga0307416_100324786 Ga0307416_1003247862 300
944 3300033179 Ga0307507_10007449 Ga0307507_1000744915 300
945 3300033180 Ga0307510_10063819 Ga0307510_100638193 300
946 3300034820 Ga0373959_0033648 Ga0373959_0033648_14_928 300
947 3300035086 Ga0373934_0016121 Ga0373934_0016121_918_1838 300
948 3300035111 Ga0373923_0000289 Ga0373923_0000289_6052_6972 300
949 3300035113 Ga0373936_0015885 Ga0373936_0015885_1526_2440 300
950 3300035113 Ga0373936_0148917 Ga0373936_0148917_61_975 300
951 3300035117 Ga0373953_0019685 Ga0373953_0019685_845_1765 300
952 3300035118 Ga0373954_0015594 Ga0373954_0015594_1741_2661 300
953 3300035119 Ga0373956_0010705 Ga0373956_0010705_1575_2495 300
954 3300035120 Ga0373957_0009960 Ga0373957_0009960_1194_2114 300
955 3300035171 Ga0373946_0003713 Ga0373946_0003713_2697_3617 300
956 3300035172 Ga0373955_0092995 Ga0373955_0092995_43_963 300
957 3300035172 Ga0373955_0287716 Ga0373955_0287716_32_958 300
958 3300035410 Ga0373924_0012573 Ga0373924_0012573_669_1589 300
959 3300035692 Ga0373935_0000499 Ga0373935_0000499_18193_19113 300
960 3300035692 Ga0373935_0039296 Ga0373935_0039296_250_1164 300
961 3300035695 Ga0373927_0000437 Ga0373927_0000437_651_1571 300
962 3300035724 Ga0373933_0001296 Ga0373933_0001296_13015_13935 300
963 3300035724 Ga0373933_0001914 Ga0373933_0001914_8322_9242 300
964 3300035724 Ga0373933_0028125 Ga0373933_0028125_153_1079 300
965 3300035724 Ga0373933_0127537 Ga0373933_0127537_279_1193 300
966 3300035725 Ga0373947_0001481 Ga0373947_0001481_11245_12165 300
967 3300035725 Ga0373947_0104142 Ga0373947_0104142_599_1513 300
968 3300035725 Ga0373947_0139127 Ga0373947_0139127_318_1232 300
969 3300036401 Ga0373937_0004047 Ga0373937_0004047_4478_5398 300
970 3300036401 Ga0373937_0014169 Ga0373937_0014169_487_1407 300
971 3300036401 Ga0373937_0113131 Ga0373937_0113131_857_1783 300
972 3300036459 Ga0372808_015058 Ga0372808_015058_127_1041 300
973 3300037068 Ga0373925_0010291 Ga0373925_0010291_4112_5032 300
974 3300037068 Ga0373925_0062730 Ga0373925_0062730_59_1183 300
975 3300037068 Ga0373925_0063599 Ga0373925_0063599_1046_1960 300
976 3300037068 Ga0373925_0139802 Ga0373925_0139802_719_1633 300
977 3300037312 Ga0395899_0166010 Ga0395899_0166010_133_1050 300
978 3300037466 Ga0395898_0047986 Ga0395898_0047986_96_1010 300
979 3300037466 Ga0395898_0167177 Ga0395898_0167177_629_1543 300
980 3300037471 Ga0395905_0070968 Ga0395905_0070968_1894_2808 300
981 3300037853 Ga0436364_1189271 Ga0436364_1189271_927_1841 300
982 3300038443 Ga0395901_0116985 Ga0395901_0116985_1486_2400 300
983 3300039437 Ga0436365_0802449 Ga0436365_0802449_88_1002 300
984 3300039437 Ga0436365_1890002 Ga0436365_1890002_125_1039 300
985 3300039447 Ga0436361_0989106 Ga0436361_0989106_132_1046 300
986 3300039453 Ga0436362_0328324 Ga0436362_0328324_1367_2281 300
987 3300044656 Ga0466969_0038255 Ga0466969_0038255_1252_2166 300
988 3300045976 Ga0466967_0021340 Ga0466967_0021340_152_1066 300
989 3300045976 Ga0466967_0344879 Ga0466967_0344879_468_1382 300
990 3300046452 Ga0495617_052860 Ga0495617_052860_239_1153 300
991 3300046454 Ga0495592_0003354 Ga0495592_0003354_1436_2356 300
992 3300046454 Ga0495592_0018326 Ga0495592_0018326_2600_3520 300
993 3300046454 Ga0495592_0149639 Ga0495592_0149639_268_1194 300
994 3300046455 Ga0495603_0000040 Ga0495603_0000040_5618_6538 300
995 3300046455 Ga0495603_0044454 Ga0495603_0044454_845_1759 300
996 3300046455 Ga0495603_0089349 Ga0495603_0089349_629_1543 300
997 3300046455 Ga0495603_0091424 Ga0495603_0091424_547_1461 300
998 3300046457 Ga0495590_0053509 Ga0495590_0053509_386_1300 300
999 3300046459 Ga0495629_0000077 Ga0495629_0000077_1530_2450 300
1000 3300046459 Ga0495629_0000188 Ga0495629_0000188_34536_35456 300
1001 3300046460 Ga0495638_0179570 Ga0495638_0179570_18_932 300
1002 3300046461 Ga0495641_0008119 Ga0495641_0008119_5050_5970 300
1003 3300046462 Ga0495651_0023797 Ga0495651_0023797_2744_3658 300
1004 3300046462 Ga0495651_0074528 Ga0495651_0074528_906_1826 300
1005 3300046463 Ga0495653_0004244 Ga0495653_0004244_9786_10706 300
1006 3300046463 Ga0495653_0104811 Ga0495653_0104811_619_1539 300
1007 3300046463 Ga0495653_0175933 Ga0495653_0175933_458_1384 300
1008 3300046472 Ga0495580_0003456 Ga0495580_0003456_8396_9316 300
1009 3300046472 Ga0495580_0298139 Ga0495580_0298139_19_933 300
1010 3300046473 Ga0495582_0000020 Ga0495582_0000020_67277_68197 300
1011 3300046475 Ga0495639_0000011 Ga0495639_0000011_59925_60845 300
1012 3300046476 Ga0495662_0000229 Ga0495662_0000229_16511_17431 300
1013 3300046477 Ga0495664_0006970 Ga0495664_0006970_5175_6095 300
1014 3300046491 Ga0495584_0133370 Ga0495584_0133370_55_969 300
1015 3300046492 Ga0495585_0062171 Ga0495585_0062171_575_1489 300
1016 3300046500 Ga0495596_0071301 Ga0495596_0071301_309_1223 300
1017 3300046501 Ga0495607_0039575 Ga0495607_0039575_1348_2265 300
1018 3300046507 Ga0495606_0043102 Ga0495606_0043102_1083_1997 300
1019 3300046511 Ga0495608_0006190 Ga0495608_0006190_1541_2461 300
1020 3300046511 Ga0495608_0131387 Ga0495608_0131387_505_1431 300
1021 3300046513 Ga0495616_0108459 Ga0495616_0108459_248_1162 300
1022 3300046514 Ga0495618_0036142 Ga0495618_0036142_1006_1932 300
1023 3300046514 Ga0495618_0256246 Ga0495618_0256246_61_981 300
1024 3300046515 Ga0495620_0044658 Ga0495620_0044658_282_1196 300
1025 3300046516 Ga0495628_0036603 Ga0495628_0036603_699_1619 300
1026 3300046517 Ga0495630_0005419 Ga0495630_0005419_2736_3656 300
1027 3300046518 Ga0495631_0041980 Ga0495631_0041980_247_1161 300
1028 3300046519 Ga0495632_0090724 Ga0495632_0090724_32_946 300
1029 3300046522 Ga0495643_0131436 Ga0495643_0131436_17_931 300
1030 3300046524 Ga0495648_0006381 Ga0495648_0006381_4929_5846 300
1031 3300046524 Ga0495648_0097879 Ga0495648_0097879_607_1521 300
1032 3300046529 Ga0495652_0020613 Ga0495652_0020613_4369_5295 300
1033 3300046529 Ga0495652_0055109 Ga0495652_0055109_1557_2477 300
1034 3300046529 Ga0495652_0112922 Ga0495652_0112922_655_1569 300
1035 3300046531 Ga0495665_0000133 Ga0495665_0000133_29837_30757 300
1036 3300046533 Ga0495640_0006645 Ga0495640_0006645_5884_6804 300
1037 3300046533 Ga0495640_0050384 Ga0495640_0050384_808_1728 300
1038 3300046533 Ga0495640_0223939 Ga0495640_0223939_220_1146 300
1039 3300046536 Ga0495587_0003226 Ga0495587_0003226_9238_10158 300
1040 3300046536 Ga0495587_0045939 Ga0495587_0045939_1046_1972 300
1041 3300046537 Ga0495598_0009153 Ga0495598_0009153_1205_2119 300
1042 3300046539 Ga0495621_0003331 Ga0495621_0003331_798_1712 300
1043 3300046543 Ga0495645_0013345 Ga0495645_0013345_256_1176 300
1044 3300046543 Ga0495645_0037041 Ga0495645_0037041_1307_2227 300
1045 3300046557 Ga0495622_0021201 Ga0495622_0021201_1688_2602 300
1046 3300046557 Ga0495622_0119717 Ga0495622_0119717_144_1058 300
1047 3300046559 Ga0495667_0001104 Ga0495667_0001104_15883_16803 300
1048 3300046559 Ga0495667_0007596 Ga0495667_0007596_5756_6676 300
1049 3300046559 Ga0495667_0026308 Ga0495667_0026308_2350_3276 300
1050 3300046559 Ga0495667_0252021 Ga0495667_0252021_122_1042 300
1051 3300046615 Ga0495656_0005561 Ga0495656_0005561_140_1054 300
1052 3300046615 Ga0495656_0028536 Ga0495656_0028536_651_1565 300
1053 3300046615 Ga0495656_0050930 Ga0495656_0050930_351_1265 300
1054 3300046616 Ga0495668_0010958 Ga0495668_0010958_3154_4068 300
1055 3300046616 Ga0495668_0117269 Ga0495668_0117269_222_1136 300
1056 3300046642 Ga0495634_0000402 Ga0495634_0000402_29527_30447 300
1057 3300046642 Ga0495634_0009196 Ga0495634_0009196_5349_6269 300
1058 3300046648 Ga0495611_0033915 Ga0495611_0033915_826_1740 300
1059 3300046660 Ga0495625_0307521 Ga0495625_0307521_48_962 300
1060 3300046663 Ga0495635_0000196 Ga0495635_0000196_1560_2480 300
1061 3300046663 Ga0495635_0012249 Ga0495635_0012249_2293_3213 300
1062 3300046664 Ga0495659_0040465 Ga0495659_0040465_414_1328 300
1063 3300046674 Ga0495588_0010446 Ga0495588_0010446_670_1584 300
1064 3300046675 Ga0495657_0001347 Ga0495657_0001347_1519_2439 300
1065 3300046675 Ga0495657_0138339 Ga0495657_0138339_210_1136 300
1066 3300046675 Ga0495657_0159888 Ga0495657_0159888_239_1159 300
1067 3300046678 Ga0495599_0015309 Ga0495599_0015309_2449_3375 300
1068 3300046678 Ga0495599_0036386 Ga0495599_0036386_749_1669 300
1069 3300046678 Ga0495599_0170988 Ga0495599_0170988_297_1217 300
1070 3300046679 Ga0495623_0037495 Ga0495623_0037495_749_1669 300
1071 3300046679 Ga0495623_0090059 Ga0495623_0090059_184_1110 300
1072 3300046680 Ga0495646_0009557 Ga0495646_0009557_5084_6004 300
1073 3300046680 Ga0495646_0044961 Ga0495646_0044961_229_1149 300
1074 3300046680 Ga0495646_0060392 Ga0495646_0060392_304_1230 300
1075 3300046681 Ga0495647_0010003 Ga0495647_0010003_1150_2070 300
1076 3300046683 Ga0495658_0000538 Ga0495658_0000538_17045_17965 300
1077 3300046683 Ga0495658_0193917 Ga0495658_0193917_15_929 300
1078 3300046684 Ga0495669_0008807 Ga0495669_0008807_739_1653 300
1079 3300046689 Ga0495613_0000873 Ga0495613_0000873_6674_7594 300
1080 3300046689 Ga0495613_0027935 Ga0495613_0027935_1291_2211 300
1081 3300046689 Ga0495613_0169878 Ga0495613_0169878_461_1387 300
1082 3300046690 Ga0495624_0000819 Ga0495624_0000819_20357_21277 300
1083 3300046692 Ga0495671_0082806 Ga0495671_0082806_579_1493 300
1084 3300046809 Ga0495600_0012427 Ga0495600_0012427_2873_3793 300
1085 3300046809 Ga0495600_0103745 Ga0495600_0103745_638_1558 300
1086 3300046809 Ga0495600_0188945 Ga0495600_0188945_23_949 300
1087 3300047315 Ga0495581_0000518 Ga0495581_0000518_16497_17417 300
1088 3300047315 Ga0495581_0129026 Ga0495581_0129026_246_1160 300
1089 3300047317 Ga0495604_0017542 Ga0495604_0017542_1153_2079 300
1090 3300047317 Ga0495604_0020026 Ga0495604_0020026_1554_2474 300
1091 3300047317 Ga0495604_0146058 Ga0495604_0146058_153_1073 300
1092 3300047319 Ga0495674_0001070 Ga0495674_0001070_18552_19472 300
1093 3300047319 Ga0495674_0066903 Ga0495674_0066903_982_1902 300
1094 3300047319 Ga0495674_0211732 Ga0495674_0211732_439_1353 300
1095 3300047319 Ga0495674_0334735 Ga0495674_0334735_190_1116 300
1096 3300047322 Ga0495680_0013711 Ga0495680_0013711_2525_3445 300
1097 3300047322 Ga0495680_0089446 Ga0495680_0089446_382_1308 300
1098 3300047444 Ga0495675_0000638 Ga0495675_0000638_1339_2259 300
1099 3300047444 Ga0495675_0058177 Ga0495675_0058177_513_1439 300
1100 3300047444 Ga0495675_0145751 Ga0495675_0145751_323_1243 300
1101 3300047445 Ga0495677_0056715 Ga0495677_0056715_302_1216 300
1102 3300047471 Ga0495684_0000068 Ga0495684_0000068_60597_61517 300
1103 3300047471 Ga0495684_0063761 Ga0495684_0063761_709_1629 300
1104 3300047471 Ga0495684_0088205 Ga0495684_0088205_871_1797 300
1105 3300047472 Ga0495686_0155136 Ga0495686_0155136_288_1202 300
1106 3300047673 Ga0495593_0000006 Ga0495593_0000006_15692_16612 300
1107 3300047673 Ga0495593_0007104 Ga0495593_0007104_4530_5450 300
1108 3300048088 Ga0495602_0011453 Ga0495602_0011453_1087_2013 300
1109 3300048088 Ga0495602_0066086 Ga0495602_0066086_1449_2369 300
1110 3300048089 Ga0495614_0004871 Ga0495614_0004871_544_1464 300
1111 3300048090 Ga0495615_0007661 Ga0495615_0007661_558_1472 300
1112 3300048903 Ga0496100_0066259 Ga0496100_0066259_93_1007 300
1113 3300048903 Ga0496100_0245954 Ga0496100_0245954_119_1033 300
1114 3300048904 Ga0496101_0026205 Ga0496101_0026205_3012_3926 300
1115 3300048905 Ga0496102_0003559 Ga0496102_0003559_8597_9511 300
1116 3300048905 Ga0496102_0036626 Ga0496102_0036626_865_1803 300
1117 3300048905 Ga0496102_0057999 Ga0496102_0057999_52_966 300
1118 3300048906 Ga0496103_0030094 Ga0496103_0030094_819_1733 300
1119 3300048907 Ga0496104_0035142 Ga0496104_0035142_193_1107 300
1120 3300048907 Ga0496104_0107877 Ga0496104_0107877_1540_2478 300
1121 3300048907 Ga0496104_0122241 Ga0496104_0122241_1093_2007 300
1122 3300048908 Ga0496105_0011609 Ga0496105_0011609_4280_5194 300
1123 3300048908 Ga0496105_0083831 Ga0496105_0083831_218_1156 300
1124 3300048909 Ga0496106_0000627 Ga0496106_0000627_3938_4873 300
1125 3300048909 Ga0496106_0006300 Ga0496106_0006300_289_1203 300
1126 3300048909 Ga0496106_0006841 Ga0496106_0006841_4917_5831 300
1127 3300048909 Ga0496106_0085203 Ga0496106_0085203_740_1678 300
1128 3300048909 Ga0496106_0113709 Ga0496106_0113709_559_1473 300
1129 3300048910 Ga0496107_0005103 Ga0496107_0005103_3707_4621 300
1130 3300048910 Ga0496107_0013020 Ga0496107_0013020_1089_2003 300
1131 3300048910 Ga0496107_0091698 Ga0496107_0091698_587_1501 300
1132 3300048910 Ga0496107_0171468 Ga0496107_0171468_492_1406 300
1133 3300048911 Ga0496108_0000259 Ga0496108_0000259_12882_13796 300
1134 3300048912 Ga0496109_0000250 Ga0496109_0000250_30998_31912 300
1135 3300048912 Ga0496109_0017185 Ga0496109_0017185_3168_4082 300
1136 3300048912 Ga0496109_0096845 Ga0496109_0096845_506_1420 300
1137 3300048913 Ga0496110_0010988 Ga0496110_0010988_4539_5453 300
1138 3300048913 Ga0496110_0037452 Ga0496110_0037452_2221_3135 300
1139 3300048913 Ga0496110_0048968 Ga0496110_0048968_1786_2721 300
1140 3300048913 Ga0496110_0094810 Ga0496110_0094810_1680_2594 300
1141 3300048913 Ga0496110_0106383 Ga0496110_0106383_867_1781 300
1142 3300048914 Ga0496111_0020268 Ga0496111_0020268_1175_2089 300
1143 3300048914 Ga0496111_0029410 Ga0496111_0029410_1961_2875 300
1144 3300048914 Ga0496111_0186563 Ga0496111_0186563_44_964 300
1145 3300048915 Ga0496112_0000017 Ga0496112_0000017_183756_184676 300
1146 3300048915 Ga0496112_0052717 Ga0496112_0052717_1282_2196 300
1147 3300048915 Ga0496112_0082096 Ga0496112_0082096_2137_3051 300
1148 3300048915 Ga0496112_0202931 Ga0496112_0202931_16_930 300
1149 3300048916 Ga0496113_0029385 Ga0496113_0029385_337_1350 300
1150 3300048916 Ga0496113_0036230 Ga0496113_0036230_1836_2750 300
1151 3300048916 Ga0496113_0059155 Ga0496113_0059155_846_1760 300
1152 3300048917 Ga0496114_0053748 Ga0496114_0053748_308_1222 300
1153 3300048917 Ga0496114_0173409 Ga0496114_0173409_411_1325 300
1154 3300048918 Ga0496115_0003885 Ga0496115_0003885_9032_9946 300
1155 3300048918 Ga0496115_0015437 Ga0496115_0015437_1128_2042 300
1156 3300048918 Ga0496115_0040567 Ga0496115_0040567_1954_2868 300
1157 3300048918 Ga0496115_0051006 Ga0496115_0051006_735_1649 300
1158 3300048918 Ga0496115_0335258 Ga0496115_0335258_213_1148 300
1159 3300048919 Ga0496116_0001079 Ga0496116_0001079_9822_10754 300
1160 3300048920 Ga0496117_0027627 Ga0496117_0027627_98_1012 300
1161 3300048920 Ga0496117_0044446 Ga0496117_0044446_1893_2807 300
1162 3300048921 Ga0496118_0005263 Ga0496118_0005263_8672_9586 300
1163 3300048921 Ga0496118_0047345 Ga0496118_0047345_2290_3222 300
1164 3300048922 Ga0496119_0108049 Ga0496119_0108049_486_1406 300
1165 3300048922 Ga0496119_0162604 Ga0496119_0162604_115_1029 300
1166 3300048924 Ga0496121_0000041 Ga0496121_0000041_208724_209638 300
1167 3300048924 Ga0496121_0001488 Ga0496121_0001488_1161_2081 300
1168 3300048924 Ga0496121_0011984 Ga0496121_0011984_3048_3962 300
1169 3300048924 Ga0496121_0014293 Ga0496121_0014293_1657_2577 300
1170 3300048924 Ga0496121_0061849 Ga0496121_0061849_1219_2133 300
1171 3300048924 Ga0496121_0256017 Ga0496121_0256017_224_1141 300
1172 3300048924 Ga0496121_0265938 Ga0496121_0265938_158_1072 300
1173 3300048925 Ga0496122_0019761 Ga0496122_0019761_3145_4062 300
1174 3300048925 Ga0496122_0071868 Ga0496122_0071868_392_1306 300
1175 3300048926 Ga0496123_0053912 Ga0496123_0053912_548_1465 300
1176 3300048926 Ga0496123_0140078 Ga0496123_0140078_60_974 300
1177 3300048927 Ga0496124_0001646 Ga0496124_0001646_20804_21718 300
1178 3300048927 Ga0496124_0136445 Ga0496124_0136445_964_1881 300
1179 3300048928 Ga0496125_0018563 Ga0496125_0018563_5432_6364 300
1180 3300048928 Ga0496125_0020254 Ga0496125_0020254_4613_5527 300
1181 3300048928 Ga0496125_0048379 Ga0496125_0048379_171_1085 300
1182 3300048928 Ga0496125_0131027 Ga0496125_0131027_747_1661 300
1183 3300048929 Ga0496126_0005288 Ga0496126_0005288_4609_5526 300
1184 3300048929 Ga0496126_0005411 Ga0496126_0005411_3364_4278 300
1185 3300048929 Ga0496126_0006081 Ga0496126_0006081_5241_6155 300
1186 3300048929 Ga0496126_0032207 Ga0496126_0032207_267_1181 300
1187 3300048929 Ga0496126_0065925 Ga0496126_0065925_131_1048 300
1188 3300048929 Ga0496126_0068821 Ga0496126_0068821_1998_2912 300
1189 3300048929 Ga0496126_0090667 Ga0496126_0090667_1430_2344 300
1190 3300048929 Ga0496126_0109374 Ga0496126_0109374_867_1787 300
1191 3300048929 Ga0496126_0135001 Ga0496126_0135001_346_1266 300
1192 3300048929 Ga0496126_0328725 Ga0496126_0328725_194_1111 300
1193 3300049570 Ga0501033_0019714 Ga0501033_0019714_2808_3725 300
1194 3300049571 Ga0501034_0479742 Ga0501034_0479742_66_983 300
1195 3300049575 Ga0501039_0036113 Ga0501039_0036113_999_1976 300
1196 3300049575 Ga0501039_0286137 Ga0501039_0286137_86_1003 300
1197 3300049578 Ga0501042_0060090 Ga0501042_0060090_843_1820 300
1198 3300049579 Ga0501043_0063197 Ga0501043_0063197_234_1151 300
1199 3300049580 Ga0501046_0038560 Ga0501046_0038560_119_1096 300
1200 3300049585 Ga0501069_0109798 Ga0501069_0109798_344_1258 300
1201 3300049586 Ga0501070_0077515 Ga0501070_0077515_41_970 300
1202 3300049586 Ga0501070_0174909 Ga0501070_0174909_246_1229 300
1203 3300049587 Ga0501071_0036003 Ga0501071_0036003_1352_2329 300
1204 3300049743 Ga0501081_0163805 Ga0501081_0163805_451_1428 300
1205 3300049744 Ga0501083_0003716 Ga0501083_0003716_2745_3674 300
1206 3300049822 Ga0501035_0325637 Ga0501035_0325637_248_1165 300
1207 3300049823 Ga0501044_0006616 Ga0501044_0006616_7287_8219 300
1208 3300050490 nmdc:mga03n38_7548_c1 nmdc:mga03n38_7548_c1_1611_2525 300
1209 3300050491 nmdc:mga00v17_271279_c1 nmdc:mga00v17_271279_c1_68_982 300
1210 3300050492 nmdc:mga0yw44_51827_c1 nmdc:mga0yw44_51827_c1_319_1233 300
1211 3300050494 nmdc:mga06z11_54938_c1 nmdc:mga06z11_54938_c1_347_1261 300
1212 3300050496 nmdc:mga07m45_102699_c1 nmdc:mga07m45_102699_c1_82_996 300
1213 3300050496 nmdc:mga07m45_145902_c1 nmdc:mga07m45_145902_c1_108_1022 300
1214 3300050511 nmdc:mga08y16_104785_c1 nmdc:mga08y16_104785_c1_1720_2634 300
1215 3300050514 nmdc:mga08x19_229594_c1 nmdc:mga08x19_229594_c1_312_1226 300
1216 3300050516 nmdc:mga0sz30_25482_c1 nmdc:mga0sz30_25482_c1_529_1443 300
1217 3300053077 Ga0495601_0071383 Ga0495601_0071383_1093_2019 300
1218 3300053080 Ga0500635_0001266 Ga0500635_0001266_2057_2971 300
1219 3300053083 Ga0495655_0053123 Ga0495655_0053123_24_938 300
1220 3300053084 Ga0495595_0011980 Ga0495595_0011980_1139_2059 300
1221 3300053085 Ga0495619_0000829 Ga0495619_0000829_8514_9434 300
1222 3300053085 Ga0495619_0018115 Ga0495619_0018115_829_1755 300
1223 3300053085 Ga0495619_0039802 Ga0495619_0039802_1766_2680 300
1224 3300053085 Ga0495619_0118554 Ga0495619_0118554_795_1715 300
1225 3300053087 Ga0500643_013747 Ga0500643_013747_1129_2043 300
1226 3300053093 Ga0500651_0037460 Ga0500651_0037460_1833_2750 300
1227 3300053094 Ga0500566_0000043 Ga0500566_0000043_863_1777 300
1228 3300053094 Ga0500566_0001303 Ga0500566_0001303_1859_2776 300
1229 3300053096 Ga0500641_0005452 Ga0500641_0005452_723_1637 300
1230 3300053096 Ga0500641_0006170 Ga0500641_0006170_3108_4022 300
1231 3300053103 Ga0500555_016917 Ga0500555_016917_615_1529 300
1232 3300053108 Ga0500562_017164 Ga0500562_017164_451_1368 300
1233 3300053108 Ga0500562_030941 Ga0500562_030941_436_1350 300
1234 3300053109 Ga0500569_027465 Ga0500569_027465_139_1056 300
1235 3300053111 Ga0500572_001745 Ga0500572_001745_1081_1995 300
1236 3300053118 Ga0500594_0072417 Ga0500594_0072417_82_996 300
1237 3300053119 Ga0500595_000722 Ga0500595_000722_4787_5707 300
1238 3300053119 Ga0500595_004127 Ga0500595_004127_1683_2603 300
1239 3300053119 Ga0500595_049370 Ga0500595_049370_186_1100 300
1240 3300053122 Ga0500608_013224 Ga0500608_013224_1817_2731 300
1241 3300053122 Ga0500608_018017 Ga0500608_018017_1657_2574 300
1242 3300053134 Ga0500658_0145375 Ga0500658_0145375_37_951 300
1243 3300053136 Ga0500559_0001123 Ga0500559_0001123_15152_16069 300
1244 3300053136 Ga0500559_0002307 Ga0500559_0002307_991_1905 300
1245 3300053136 Ga0500559_0009193 Ga0500559_0009193_3233_4147 300
1246 3300053136 Ga0500559_0030298 Ga0500559_0030298_1372_2286 300
1247 3300053140 Ga0500573_0053716 Ga0500573_0053716_494_1408 300
1248 3300053142 Ga0500577_0001256 Ga0500577_0001256_4303_5217 300
1249 3300053150 Ga0500603_016007 Ga0500603_016007_81_995 300
1250 3300053151 Ga0500604_0045811 Ga0500604_0045811_406_1320 300
1251 3300053159 Ga0500630_001851 Ga0500630_001851_890_1804 300
1252 3300053160 Ga0500633_0037242 Ga0500633_0037242_635_1549 300
1253 3300053161 Ga0500634_0109761 Ga0500634_0109761_342_1259 300
1254 3300053162 Ga0500638_063273 Ga0500638_063273_23_937 300
1255 3300053163 Ga0500639_000099 Ga0500639_000099_28280_29194 300
1256 3300053177 Ga0500636_0004209 Ga0500636_0004209_4917_5834 300
1257 3300053177 Ga0500636_0058733 Ga0500636_0058733_129_1040 300
1258 3300053178 Ga0500637_0185181 Ga0500637_0185181_156_1070 300
1259 3300053725 Ga0500576_052040 Ga0500576_052040_122_1036 300
1260 3300053730 Ga0500645_033245 Ga0500645_033245_119_1033 300
1261 3300053735 Ga0500596_005195 Ga0500596_005195_694_1608 300
1262 3300054114 Ga0501084_0110470 Ga0501084_0110470_829_1806 300
1263 3300060353 Ga0501082_0232769 Ga0501082_0232769_41_970 300
1264 3300060353 Ga0501082_0266726 Ga0501082_0266726_240_1154 300
1265 iso_pu_bacteria 2597489875 2597812371 300
1266 iso_pu_bacteria 2856342000 2856348463 300
1267 iso_pu_bacteria 2874123672 2874123953 300
1268 iso_pu_bacteria 2885305155 2885305870 300
1269 iso_pu_bacteria 2888343758 2888346135 300
1270 iso_pu_bacteria 2924754689 2924755746 300
1271 iso_pu_bacteria 2970524798 2970527633 300
1272 iso_pu_bacteria 2970540015 2970545260 300
1273 iso_pu_bacteria 2977858184 2977863811 300
1274 iso_pu_bacteria 8004445564 8004451298 300
1275 iso_pu_bacteria 8055617313 8055619861 300
1276 3300005327 Ga0070658_10406454 Ga0070658_104064542 301
1277 3300005336 Ga0070680_100008704 Ga0070680_1000087049 301
1278 3300005339 Ga0070660_100047303 Ga0070660_1000473031 301
1279 3300005341 Ga0070691_10114389 Ga0070691_101143892 301
1280 3300005344 Ga0070661_100122022 Ga0070661_1001220222 301
1281 3300005445 Ga0070708_100236693 Ga0070708_1002366932 301
1282 3300005459 Ga0068867_100381336 Ga0068867_1003813361 301
1283 3300005535 Ga0070684_100065035 Ga0070684_1000650352 301
1284 3300005539 Ga0068853_100055518 Ga0068853_1000555183 301
1285 3300005548 Ga0070665_100008803 Ga0070665_1000088037 301
1286 3300005563 Ga0068855_100121344 Ga0068855_1001213442 301
1287 3300005577 Ga0068857_100013693 Ga0068857_1000136935 301
1288 3300005577 Ga0068857_100430756 Ga0068857_1004307561 301
1289 3300005616 Ga0068852_100251038 Ga0068852_1002510382 301
1290 3300005834 Ga0068851_10035787 Ga0068851_100357873 301
1291 3300006871 Ga0075434_100043289 Ga0075434_1000432892 301
1292 3300007788 Ga0099795_10040428 Ga0099795_100404282 301
1293 3300009093 Ga0105240_10030277 Ga0105240_100302774 301
1294 3300010159 Ga0099796_10024830 Ga0099796_100248302 301
1295 3300010375 Ga0105239_10291284 Ga0105239_102912842 301
1296 3300020070 Ga0206356_11198058 Ga0206356_111980582 301
1297 3300025321 Ga0207656_10015273 Ga0207656_100152732 301
1298 3300025912 Ga0207707_10004078 Ga0207707_1000407813 301
1299 3300025913 Ga0207695_10048138 Ga0207695_100481382 301
1300 3300025917 Ga0207660_10003159 Ga0207660_100031593 301
1301 3300025919 Ga0207657_10004372 Ga0207657_1000437213 301
1302 3300025944 Ga0207661_10013657 Ga0207661_100136573 301
1303 3300025949 Ga0207667_10005778 Ga0207667_1000577812 301
1304 3300026116 Ga0207674_10046213 Ga0207674_100462132 301
1305 3300027512 Ga0209179_1021838 Ga0209179_10218381 301
1306 3300027671 Ga0209588_1014042 Ga0209588_10140422 301
1307 3300028379 Ga0268266_10022851 Ga0268266_100228514 301
1308 3300031249 Ga0265339_10001505 Ga0265339_100015054 301
1309 3300031344 Ga0265316_10110918 Ga0265316_101109181 301
1310 3300031616 Ga0307508_10000032 Ga0307508_1000003220 301
1311 3300035695 Ga0373927_0028546 Ga0373927_0028546_32_958 301
1312 3300035725 Ga0373947_0009460 Ga0373947_0009460_2240_3166 301
1313 3300035725 Ga0373947_0125977 Ga0373947_0125977_207_1136 301
1314 3300039438 Ga0436360_0063161 Ga0436360_0063161_680_1603 301
1315 3300046455 Ga0495603_0002873 Ga0495603_0002873_2437_3363 301
1316 3300046471 Ga0495650_0060222 Ga0495650_0060222_115_1095 301
1317 3300046492 Ga0495585_0001246 Ga0495585_0001246_3115_4074 301
1318 3300046507 Ga0495606_0000186 Ga0495606_0000186_21049_22008 301
1319 3300046507 Ga0495606_0027650 Ga0495606_0027650_1826_2815 301
1320 3300046512 Ga0495610_0002153 Ga0495610_0002153_8355_9344 301
1321 3300046519 Ga0495632_0018833 Ga0495632_0018833_2124_3083 301
1322 3300046524 Ga0495648_0001821 Ga0495648_0001821_10736_11725 301
1323 3300046690 Ga0495624_0044349 Ga0495624_0044349_1162_2088 301
1324 3300047315 Ga0495581_0142230 Ga0495581_0142230_355_1275 301
1325 3300047323 Ga0495683_0000532 Ga0495683_0000532_10779_11759 301
1326 3300047469 Ga0495673_0006897 Ga0495673_0006897_4762_5751 301
1327 3300047472 Ga0495686_0004768 Ga0495686_0004768_2862_3851 301
1328 3300047472 Ga0495686_0025525 Ga0495686_0025525_265_1245 301
1329 3300048924 Ga0496121_0007872 Ga0496121_0007872_8963_9922 301
1330 3300048924 Ga0496121_0014476 Ga0496121_0014476_3943_4863 301
1331 3300053077 Ga0495601_0077685 Ga0495601_0077685_66_995 301
1332 3300053085 Ga0495619_0234646 Ga0495619_0234646_266_1195 301
1333 iso_pu_bacteria 2599185170 2599415339 301
1334 iso_pu_bacteria 2718218334 2721025340 301
1335 iso_pu_bacteria 2738543009 2739226149 301
1336 iso_pu_bacteria 2838035591 2838038936 301
1337 iso_pu_bacteria 2838661181 2838664474 301
1338 iso_pu_bacteria 2958115193 2958118200 301
1339 iso_pu_bacteria 2965062239 2965062642 301
1340 iso_pu_bacteria 2968091066 2968092105 301
1341 iso_pu_bacteria 2968097103 2968098606 301
1342 iso_pu_bacteria 2968128360 2968130733 301
1343 iso_pu_bacteria 2979779861 2979782506 301
1344 iso_pu_bacteria 2996341866 2996346514 301
1345 iso_pu_bacteria 3005409236 3005413791 301
1346 iso_pu_bacteria 8004703790 8004709103 301
1347 3300031852 Ga0307410_10073292 Ga0307410_100732922 302
1348 3300010375 Ga0105239_10313566 Ga0105239_103135662 303
1349 3300031728 Ga0316578_10028219 Ga0316578_100282192 303
1350 3300036647 Ga0316582_0011480 Ga0316582_0011480_2537_3466 303
1351 3300046474 Ga0495605_0008346 Ga0495605_0008346_1358_2272 303
1352 3300046492 Ga0495585_0084374 Ga0495585_0084374_166_1080 303
1353 3300046506 Ga0495583_0024110 Ga0495583_0024110_882_1796 303
1354 3300046513 Ga0495616_0025893 Ga0495616_0025893_1013_1927 303
1355 3300046515 Ga0495620_0026829 Ga0495620_0026829_351_1265 303
1356 3300046518 Ga0495631_0016680 Ga0495631_0016680_2215_3129 303
1357 3300046538 Ga0495609_0047167 Ga0495609_0047167_160_1074 303
1358 3300046616 Ga0495668_0006779 Ga0495668_0006779_4214_5128 303
1359 3300046660 Ga0495625_0002662 Ga0495625_0002662_13644_14558 303
1360 3300053079 Ga0500610_0002697 Ga0500610_0002697_5340_6254 303
1361 3300053108 Ga0500562_046085 Ga0500562_046085_88_1080 303
1362 3300053118 Ga0500594_0003721 Ga0500594_0003721_1701_2615 303
1363 3300053139 Ga0500568_0000331 Ga0500568_0000331_13_1005 303
1364 3300053153 Ga0500616_0007504 Ga0500616_0007504_4532_5524 303
1365 3300053736 Ga0500599_006575 Ga0500599_006575_168_1082 303
1366 3300036647 Ga0316582_0134341 Ga0316582_0134341_266_1180 304
1367 3300037471 Ga0395905_0000972 Ga0395905_0000972_23202_24116 304
1368 3300003187 JGI25151J46595_10002636 JGI25151J46595_1000263610 305
1369 3300003323 rootH1_10365848 rootH1_103658481 305
1370 3300005262 Ga0065165_1008347 Ga0065165_10083473 305
1371 3300005563 Ga0068855_100120294 Ga0068855_1001202942 305
1372 3300025258 Ga0209129_1000016 Ga0209129_1000016331 305
1373 3300025294 Ga0209025_1000126 Ga0209025_100012665 305
1374 3300025303 Ga0209051_1006374 Ga0209051_10063744 305
1375 3300025949 Ga0207667_10438642 Ga0207667_104386422 305
1376 3300038443 Ga0395901_0102446 Ga0395901_0102446_1687_2691 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

78

237

0.98

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

241

361

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

78

158

0.87

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

73

169

0.87

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

50

186

0.85

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

78

186

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9647 7 290
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9643 7 291
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9563 8 289
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9516 7 290
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9513 7 291
ID Description Score Start End Superfamily
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9913 171 298 1.10.1040.10
af_A0A1D6LWN3_490_603_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9903 171 273 1.10.1040.10
3g0oA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9827 172 290 1.10.1040.10
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9777 7 166 3.40.50.720
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 7 168 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A094E1N2-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9774 160 289 GO:0051287
AF-A0A0H3LJV3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9769 1 297 GO:0008442
GO:0016054
GO:0050661
GO:0051287
AF-A0A4R3T858-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9761 7 291 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A7I7G549-F1-model_v4 deleted 0.9756 7 183
AF-A0A2N1RZ29-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9742 97 290 GO:0016054
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
95.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map