F493472
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1376 | 712 | 1144 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0062730|Ga0373925_0062730_59_1183 |
| Length | 374 |
| Sequence | MDGILFVALSHALATRPSRDTRLLVWHDLRANASRLSEGKPVSTFPDHAQEPKPSEDAGLTRNLREHRMPEAAVQRPRVAVIGLGSMGMGMAISLRRAGFDVTGCDVSAEAVARFVAEGGRGAKTPAEAARQSGIVISVVVNAAQTETILFGSNGAAETMAEEAVFVSSATMDPDVARRLAKQLEATGRHYLDAPISGGAQRAAQGELTILASGSPAAFAKARPALDAMAAKLYELGDAAGQGAAFKMINQLLAGVHIAAASEAITFAAKQGLDIRKVYEVVTASAGNSWMFENRMPHVLDGDYAPRSAVEIFVKDLGIIQDMARTAKFPVPVASAALQMFLMTAASGMGRDDDASVARMYARVTGTQLPGEPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 23 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 26 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 27 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 30 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 31 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 50 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 51 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 52 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 53 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 54 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 55 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 73 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 74 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 75 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 76 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 77 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 78 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 79 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 80 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 81 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 82 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 83 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 84 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 85 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 86 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 87 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 88 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 89 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 90 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 91 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 92 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 93 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 94 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 95 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 96 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 97 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 98 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 99 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 100 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 101 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 102 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 103 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 104 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 105 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 106 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 107 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 108 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 109 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 110 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 111 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 112 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 113 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 114 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 115 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 116 | 2922368715 | |||
| 117 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 118 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 129 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 130 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 131 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 132 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 133 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 134 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 135 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 136 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 137 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 138 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 139 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 140 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 141 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 142 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 143 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 144 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 145 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 146 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 147 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 148 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 149 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 150 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 151 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 152 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 153 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 154 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 155 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 156 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 157 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 158 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 159 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 160 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 161 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 162 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 163 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 164 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 165 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 166 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 179 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 180 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 181 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 182 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 183 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 184 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 185 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 186 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 187 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 188 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 189 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 190 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 191 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 192 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 193 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 194 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 195 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 196 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 197 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 198 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 199 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 200 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 201 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 202 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 203 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 204 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 205 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 206 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 207 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 210 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 211 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 212 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 214 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 228 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 231 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 236 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 237 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 239 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 240 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 242 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 245 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 247 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 248 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 249 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 251 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 252 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 253 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 254 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 255 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 256 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 257 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 258 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 259 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 260 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 261 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 262 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 263 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 264 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 266 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 267 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 268 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 269 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 270 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 271 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 272 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 273 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 275 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 276 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 277 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 278 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 279 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 280 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 281 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 283 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 284 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 285 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 286 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 287 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 299 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 300 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 314 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 316 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 317 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 318 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 319 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 320 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 321 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 322 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 323 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 330 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 332 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 388 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 389 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 390 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 391 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 394 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 398 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 399 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 400 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 401 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 402 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 403 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 404 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 405 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 406 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 407 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 408 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 409 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 410 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 411 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 412 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 413 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 414 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 415 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 416 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 417 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 418 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 419 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 420 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 421 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 422 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 423 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 424 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 425 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 426 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 427 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 428 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 429 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 430 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 431 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 432 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 433 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 434 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 435 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 436 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 437 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 438 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 439 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 440 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 441 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 442 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 443 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 444 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 445 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 446 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 447 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 448 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 449 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 450 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 451 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 452 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 453 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 454 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 455 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 456 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 457 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 458 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 459 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 460 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 461 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 462 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 463 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 464 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 465 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 466 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 467 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 468 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 469 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 470 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 471 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 472 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 473 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 474 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 475 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 476 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 477 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 478 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 479 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 560 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 561 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 562 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 563 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 564 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 565 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 566 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 567 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 568 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 569 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 570 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 571 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 572 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 573 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 574 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 575 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 576 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 577 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 578 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 579 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 580 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 581 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 582 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 583 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 584 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 585 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 586 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 591 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 592 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 615 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 616 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 617 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 618 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 619 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 620 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 621 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 622 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 623 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 624 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 625 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 626 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 627 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 630 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 631 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 635 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 636 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 637 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 638 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 639 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 640 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 641 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 642 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 643 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 644 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 645 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 646 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 647 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 648 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 649 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 650 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 651 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 652 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 653 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 654 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 655 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 656 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 657 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 658 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 659 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 660 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 661 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 662 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 663 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 664 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 665 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 666 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 667 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 668 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 669 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 670 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 671 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 672 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 673 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 674 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 675 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 676 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 678 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 679 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 680 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 681 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 682 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 683 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 684 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 685 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 686 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 687 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 688 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 689 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 690 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 691 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 692 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 693 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 694 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 695 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 696 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 697 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 698 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 699 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 700 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 701 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 702 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 703 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 704 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 705 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 706 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 707 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 708 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 709 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 710 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 711 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 712 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.11 |
| Metatranscriptomes | 0.15 |
| Isolates | 16.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.67 |
| Nodule | 13.01 |
| Rhizoplane | 5.01 |
| Rhizosphere | 60.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10002636 | 3300003187 | Bacteria | 10556 |
| 2 | JGI25406J46586_10003417 | 3300003203 | Bacteria | 7474 |
| 3 | JGI25406J46586_10006092 | 3300003203 | Bacteria | 5571 |
| 4 | JGI25153J46596_10000952 | 3300003215 | Bacteria | 17565 |
| 5 | JGI25153J46596_10001884 | 3300003215 | Bacteria | 12431 |
| 6 | rootH1_10365848 | 3300003323 | Unclassified | 1656 |
| 7 | JGI25160J50197_1002766 | 3300003354 | Bacteria | 8042 |
| 8 | JGI25160J50197_1003726 | 3300003354 | Bacteria | 6720 |
| 9 | JGI25160J50197_1006214 | 3300003354 | Bacteria | 4860 |
| 10 | JGI25160J50197_1030839 | 3300003354 | Bacteria | 1391 |
| 11 | JGI25160J50197_1031023 | 3300003354 | Bacteria | 1383 |
| 12 | JGI25404J52841_10007977 | 3300003659 | Bacteria | 2247 |
| 13 | JGI25404J52841_10026578 | 3300003659 | Bacteria | 1245 |
| 14 | JGI25404J52841_10037615 | 3300003659 | Bacteria | 1028 |
| 15 | Ga0055539_1002463 | 3300003752 | Bacteria | 2813 |
| 16 | Ga0055542_1013235 | 3300003762 | Bacteria | 1396 |
| 17 | Ga0055531_10008008 | 3300003794 | Bacteria | 5651 |
| 18 | Ga0065165_1004449 | 3300005262 | Bacteria | 8687 |
| 19 | Ga0065165_1004595 | 3300005262 | Bacteria | 8409 |
| 20 | Ga0065165_1005514 | 3300005262 | Bacteria | 7075 |
| 21 | Ga0065165_1008347 | 3300005262 | Bacteria | 4867 |
| 22 | Ga0070658_10406454 | 3300005327 | Bacteria | 1170 |
| 23 | Ga0070683_100005150 | 3300005329 | Bacteria | 10876 |
| 24 | Ga0068869_100015050 | 3300005334 | Bacteria | 5178 |
| 25 | Ga0068869_100023837 | 3300005334 | Bacteria | 4234 |
| 26 | Ga0068869_100058281 | 3300005334 | Bacteria | 2823 |
| 27 | Ga0070680_100008704 | 3300005336 | Bacteria | 7779 |
| 28 | Ga0070680_100014277 | 3300005336 | Bacteria | 6203 |
| 29 | Ga0070680_100395881 | 3300005336 | Bacteria | 1177 |
| 30 | Ga0070682_100116584 | 3300005337 | Bacteria | 1787 |
| 31 | Ga0070682_100176007 | 3300005337 | Bacteria | 1490 |
| 32 | Ga0070660_100047303 | 3300005339 | Bacteria | 3300 |
| 33 | Ga0070689_100106246 | 3300005340 | Bacteria | 2227 |
| 34 | Ga0070691_10114389 | 3300005341 | Bacteria | 1353 |
| 35 | Ga0070661_100024069 | 3300005344 | Bacteria | 4368 |
| 36 | Ga0070661_100122022 | 3300005344 | Bacteria | 1953 |
| 37 | Ga0070692_10060822 | 3300005345 | Unclassified | 1989 |
| 38 | Ga0070668_100037793 | 3300005347 | Bacteria | 3688 |
| 39 | Ga0070668_100083103 | 3300005347 | Bacteria | 2513 |
| 40 | Ga0070668_100232245 | 3300005347 | Bacteria | 1525 |
| 41 | Ga0070668_100512793 | 3300005347 | Bacteria | 1039 |
| 42 | Ga0070675_100255976 | 3300005354 | Bacteria | 1533 |
| 43 | Ga0070671_100036506 | 3300005355 | Bacteria | 4075 |
| 44 | Ga0070671_100261884 | 3300005355 | Bacteria | 1470 |
| 45 | Ga0070673_100408276 | 3300005364 | Bacteria | 1216 |
| 46 | Ga0070659_100117117 | 3300005366 | Bacteria | 2154 |
| 47 | Ga0070667_100184773 | 3300005367 | Bacteria | 1845 |
| 48 | Ga0070667_100233170 | 3300005367 | Bacteria | 1642 |
| 49 | Ga0070667_100260544 | 3300005367 | Bacteria | 1552 |
| 50 | Ga0070709_10000900 | 3300005434 | Bacteria | 16554 |
| 51 | Ga0070714_100039125 | 3300005435 | Bacteria | 3991 |
| 52 | Ga0070714_100049342 | 3300005435 | Bacteria | 3582 |
| 53 | Ga0070714_100389789 | 3300005435 | Bacteria | 1315 |
| 54 | Ga0070713_100003714 | 3300005436 | Bacteria | 10103 |
| 55 | Ga0070713_100006598 | 3300005436 | Bacteria | 8063 |
| 56 | Ga0070713_100030680 | 3300005436 | Bacteria | 4272 |
| 57 | Ga0070713_100037885 | 3300005436 | Bacteria | 3901 |
| 58 | Ga0070713_100517810 | 3300005436 | Bacteria | 1127 |
| 59 | Ga0070713_100609448 | 3300005436 | Bacteria | 1038 |
| 60 | Ga0070710_10000221 | 3300005437 | Bacteria | 26514 |
| 61 | Ga0070701_10022506 | 3300005438 | Bacteria | 3021 |
| 62 | Ga0070711_100002818 | 3300005439 | Bacteria | 9977 |
| 63 | Ga0070711_100011819 | 3300005439 | Bacteria | 5432 |
| 64 | Ga0070711_100037529 | 3300005439 | Bacteria | 3252 |
| 65 | Ga0070711_100133917 | 3300005439 | Bacteria | 1849 |
| 66 | Ga0070705_100066294 | 3300005440 | Bacteria | 2164 |
| 67 | Ga0070700_100002411 | 3300005441 | Bacteria | 9532 |
| 68 | Ga0070700_100127190 | 3300005441 | Bacteria | 1715 |
| 69 | Ga0070708_100236693 | 3300005445 | Bacteria | 1714 |
| 70 | Ga0070663_100026611 | 3300005455 | Bacteria | 3920 |
| 71 | Ga0070663_100057740 | 3300005455 | Bacteria | 2785 |
| 72 | Ga0070663_100267226 | 3300005455 | Bacteria | 1359 |
| 73 | Ga0070663_100345222 | 3300005455 | Bacteria | 1204 |
| 74 | Ga0070678_100064537 | 3300005456 | Bacteria | 2714 |
| 75 | Ga0070678_100101721 | 3300005456 | Bacteria | 2228 |
| 76 | Ga0070662_100162508 | 3300005457 | Bacteria | 1748 |
| 77 | Ga0070662_100365725 | 3300005457 | Bacteria | 1184 |
| 78 | Ga0068867_100070765 | 3300005459 | Bacteria | 2608 |
| 79 | Ga0068867_100093789 | 3300005459 | Bacteria | 2282 |
| 80 | Ga0068867_100381336 | 3300005459 | Bacteria | 1184 |
| 81 | Ga0070685_10175755 | 3300005466 | Bacteria | 1375 |
| 82 | Ga0070679_100079100 | 3300005530 | Bacteria | 3277 |
| 83 | Ga0070684_100003497 | 3300005535 | Bacteria | 11794 |
| 84 | Ga0070684_100065035 | 3300005535 | Bacteria | 3200 |
| 85 | Ga0068853_100055518 | 3300005539 | Bacteria | 3414 |
| 86 | Ga0068853_100203223 | 3300005539 | Bacteria | 1803 |
| 87 | Ga0068853_100312664 | 3300005539 | Bacteria | 1455 |
| 88 | Ga0070672_100121938 | 3300005543 | Bacteria | 2135 |
| 89 | Ga0070672_100242415 | 3300005543 | Bacteria | 1516 |
| 90 | Ga0070686_100002442 | 3300005544 | Bacteria | 10238 |
| 91 | Ga0070686_100211036 | 3300005544 | Bacteria | 1398 |
| 92 | Ga0070696_100012771 | 3300005546 | Bacteria | 5639 |
| 93 | Ga0070665_100008803 | 3300005548 | Bacteria | 10217 |
| 94 | Ga0070665_100043157 | 3300005548 | Bacteria | 4532 |
| 95 | Ga0070665_100062271 | 3300005548 | Bacteria | 3741 |
| 96 | Ga0070665_100141313 | 3300005548 | Bacteria | 2410 |
| 97 | Ga0070665_100147619 | 3300005548 | Bacteria | 2354 |
| 98 | Ga0070665_100177949 | 3300005548 | Bacteria | 2128 |
| 99 | Ga0070665_100347803 | 3300005548 | Bacteria | 1488 |
| 100 | Ga0068855_100120294 | 3300005563 | Bacteria | 3005 |
| 101 | Ga0068855_100121344 | 3300005563 | Bacteria | 2991 |
| 102 | Ga0068855_100279475 | 3300005563 | Bacteria | 1854 |
| 103 | Ga0068855_100304107 | 3300005563 | Bacteria | 1766 |
| 104 | Ga0068855_100372676 | 3300005563 | Bacteria | 1569 |
| 105 | Ga0070664_100196369 | 3300005564 | Bacteria | 1799 |
| 106 | Ga0068857_100013693 | 3300005577 | Bacteria | 7068 |
| 107 | Ga0068857_100430756 | 3300005577 | Bacteria | 1231 |
| 108 | Ga0068854_100062848 | 3300005578 | Bacteria | 2694 |
| 109 | Ga0068854_100081760 | 3300005578 | Bacteria | 2387 |
| 110 | Ga0068856_100009329 | 3300005614 | Bacteria | 9530 |
| 111 | Ga0068856_100036241 | 3300005614 | Bacteria | 4836 |
| 112 | Ga0068856_100221455 | 3300005614 | Bacteria | 1907 |
| 113 | Ga0068856_100237100 | 3300005614 | Bacteria | 1840 |
| 114 | Ga0068856_100410673 | 3300005614 | Bacteria | 1374 |
| 115 | Ga0070702_100001701 | 3300005615 | Bacteria | 9132 |
| 116 | Ga0068852_100011643 | 3300005616 | Bacteria | 6635 |
| 117 | Ga0068852_100251038 | 3300005616 | Bacteria | 1695 |
| 118 | Ga0068859_100048271 | 3300005617 | Bacteria | 4276 |
| 119 | Ga0068866_10002218 | 3300005718 | Bacteria | 8062 |
| 120 | Ga0068861_100034910 | 3300005719 | Bacteria | 3721 |
| 121 | Ga0068861_100059216 | 3300005719 | Bacteria | 2931 |
| 122 | Ga0068861_100169834 | 3300005719 | Bacteria | 1807 |
| 123 | Ga0068851_10035787 | 3300005834 | Bacteria | 2484 |
| 124 | Ga0068870_10029561 | 3300005840 | Unclassified | 2761 |
| 125 | Ga0068870_10098006 | 3300005840 | Bacteria | 1651 |
| 126 | Ga0068863_100380668 | 3300005841 | Bacteria | 1378 |
| 127 | Ga0068863_100380715 | 3300005841 | Bacteria | 1378 |
| 128 | Ga0068858_100099471 | 3300005842 | Bacteria | 2712 |
| 129 | Ga0068858_100100635 | 3300005842 | Bacteria | 2695 |
| 130 | Ga0068858_100137131 | 3300005842 | Bacteria | 2296 |
| 131 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 132 | Ga0068860_100096257 | 3300005843 | Bacteria | 2822 |
| 133 | Ga0068860_100221004 | 3300005843 | Bacteria | 1840 |
| 134 | Ga0068860_100499257 | 3300005843 | Bacteria | 1214 |
| 135 | Ga0068862_100007926 | 3300005844 | Bacteria | 8786 |
| 136 | Ga0068862_100131326 | 3300005844 | Bacteria | 2215 |
| 137 | Ga0068862_100332613 | 3300005844 | Bacteria | 1405 |
| 138 | Ga0081455_10000043 | 3300005937 | Bacteria | 132283 |
| 139 | Ga0081455_10011860 | 3300005937 | Bacteria | 8725 |
| 140 | Ga0081455_10052548 | 3300005937 | Bacteria | 3487 |
| 141 | Ga0081455_10082536 | 3300005937 | Bacteria | 2629 |
| 142 | Ga0081455_10099099 | 3300005937 | Bacteria | 2345 |
| 143 | Ga0081538_10066586 | 3300005981 | Bacteria | 2018 |
| 144 | Ga0081540_1000884 | 3300005983 | Bacteria | 27058 |
| 145 | Ga0081540_1003783 | 3300005983 | Bacteria | 11839 |
| 146 | Ga0081540_1004220 | 3300005983 | Bacteria | 11042 |
| 147 | Ga0081540_1005132 | 3300005983 | Bacteria | 9811 |
| 148 | Ga0081540_1012953 | 3300005983 | Bacteria | 5449 |
| 149 | Ga0081540_1014508 | 3300005983 | Bacteria | 5041 |
| 150 | Ga0081540_1019658 | 3300005983 | Bacteria | 4094 |
| 151 | Ga0081540_1025835 | 3300005983 | Bacteria | 3368 |
| 152 | Ga0081539_10006229 | 3300005985 | Bacteria | 11559 |
| 153 | Ga0081539_10010493 | 3300005985 | Bacteria | 7513 |
| 154 | Ga0081539_10053017 | 3300005985 | Bacteria | 2274 |
| 155 | Ga0081539_10063223 | 3300005985 | Bacteria | 2020 |
| 156 | Ga0070717_10003635 | 3300006028 | Bacteria | 11063 |
| 157 | Ga0070717_10005810 | 3300006028 | Bacteria | 9034 |
| 158 | Ga0070717_10292090 | 3300006028 | Bacteria | 1447 |
| 159 | Ga0075365_10007730 | 3300006038 | Bacteria | 6051 |
| 160 | Ga0075363_100017124 | 3300006048 | Bacteria | 3588 |
| 161 | Ga0075363_100072858 | 3300006048 | Bacteria | 1868 |
| 162 | Ga0075364_10046279 | 3300006051 | Bacteria | 2832 |
| 163 | Ga0075364_10329003 | 3300006051 | Bacteria | 1041 |
| 164 | Ga0070715_10001911 | 3300006163 | Bacteria | 6264 |
| 165 | Ga0070716_100001730 | 3300006173 | Bacteria | 9850 |
| 166 | Ga0070712_100021309 | 3300006175 | Bacteria | 4256 |
| 167 | Ga0075367_10060179 | 3300006178 | Bacteria | 2264 |
| 168 | Ga0075366_10013043 | 3300006195 | Bacteria | 4726 |
| 169 | Ga0075366_10095579 | 3300006195 | Bacteria | 1781 |
| 170 | Ga0097621_100054607 | 3300006237 | Bacteria | 3259 |
| 171 | Ga0075370_10044333 | 3300006353 | Bacteria | 2514 |
| 172 | Ga0075370_10141513 | 3300006353 | Bacteria | 1406 |
| 173 | Ga0068871_100012232 | 3300006358 | Bacteria | 6319 |
| 174 | Ga0075428_100013369 | 3300006844 | Bacteria | 9130 |
| 175 | Ga0075428_100460985 | 3300006844 | Bacteria | 1361 |
| 176 | Ga0075430_100344885 | 3300006846 | Bacteria | 1230 |
| 177 | Ga0075431_100010844 | 3300006847 | Bacteria | 9167 |
| 178 | Ga0075431_100318778 | 3300006847 | Bacteria | 1568 |
| 179 | Ga0075434_100004782 | 3300006871 | Bacteria | 12262 |
| 180 | Ga0075434_100043289 | 3300006871 | Bacteria | 4465 |
| 181 | Ga0075434_100368345 | 3300006871 | Bacteria | 1458 |
| 182 | Ga0068865_100043959 | 3300006881 | Bacteria | 3055 |
| 183 | Ga0097620_100048271 | 3300006931 | Bacteria | 4276 |
| 184 | Ga0099824_1011798 | 3300006942 | Bacteria | 9748 |
| 185 | Ga0099824_1013115 | 3300006942 | Bacteria | 8742 |
| 186 | Ga0099822_1000072 | 3300006943 | Bacteria | 55118 |
| 187 | Ga0075435_100015198 | 3300007076 | Bacteria | 5781 |
| 188 | Ga0099794_10122087 | 3300007265 | Bacteria | 1311 |
| 189 | Ga0099795_10022343 | 3300007788 | Bacteria | 2087 |
| 190 | Ga0099795_10040428 | 3300007788 | Bacteria | 1656 |
| 191 | Ga0099795_10104640 | 3300007788 | Bacteria | 1115 |
| 192 | Ga0105240_10002746 | 3300009093 | Bacteria | 27840 |
| 193 | Ga0105240_10010472 | 3300009093 | Bacteria | 13035 |
| 194 | Ga0105240_10030277 | 3300009093 | Bacteria | 7034 |
| 195 | Ga0105240_10052653 | 3300009093 | Bacteria | 5114 |
| 196 | Ga0105240_10306338 | 3300009093 | Bacteria | 1816 |
| 197 | Ga0105240_10571886 | 3300009093 | Bacteria | 1248 |
| 198 | Ga0111539_10000096 | 3300009094 | Bacteria | 92188 |
| 199 | Ga0111539_10030047 | 3300009094 | Bacteria | 6610 |
| 200 | Ga0111539_10076396 | 3300009094 | Bacteria | 3944 |
| 201 | Ga0105245_10021491 | 3300009098 | Bacteria | 5662 |
| 202 | Ga0105247_10310904 | 3300009101 | Bacteria | 1096 |
| 203 | Ga0114129_10092011 | 3300009147 | Bacteria | 4201 |
| 204 | Ga0114129_10532211 | 3300009147 | Bacteria | 1531 |
| 205 | Ga0105243_10247646 | 3300009148 | Bacteria | 1589 |
| 206 | Ga0105243_10542532 | 3300009148 | Bacteria | 1110 |
| 207 | Ga0105241_10028754 | 3300009174 | Bacteria | 4143 |
| 208 | Ga0105241_10034445 | 3300009174 | Bacteria | 3804 |
| 209 | Ga0105248_10117215 | 3300009177 | Bacteria | 3003 |
| 210 | Ga0105248_10517023 | 3300009177 | Bacteria | 1346 |
| 211 | Ga0105237_10002979 | 3300009545 | Bacteria | 20474 |
| 212 | Ga0105237_10004025 | 3300009545 | Bacteria | 17170 |
| 213 | Ga0105237_10043095 | 3300009545 | Bacteria | 4548 |
| 214 | Ga0105237_10097146 | 3300009545 | Bacteria | 2936 |
| 215 | Ga0105237_10238000 | 3300009545 | Bacteria | 1822 |
| 216 | Ga0105237_10508237 | 3300009545 | Bacteria | 1212 |
| 217 | Ga0105238_10098901 | 3300009551 | Bacteria | 2901 |
| 218 | Ga0105238_10275191 | 3300009551 | Bacteria | 1664 |
| 219 | Ga0105249_10026940 | 3300009553 | Bacteria | 5183 |
| 220 | Ga0123341_1000054 | 3300009765 | Bacteria | 48678 |
| 221 | Ga0099796_10024830 | 3300010159 | Bacteria | 1885 |
| 222 | Ga0105239_10002039 | 3300010375 | Bacteria | 26201 |
| 223 | Ga0105239_10088799 | 3300010375 | Bacteria | 3408 |
| 224 | Ga0105239_10150875 | 3300010375 | Bacteria | 2594 |
| 225 | Ga0105239_10224672 | 3300010375 | Bacteria | 2106 |
| 226 | Ga0105239_10291284 | 3300010375 | Bacteria | 1838 |
| 227 | Ga0105239_10313566 | 3300010375 | Bacteria | 1768 |
| 228 | Ga0105239_10601272 | 3300010375 | Bacteria | 1254 |
| 229 | Ga0105239_10656089 | 3300010375 | Bacteria | 1199 |
| 230 | Ga0105239_10660041 | 3300010375 | Bacteria | 1195 |
| 231 | Ga0105246_10020341 | 3300011119 | Bacteria | 4255 |
| 232 | Ga0105246_10232918 | 3300011119 | Bacteria | 1451 |
| 233 | Ga0157373_10001338 | 3300013100 | Bacteria | 18862 |
| 234 | Ga0157371_10086913 | 3300013102 | Bacteria | 2214 |
| 235 | Ga0157369_10006461 | 3300013105 | Bacteria | 13590 |
| 236 | Ga0157369_10017188 | 3300013105 | Bacteria | 8128 |
| 237 | Ga0157369_10039801 | 3300013105 | Bacteria | 5136 |
| 238 | Ga0157369_10167802 | 3300013105 | Bacteria | 2314 |
| 239 | Ga0157374_10418799 | 3300013296 | Bacteria | 1338 |
| 240 | Ga0157378_10153034 | 3300013297 | Bacteria | 2150 |
| 241 | Ga0157378_10246331 | 3300013297 | Bacteria | 1709 |
| 242 | Ga0163162_10118943 | 3300013306 | Bacteria | 2744 |
| 243 | Ga0163162_10192939 | 3300013306 | Bacteria | 2165 |
| 244 | Ga0163162_10459239 | 3300013306 | Bacteria | 1405 |
| 245 | Ga0157372_10101368 | 3300013307 | Bacteria | 3287 |
| 246 | Ga0157372_10161234 | 3300013307 | Bacteria | 2592 |
| 247 | Ga0157375_10058051 | 3300013308 | Bacteria | 3827 |
| 248 | Ga0157375_10083511 | 3300013308 | Bacteria | 3239 |
| 249 | Ga0157375_10148248 | 3300013308 | Bacteria | 2479 |
| 250 | Ga0157375_10183660 | 3300013308 | Bacteria | 2244 |
| 251 | Ga0163163_10045337 | 3300014325 | Bacteria | 4315 |
| 252 | Ga0163163_10089620 | 3300014325 | Bacteria | 3088 |
| 253 | Ga0163163_10777310 | 3300014325 | Bacteria | 1021 |
| 254 | Ga0157380_10048809 | 3300014326 | Bacteria | 3336 |
| 255 | Ga0157380_10112042 | 3300014326 | Bacteria | 2295 |
| 256 | Ga0157376_10012173 | 3300014969 | Bacteria | 6374 |
| 257 | Ga0157376_10148203 | 3300014969 | Bacteria | 2113 |
| 258 | Ga0157376_10156358 | 3300014969 | Bacteria | 2062 |
| 259 | Ga0182007_10034693 | 3300015262 | Bacteria | 1703 |
| 260 | Ga0163161_10004973 | 3300017792 | Bacteria | 9253 |
| 261 | Ga0206356_11198058 | 3300020070 | Bacteria | 1289 |
| 262 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 263 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 264 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 265 | Ga0214543_1003164 | 3300021327 | Bacteria | 32141 |
| 266 | Ga0213873_10001660 | 3300021358 | Bacteria | 3728 |
| 267 | Ga0213876_10009083 | 3300021384 | Bacteria | 5351 |
| 268 | Ga0213876_10048676 | 3300021384 | Bacteria | 2239 |
| 269 | Ga0213876_10051082 | 3300021384 | Bacteria | 2185 |
| 270 | Ga0213876_10157207 | 3300021384 | Bacteria | 1209 |
| 271 | Ga0213875_10002147 | 3300021388 | Bacteria | 12036 |
| 272 | Ga0213875_10002587 | 3300021388 | Bacteria | 10766 |
| 273 | Ga0213875_10031932 | 3300021388 | Bacteria | 2489 |
| 274 | Ga0209677_100908 | 3300025253 | Bacteria | 14482 |
| 275 | Ga0209677_106221 | 3300025253 | Bacteria | 2883 |
| 276 | Ga0209148_1000699 | 3300025254 | Bacteria | 27192 |
| 277 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 278 | Ga0209233_1001449 | 3300025261 | Bacteria | 9377 |
| 279 | Ga0209233_1002356 | 3300025261 | Bacteria | 7030 |
| 280 | Ga0209233_1011713 | 3300025261 | Bacteria | 2575 |
| 281 | Ga0209233_1012838 | 3300025261 | Bacteria | 2412 |
| 282 | Ga0209455_1004211 | 3300025272 | Bacteria | 4798 |
| 283 | Ga0209025_1000126 | 3300025294 | Bacteria | 200866 |
| 284 | Ga0209025_1000224 | 3300025294 | Bacteria | 133328 |
| 285 | Ga0209564_1001822 | 3300025295 | Bacteria | 19558 |
| 286 | Ga0209564_1009146 | 3300025295 | Bacteria | 4764 |
| 287 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 288 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 289 | Ga0209758_1001786 | 3300025297 | Bacteria | 23762 |
| 290 | Ga0209758_1001858 | 3300025297 | Bacteria | 23145 |
| 291 | Ga0209758_1002537 | 3300025297 | Bacteria | 18401 |
| 292 | Ga0209758_1006910 | 3300025297 | Bacteria | 7926 |
| 293 | Ga0209758_1011139 | 3300025297 | Bacteria | 5252 |
| 294 | Ga0209256_1005335 | 3300025299 | Bacteria | 7472 |
| 295 | Ga0209256_1035539 | 3300025299 | Bacteria | 1315 |
| 296 | Ga0207426_1000151 | 3300025302 | Bacteria | 185103 |
| 297 | Ga0207426_1001289 | 3300025302 | Bacteria | 21656 |
| 298 | Ga0207426_1002137 | 3300025302 | Bacteria | 13493 |
| 299 | Ga0207426_1002396 | 3300025302 | Bacteria | 12077 |
| 300 | Ga0209051_1006374 | 3300025303 | Bacteria | 6670 |
| 301 | Ga0209257_1006326 | 3300025304 | Bacteria | 7704 |
| 302 | Ga0207656_10015273 | 3300025321 | Bacteria | 2970 |
| 303 | Ga0207656_10048015 | 3300025321 | Bacteria | 1837 |
| 304 | Ga0207692_10000364 | 3300025898 | Bacteria | 15516 |
| 305 | Ga0207692_10005642 | 3300025898 | Bacteria | 5026 |
| 306 | Ga0207710_10042705 | 3300025900 | Bacteria | 2014 |
| 307 | Ga0207688_10108501 | 3300025901 | Bacteria | 1609 |
| 308 | Ga0207688_10131512 | 3300025901 | Bacteria | 1467 |
| 309 | Ga0207688_10184203 | 3300025901 | Bacteria | 1246 |
| 310 | Ga0207688_10185181 | 3300025901 | Bacteria | 1243 |
| 311 | Ga0207680_10114777 | 3300025903 | Bacteria | 1753 |
| 312 | Ga0207647_10000406 | 3300025904 | Bacteria | 35299 |
| 313 | Ga0207647_10019836 | 3300025904 | Bacteria | 4515 |
| 314 | Ga0207699_10000319 | 3300025906 | Bacteria | 25750 |
| 315 | Ga0207699_10002988 | 3300025906 | Bacteria | 8041 |
| 316 | Ga0207645_10072196 | 3300025907 | Bacteria | 2209 |
| 317 | Ga0207643_10112698 | 3300025908 | Bacteria | 1604 |
| 318 | Ga0207654_10003032 | 3300025911 | Bacteria | 8518 |
| 319 | Ga0207654_10100931 | 3300025911 | Bacteria | 1778 |
| 320 | Ga0207707_10000378 | 3300025912 | Bacteria | 46582 |
| 321 | Ga0207707_10004078 | 3300025912 | Bacteria | 12936 |
| 322 | Ga0207707_10080028 | 3300025912 | Bacteria | 2853 |
| 323 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 324 | Ga0207695_10007868 | 3300025913 | Bacteria | 13458 |
| 325 | Ga0207695_10048138 | 3300025913 | Bacteria | 4505 |
| 326 | Ga0207695_10051139 | 3300025913 | Bacteria | 4341 |
| 327 | Ga0207695_10158677 | 3300025913 | Bacteria | 2195 |
| 328 | Ga0207695_10207041 | 3300025913 | Bacteria | 1874 |
| 329 | Ga0207671_10004403 | 3300025914 | Bacteria | 13492 |
| 330 | Ga0207671_10028846 | 3300025914 | Bacteria | 4146 |
| 331 | Ga0207671_10044648 | 3300025914 | Bacteria | 3278 |
| 332 | Ga0207671_10086765 | 3300025914 | Bacteria | 2353 |
| 333 | Ga0207671_10150587 | 3300025914 | Bacteria | 1797 |
| 334 | Ga0207671_10157263 | 3300025914 | Bacteria | 1759 |
| 335 | Ga0207671_10211504 | 3300025914 | Bacteria | 1517 |
| 336 | Ga0207671_10389942 | 3300025914 | Bacteria | 1107 |
| 337 | Ga0207693_10009252 | 3300025915 | Bacteria | 8044 |
| 338 | Ga0207693_10043239 | 3300025915 | Bacteria | 3545 |
| 339 | Ga0207663_10000417 | 3300025916 | Bacteria | 18473 |
| 340 | Ga0207663_10015030 | 3300025916 | Bacteria | 4259 |
| 341 | Ga0207663_10328661 | 3300025916 | Bacteria | 1151 |
| 342 | Ga0207660_10003159 | 3300025917 | Bacteria | 10789 |
| 343 | Ga0207660_10372938 | 3300025917 | Bacteria | 1146 |
| 344 | Ga0207657_10002402 | 3300025919 | Bacteria | 20250 |
| 345 | Ga0207657_10004372 | 3300025919 | Bacteria | 14956 |
| 346 | Ga0207652_10004828 | 3300025921 | Bacteria | 10918 |
| 347 | Ga0207652_10186135 | 3300025921 | Bacteria | 1867 |
| 348 | Ga0207681_10151435 | 3300025923 | Bacteria | 1739 |
| 349 | Ga0207694_10293618 | 3300025924 | Bacteria | 1337 |
| 350 | Ga0207687_10046879 | 3300025927 | Bacteria | 2994 |
| 351 | Ga0207687_10102387 | 3300025927 | Bacteria | 2109 |
| 352 | Ga0207687_10119174 | 3300025927 | Bacteria | 1971 |
| 353 | Ga0207700_10013002 | 3300025928 | Bacteria | 5395 |
| 354 | Ga0207700_10025289 | 3300025928 | Bacteria | 4121 |
| 355 | Ga0207700_10081431 | 3300025928 | Bacteria | 2528 |
| 356 | Ga0207700_10252975 | 3300025928 | Bacteria | 1506 |
| 357 | Ga0207664_10040468 | 3300025929 | Bacteria | 3625 |
| 358 | Ga0207644_10099161 | 3300025931 | Bacteria | 2185 |
| 359 | Ga0207644_10446221 | 3300025931 | Bacteria | 1062 |
| 360 | Ga0207706_10081774 | 3300025933 | Bacteria | 2838 |
| 361 | Ga0207686_10163393 | 3300025934 | Bacteria | 1563 |
| 362 | Ga0207709_10095240 | 3300025935 | Bacteria | 1956 |
| 363 | Ga0207709_10199986 | 3300025935 | Bacteria | 1426 |
| 364 | Ga0207709_10295360 | 3300025935 | Bacteria | 1203 |
| 365 | Ga0207669_10211307 | 3300025937 | Bacteria | 1416 |
| 366 | Ga0207704_10062387 | 3300025938 | Bacteria | 2317 |
| 367 | Ga0207704_10091800 | 3300025938 | Bacteria | 1997 |
| 368 | Ga0207704_10238137 | 3300025938 | Bacteria | 1358 |
| 369 | Ga0207704_10288326 | 3300025938 | Bacteria | 1251 |
| 370 | Ga0207665_10000190 | 3300025939 | Bacteria | 41515 |
| 371 | Ga0207665_10016066 | 3300025939 | Bacteria | 4916 |
| 372 | Ga0207691_10079196 | 3300025940 | Bacteria | 2957 |
| 373 | Ga0207691_10115388 | 3300025940 | Bacteria | 2385 |
| 374 | Ga0207691_10167890 | 3300025940 | Bacteria | 1923 |
| 375 | Ga0207711_10121288 | 3300025941 | Bacteria | 2334 |
| 376 | Ga0207711_10335540 | 3300025941 | Bacteria | 1399 |
| 377 | Ga0207689_10000498 | 3300025942 | Bacteria | 37073 |
| 378 | Ga0207689_10001020 | 3300025942 | Bacteria | 26905 |
| 379 | Ga0207689_10013133 | 3300025942 | Bacteria | 7068 |
| 380 | Ga0207689_10112409 | 3300025942 | Bacteria | 2239 |
| 381 | Ga0207689_10156514 | 3300025942 | Bacteria | 1878 |
| 382 | Ga0207661_10000217 | 3300025944 | Bacteria | 37415 |
| 383 | Ga0207661_10007635 | 3300025944 | Bacteria | 7690 |
| 384 | Ga0207661_10013657 | 3300025944 | Bacteria | 5930 |
| 385 | Ga0207661_10260162 | 3300025944 | Bacteria | 1545 |
| 386 | Ga0207679_10031445 | 3300025945 | Bacteria | 3715 |
| 387 | Ga0207667_10003983 | 3300025949 | Bacteria | 18156 |
| 388 | Ga0207667_10005778 | 3300025949 | Bacteria | 15094 |
| 389 | Ga0207667_10058635 | 3300025949 | Bacteria | 4036 |
| 390 | Ga0207667_10122118 | 3300025949 | Bacteria | 2684 |
| 391 | Ga0207667_10293395 | 3300025949 | Bacteria | 1661 |
| 392 | Ga0207667_10438642 | 3300025949 | Bacteria | 1328 |
| 393 | Ga0207651_10181677 | 3300025960 | Bacteria | 1669 |
| 394 | Ga0207651_10212524 | 3300025960 | Bacteria | 1558 |
| 395 | Ga0207668_10059335 | 3300025972 | Bacteria | 2680 |
| 396 | Ga0207668_10061439 | 3300025972 | Bacteria | 2642 |
| 397 | Ga0207640_10129322 | 3300025981 | Bacteria | 1823 |
| 398 | Ga0207640_10136772 | 3300025981 | Bacteria | 1780 |
| 399 | Ga0207640_10160435 | 3300025981 | Bacteria | 1663 |
| 400 | Ga0207640_10236370 | 3300025981 | Bacteria | 1409 |
| 401 | Ga0207658_10145331 | 3300025986 | Bacteria | 1925 |
| 402 | Ga0207658_10306924 | 3300025986 | Bacteria | 1369 |
| 403 | Ga0207677_10066181 | 3300026023 | Bacteria | 2525 |
| 404 | Ga0207703_10039547 | 3300026035 | Bacteria | 3769 |
| 405 | Ga0207703_10108150 | 3300026035 | Bacteria | 2368 |
| 406 | Ga0207639_10073699 | 3300026041 | Bacteria | 2677 |
| 407 | Ga0207639_10107575 | 3300026041 | Bacteria | 2265 |
| 408 | Ga0207639_10405447 | 3300026041 | Bacteria | 1229 |
| 409 | Ga0207678_10048644 | 3300026067 | Bacteria | 3665 |
| 410 | Ga0207678_10063124 | 3300026067 | Bacteria | 3183 |
| 411 | Ga0207678_10068316 | 3300026067 | Bacteria | 3050 |
| 412 | Ga0207678_10125182 | 3300026067 | Bacteria | 2193 |
| 413 | Ga0207678_10232327 | 3300026067 | Bacteria | 1579 |
| 414 | Ga0207708_10002775 | 3300026075 | Bacteria | 12869 |
| 415 | Ga0207708_10117705 | 3300026075 | Bacteria | 2068 |
| 416 | Ga0207708_10174169 | 3300026075 | Bacteria | 1705 |
| 417 | Ga0207702_10000779 | 3300026078 | Bacteria | 33703 |
| 418 | Ga0207702_10691314 | 3300026078 | Bacteria | 1005 |
| 419 | Ga0207641_10128613 | 3300026088 | Bacteria | 2271 |
| 420 | Ga0207648_10114081 | 3300026089 | Bacteria | 2374 |
| 421 | Ga0207648_10167678 | 3300026089 | Bacteria | 1941 |
| 422 | Ga0207648_10168528 | 3300026089 | Bacteria | 1935 |
| 423 | Ga0207674_10046213 | 3300026116 | Bacteria | 4472 |
| 424 | Ga0207674_10109148 | 3300026116 | Bacteria | 2743 |
| 425 | Ga0207674_10205149 | 3300026116 | Bacteria | 1920 |
| 426 | Ga0207675_100004332 | 3300026118 | Bacteria | 13714 |
| 427 | Ga0207675_100772183 | 3300026118 | Bacteria | 973 |
| 428 | Ga0207683_10008222 | 3300026121 | Bacteria | 8926 |
| 429 | Ga0207683_10020311 | 3300026121 | Bacteria | 5680 |
| 430 | Ga0207683_10031453 | 3300026121 | Bacteria | 4606 |
| 431 | Ga0207683_10112708 | 3300026121 | Bacteria | 2436 |
| 432 | Ga0207683_10148222 | 3300026121 | Bacteria | 2117 |
| 433 | Ga0207698_10047807 | 3300026142 | Bacteria | 3245 |
| 434 | Ga0207698_10074151 | 3300026142 | Bacteria | 2713 |
| 435 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 436 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 437 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 438 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 439 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 440 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 441 | Ga0209489_100612 | 3300027361 | Bacteria | 69168 |
| 442 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 443 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 444 | Ga0209179_1021838 | 3300027512 | Bacteria | 1252 |
| 445 | Ga0209588_1014042 | 3300027671 | Bacteria | 2450 |
| 446 | Ga0209588_1051125 | 3300027671 | Bacteria | 1337 |
| 447 | Ga0207428_10000120 | 3300027907 | Bacteria | 106231 |
| 448 | Ga0207428_10256890 | 3300027907 | Bacteria | 1302 |
| 449 | Ga0268266_10001082 | 3300028379 | Bacteria | 34140 |
| 450 | Ga0268266_10018792 | 3300028379 | Bacteria | 5889 |
| 451 | Ga0268266_10020256 | 3300028379 | Bacteria | 5671 |
| 452 | Ga0268266_10022851 | 3300028379 | Bacteria | 5323 |
| 453 | Ga0268266_10068666 | 3300028379 | Bacteria | 3069 |
| 454 | Ga0268266_10142512 | 3300028379 | Bacteria | 2152 |
| 455 | Ga0268266_10177582 | 3300028379 | Bacteria | 1937 |
| 456 | Ga0268266_10186986 | 3300028379 | Bacteria | 1889 |
| 457 | Ga0268266_10303435 | 3300028379 | Bacteria | 1490 |
| 458 | Ga0268265_10209060 | 3300028380 | Bacteria | 1699 |
| 459 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 460 | Ga0265337_1006052 | 3300028556 | Bacteria | 4718 |
| 461 | Ga0265326_10003632 | 3300028558 | Bacteria | 5041 |
| 462 | Ga0265319_1009562 | 3300028563 | Bacteria | 4118 |
| 463 | Ga0265334_10018461 | 3300028573 | Bacteria | 2875 |
| 464 | Ga0265318_10014529 | 3300028577 | Bacteria | 3304 |
| 465 | Ga0265323_10002008 | 3300028653 | Bacteria | 9596 |
| 466 | Ga0265322_10022080 | 3300028654 | Bacteria | 1822 |
| 467 | Ga0265336_10002276 | 3300028666 | Bacteria | 8031 |
| 468 | Ga0307517_10004833 | 3300028786 | Bacteria | 20547 |
| 469 | Ga0307515_10025331 | 3300028794 | Bacteria | 10271 |
| 470 | Ga0307515_10343633 | 3300028794 | Bacteria | 1143 |
| 471 | Ga0265338_10007046 | 3300028800 | Bacteria | 14103 |
| 472 | Ga0265324_10012696 | 3300029957 | Bacteria | 3168 |
| 473 | Ga0307511_10059327 | 3300030521 | Bacteria | 2944 |
| 474 | Ga0265330_10008271 | 3300031235 | Bacteria | 5014 |
| 475 | Ga0265332_10006592 | 3300031238 | Bacteria | 5262 |
| 476 | Ga0265332_10011731 | 3300031238 | Bacteria | 3893 |
| 477 | Ga0265325_10004296 | 3300031241 | Bacteria | 9033 |
| 478 | Ga0265340_10003690 | 3300031247 | Bacteria | 8619 |
| 479 | Ga0265339_10001505 | 3300031249 | Bacteria | 17219 |
| 480 | Ga0265331_10014784 | 3300031250 | Bacteria | 4143 |
| 481 | Ga0265316_10110918 | 3300031344 | Bacteria | 2077 |
| 482 | Ga0307513_10084452 | 3300031456 | Bacteria | 3261 |
| 483 | Ga0307509_10009225 | 3300031507 | Bacteria | 12382 |
| 484 | Ga0307509_10082147 | 3300031507 | Bacteria | 3325 |
| 485 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 486 | Ga0307508_10288874 | 3300031616 | Bacteria | 1233 |
| 487 | Ga0316579_10000229 | 3300031691 | Bacteria | 16998 |
| 488 | Ga0265314_10002744 | 3300031711 | Bacteria | 17602 |
| 489 | Ga0265314_10012438 | 3300031711 | Bacteria | 6945 |
| 490 | Ga0265314_10140265 | 3300031711 | Bacteria | 1495 |
| 491 | Ga0265342_10057586 | 3300031712 | Bacteria | 2299 |
| 492 | Ga0316578_10028219 | 3300031728 | Bacteria | 3177 |
| 493 | Ga0307516_10033133 | 3300031730 | Bacteria | 5200 |
| 494 | Ga0307516_10056839 | 3300031730 | Bacteria | 3813 |
| 495 | Ga0307516_10064792 | 3300031730 | Bacteria | 3532 |
| 496 | Ga0307413_10055476 | 3300031824 | Bacteria | 2411 |
| 497 | Ga0307413_10176186 | 3300031824 | Bacteria | 1519 |
| 498 | Ga0307518_10137357 | 3300031838 | Bacteria | 1710 |
| 499 | Ga0307410_10073292 | 3300031852 | Bacteria | 2381 |
| 500 | Ga0307409_100325739 | 3300031995 | Bacteria | 1440 |
| 501 | Ga0307409_100552428 | 3300031995 | Bacteria | 1130 |
| 502 | Ga0307416_100324786 | 3300032002 | Bacteria | 1543 |
| 503 | Ga0316583_10001141 | 3300032133 | Bacteria | 8669 |
| 504 | Ga0307507_10007449 | 3300033179 | Bacteria | 15914 |
| 505 | Ga0307510_10022493 | 3300033180 | Bacteria | 7322 |
| 506 | Ga0307510_10063819 | 3300033180 | Bacteria | 3746 |
| 507 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 508 | Ga0373959_0033648 | 3300034820 | Bacteria | 1047 |
| 509 | Ga0373934_0016121 | 3300035086 | Bacteria | 2838 |
| 510 | Ga0373923_0000289 | 3300035111 | Bacteria | 11095 |
| 511 | Ga0373936_0015885 | 3300035113 | Bacteria | 2888 |
| 512 | Ga0373936_0109198 | 3300035113 | Bacteria | 1173 |
| 513 | Ga0373936_0148917 | 3300035113 | Bacteria | 1014 |
| 514 | Ga0373953_0019685 | 3300035117 | Bacteria | 2513 |
| 515 | Ga0373954_0015594 | 3300035118 | Bacteria | 3398 |
| 516 | Ga0373954_0099424 | 3300035118 | Bacteria | 1402 |
| 517 | Ga0373956_0010705 | 3300035119 | Bacteria | 3765 |
| 518 | Ga0373956_0086044 | 3300035119 | Bacteria | 1446 |
| 519 | Ga0373957_0009960 | 3300035120 | Bacteria | 3125 |
| 520 | Ga0373943_0033284 | 3300035170 | Bacteria | 2454 |
| 521 | Ga0373943_0068086 | 3300035170 | Bacteria | 1797 |
| 522 | Ga0373946_0003713 | 3300035171 | Bacteria | 5411 |
| 523 | Ga0373955_0023258 | 3300035172 | Bacteria | 3154 |
| 524 | Ga0373955_0092995 | 3300035172 | Bacteria | 1721 |
| 525 | Ga0373955_0287716 | 3300035172 | Bacteria | 989 |
| 526 | Ga0373924_0006636 | 3300035410 | Bacteria | 4151 |
| 527 | Ga0373924_0012573 | 3300035410 | Bacteria | 3166 |
| 528 | Ga0373935_0000499 | 3300035692 | Bacteria | 20274 |
| 529 | Ga0373935_0039296 | 3300035692 | Bacteria | 2967 |
| 530 | Ga0373935_0068682 | 3300035692 | Bacteria | 2280 |
| 531 | Ga0373927_0000437 | 3300035695 | Bacteria | 31976 |
| 532 | Ga0373927_0028546 | 3300035695 | Bacteria | 3640 |
| 533 | Ga0373927_0061213 | 3300035695 | Bacteria | 2435 |
| 534 | Ga0373933_0001296 | 3300035724 | Bacteria | 14709 |
| 535 | Ga0373933_0001914 | 3300035724 | Bacteria | 12012 |
| 536 | Ga0373933_0028125 | 3300035724 | Bacteria | 3241 |
| 537 | Ga0373933_0127537 | 3300035724 | Bacteria | 1597 |
| 538 | Ga0373947_0001481 | 3300035725 | Bacteria | 14428 |
| 539 | Ga0373947_0009460 | 3300035725 | Bacteria | 5597 |
| 540 | Ga0373947_0104142 | 3300035725 | Bacteria | 1786 |
| 541 | Ga0373947_0125977 | 3300035725 | Bacteria | 1631 |
| 542 | Ga0373947_0139127 | 3300035725 | Bacteria | 1556 |
| 543 | Ga0373937_0004047 | 3300036401 | Bacteria | 12416 |
| 544 | Ga0373937_0014169 | 3300036401 | Bacteria | 7033 |
| 545 | Ga0373937_0113131 | 3300036401 | Bacteria | 2525 |
| 546 | Ga0372808_015058 | 3300036459 | Bacteria | 1105 |
| 547 | Ga0316582_0011480 | 3300036647 | Bacteria | 4899 |
| 548 | Ga0316582_0134341 | 3300036647 | Bacteria | 1664 |
| 549 | Ga0373925_0010291 | 3300037068 | Bacteria | 6783 |
| 550 | Ga0373925_0062730 | 3300037068 | Bacteria | 2795 |
| 551 | Ga0373925_0063599 | 3300037068 | Bacteria | 2776 |
| 552 | Ga0373925_0120691 | 3300037068 | Bacteria | 2034 |
| 553 | Ga0373925_0139625 | 3300037068 | Bacteria | 1896 |
| 554 | Ga0373925_0139802 | 3300037068 | Bacteria | 1894 |
| 555 | Ga0395899_0075081 | 3300037312 | Bacteria | 2469 |
| 556 | Ga0395899_0094459 | 3300037312 | Bacteria | 2164 |
| 557 | Ga0395899_0132606 | 3300037312 | Bacteria | 1778 |
| 558 | Ga0395899_0166010 | 3300037312 | Bacteria | 1557 |
| 559 | Ga0395900_0000851 | 3300037418 | Bacteria | 40239 |
| 560 | Ga0395900_0232358 | 3300037418 | Bacteria | 1854 |
| 561 | Ga0395898_0047986 | 3300037466 | Bacteria | 4189 |
| 562 | Ga0395898_0157231 | 3300037466 | Bacteria | 2174 |
| 563 | Ga0395898_0167177 | 3300037466 | Bacteria | 2103 |
| 564 | Ga0395898_0309150 | 3300037466 | Bacteria | 1508 |
| 565 | Ga0395905_0000972 | 3300037471 | Bacteria | 36749 |
| 566 | Ga0395905_0005304 | 3300037471 | Bacteria | 13182 |
| 567 | Ga0395905_0005689 | 3300037471 | Bacteria | 12668 |
| 568 | Ga0395905_0070968 | 3300037471 | Bacteria | 3265 |
| 569 | Ga0436364_0416519 | 3300037853 | Bacteria | 115750 |
| 570 | Ga0436364_0639208 | 3300037853 | Bacteria | 10717 |
| 571 | Ga0436364_1189271 | 3300037853 | Bacteria | 2075 |
| 572 | Ga0395901_0009809 | 3300038443 | Bacteria | 9710 |
| 573 | Ga0395901_0102446 | 3300038443 | Bacteria | 3004 |
| 574 | Ga0395901_0116985 | 3300038443 | Bacteria | 2801 |
| 575 | Ga0436365_0109783 | 3300039437 | Bacteria | 28002 |
| 576 | Ga0436365_0627243 | 3300039437 | Bacteria | 2814 |
| 577 | Ga0436365_0802449 | 3300039437 | Bacteria | 1251 |
| 578 | Ga0436365_1890002 | 3300039437 | Bacteria | 1270 |
| 579 | Ga0436360_0063161 | 3300039438 | Bacteria | 1911 |
| 580 | Ga0436361_0265242 | 3300039447 | Bacteria | 3580 |
| 581 | Ga0436361_0989106 | 3300039447 | Bacteria | 1373 |
| 582 | Ga0436362_0328324 | 3300039453 | Bacteria | 3150 |
| 583 | Ga0436362_0928995 | 3300039453 | Bacteria | 2865 |
| 584 | Ga0439448_0001260 | 3300042005 | Bacteria | 6475 |
| 585 | Ga0466969_0027572 | 3300044656 | Bacteria | 2908 |
| 586 | Ga0466969_0038255 | 3300044656 | Bacteria | 2415 |
| 587 | Ga0466969_0045804 | 3300044656 | Bacteria | 2170 |
| 588 | Ga0466972_0000325 | 3300044658 | Bacteria | 26886 |
| 589 | Ga0466972_0028367 | 3300044658 | Bacteria | 2761 |
| 590 | Ga0453683_0107497 | 3300044673 | Bacteria | 1754 |
| 591 | Ga0466965_0006371 | 3300044683 | Bacteria | 5353 |
| 592 | Ga0466965_0019908 | 3300044683 | Bacteria | 3222 |
| 593 | Ga0466966_0012258 | 3300044684 | Bacteria | 5680 |
| 594 | Ga0466966_0118327 | 3300044684 | Bacteria | 1629 |
| 595 | Ga0466961_0000132 | 3300044693 | Bacteria | 49595 |
| 596 | Ga0466961_0071535 | 3300044693 | Bacteria | 2201 |
| 597 | Ga0466963_0021127 | 3300044694 | Bacteria | 4102 |
| 598 | Ga0466964_0013052 | 3300044706 | Bacteria | 3148 |
| 599 | Ga0453684_0001209 | 3300044712 | Bacteria | 79474 |
| 600 | Ga0453684_0018189 | 3300044712 | Bacteria | 10812 |
| 601 | Ga0453684_0397884 | 3300044712 | Bacteria | 1543 |
| 602 | Ga0466968_0004242 | 3300044735 | Bacteria | 5346 |
| 603 | Ga0466957_0045106 | 3300044842 | Bacteria | 2673 |
| 604 | Ga0466957_0108073 | 3300044842 | Bacteria | 1761 |
| 605 | Ga0466960_0007335 | 3300044901 | Bacteria | 4474 |
| 606 | Ga0466959_0000295 | 3300045049 | Bacteria | 29676 |
| 607 | Ga0466959_0007796 | 3300045049 | Bacteria | 7532 |
| 608 | Ga0466959_0089733 | 3300045049 | Bacteria | 2208 |
| 609 | Ga0466967_0021340 | 3300045976 | Bacteria | 5258 |
| 610 | Ga0466967_0073807 | 3300045976 | Bacteria | 3061 |
| 611 | Ga0466967_0344879 | 3300045976 | Bacteria | 1441 |
| 612 | Ga0495617_027153 | 3300046452 | Bacteria | 1927 |
| 613 | Ga0495617_052860 | 3300046452 | Bacteria | 1349 |
| 614 | Ga0495592_0003354 | 3300046454 | Bacteria | 11465 |
| 615 | Ga0495592_0018326 | 3300046454 | Bacteria | 5322 |
| 616 | Ga0495592_0023956 | 3300046454 | Bacteria | 4643 |
| 617 | Ga0495592_0149639 | 3300046454 | Bacteria | 1615 |
| 618 | Ga0495603_0000040 | 3300046455 | Bacteria | 55056 |
| 619 | Ga0495603_0002873 | 3300046455 | Bacteria | 10184 |
| 620 | Ga0495603_0044454 | 3300046455 | Bacteria | 2650 |
| 621 | Ga0495603_0089349 | 3300046455 | Bacteria | 1802 |
| 622 | Ga0495603_0091424 | 3300046455 | Bacteria | 1779 |
| 623 | Ga0495603_0102118 | 3300046455 | Bacteria | 1674 |
| 624 | Ga0495590_0053509 | 3300046457 | Bacteria | 1409 |
| 625 | Ga0495629_0000077 | 3300046459 | Bacteria | 85931 |
| 626 | Ga0495629_0000188 | 3300046459 | Bacteria | 56009 |
| 627 | Ga0495629_0106813 | 3300046459 | Bacteria | 1953 |
| 628 | Ga0495638_0013009 | 3300046460 | Bacteria | 5682 |
| 629 | Ga0495638_0179570 | 3300046460 | Bacteria | 1208 |
| 630 | Ga0495641_0008119 | 3300046461 | Bacteria | 6447 |
| 631 | Ga0495641_0132254 | 3300046461 | Bacteria | 1114 |
| 632 | Ga0495651_0000271 | 3300046462 | Bacteria | 40231 |
| 633 | Ga0495651_0023165 | 3300046462 | Bacteria | 4829 |
| 634 | Ga0495651_0023797 | 3300046462 | Bacteria | 4763 |
| 635 | Ga0495651_0074528 | 3300046462 | Bacteria | 2574 |
| 636 | Ga0495653_0004244 | 3300046463 | Bacteria | 11611 |
| 637 | Ga0495653_0104811 | 3300046463 | Bacteria | 2043 |
| 638 | Ga0495653_0175933 | 3300046463 | Bacteria | 1473 |
| 639 | Ga0495650_0060222 | 3300046471 | Bacteria | 1525 |
| 640 | Ga0495580_0003456 | 3300046472 | Bacteria | 13444 |
| 641 | Ga0495580_0004422 | 3300046472 | Bacteria | 11810 |
| 642 | Ga0495580_0298139 | 3300046472 | Bacteria | 1098 |
| 643 | Ga0495582_0000020 | 3300046473 | Bacteria | 88349 |
| 644 | Ga0495582_0052261 | 3300046473 | Bacteria | 2253 |
| 645 | Ga0495605_0008346 | 3300046474 | Bacteria | 5858 |
| 646 | Ga0495639_0000011 | 3300046475 | Bacteria | 92268 |
| 647 | Ga0495639_0020094 | 3300046475 | Bacteria | 2917 |
| 648 | Ga0495662_0000229 | 3300046476 | Bacteria | 23341 |
| 649 | Ga0495662_0084561 | 3300046476 | Bacteria | 1544 |
| 650 | Ga0495662_0189151 | 3300046476 | Bacteria | 1015 |
| 651 | Ga0495664_0006970 | 3300046477 | Bacteria | 6261 |
| 652 | Ga0495664_0028905 | 3300046477 | Bacteria | 3239 |
| 653 | Ga0495664_0066710 | 3300046477 | Bacteria | 2146 |
| 654 | Ga0495584_0133370 | 3300046491 | Bacteria | 1260 |
| 655 | Ga0495585_0001246 | 3300046492 | Bacteria | 20537 |
| 656 | Ga0495585_0062171 | 3300046492 | Bacteria | 2051 |
| 657 | Ga0495585_0084374 | 3300046492 | Bacteria | 1718 |
| 658 | Ga0495596_0071301 | 3300046500 | Bacteria | 1349 |
| 659 | Ga0495607_0039575 | 3300046501 | Bacteria | 2815 |
| 660 | Ga0495583_0024110 | 3300046506 | Bacteria | 3064 |
| 661 | Ga0495606_0000186 | 3300046507 | Bacteria | 109172 |
| 662 | Ga0495606_0001881 | 3300046507 | Bacteria | 26299 |
| 663 | Ga0495606_0027650 | 3300046507 | Bacteria | 4016 |
| 664 | Ga0495606_0043102 | 3300046507 | Bacteria | 3013 |
| 665 | Ga0495608_0006190 | 3300046511 | Bacteria | 8495 |
| 666 | Ga0495608_0026863 | 3300046511 | Bacteria | 3921 |
| 667 | Ga0495608_0131387 | 3300046511 | Bacteria | 1602 |
| 668 | Ga0495610_0002153 | 3300046512 | Bacteria | 16753 |
| 669 | Ga0495616_0025893 | 3300046513 | Bacteria | 3128 |
| 670 | Ga0495616_0039835 | 3300046513 | Bacteria | 2404 |
| 671 | Ga0495616_0108459 | 3300046513 | Bacteria | 1292 |
| 672 | Ga0495616_0126353 | 3300046513 | Bacteria | 1176 |
| 673 | Ga0495618_0036142 | 3300046514 | Bacteria | 3100 |
| 674 | Ga0495618_0256246 | 3300046514 | Bacteria | 1096 |
| 675 | Ga0495620_0026829 | 3300046515 | Bacteria | 2704 |
| 676 | Ga0495620_0044658 | 3300046515 | Bacteria | 1924 |
| 677 | Ga0495628_0036603 | 3300046516 | Bacteria | 3937 |
| 678 | Ga0495628_0050238 | 3300046516 | Bacteria | 3299 |
| 679 | Ga0495630_0005419 | 3300046517 | Bacteria | 9006 |
| 680 | Ga0495630_0197713 | 3300046517 | Bacteria | 1534 |
| 681 | Ga0495631_0016680 | 3300046518 | Bacteria | 3494 |
| 682 | Ga0495631_0041980 | 3300046518 | Bacteria | 2022 |
| 683 | Ga0495632_0018833 | 3300046519 | Bacteria | 3775 |
| 684 | Ga0495632_0090724 | 3300046519 | Bacteria | 1449 |
| 685 | Ga0495643_0024447 | 3300046522 | Bacteria | 3426 |
| 686 | Ga0495643_0131436 | 3300046522 | Bacteria | 1256 |
| 687 | Ga0495648_0001821 | 3300046524 | Bacteria | 20522 |
| 688 | Ga0495648_0006381 | 3300046524 | Bacteria | 9639 |
| 689 | Ga0495648_0075054 | 3300046524 | Bacteria | 1946 |
| 690 | Ga0495648_0097879 | 3300046524 | Bacteria | 1626 |
| 691 | Ga0495652_0004764 | 3300046529 | Bacteria | 12908 |
| 692 | Ga0495652_0020613 | 3300046529 | Bacteria | 5859 |
| 693 | Ga0495652_0055109 | 3300046529 | Bacteria | 3382 |
| 694 | Ga0495652_0112922 | 3300046529 | Bacteria | 2182 |
| 695 | Ga0495665_0000133 | 3300046531 | Bacteria | 35771 |
| 696 | Ga0495665_0165372 | 3300046531 | Bacteria | 1152 |
| 697 | Ga0495640_0006645 | 3300046533 | Bacteria | 9127 |
| 698 | Ga0495640_0010408 | 3300046533 | Bacteria | 7193 |
| 699 | Ga0495640_0050384 | 3300046533 | Bacteria | 2868 |
| 700 | Ga0495640_0223939 | 3300046533 | Bacteria | 1185 |
| 701 | Ga0495586_0052280 | 3300046535 | Bacteria | 2212 |
| 702 | Ga0495587_0003226 | 3300046536 | Bacteria | 10906 |
| 703 | Ga0495587_0044816 | 3300046536 | Bacteria | 2630 |
| 704 | Ga0495587_0045939 | 3300046536 | Bacteria | 2594 |
| 705 | Ga0495598_0009153 | 3300046537 | Bacteria | 2331 |
| 706 | Ga0495609_0047167 | 3300046538 | Bacteria | 1928 |
| 707 | Ga0495621_0003331 | 3300046539 | Bacteria | 4428 |
| 708 | Ga0495645_0008894 | 3300046543 | Bacteria | 7016 |
| 709 | Ga0495645_0013345 | 3300046543 | Bacteria | 5807 |
| 710 | Ga0495645_0024316 | 3300046543 | Bacteria | 4395 |
| 711 | Ga0495645_0037041 | 3300046543 | Bacteria | 3555 |
| 712 | Ga0495622_0008052 | 3300046557 | Bacteria | 4886 |
| 713 | Ga0495622_0021201 | 3300046557 | Bacteria | 3027 |
| 714 | Ga0495622_0119717 | 3300046557 | Bacteria | 1202 |
| 715 | Ga0495667_0001104 | 3300046559 | Bacteria | 17551 |
| 716 | Ga0495667_0007596 | 3300046559 | Bacteria | 7358 |
| 717 | Ga0495667_0010094 | 3300046559 | Bacteria | 6395 |
| 718 | Ga0495667_0026308 | 3300046559 | Bacteria | 3921 |
| 719 | Ga0495667_0035944 | 3300046559 | Bacteria | 3309 |
| 720 | Ga0495667_0252021 | 3300046559 | Bacteria | 1123 |
| 721 | Ga0495656_0005561 | 3300046615 | Bacteria | 4355 |
| 722 | Ga0495656_0028536 | 3300046615 | Bacteria | 2239 |
| 723 | Ga0495656_0050930 | 3300046615 | Bacteria | 1770 |
| 724 | Ga0495668_0006779 | 3300046616 | Bacteria | 7442 |
| 725 | Ga0495668_0010958 | 3300046616 | Bacteria | 5457 |
| 726 | Ga0495668_0032597 | 3300046616 | Bacteria | 2930 |
| 727 | Ga0495668_0051728 | 3300046616 | Bacteria | 2274 |
| 728 | Ga0495668_0117269 | 3300046616 | Bacteria | 1456 |
| 729 | Ga0495634_0000402 | 3300046642 | Bacteria | 42617 |
| 730 | Ga0495634_0009196 | 3300046642 | Bacteria | 7295 |
| 731 | Ga0495634_0047380 | 3300046642 | Bacteria | 2897 |
| 732 | Ga0495634_0053945 | 3300046642 | Bacteria | 2691 |
| 733 | Ga0495634_0074637 | 3300046642 | Bacteria | 2228 |
| 734 | Ga0495611_0033915 | 3300046648 | Bacteria | 2254 |
| 735 | Ga0495625_0001536 | 3300046660 | Bacteria | 27569 |
| 736 | Ga0495625_0002662 | 3300046660 | Bacteria | 19020 |
| 737 | Ga0495625_0084999 | 3300046660 | Bacteria | 2197 |
| 738 | Ga0495625_0307521 | 3300046660 | Bacteria | 1012 |
| 739 | Ga0495635_0000196 | 3300046663 | Bacteria | 38194 |
| 740 | Ga0495635_0012249 | 3300046663 | Bacteria | 6009 |
| 741 | Ga0495635_0015570 | 3300046663 | Bacteria | 5315 |
| 742 | Ga0495635_0050962 | 3300046663 | Bacteria | 2853 |
| 743 | Ga0495635_0257922 | 3300046663 | Bacteria | 1174 |
| 744 | Ga0495659_0040465 | 3300046664 | Bacteria | 1661 |
| 745 | Ga0495588_0001382 | 3300046674 | Bacteria | 10366 |
| 746 | Ga0495588_0010446 | 3300046674 | Bacteria | 4318 |
| 747 | Ga0495657_0001347 | 3300046675 | Bacteria | 21368 |
| 748 | Ga0495657_0003332 | 3300046675 | Bacteria | 13159 |
| 749 | Ga0495657_0054766 | 3300046675 | Bacteria | 2663 |
| 750 | Ga0495657_0138339 | 3300046675 | Bacteria | 1520 |
| 751 | Ga0495657_0159888 | 3300046675 | Bacteria | 1394 |
| 752 | Ga0495599_0015309 | 3300046678 | Bacteria | 4759 |
| 753 | Ga0495599_0019003 | 3300046678 | Bacteria | 4284 |
| 754 | Ga0495599_0036386 | 3300046678 | Bacteria | 3091 |
| 755 | Ga0495599_0170988 | 3300046678 | Bacteria | 1341 |
| 756 | Ga0495623_0004419 | 3300046679 | Bacteria | 9239 |
| 757 | Ga0495623_0037495 | 3300046679 | Bacteria | 3101 |
| 758 | Ga0495623_0090059 | 3300046679 | Bacteria | 1884 |
| 759 | Ga0495646_0009557 | 3300046680 | Bacteria | 6156 |
| 760 | Ga0495646_0025141 | 3300046680 | Bacteria | 3747 |
| 761 | Ga0495646_0043300 | 3300046680 | Bacteria | 2758 |
| 762 | Ga0495646_0044961 | 3300046680 | Bacteria | 2698 |
| 763 | Ga0495646_0060392 | 3300046680 | Bacteria | 2261 |
| 764 | Ga0495647_0010003 | 3300046681 | Bacteria | 3223 |
| 765 | Ga0495647_0042605 | 3300046681 | Bacteria | 1734 |
| 766 | Ga0495658_0000538 | 3300046683 | Bacteria | 20615 |
| 767 | Ga0495658_0019954 | 3300046683 | Bacteria | 3507 |
| 768 | Ga0495658_0193917 | 3300046683 | Bacteria | 1264 |
| 769 | Ga0495669_0008807 | 3300046684 | Bacteria | 4251 |
| 770 | Ga0495613_0000873 | 3300046689 | Bacteria | 23135 |
| 771 | Ga0495613_0001148 | 3300046689 | Bacteria | 20201 |
| 772 | Ga0495613_0027935 | 3300046689 | Bacteria | 4200 |
| 773 | Ga0495613_0052618 | 3300046689 | Bacteria | 2998 |
| 774 | Ga0495613_0169878 | 3300046689 | Bacteria | 1548 |
| 775 | Ga0495613_0269400 | 3300046689 | Bacteria | 1185 |
| 776 | Ga0495624_0000819 | 3300046690 | Bacteria | 24553 |
| 777 | Ga0495624_0044349 | 3300046690 | Bacteria | 2835 |
| 778 | Ga0495624_0119709 | 3300046690 | Bacteria | 1617 |
| 779 | Ga0495671_0082806 | 3300046692 | Bacteria | 1572 |
| 780 | Ga0495671_0124526 | 3300046692 | Bacteria | 1257 |
| 781 | Ga0495649_0040650 | 3300046694 | Bacteria | 2545 |
| 782 | Ga0495600_0001932 | 3300046809 | Bacteria | 11640 |
| 783 | Ga0495600_0012427 | 3300046809 | Bacteria | 5323 |
| 784 | Ga0495600_0030740 | 3300046809 | Bacteria | 3478 |
| 785 | Ga0495600_0103745 | 3300046809 | Bacteria | 1853 |
| 786 | Ga0495600_0188945 | 3300046809 | Bacteria | 1325 |
| 787 | Ga0495581_0000518 | 3300047315 | Bacteria | 19734 |
| 788 | Ga0495581_0007817 | 3300047315 | Bacteria | 6192 |
| 789 | Ga0495581_0129026 | 3300047315 | Bacteria | 1473 |
| 790 | Ga0495581_0142230 | 3300047315 | Bacteria | 1400 |
| 791 | Ga0495604_0002485 | 3300047317 | Bacteria | 14722 |
| 792 | Ga0495604_0004984 | 3300047317 | Bacteria | 10513 |
| 793 | Ga0495604_0017542 | 3300047317 | Bacteria | 5732 |
| 794 | Ga0495604_0020026 | 3300047317 | Bacteria | 5346 |
| 795 | Ga0495604_0121713 | 3300047317 | Bacteria | 1888 |
| 796 | Ga0495604_0146058 | 3300047317 | Bacteria | 1685 |
| 797 | Ga0495674_0001070 | 3300047319 | Bacteria | 26357 |
| 798 | Ga0495674_0013696 | 3300047319 | Bacteria | 7618 |
| 799 | Ga0495674_0041838 | 3300047319 | Bacteria | 4090 |
| 800 | Ga0495674_0066903 | 3300047319 | Bacteria | 3115 |
| 801 | Ga0495674_0211732 | 3300047319 | Bacteria | 1605 |
| 802 | Ga0495674_0334735 | 3300047319 | Bacteria | 1231 |
| 803 | Ga0495676_0033175 | 3300047321 | Bacteria | 4351 |
| 804 | Ga0495680_0001198 | 3300047322 | Bacteria | 28460 |
| 805 | Ga0495680_0013711 | 3300047322 | Bacteria | 7055 |
| 806 | Ga0495680_0089446 | 3300047322 | Bacteria | 2311 |
| 807 | Ga0495683_0000532 | 3300047323 | Bacteria | 28893 |
| 808 | Ga0495683_0021057 | 3300047323 | Bacteria | 3361 |
| 809 | Ga0495687_025008 | 3300047443 | Bacteria | 2829 |
| 810 | Ga0495675_0000638 | 3300047444 | Bacteria | 22292 |
| 811 | Ga0495675_0003907 | 3300047444 | Bacteria | 9025 |
| 812 | Ga0495675_0058177 | 3300047444 | Bacteria | 2451 |
| 813 | Ga0495675_0145751 | 3300047444 | Bacteria | 1465 |
| 814 | Ga0495675_0206245 | 3300047444 | Bacteria | 1195 |
| 815 | Ga0495677_0056715 | 3300047445 | Bacteria | 1447 |
| 816 | Ga0495673_0006897 | 3300047469 | Bacteria | 6621 |
| 817 | Ga0495684_0000068 | 3300047471 | Bacteria | 70808 |
| 818 | Ga0495684_0025140 | 3300047471 | Bacteria | 4579 |
| 819 | Ga0495684_0063761 | 3300047471 | Bacteria | 2801 |
| 820 | Ga0495684_0088205 | 3300047471 | Bacteria | 2351 |
| 821 | Ga0495684_0117110 | 3300047471 | Bacteria | 2008 |
| 822 | Ga0495686_0004768 | 3300047472 | Bacteria | 10971 |
| 823 | Ga0495686_0025525 | 3300047472 | Bacteria | 3872 |
| 824 | Ga0495686_0119814 | 3300047472 | Bacteria | 1570 |
| 825 | Ga0495686_0155136 | 3300047472 | Bacteria | 1341 |
| 826 | Ga0495593_0000006 | 3300047673 | Bacteria | 90370 |
| 827 | Ga0495593_0007104 | 3300047673 | Bacteria | 6565 |
| 828 | Ga0495593_0031542 | 3300047673 | Bacteria | 2894 |
| 829 | Ga0495593_0074513 | 3300047673 | Bacteria | 1760 |
| 830 | Ga0495602_0001578 | 3300048088 | Bacteria | 22679 |
| 831 | Ga0495602_0011453 | 3300048088 | Bacteria | 9169 |
| 832 | Ga0495602_0015304 | 3300048088 | Bacteria | 7750 |
| 833 | Ga0495602_0066086 | 3300048088 | Bacteria | 3117 |
| 834 | Ga0495614_0004871 | 3300048089 | Bacteria | 6061 |
| 835 | Ga0495614_0088486 | 3300048089 | Bacteria | 1346 |
| 836 | Ga0495614_0177202 | 3300048089 | Bacteria | 958 |
| 837 | Ga0495615_0007661 | 3300048090 | Bacteria | 2058 |
| 838 | Ga0496100_0066259 | 3300048903 | Bacteria | 2395 |
| 839 | Ga0496100_0077186 | 3300048903 | Bacteria | 2239 |
| 840 | Ga0496100_0245954 | 3300048903 | Bacteria | 1321 |
| 841 | Ga0496101_0026205 | 3300048904 | Bacteria | 4053 |
| 842 | Ga0496101_0161563 | 3300048904 | Bacteria | 1718 |
| 843 | Ga0496102_0003559 | 3300048905 | Bacteria | 13195 |
| 844 | Ga0496102_0036626 | 3300048905 | Bacteria | 4421 |
| 845 | Ga0496102_0056022 | 3300048905 | Bacteria | 3595 |
| 846 | Ga0496102_0057999 | 3300048905 | Bacteria | 3537 |
| 847 | Ga0496103_0030094 | 3300048906 | Bacteria | 3302 |
| 848 | Ga0496104_0001744 | 3300048907 | Bacteria | 18783 |
| 849 | Ga0496104_0035142 | 3300048907 | Bacteria | 4678 |
| 850 | Ga0496104_0078243 | 3300048907 | Bacteria | 3151 |
| 851 | Ga0496104_0082553 | 3300048907 | Bacteria | 3064 |
| 852 | Ga0496104_0107877 | 3300048907 | Bacteria | 2668 |
| 853 | Ga0496104_0122241 | 3300048907 | Bacteria | 2499 |
| 854 | Ga0496105_0002142 | 3300048908 | Bacteria | 14301 |
| 855 | Ga0496105_0011609 | 3300048908 | Bacteria | 6969 |
| 856 | Ga0496105_0083831 | 3300048908 | Bacteria | 2632 |
| 857 | Ga0496106_0000627 | 3300048909 | Bacteria | 25272 |
| 858 | Ga0496106_0006300 | 3300048909 | Bacteria | 8785 |
| 859 | Ga0496106_0006841 | 3300048909 | Bacteria | 8439 |
| 860 | Ga0496106_0085203 | 3300048909 | Bacteria | 2433 |
| 861 | Ga0496106_0113709 | 3300048909 | Bacteria | 2110 |
| 862 | Ga0496107_0005103 | 3300048910 | Bacteria | 8953 |
| 863 | Ga0496107_0011833 | 3300048910 | Bacteria | 6093 |
| 864 | Ga0496107_0013020 | 3300048910 | Bacteria | 5811 |
| 865 | Ga0496107_0091698 | 3300048910 | Bacteria | 2221 |
| 866 | Ga0496107_0171468 | 3300048910 | Bacteria | 1610 |
| 867 | Ga0496108_0000259 | 3300048911 | Bacteria | 45599 |
| 868 | Ga0496108_0127426 | 3300048911 | Bacteria | 2186 |
| 869 | Ga0496109_0000250 | 3300048912 | Bacteria | 51687 |
| 870 | Ga0496109_0017185 | 3300048912 | Bacteria | 6335 |
| 871 | Ga0496109_0037911 | 3300048912 | Bacteria | 4356 |
| 872 | Ga0496109_0096845 | 3300048912 | Bacteria | 2734 |
| 873 | Ga0496110_0010988 | 3300048913 | Bacteria | 7387 |
| 874 | Ga0496110_0018274 | 3300048913 | Bacteria | 5878 |
| 875 | Ga0496110_0037452 | 3300048913 | Bacteria | 4216 |
| 876 | Ga0496110_0048968 | 3300048913 | Bacteria | 3706 |
| 877 | Ga0496110_0094810 | 3300048913 | Bacteria | 2672 |
| 878 | Ga0496110_0106383 | 3300048913 | Bacteria | 2517 |
| 879 | Ga0496110_0150182 | 3300048913 | Bacteria | 2109 |
| 880 | Ga0496110_0224236 | 3300048913 | Bacteria | 1709 |
| 881 | Ga0496111_0020268 | 3300048914 | Bacteria | 4627 |
| 882 | Ga0496111_0029410 | 3300048914 | Bacteria | 3903 |
| 883 | Ga0496111_0186563 | 3300048914 | Bacteria | 1542 |
| 884 | Ga0496111_0192179 | 3300048914 | Bacteria | 1518 |
| 885 | Ga0496111_0314913 | 3300048914 | Bacteria | 1159 |
| 886 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 887 | Ga0496112_0052717 | 3300048915 | Bacteria | 3993 |
| 888 | Ga0496112_0082096 | 3300048915 | Bacteria | 3188 |
| 889 | Ga0496112_0180320 | 3300048915 | Bacteria | 2076 |
| 890 | Ga0496112_0202931 | 3300048915 | Bacteria | 1941 |
| 891 | Ga0496112_0631898 | 3300048915 | Bacteria | 1001 |
| 892 | Ga0496113_0029385 | 3300048916 | Bacteria | 3968 |
| 893 | Ga0496113_0036230 | 3300048916 | Bacteria | 3613 |
| 894 | Ga0496113_0059155 | 3300048916 | Bacteria | 2886 |
| 895 | Ga0496113_0081737 | 3300048916 | Bacteria | 2477 |
| 896 | Ga0496113_0174718 | 3300048916 | Bacteria | 1702 |
| 897 | Ga0496113_0395442 | 3300048916 | Bacteria | 1109 |
| 898 | Ga0496114_0053748 | 3300048917 | Bacteria | 3357 |
| 899 | Ga0496114_0135248 | 3300048917 | Bacteria | 2131 |
| 900 | Ga0496114_0173409 | 3300048917 | Bacteria | 1881 |
| 901 | Ga0496115_0003885 | 3300048918 | Bacteria | 10774 |
| 902 | Ga0496115_0015437 | 3300048918 | Bacteria | 5794 |
| 903 | Ga0496115_0040567 | 3300048918 | Bacteria | 3702 |
| 904 | Ga0496115_0051006 | 3300048918 | Bacteria | 3317 |
| 905 | Ga0496115_0067618 | 3300048918 | Bacteria | 2890 |
| 906 | Ga0496115_0335258 | 3300048918 | Bacteria | 1235 |
| 907 | Ga0496116_0001079 | 3300048919 | Bacteria | 32822 |
| 908 | Ga0496116_0027016 | 3300048919 | Bacteria | 4183 |
| 909 | Ga0496117_0027627 | 3300048920 | Bacteria | 4415 |
| 910 | Ga0496117_0044446 | 3300048920 | Bacteria | 3218 |
| 911 | Ga0496117_0100523 | 3300048920 | Bacteria | 1831 |
| 912 | Ga0496117_0119834 | 3300048920 | Bacteria | 1619 |
| 913 | Ga0496118_0005263 | 3300048921 | Bacteria | 14775 |
| 914 | Ga0496118_0047345 | 3300048921 | Bacteria | 3333 |
| 915 | Ga0496118_0076350 | 3300048921 | Bacteria | 2383 |
| 916 | Ga0496118_0129688 | 3300048921 | Bacteria | 1622 |
| 917 | Ga0496119_0096025 | 3300048922 | Bacteria | 1673 |
| 918 | Ga0496119_0108049 | 3300048922 | Bacteria | 1550 |
| 919 | Ga0496119_0162604 | 3300048922 | Bacteria | 1185 |
| 920 | Ga0496120_0009024 | 3300048923 | Bacteria | 7126 |
| 921 | Ga0496120_0079037 | 3300048923 | Bacteria | 1786 |
| 922 | Ga0496120_0101831 | 3300048923 | Bacteria | 1516 |
| 923 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 924 | Ga0496121_0001488 | 3300048924 | Bacteria | 39493 |
| 925 | Ga0496121_0007872 | 3300048924 | Bacteria | 12746 |
| 926 | Ga0496121_0011984 | 3300048924 | Bacteria | 9533 |
| 927 | Ga0496121_0014293 | 3300048924 | Bacteria | 8440 |
| 928 | Ga0496121_0014476 | 3300048924 | Bacteria | 8365 |
| 929 | Ga0496121_0025495 | 3300048924 | Bacteria | 5607 |
| 930 | Ga0496121_0061849 | 3300048924 | Bacteria | 3070 |
| 931 | Ga0496121_0103153 | 3300048924 | Bacteria | 2195 |
| 932 | Ga0496121_0108787 | 3300048924 | Bacteria | 2120 |
| 933 | Ga0496121_0256017 | 3300048924 | Bacteria | 1211 |
| 934 | Ga0496121_0265938 | 3300048924 | Bacteria | 1181 |
| 935 | Ga0496122_0019761 | 3300048925 | Bacteria | 6137 |
| 936 | Ga0496122_0071868 | 3300048925 | Bacteria | 2463 |
| 937 | Ga0496123_0053912 | 3300048926 | Bacteria | 2653 |
| 938 | Ga0496123_0140078 | 3300048926 | Bacteria | 1324 |
| 939 | Ga0496124_0001646 | 3300048927 | Bacteria | 31986 |
| 940 | Ga0496124_0069807 | 3300048927 | Bacteria | 2916 |
| 941 | Ga0496124_0105539 | 3300048927 | Bacteria | 2276 |
| 942 | Ga0496124_0136445 | 3300048927 | Bacteria | 1942 |
| 943 | Ga0496125_0018563 | 3300048928 | Bacteria | 6603 |
| 944 | Ga0496125_0020254 | 3300048928 | Bacteria | 6247 |
| 945 | Ga0496125_0048379 | 3300048928 | Bacteria | 3547 |
| 946 | Ga0496125_0052034 | 3300048928 | Bacteria | 3371 |
| 947 | Ga0496125_0059141 | 3300048928 | Bacteria | 3090 |
| 948 | Ga0496125_0103617 | 3300048928 | Bacteria | 2087 |
| 949 | Ga0496125_0131027 | 3300048928 | Bacteria | 1765 |
| 950 | Ga0496126_0005288 | 3300048929 | Bacteria | 14814 |
| 951 | Ga0496126_0005411 | 3300048929 | Bacteria | 14568 |
| 952 | Ga0496126_0006081 | 3300048929 | Bacteria | 13538 |
| 953 | Ga0496126_0020645 | 3300048929 | Bacteria | 6452 |
| 954 | Ga0496126_0032207 | 3300048929 | Bacteria | 4941 |
| 955 | Ga0496126_0065925 | 3300048929 | Bacteria | 3238 |
| 956 | Ga0496126_0068821 | 3300048929 | Bacteria | 3159 |
| 957 | Ga0496126_0090667 | 3300048929 | Bacteria | 2689 |
| 958 | Ga0496126_0109374 | 3300048929 | Bacteria | 2409 |
| 959 | Ga0496126_0122534 | 3300048929 | Bacteria | 2253 |
| 960 | Ga0496126_0131606 | 3300048929 | Bacteria | 2161 |
| 961 | Ga0496126_0135001 | 3300048929 | Bacteria | 2129 |
| 962 | Ga0496126_0215692 | 3300048929 | Bacteria | 1614 |
| 963 | Ga0496126_0235250 | 3300048929 | Bacteria | 1533 |
| 964 | Ga0496126_0328725 | 3300048929 | Bacteria | 1255 |
| 965 | Ga0501031_0000368 | 3300049568 | Bacteria | 26339 |
| 966 | Ga0501032_0000392 | 3300049569 | Bacteria | 36103 |
| 967 | Ga0501032_0000696 | 3300049569 | Bacteria | 27371 |
| 968 | Ga0501033_0000232 | 3300049570 | Bacteria | 53703 |
| 969 | Ga0501033_0002168 | 3300049570 | Bacteria | 16958 |
| 970 | Ga0501033_0019714 | 3300049570 | Bacteria | 5097 |
| 971 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 972 | Ga0501034_0000487 | 3300049571 | Bacteria | 64548 |
| 973 | Ga0501034_0000704 | 3300049571 | Bacteria | 50735 |
| 974 | Ga0501034_0251834 | 3300049571 | Bacteria | 1710 |
| 975 | Ga0501034_0479742 | 3300049571 | Bacteria | 1159 |
| 976 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 977 | Ga0501036_0000052 | 3300049572 | Bacteria | 74795 |
| 978 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 979 | Ga0501037_0000066 | 3300049573 | Bacteria | 96723 |
| 980 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 981 | Ga0501038_0000168 | 3300049574 | Bacteria | 55496 |
| 982 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 983 | Ga0501039_0001742 | 3300049575 | Bacteria | 16050 |
| 984 | Ga0501039_0036113 | 3300049575 | Bacteria | 3813 |
| 985 | Ga0501039_0286137 | 3300049575 | Bacteria | 1296 |
| 986 | Ga0501042_0060090 | 3300049578 | Bacteria | 2715 |
| 987 | Ga0501042_0087410 | 3300049578 | Bacteria | 2236 |
| 988 | Ga0501042_0140884 | 3300049578 | Bacteria | 1739 |
| 989 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 990 | Ga0501043_0063197 | 3300049579 | Bacteria | 2907 |
| 991 | Ga0501043_0175848 | 3300049579 | Bacteria | 1669 |
| 992 | Ga0501046_0000147 | 3300049580 | Bacteria | 74186 |
| 993 | Ga0501046_0000231 | 3300049580 | Bacteria | 57655 |
| 994 | Ga0501046_0038560 | 3300049580 | Bacteria | 3833 |
| 995 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 996 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 997 | Ga0501048_0000460 | 3300049582 | Bacteria | 28509 |
| 998 | Ga0501048_0000585 | 3300049582 | Bacteria | 25849 |
| 999 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 1000 | Ga0501067_0038575 | 3300049583 | Bacteria | 2652 |
| 1001 | Ga0501068_0000569 | 3300049584 | Bacteria | 18796 |
| 1002 | Ga0501068_0000944 | 3300049584 | Bacteria | 15231 |
| 1003 | Ga0501069_0001325 | 3300049585 | Bacteria | 12134 |
| 1004 | Ga0501069_0109798 | 3300049585 | Bacteria | 1570 |
| 1005 | Ga0501070_0000163 | 3300049586 | Bacteria | 60911 |
| 1006 | Ga0501070_0077515 | 3300049586 | Bacteria | 2751 |
| 1007 | Ga0501070_0174909 | 3300049586 | Bacteria | 1768 |
| 1008 | Ga0501071_0018672 | 3300049587 | Bacteria | 4807 |
| 1009 | Ga0501071_0036003 | 3300049587 | Bacteria | 3529 |
| 1010 | Ga0501071_0108835 | 3300049587 | Bacteria | 2047 |
| 1011 | Ga0501071_0135408 | 3300049587 | Bacteria | 1833 |
| 1012 | Ga0501072_0001295 | 3300049588 | Bacteria | 18708 |
| 1013 | Ga0501072_0026856 | 3300049588 | Bacteria | 4492 |
| 1014 | Ga0501073_0000070 | 3300049589 | Bacteria | 63026 |
| 1015 | Ga0501073_0000135 | 3300049589 | Bacteria | 47869 |
| 1016 | Ga0501074_0001792 | 3300049590 | Bacteria | 14692 |
| 1017 | Ga0501074_0006247 | 3300049590 | Bacteria | 8604 |
| 1018 | Ga0501074_0094574 | 3300049590 | Bacteria | 2140 |
| 1019 | Ga0501079_0017767 | 3300049741 | Bacteria | 5434 |
| 1020 | Ga0501079_0299247 | 3300049741 | Bacteria | 1259 |
| 1021 | Ga0501079_0316818 | 3300049741 | Bacteria | 1221 |
| 1022 | Ga0501080_0000137 | 3300049742 | Bacteria | 51355 |
| 1023 | Ga0501080_0001229 | 3300049742 | Bacteria | 21299 |
| 1024 | Ga0501081_0163805 | 3300049743 | Bacteria | 1603 |
| 1025 | Ga0501083_0001024 | 3300049744 | Bacteria | 18626 |
| 1026 | Ga0501083_0003716 | 3300049744 | Bacteria | 10720 |
| 1027 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 1028 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 1029 | Ga0501035_0325637 | 3300049822 | Bacteria | 1290 |
| 1030 | Ga0501044_0000217 | 3300049823 | Bacteria | 73242 |
| 1031 | Ga0501044_0000366 | 3300049823 | Bacteria | 56832 |
| 1032 | Ga0501044_0006616 | 3300049823 | Bacteria | 12783 |
| 1033 | Ga0501044_0277867 | 3300049823 | Bacteria | 1609 |
| 1034 | Ga0501045_0006921 | 3300049824 | Bacteria | 7858 |
| 1035 | nmdc:mga03n38_7548_c1 | 3300050490 | Bacteria | 3853 |
| 1036 | nmdc:mga00v17_110651_c1 | 3300050491 | Bacteria | 1742 |
| 1037 | nmdc:mga00v17_271279_c1 | 3300050491 | Bacteria | 1101 |
| 1038 | nmdc:mga0yw44_160354_c1 | 3300050492 | Bacteria | 1472 |
| 1039 | nmdc:mga0yw44_51827_c1 | 3300050492 | Bacteria | 2486 |
| 1040 | nmdc:mga0k408_13681_c1 | 3300050493 | Bacteria | 4455 |
| 1041 | nmdc:mga06z11_54938_c1 | 3300050494 | Bacteria | 2054 |
| 1042 | nmdc:mga06z11_68549_c1 | 3300050494 | Bacteria | 1870 |
| 1043 | nmdc:mga07m45_102699_c1 | 3300050496 | Bacteria | 1642 |
| 1044 | nmdc:mga07m45_145902_c1 | 3300050496 | Bacteria | 1372 |
| 1045 | nmdc:mga05p37_150674_c1 | 3300050507 | Bacteria | 2845 |
| 1046 | nmdc:mga05p37_496891_c1 | 3300050507 | Bacteria | 1401 |
| 1047 | nmdc:mga06r32_286815_c1 | 3300050510 | Bacteria | 1633 |
| 1048 | nmdc:mga08y16_104785_c1 | 3300050511 | Bacteria | 2944 |
| 1049 | nmdc:mga08y16_42_c1 | 3300050511 | Bacteria | 128353 |
| 1050 | nmdc:mga08y16_86051_c1 | 3300050511 | Bacteria | 3276 |
| 1051 | nmdc:mga0n895_2522_c1 | 3300050512 | Bacteria | 14348 |
| 1052 | nmdc:mga0n895_687443_c1 | 3300050512 | Bacteria | 1020 |
| 1053 | nmdc:mga0rr50_37517_c1 | 3300050513 | Bacteria | 3499 |
| 1054 | nmdc:mga08x19_229594_c1 | 3300050514 | Bacteria | 1277 |
| 1055 | nmdc:mga08x19_239436_c1 | 3300050514 | Bacteria | 1250 |
| 1056 | nmdc:mga0sz30_25482_c1 | 3300050516 | Bacteria | 1683 |
| 1057 | nmdc:mga0sz30_32419_c1 | 3300050516 | Bacteria | 2167 |
| 1058 | Ga0495601_0071383 | 3300053077 | Bacteria | 2217 |
| 1059 | Ga0495601_0077685 | 3300053077 | Bacteria | 2126 |
| 1060 | Ga0495601_0102088 | 3300053077 | Bacteria | 1853 |
| 1061 | Ga0495612_0151909 | 3300053078 | Bacteria | 1008 |
| 1062 | Ga0500610_0002697 | 3300053079 | Bacteria | 6615 |
| 1063 | Ga0500610_0040047 | 3300053079 | Bacteria | 2421 |
| 1064 | Ga0500635_0001266 | 3300053080 | Bacteria | 6035 |
| 1065 | Ga0495655_0053123 | 3300053083 | Bacteria | 1080 |
| 1066 | Ga0495595_0011980 | 3300053084 | Bacteria | 3636 |
| 1067 | Ga0495619_0000829 | 3300053085 | Bacteria | 20282 |
| 1068 | Ga0495619_0018115 | 3300053085 | Bacteria | 4465 |
| 1069 | Ga0495619_0039802 | 3300053085 | Bacteria | 3070 |
| 1070 | Ga0495619_0118554 | 3300053085 | Bacteria | 1813 |
| 1071 | Ga0495619_0208246 | 3300053085 | Bacteria | 1354 |
| 1072 | Ga0495619_0234646 | 3300053085 | Bacteria | 1271 |
| 1073 | Ga0500578_0077899 | 3300053086 | Bacteria | 2110 |
| 1074 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 1075 | Ga0500643_013747 | 3300053087 | Bacteria | 2843 |
| 1076 | Ga0500651_0037460 | 3300053093 | Bacteria | 3057 |
| 1077 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 1078 | Ga0500566_0000479 | 3300053094 | Bacteria | 22269 |
| 1079 | Ga0500566_0001303 | 3300053094 | Bacteria | 14556 |
| 1080 | Ga0500641_0005452 | 3300053096 | Bacteria | 4510 |
| 1081 | Ga0500641_0006170 | 3300053096 | Bacteria | 4249 |
| 1082 | Ga0500555_005858 | 3300053103 | Bacteria | 3486 |
| 1083 | Ga0500555_016917 | 3300053103 | Bacteria | 2102 |
| 1084 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1085 | Ga0500562_017164 | 3300053108 | Bacteria | 1864 |
| 1086 | Ga0500562_030941 | 3300053108 | Bacteria | 1411 |
| 1087 | Ga0500562_046085 | 3300053108 | Bacteria | 1162 |
| 1088 | Ga0500569_027465 | 3300053109 | Bacteria | 1568 |
| 1089 | Ga0500572_001745 | 3300053111 | Bacteria | 5639 |
| 1090 | Ga0500594_0003721 | 3300053118 | Bacteria | 3361 |
| 1091 | Ga0500594_0015719 | 3300053118 | Bacteria | 1830 |
| 1092 | Ga0500594_0072417 | 3300053118 | Bacteria | 1016 |
| 1093 | Ga0500595_000722 | 3300053119 | Bacteria | 19637 |
| 1094 | Ga0500595_001442 | 3300053119 | Bacteria | 12692 |
| 1095 | Ga0500595_004127 | 3300053119 | Bacteria | 6589 |
| 1096 | Ga0500595_049370 | 3300053119 | Bacteria | 1311 |
| 1097 | Ga0500608_013224 | 3300053122 | Bacteria | 3651 |
| 1098 | Ga0500608_018017 | 3300053122 | Bacteria | 3216 |
| 1099 | Ga0500608_021825 | 3300053122 | Bacteria | 2962 |
| 1100 | Ga0500642_0000114 | 3300053130 | Bacteria | 37434 |
| 1101 | Ga0500642_0185555 | 3300053130 | Bacteria | 971 |
| 1102 | Ga0500652_000620 | 3300053131 | Bacteria | 12220 |
| 1103 | Ga0500658_0145375 | 3300053134 | Bacteria | 1066 |
| 1104 | Ga0500559_0001123 | 3300053136 | Bacteria | 16112 |
| 1105 | Ga0500559_0002307 | 3300053136 | Bacteria | 10015 |
| 1106 | Ga0500559_0009193 | 3300053136 | Bacteria | 4290 |
| 1107 | Ga0500559_0030298 | 3300053136 | Bacteria | 2319 |
| 1108 | Ga0500559_0085045 | 3300053136 | Bacteria | 1442 |
| 1109 | Ga0500568_0000331 | 3300053139 | Bacteria | 37235 |
| 1110 | Ga0500573_0053716 | 3300053140 | Bacteria | 2314 |
| 1111 | Ga0500577_0001256 | 3300053142 | Bacteria | 6490 |
| 1112 | Ga0500590_049087 | 3300053148 | Bacteria | 2148 |
| 1113 | Ga0500603_016007 | 3300053150 | Bacteria | 1773 |
| 1114 | Ga0500604_0045811 | 3300053151 | Bacteria | 1336 |
| 1115 | Ga0500616_0007504 | 3300053153 | Bacteria | 6910 |
| 1116 | Ga0500619_013213 | 3300053154 | Bacteria | 2182 |
| 1117 | Ga0500620_016047 | 3300053155 | Bacteria | 2132 |
| 1118 | Ga0500622_0038867 | 3300053156 | Bacteria | 2482 |
| 1119 | Ga0500627_0082826 | 3300053158 | Bacteria | 1431 |
| 1120 | Ga0500630_001851 | 3300053159 | Bacteria | 10169 |
| 1121 | Ga0500633_0037242 | 3300053160 | Bacteria | 1614 |
| 1122 | Ga0500634_0109761 | 3300053161 | Bacteria | 1364 |
| 1123 | Ga0500638_063273 | 3300053162 | Bacteria | 1776 |
| 1124 | Ga0500638_070179 | 3300053162 | Bacteria | 1675 |
| 1125 | Ga0500639_000099 | 3300053163 | Bacteria | 40200 |
| 1126 | Ga0500636_0001860 | 3300053177 | Bacteria | 11559 |
| 1127 | Ga0500636_0004209 | 3300053177 | Bacteria | 8147 |
| 1128 | Ga0500636_0058733 | 3300053177 | Bacteria | 2248 |
| 1129 | Ga0500636_0071286 | 3300053177 | Bacteria | 2015 |
| 1130 | Ga0500637_0185181 | 3300053178 | Bacteria | 1191 |
| 1131 | Ga0500576_052040 | 3300053725 | Bacteria | 1813 |
| 1132 | Ga0500645_033245 | 3300053730 | Bacteria | 1544 |
| 1133 | Ga0500552_001614 | 3300053733 | Bacteria | 2147 |
| 1134 | Ga0500596_005195 | 3300053735 | Bacteria | 2316 |
| 1135 | Ga0500599_006575 | 3300053736 | Bacteria | 1482 |
| 1136 | Ga0500599_008745 | 3300053736 | Bacteria | 1319 |
| 1137 | Ga0500601_000092 | 3300053737 | Bacteria | 18784 |
| 1138 | Ga0501084_0012682 | 3300054114 | Bacteria | 6984 |
| 1139 | Ga0501084_0110470 | 3300054114 | Bacteria | 2310 |
| 1140 | Ga0501082_0099045 | 3300060353 | Bacteria | 2520 |
| 1141 | Ga0501082_0232769 | 3300060353 | Bacteria | 1603 |
| 1142 | Ga0501082_0266726 | 3300060353 | Bacteria | 1490 |
| 1143 | Ga0466962_0061949 | 3300061719 | Bacteria | 1786 |
| 1144 | Ga0466962_0136920 | 3300061719 | Bacteria | 1185 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0000392 | Ga0501032_0000392_12911_13900 | 275 |
| 2 | 3300049570 | Ga0501033_0000232 | Ga0501033_0000232_41162_42151 | 275 |
| 3 | 3300049571 | Ga0501034_0000704 | Ga0501034_0000704_37053_38042 | 275 |
| 4 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_190272_191261 | 275 |
| 5 | 3300049573 | Ga0501037_0000066 | Ga0501037_0000066_84511_85500 | 275 |
| 6 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_50567_51556 | 275 |
| 7 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_60930_61919 | 275 |
| 8 | 3300049578 | Ga0501042_0140884 | Ga0501042_0140884_542_1531 | 275 |
| 9 | 3300049579 | Ga0501043_0000036 | Ga0501043_0000036_94450_95439 | 275 |
| 10 | 3300049580 | Ga0501046_0000147 | Ga0501046_0000147_44383_45372 | 275 |
| 11 | 3300049581 | Ga0501047_0000209 | Ga0501047_0000209_19660_20649 | 275 |
| 12 | 3300049582 | Ga0501048_0000460 | Ga0501048_0000460_1703_2692 | 275 |
| 13 | 3300049583 | Ga0501067_0038575 | Ga0501067_0038575_862_1851 | 275 |
| 14 | 3300049584 | Ga0501068_0000569 | Ga0501068_0000569_17760_18749 | 275 |
| 15 | 3300049586 | Ga0501070_0000163 | Ga0501070_0000163_46533_47522 | 275 |
| 16 | 3300049587 | Ga0501071_0108835 | Ga0501071_0108835_79_1068 | 275 |
| 17 | 3300049588 | Ga0501072_0026856 | Ga0501072_0026856_2952_3941 | 275 |
| 18 | 3300049589 | Ga0501073_0000070 | Ga0501073_0000070_8898_9887 | 275 |
| 19 | 3300049590 | Ga0501074_0006247 | Ga0501074_0006247_7597_8586 | 275 |
| 20 | 3300049742 | Ga0501080_0000137 | Ga0501080_0000137_10239_11228 | 275 |
| 21 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_2913_3902 | 275 |
| 22 | 3300049823 | Ga0501044_0000366 | Ga0501044_0000366_43879_44868 | 275 |
| 23 | 3300026075 | Ga0207708_10117705 | Ga0207708_101177052 | 281 |
| 24 | 3300031711 | Ga0265314_10140265 | Ga0265314_101402652 | 283 |
| 25 | 3300031241 | Ga0265325_10004296 | Ga0265325_100042965 | 288 |
| 26 | 3300039437 | Ga0436365_0109783 | Ga0436365_0109783_8849_9718 | 288 |
| 27 | 3300039453 | Ga0436362_0928995 | Ga0436362_0928995_1095_1964 | 288 |
| 28 | 3300017792 | Ga0163161_10004973 | Ga0163161_100049736 | 290 |
| 29 | 3300046507 | Ga0495606_0001881 | Ga0495606_0001881_8991_9980 | 290 |
| 30 | 3300046660 | Ga0495625_0001536 | Ga0495625_0001536_20366_21355 | 290 |
| 31 | 3300006844 | Ga0075428_100460985 | Ga0075428_1004609851 | 292 |
| 32 | 3300006846 | Ga0075430_100344885 | Ga0075430_1003448852 | 292 |
| 33 | 3300006847 | Ga0075431_100318778 | Ga0075431_1003187782 | 292 |
| 34 | 3300006871 | Ga0075434_100368345 | Ga0075434_1003683452 | 292 |
| 35 | 3300009094 | Ga0111539_10030047 | Ga0111539_100300473 | 292 |
| 36 | 3300009147 | Ga0114129_10092011 | Ga0114129_100920112 | 292 |
| 37 | 3300014326 | Ga0157380_10048809 | Ga0157380_100488094 | 292 |
| 38 | 3300025907 | Ga0207645_10072196 | Ga0207645_100721962 | 292 |
| 39 | 3300026089 | Ga0207648_10114081 | Ga0207648_101140812 | 292 |
| 40 | 3300027907 | Ga0207428_10256890 | Ga0207428_102568901 | 292 |
| 41 | 3300048915 | Ga0496112_0631898 | Ga0496112_0631898_64_954 | 292 |
| 42 | 3300050507 | nmdc:mga05p37_150674_c1 | nmdc:mga05p37_150674_c1_759_1649 | 292 |
| 43 | 3300050510 | nmdc:mga06r32_286815_c1 | nmdc:mga06r32_286815_c1_239_1129 | 292 |
| 44 | 3300050511 | nmdc:mga08y16_86051_c1 | nmdc:mga08y16_86051_c1_990_1919 | 292 |
| 45 | 3300050512 | nmdc:mga0n895_2522_c1 | nmdc:mga0n895_2522_c1_333_1256 | 292 |
| 46 | 3300050513 | nmdc:mga0rr50_37517_c1 | nmdc:mga0rr50_37517_c1_792_1715 | 292 |
| 47 | 3300005334 | Ga0068869_100015050 | Ga0068869_1000150501 | 293 |
| 48 | 3300005345 | Ga0070692_10060822 | Ga0070692_100608222 | 293 |
| 49 | 3300005438 | Ga0070701_10022506 | Ga0070701_100225063 | 293 |
| 50 | 3300005459 | Ga0068867_100070765 | Ga0068867_1000707652 | 293 |
| 51 | 3300005544 | Ga0070686_100002442 | Ga0070686_1000024426 | 293 |
| 52 | 3300005546 | Ga0070696_100012771 | Ga0070696_1000127711 | 293 |
| 53 | 3300005615 | Ga0070702_100001701 | Ga0070702_1000017014 | 293 |
| 54 | 3300005844 | Ga0068862_100007926 | Ga0068862_1000079263 | 293 |
| 55 | 3300009553 | Ga0105249_10026940 | Ga0105249_100269404 | 293 |
| 56 | 3300025934 | Ga0207686_10163393 | Ga0207686_101633932 | 293 |
| 57 | 3300025938 | Ga0207704_10062387 | Ga0207704_100623872 | 293 |
| 58 | 3300025944 | Ga0207661_10260162 | Ga0207661_102601622 | 293 |
| 59 | 3300026118 | Ga0207675_100004332 | Ga0207675_10000433211 | 293 |
| 60 | 3300026121 | Ga0207683_10020311 | Ga0207683_100203112 | 293 |
| 61 | 3300048920 | Ga0496117_0119834 | Ga0496117_0119834_290_1198 | 293 |
| 62 | 3300048928 | Ga0496125_0059141 | Ga0496125_0059141_1387_2295 | 293 |
| 63 | 3300049571 | Ga0501034_0000487 | Ga0501034_0000487_63536_64453 | 293 |
| 64 | 3300006871 | Ga0075434_100004782 | Ga0075434_1000047824 | 294 |
| 65 | 3300007076 | Ga0075435_100015198 | Ga0075435_1000151982 | 294 |
| 66 | 3300014325 | Ga0163163_10089620 | Ga0163163_100896201 | 294 |
| 67 | 3300026088 | Ga0207641_10128613 | Ga0207641_101286132 | 294 |
| 68 | 3300037312 | Ga0395899_0132606 | Ga0395899_0132606_251_1153 | 294 |
| 69 | 3300037466 | Ga0395898_0309150 | Ga0395898_0309150_524_1426 | 294 |
| 70 | 3300037471 | Ga0395905_0005689 | Ga0395905_0005689_3527_4429 | 294 |
| 71 | 3300044712 | Ga0453684_0001209 | Ga0453684_0001209_51593_52498 | 294 |
| 72 | 3300044712 | Ga0453684_0018189 | Ga0453684_0018189_8499_9404 | 294 |
| 73 | 3300044712 | Ga0453684_0397884 | Ga0453684_0397884_612_1517 | 294 |
| 74 | 3300048907 | Ga0496104_0082553 | Ga0496104_0082553_565_1503 | 294 |
| 75 | 3300048913 | Ga0496110_0018274 | Ga0496110_0018274_906_1844 | 294 |
| 76 | 3300048915 | Ga0496112_0180320 | Ga0496112_0180320_25_963 | 294 |
| 77 | 3300005334 | Ga0068869_100023837 | Ga0068869_1000238375 | 295 |
| 78 | 3300005354 | Ga0070675_100255976 | Ga0070675_1002559761 | 295 |
| 79 | 3300005364 | Ga0070673_100408276 | Ga0070673_1004082761 | 295 |
| 80 | 3300005436 | Ga0070713_100517810 | Ga0070713_1005178101 | 295 |
| 81 | 3300005440 | Ga0070705_100066294 | Ga0070705_1000662942 | 295 |
| 82 | 3300005441 | Ga0070700_100002411 | Ga0070700_1000024116 | 295 |
| 83 | 3300005548 | Ga0070665_100177949 | Ga0070665_1001779492 | 295 |
| 84 | 3300005617 | Ga0068859_100048271 | Ga0068859_1000482712 | 295 |
| 85 | 3300005718 | Ga0068866_10002218 | Ga0068866_100022186 | 295 |
| 86 | 3300005719 | Ga0068861_100034910 | Ga0068861_1000349103 | 295 |
| 87 | 3300005840 | Ga0068870_10029561 | Ga0068870_100295612 | 295 |
| 88 | 3300005840 | Ga0068870_10098006 | Ga0068870_100980062 | 295 |
| 89 | 3300005842 | Ga0068858_100100635 | Ga0068858_1001006353 | 295 |
| 90 | 3300005843 | Ga0068860_100096257 | Ga0068860_1000962573 | 295 |
| 91 | 3300005844 | Ga0068862_100332613 | Ga0068862_1003326132 | 295 |
| 92 | 3300006237 | Ga0097621_100054607 | Ga0097621_1000546072 | 295 |
| 93 | 3300006358 | Ga0068871_100012232 | Ga0068871_1000122324 | 295 |
| 94 | 3300006844 | Ga0075428_100013369 | Ga0075428_1000133694 | 295 |
| 95 | 3300006847 | Ga0075431_100010844 | Ga0075431_1000108446 | 295 |
| 96 | 3300006931 | Ga0097620_100048271 | Ga0097620_1000482712 | 295 |
| 97 | 3300009093 | Ga0105240_10002746 | Ga0105240_1000274614 | 295 |
| 98 | 3300009147 | Ga0114129_10532211 | Ga0114129_105322112 | 295 |
| 99 | 3300009545 | Ga0105237_10002979 | Ga0105237_1000297911 | 295 |
| 100 | 3300010375 | Ga0105239_10002039 | Ga0105239_1000203911 | 295 |
| 101 | 3300010375 | Ga0105239_10150875 | Ga0105239_101508753 | 295 |
| 102 | 3300013100 | Ga0157373_10001338 | Ga0157373_100013384 | 295 |
| 103 | 3300013105 | Ga0157369_10006461 | Ga0157369_100064616 | 295 |
| 104 | 3300013297 | Ga0157378_10153034 | Ga0157378_101530342 | 295 |
| 105 | 3300013308 | Ga0157375_10148248 | Ga0157375_101482483 | 295 |
| 106 | 3300014326 | Ga0157380_10112042 | Ga0157380_101120423 | 295 |
| 107 | 3300014969 | Ga0157376_10012173 | Ga0157376_100121732 | 295 |
| 108 | 3300025904 | Ga0207647_10000406 | Ga0207647_1000040620 | 295 |
| 109 | 3300025908 | Ga0207643_10112698 | Ga0207643_101126982 | 295 |
| 110 | 3300025913 | Ga0207695_10007868 | Ga0207695_100078688 | 295 |
| 111 | 3300025914 | Ga0207671_10028846 | Ga0207671_100288462 | 295 |
| 112 | 3300025919 | Ga0207657_10002402 | Ga0207657_1000240215 | 295 |
| 113 | 3300025935 | Ga0207709_10095240 | Ga0207709_100952402 | 295 |
| 114 | 3300025938 | Ga0207704_10091800 | Ga0207704_100918001 | 295 |
| 115 | 3300025941 | Ga0207711_10121288 | Ga0207711_101212883 | 295 |
| 116 | 3300025942 | Ga0207689_10000498 | Ga0207689_1000049825 | 295 |
| 117 | 3300025942 | Ga0207689_10001020 | Ga0207689_100010207 | 295 |
| 118 | 3300025949 | Ga0207667_10003983 | Ga0207667_1000398314 | 295 |
| 119 | 3300025960 | Ga0207651_10212524 | Ga0207651_102125241 | 295 |
| 120 | 3300026035 | Ga0207703_10108150 | Ga0207703_101081502 | 295 |
| 121 | 3300026075 | Ga0207708_10002775 | Ga0207708_100027755 | 295 |
| 122 | 3300042005 | Ga0439448_0001260 | Ga0439448_0001260_2159_3076 | 295 |
| 123 | 3300044673 | Ga0453683_0107497 | Ga0453683_0107497_294_1202 | 295 |
| 124 | 3300049587 | Ga0501071_0135408 | Ga0501071_0135408_344_1294 | 295 |
| 125 | 3300050507 | nmdc:mga05p37_496891_c1 | nmdc:mga05p37_496891_c1_394_1326 | 295 |
| 126 | 3300053131 | Ga0500652_000620 | Ga0500652_000620_1474_2391 | 295 |
| 127 | 3300003354 | JGI25160J50197_1002766 | JGI25160J50197_10027666 | 296 |
| 128 | 3300009094 | Ga0111539_10000096 | Ga0111539_1000009660 | 296 |
| 129 | 3300013102 | Ga0157371_10086913 | Ga0157371_100869132 | 296 |
| 130 | 3300013307 | Ga0157372_10161234 | Ga0157372_101612342 | 296 |
| 131 | 3300025294 | Ga0209025_1000224 | Ga0209025_1000224115 | 296 |
| 132 | 3300025297 | Ga0209758_1001786 | Ga0209758_10017862 | 296 |
| 133 | 3300025302 | Ga0207426_1000151 | Ga0207426_1000151148 | 296 |
| 134 | 3300027907 | Ga0207428_10000120 | Ga0207428_1000012037 | 296 |
| 135 | 3300031730 | Ga0307516_10056839 | Ga0307516_100568394 | 296 |
| 136 | 3300046689 | Ga0495613_0001148 | Ga0495613_0001148_1115_2011 | 296 |
| 137 | 3300049568 | Ga0501031_0000368 | Ga0501031_0000368_13077_13979 | 296 |
| 138 | 3300049569 | Ga0501032_0000696 | Ga0501032_0000696_26179_27081 | 296 |
| 139 | 3300049570 | Ga0501033_0002168 | Ga0501033_0002168_10566_11468 | 296 |
| 140 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_178275_179177 | 296 |
| 141 | 3300049572 | Ga0501036_0000052 | Ga0501036_0000052_6965_7867 | 296 |
| 142 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_80844_81746 | 296 |
| 143 | 3300049574 | Ga0501038_0000168 | Ga0501038_0000168_15321_16223 | 296 |
| 144 | 3300049575 | Ga0501039_0001742 | Ga0501039_0001742_13348_14250 | 296 |
| 145 | 3300049578 | Ga0501042_0087410 | Ga0501042_0087410_1286_2188 | 296 |
| 146 | 3300049580 | Ga0501046_0000231 | Ga0501046_0000231_2786_3688 | 296 |
| 147 | 3300049581 | Ga0501047_0000379 | Ga0501047_0000379_48267_49169 | 296 |
| 148 | 3300049582 | Ga0501048_0000585 | Ga0501048_0000585_18012_18914 | 296 |
| 149 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_56894_57796 | 296 |
| 150 | 3300049584 | Ga0501068_0000944 | Ga0501068_0000944_10578_11480 | 296 |
| 151 | 3300049585 | Ga0501069_0001325 | Ga0501069_0001325_169_1071 | 296 |
| 152 | 3300049587 | Ga0501071_0018672 | Ga0501071_0018672_2358_3260 | 296 |
| 153 | 3300049588 | Ga0501072_0001295 | Ga0501072_0001295_11332_12234 | 296 |
| 154 | 3300049589 | Ga0501073_0000135 | Ga0501073_0000135_13243_14145 | 296 |
| 155 | 3300049590 | Ga0501074_0001792 | Ga0501074_0001792_6826_7728 | 296 |
| 156 | 3300049741 | Ga0501079_0017767 | Ga0501079_0017767_2549_3451 | 296 |
| 157 | 3300049742 | Ga0501080_0001229 | Ga0501080_0001229_11269_12171 | 296 |
| 158 | 3300049744 | Ga0501083_0001024 | Ga0501083_0001024_10838_11740 | 296 |
| 159 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_21467_22369 | 296 |
| 160 | 3300049823 | Ga0501044_0000217 | Ga0501044_0000217_5412_6314 | 296 |
| 161 | 3300049824 | Ga0501045_0006921 | Ga0501045_0006921_5049_5951 | 296 |
| 162 | 3300050511 | nmdc:mga08y16_42_c1 | nmdc:mga08y16_42_c1_14454_15356 | 296 |
| 163 | 3300054114 | Ga0501084_0012682 | Ga0501084_0012682_5831_6733 | 296 |
| 164 | 3300060353 | Ga0501082_0099045 | Ga0501082_0099045_702_1604 | 296 |
| 165 | iso_pu_bacteria | 2507262055 | 2507507641 | 296 |
| 166 | iso_pu_bacteria | 2508501009 | 2508541758 | 296 |
| 167 | iso_pu_bacteria | 2508501042 | 2508692698 | 296 |
| 168 | iso_pu_bacteria | 2511231028 | 2511395362 | 296 |
| 169 | iso_pu_bacteria | 2513237092 | 2513621845 | 296 |
| 170 | iso_pu_bacteria | 2513237094 | 2513636716 | 296 |
| 171 | iso_pu_bacteria | 2513237095 | 2513647536 | 296 |
| 172 | iso_pu_bacteria | 2513237102 | 2513701493 | 296 |
| 173 | iso_pu_bacteria | 2513237104 | 2513721272 | 296 |
| 174 | iso_pu_bacteria | 2513237139 | 2513878664 | 296 |
| 175 | iso_pu_bacteria | 2513237161 | 2514009409 | 296 |
| 176 | iso_pu_bacteria | 2515154112 | 2515626096 | 296 |
| 177 | iso_pu_bacteria | 2517093001 | 2517104177 | 296 |
| 178 | iso_pu_bacteria | 2524023205 | 2524436260 | 296 |
| 179 | iso_pu_bacteria | 2528768022 | 2528848960 | 296 |
| 180 | iso_pu_bacteria | 2617270735 | 2617346817 | 296 |
| 181 | iso_pu_bacteria | 2617270741 | 2617372749 | 296 |
| 182 | iso_pu_bacteria | 2744054633 | 2745080785 | 296 |
| 183 | iso_pu_bacteria | 2791355196 | 2793060895 | 296 |
| 184 | iso_pu_bacteria | 2802429603 | 2805921313 | 296 |
| 185 | iso_pu_bacteria | 2816332527 | 2818236573 | 296 |
| 186 | iso_pu_bacteria | 2824617872 | 2824620446 | 296 |
| 187 | iso_pu_bacteria | 2824626560 | 2824628506 | 296 |
| 188 | iso_pu_bacteria | 2824635225 | 2824637206 | 296 |
| 189 | iso_pu_bacteria | 2824644064 | 2824645871 | 296 |
| 190 | iso_pu_bacteria | 2824661429 | 2824666147 | 296 |
| 191 | iso_pu_bacteria | 2824671348 | 2824678373 | 296 |
| 192 | iso_pu_bacteria | 2824687955 | 2824694814 | 296 |
| 193 | iso_pu_bacteria | 2824696289 | 2824699603 | 296 |
| 194 | iso_pu_bacteria | 2824704595 | 2824711161 | 296 |
| 195 | iso_pu_bacteria | 2824723954 | 2824725599 | 296 |
| 196 | iso_pu_bacteria | 2824732956 | 2824737206 | 296 |
| 197 | iso_pu_bacteria | 2824746037 | 2824748844 | 296 |
| 198 | iso_pu_bacteria | 2824753945 | 2824756001 | 296 |
| 199 | iso_pu_bacteria | 2824763712 | 2824767539 | 296 |
| 200 | iso_pu_bacteria | 2824773399 | 2824775106 | 296 |
| 201 | iso_pu_bacteria | 2838122688 | 2838130457 | 296 |
| 202 | iso_pu_bacteria | 2841941048 | 2841948106 | 296 |
| 203 | iso_pu_bacteria | 2841949485 | 2841953499 | 296 |
| 204 | iso_pu_bacteria | 2841957949 | 2841962903 | 296 |
| 205 | iso_pu_bacteria | 2841966195 | 2841972023 | 296 |
| 206 | iso_pu_bacteria | 2841974524 | 2841978227 | 296 |
| 207 | iso_pu_bacteria | 2841983080 | 2841990969 | 296 |
| 208 | iso_pu_bacteria | 2842038055 | 2842040670 | 296 |
| 209 | iso_pu_bacteria | 2842045827 | 2842046384 | 296 |
| 210 | iso_pu_bacteria | 2844315083 | 2844320048 | 296 |
| 211 | iso_pu_bacteria | 2844533157 | 2844535928 | 296 |
| 212 | iso_pu_bacteria | 2847930680 | 2847937342 | 296 |
| 213 | iso_pu_bacteria | 2847939898 | 2847947766 | 296 |
| 214 | iso_pu_bacteria | 2849076700 | 2849078373 | 296 |
| 215 | iso_pu_bacteria | 2857509624 | 2857512750 | 296 |
| 216 | iso_pu_bacteria | 2874590934 | 2874598756 | 296 |
| 217 | iso_pu_bacteria | 2874612657 | 2874614551 | 296 |
| 218 | iso_pu_bacteria | 2874620515 | 2874628100 | 296 |
| 219 | iso_pu_bacteria | 2874628541 | 2874634985 | 296 |
| 220 | iso_pu_bacteria | 2874645413 | 2874652212 | 296 |
| 221 | iso_pu_bacteria | 2876761206 | 2876771058 | 296 |
| 222 | iso_pu_bacteria | 2876771140 | 2876778795 | 296 |
| 223 | iso_pu_bacteria | 2876818435 | 2876824310 | 296 |
| 224 | iso_pu_bacteria | 2879074833 | 2879082588 | 296 |
| 225 | iso_pu_bacteria | 2879083081 | 2879086643 | 296 |
| 226 | iso_pu_bacteria | 2879099564 | 2879107156 | 296 |
| 227 | iso_pu_bacteria | 2879127579 | 2879131505 | 296 |
| 228 | iso_pu_bacteria | 2879142872 | 2879147951 | 296 |
| 229 | iso_pu_bacteria | 2881364244 | 2881371437 | 296 |
| 230 | iso_pu_bacteria | 2881665667 | 2881666599 | 296 |
| 231 | iso_pu_bacteria | 2885366525 | 2885369986 | 296 |
| 232 | iso_pu_bacteria | 2885409591 | 2885417874 | 296 |
| 233 | iso_pu_bacteria | 2888378607 | 2888385473 | 296 |
| 234 | iso_pu_bacteria | 2888388044 | 2888392757 | 296 |
| 235 | iso_pu_bacteria | 2889306138 | 2889311895 | 296 |
| 236 | iso_pu_bacteria | 2902330777 | 2902335033 | 296 |
| 237 | iso_pu_bacteria | 2902405164 | 2902411377 | 296 |
| 238 | iso_pu_bacteria | 2903727486 | 2903730278 | 296 |
| 239 | iso_pu_bacteria | 2904666416 | 2904674282 | 296 |
| 240 | iso_pu_bacteria | 2904711408 | 2904711954 | 296 |
| 241 | iso_pu_bacteria | 2906602504 | 2906609873 | 296 |
| 242 | iso_pu_bacteria | 2906626472 | 2906629232 | 296 |
| 243 | iso_pu_bacteria | 2906643746 | 2906643967 | 296 |
| 244 | iso_pu_bacteria | 2908775508 | 2908781193 | 296 |
| 245 | iso_pu_bacteria | 2922368715 | 2922372384 | 296 |
| 246 | iso_pu_bacteria | 2929615660 | 2929621044 | 296 |
| 247 | iso_pu_bacteria | 2929624759 | 2929626125 | 296 |
| 248 | iso_pu_bacteria | 2932784394 | 2932784995 | 296 |
| 249 | iso_pu_bacteria | 2932794094 | 2932795132 | 296 |
| 250 | iso_pu_bacteria | 2932801729 | 2932805660 | 296 |
| 251 | iso_pu_bacteria | 2932809354 | 2932810029 | 296 |
| 252 | iso_pu_bacteria | 2932818245 | 2932827026 | 296 |
| 253 | iso_pu_bacteria | 2932828146 | 2932828832 | 296 |
| 254 | iso_pu_bacteria | 2933577622 | 2933583086 | 296 |
| 255 | iso_pu_bacteria | 2935608549 | 2935609849 | 296 |
| 256 | iso_pu_bacteria | 2935616580 | 2935619748 | 296 |
| 257 | iso_pu_bacteria | 2935638405 | 2935638729 | 296 |
| 258 | iso_pu_bacteria | 2935648319 | 2935652120 | 296 |
| 259 | iso_pu_bacteria | 2935656913 | 2935659907 | 296 |
| 260 | iso_pu_bacteria | 2935665750 | 2935666420 | 296 |
| 261 | iso_pu_bacteria | 2935675223 | 2935676532 | 296 |
| 262 | iso_pu_bacteria | 2935684952 | 2935690795 | 296 |
| 263 | iso_pu_bacteria | 2935694250 | 2935694614 | 296 |
| 264 | iso_pu_bacteria | 2935703347 | 2935703735 | 296 |
| 265 | iso_pu_bacteria | 2935713505 | 2935718176 | 296 |
| 266 | iso_pu_bacteria | 2935722832 | 2935727843 | 296 |
| 267 | iso_pu_bacteria | 2935732158 | 2935736547 | 296 |
| 268 | iso_pu_bacteria | 2935741537 | 2935745926 | 296 |
| 269 | iso_pu_bacteria | 2935750917 | 2935756307 | 296 |
| 270 | iso_pu_bacteria | 2935760218 | 2935760589 | 296 |
| 271 | iso_pu_bacteria | 2935769743 | 2935776977 | 296 |
| 272 | iso_pu_bacteria | 2935777560 | 2935783532 | 296 |
| 273 | iso_pu_bacteria | 2935785616 | 2935792822 | 296 |
| 274 | iso_pu_bacteria | 2935793552 | 2935800830 | 296 |
| 275 | iso_pu_bacteria | 2935801545 | 2935801872 | 296 |
| 276 | iso_pu_bacteria | 2935810662 | 2935814718 | 296 |
| 277 | iso_pu_bacteria | 2935819856 | 2935823010 | 296 |
| 278 | iso_pu_bacteria | 2935827899 | 2935828223 | 296 |
| 279 | iso_pu_bacteria | 2935837841 | 2935842427 | 296 |
| 280 | iso_pu_bacteria | 2935847175 | 2935848592 | 296 |
| 281 | iso_pu_bacteria | 2935855204 | 2935857937 | 296 |
| 282 | iso_pu_bacteria | 2935864058 | 2935868721 | 296 |
| 283 | iso_pu_bacteria | 2935873716 | 2935874136 | 296 |
| 284 | iso_pu_bacteria | 2935883170 | 2935883970 | 296 |
| 285 | iso_pu_bacteria | 2935908558 | 2935909601 | 296 |
| 286 | iso_pu_bacteria | 2935916978 | 2935917326 | 296 |
| 287 | iso_pu_bacteria | 2935926038 | 2935927082 | 296 |
| 288 | iso_pu_bacteria | 2935934488 | 2935937074 | 296 |
| 289 | iso_pu_bacteria | 2935942939 | 2935944623 | 296 |
| 290 | iso_pu_bacteria | 2935951376 | 2935953060 | 296 |
| 291 | iso_pu_bacteria | 2935959822 | 2935962737 | 296 |
| 292 | iso_pu_bacteria | 2935967501 | 2935969900 | 296 |
| 293 | iso_pu_bacteria | 2935975950 | 2935976496 | 296 |
| 294 | iso_pu_bacteria | 2935984226 | 2935987051 | 296 |
| 295 | iso_pu_bacteria | 2935992306 | 2935992939 | 296 |
| 296 | iso_pu_bacteria | 2936002035 | 2936002852 | 296 |
| 297 | iso_pu_bacteria | 2936011229 | 2936014323 | 296 |
| 298 | iso_pu_bacteria | 2936019824 | 2936023837 | 296 |
| 299 | iso_pu_bacteria | 2936028420 | 2936031480 | 296 |
| 300 | iso_pu_bacteria | 2936037263 | 2936040639 | 296 |
| 301 | iso_pu_bacteria | 2936046547 | 2936049429 | 296 |
| 302 | iso_pu_bacteria | 2936055302 | 2936062179 | 296 |
| 303 | iso_pu_bacteria | 2940556831 | 2940561718 | 296 |
| 304 | iso_pu_bacteria | 2941531003 | 2941531231 | 296 |
| 305 | iso_pu_bacteria | 2941538514 | 2941542476 | 296 |
| 306 | iso_pu_bacteria | 3005483717 | 3005484774 | 296 |
| 307 | iso_pu_bacteria | 3005506211 | 3005508412 | 296 |
| 308 | iso_pu_bacteria | 3005587118 | 3005588084 | 296 |
| 309 | iso_pu_bacteria | 3005594810 | 3005600335 | 296 |
| 310 | iso_pu_bacteria | 3005710791 | 3005715827 | 296 |
| 311 | iso_pu_bacteria | 3005718088 | 3005723184 | 296 |
| 312 | iso_pu_bacteria | 8006926726 | 8006928372 | 296 |
| 313 | iso_pu_bacteria | 8016511872 | 8016520637 | 296 |
| 314 | iso_pu_bacteria | 8016522445 | 8016528664 | 296 |
| 315 | iso_pu_bacteria | 8016530956 | 8016533838 | 296 |
| 316 | iso_pu_bacteria | 8016539877 | 8016547061 | 296 |
| 317 | iso_pu_bacteria | 8016548790 | 8016555059 | 296 |
| 318 | iso_pu_bacteria | 8016566248 | 8016572170 | 296 |
| 319 | iso_pu_bacteria | 8016575299 | 8016576369 | 296 |
| 320 | iso_pu_bacteria | 8016583857 | 8016594370 | 296 |
| 321 | iso_pu_bacteria | 8016595262 | 8016601172 | 296 |
| 322 | iso_pu_bacteria | 8016613128 | 8016615633 | 296 |
| 323 | iso_pu_bacteria | 8016622563 | 8016625590 | 296 |
| 324 | iso_pu_bacteria | 8016630954 | 8016639150 | 296 |
| 325 | iso_pu_bacteria | 8017057580 | 8017064942 | 296 |
| 326 | iso_pu_bacteria | 8019538911 | 8019546052 | 296 |
| 327 | iso_pu_bacteria | 8019547302 | 8019552668 | 296 |
| 328 | iso_pu_bacteria | 8019576017 | 8019584320 | 296 |
| 329 | iso_pu_bacteria | 8019586578 | 8019592089 | 296 |
| 330 | iso_pu_bacteria | 8019597564 | 8019599193 | 296 |
| 331 | iso_pu_bacteria | 8019608314 | 8019609163 | 296 |
| 332 | iso_pu_bacteria | 8019619141 | 8019619831 | 296 |
| 333 | iso_pu_bacteria | 8019629233 | 8019633284 | 296 |
| 334 | iso_pu_bacteria | 8019648815 | 8019649385 | 296 |
| 335 | iso_pu_bacteria | 8019678201 | 8019685525 | 296 |
| 336 | iso_pu_bacteria | 8055742211 | 8055745093 | 296 |
| 337 | iso_pu_bacteria | 8056967851 | 8056975045 | 296 |
| 338 | 3300005548 | Ga0070665_100347803 | Ga0070665_1003478032 | 297 |
| 339 | 3300014325 | Ga0163163_10777310 | Ga0163163_107773101 | 297 |
| 340 | 3300021358 | Ga0213873_10001660 | Ga0213873_100016603 | 297 |
| 341 | 3300021384 | Ga0213876_10009083 | Ga0213876_100090836 | 297 |
| 342 | 3300021388 | Ga0213875_10002587 | Ga0213875_100025878 | 297 |
| 343 | 3300021388 | Ga0213875_10031932 | Ga0213875_100319322 | 297 |
| 344 | 3300031691 | Ga0316579_10000229 | Ga0316579_1000022915 | 297 |
| 345 | 3300032133 | Ga0316583_10001141 | Ga0316583_100011419 | 297 |
| 346 | 3300037418 | Ga0395900_0232358 | Ga0395900_0232358_937_1839 | 297 |
| 347 | 3300037853 | Ga0436364_0639208 | Ga0436364_0639208_1277_2182 | 297 |
| 348 | 3300049579 | Ga0501043_0175848 | Ga0501043_0175848_18_953 | 297 |
| 349 | iso_pu_bacteria | 2508501128 | 2509149275 | 297 |
| 350 | iso_pu_bacteria | 2513237098 | 2513674808 | 297 |
| 351 | iso_pu_bacteria | 2513237101 | 2513697062 | 297 |
| 352 | iso_pu_bacteria | 2513237141 | 2513891228 | 297 |
| 353 | iso_pu_bacteria | 2524023210 | 2524471222 | 297 |
| 354 | iso_pu_bacteria | 2643221651 | 2644290037 | 297 |
| 355 | iso_pu_bacteria | 2721755755 | 2723843658 | 297 |
| 356 | iso_pu_bacteria | 2738543032 | 2739356732 | 297 |
| 357 | iso_pu_bacteria | 2791355199 | 2793083813 | 297 |
| 358 | iso_pu_bacteria | 2824600985 | 2824605244 | 297 |
| 359 | iso_pu_bacteria | 2824609381 | 2824615563 | 297 |
| 360 | iso_pu_bacteria | 2824653114 | 2824656453 | 297 |
| 361 | iso_pu_bacteria | 2842694124 | 2842696501 | 297 |
| 362 | iso_pu_bacteria | 2857524615 | 2857527020 | 297 |
| 363 | iso_pu_bacteria | 2874604998 | 2874607129 | 297 |
| 364 | iso_pu_bacteria | 2876808645 | 2876817681 | 297 |
| 365 | iso_pu_bacteria | 2879110137 | 2879111890 | 297 |
| 366 | iso_pu_bacteria | 2885383462 | 2885387473 | 297 |
| 367 | iso_pu_bacteria | 2888419890 | 2888425604 | 297 |
| 368 | iso_pu_bacteria | 2889033259 | 2889037986 | 297 |
| 369 | iso_pu_bacteria | 2893066018 | 2893068198 | 297 |
| 370 | iso_pu_bacteria | 2903768456 | 2903772194 | 297 |
| 371 | iso_pu_bacteria | 2922361189 | 2922365991 | 297 |
| 372 | iso_pu_bacteria | 2922386360 | 2922386846 | 297 |
| 373 | iso_pu_bacteria | 8006964411 | 8006968778 | 297 |
| 374 | iso_pu_bacteria | 8006984368 | 8006984463 | 297 |
| 375 | iso_pu_bacteria | 8006994254 | 8007000929 | 297 |
| 376 | iso_pu_bacteria | 8056673599 | 8056677449 | 297 |
| 377 | iso_pu_bacteria | 8056681323 | 8056684768 | 297 |
| 378 | iso_pu_bacteria | 8056689827 | 8056690769 | 297 |
| 379 | 3300003203 | JGI25406J46586_10006092 | JGI25406J46586_100060922 | 298 |
| 380 | 3300005344 | Ga0070661_100024069 | Ga0070661_1000240693 | 298 |
| 381 | 3300005435 | Ga0070714_100049342 | Ga0070714_1000493423 | 298 |
| 382 | 3300005436 | Ga0070713_100037885 | Ga0070713_1000378854 | 298 |
| 383 | 3300005937 | Ga0081455_10000043 | Ga0081455_1000004379 | 298 |
| 384 | 3300005985 | Ga0081539_10006229 | Ga0081539_100062297 | 298 |
| 385 | 3300005985 | Ga0081539_10053017 | Ga0081539_100530172 | 298 |
| 386 | 3300006028 | Ga0070717_10005810 | Ga0070717_100058105 | 298 |
| 387 | 3300009545 | Ga0105237_10238000 | Ga0105237_102380002 | 298 |
| 388 | 3300013308 | Ga0157375_10083511 | Ga0157375_100835113 | 298 |
| 389 | 3300025914 | Ga0207671_10044648 | Ga0207671_100446483 | 298 |
| 390 | 3300025928 | Ga0207700_10013002 | Ga0207700_100130024 | 298 |
| 391 | 3300025929 | Ga0207664_10040468 | Ga0207664_100404683 | 298 |
| 392 | 3300026041 | Ga0207639_10073699 | Ga0207639_100736992 | 298 |
| 393 | 3300039447 | Ga0436361_0265242 | Ga0436361_0265242_1771_2679 | 298 |
| 394 | 3300044656 | Ga0466969_0027572 | Ga0466969_0027572_753_1667 | 298 |
| 395 | 3300044683 | Ga0466965_0006371 | Ga0466965_0006371_2217_3131 | 298 |
| 396 | 3300044706 | Ga0466964_0013052 | Ga0466964_0013052_51_965 | 298 |
| 397 | 3300045049 | Ga0466959_0007796 | Ga0466959_0007796_2680_3594 | 298 |
| 398 | 3300049590 | Ga0501074_0094574 | Ga0501074_0094574_588_1496 | 298 |
| 399 | 3300049741 | Ga0501079_0316818 | Ga0501079_0316818_232_1140 | 298 |
| 400 | 3300049823 | Ga0501044_0277867 | Ga0501044_0277867_184_1092 | 298 |
| 401 | 3300053118 | Ga0500594_0015719 | Ga0500594_0015719_34_948 | 298 |
| 402 | 3300053119 | Ga0500595_001442 | Ga0500595_001442_5861_6775 | 298 |
| 403 | 3300053130 | Ga0500642_0185555 | Ga0500642_0185555_19_933 | 298 |
| 404 | 3300053158 | Ga0500627_0082826 | Ga0500627_0082826_236_1150 | 298 |
| 405 | iso_pu_bacteria | 2734482264 | 2735834694 | 298 |
| 406 | iso_pu_bacteria | 2939669807 | 2939670458 | 298 |
| 407 | 3300003203 | JGI25406J46586_10003417 | JGI25406J46586_100034173 | 299 |
| 408 | 3300003215 | JGI25153J46596_10001884 | JGI25153J46596_100018849 | 299 |
| 409 | 3300003354 | JGI25160J50197_1003726 | JGI25160J50197_10037263 | 299 |
| 410 | 3300003354 | JGI25160J50197_1006214 | JGI25160J50197_10062144 | 299 |
| 411 | 3300003354 | JGI25160J50197_1030839 | JGI25160J50197_10308391 | 299 |
| 412 | 3300003354 | JGI25160J50197_1031023 | JGI25160J50197_10310232 | 299 |
| 413 | 3300003659 | JGI25404J52841_10007977 | JGI25404J52841_100079773 | 299 |
| 414 | 3300003659 | JGI25404J52841_10037615 | JGI25404J52841_100376151 | 299 |
| 415 | 3300003762 | Ga0055542_1013235 | Ga0055542_10132352 | 299 |
| 416 | 3300003794 | Ga0055531_10008008 | Ga0055531_100080084 | 299 |
| 417 | 3300005262 | Ga0065165_1004449 | Ga0065165_10044494 | 299 |
| 418 | 3300005262 | Ga0065165_1004595 | Ga0065165_10045954 | 299 |
| 419 | 3300005262 | Ga0065165_1005514 | Ga0065165_10055144 | 299 |
| 420 | 3300005337 | Ga0070682_100176007 | Ga0070682_1001760071 | 299 |
| 421 | 3300005355 | Ga0070671_100036506 | Ga0070671_1000365063 | 299 |
| 422 | 3300005367 | Ga0070667_100233170 | Ga0070667_1002331701 | 299 |
| 423 | 3300005435 | Ga0070714_100389789 | Ga0070714_1003897892 | 299 |
| 424 | 3300005455 | Ga0070663_100057740 | Ga0070663_1000577402 | 299 |
| 425 | 3300005459 | Ga0068867_100093789 | Ga0068867_1000937892 | 299 |
| 426 | 3300005539 | Ga0068853_100203223 | Ga0068853_1002032232 | 299 |
| 427 | 3300005548 | Ga0070665_100043157 | Ga0070665_1000431572 | 299 |
| 428 | 3300005563 | Ga0068855_100304107 | Ga0068855_1003041072 | 299 |
| 429 | 3300005563 | Ga0068855_100372676 | Ga0068855_1003726762 | 299 |
| 430 | 3300005614 | Ga0068856_100410673 | Ga0068856_1004106731 | 299 |
| 431 | 3300005616 | Ga0068852_100011643 | Ga0068852_1000116436 | 299 |
| 432 | 3300005841 | Ga0068863_100380668 | Ga0068863_1003806681 | 299 |
| 433 | 3300005937 | Ga0081455_10011860 | Ga0081455_1001186010 | 299 |
| 434 | 3300005937 | Ga0081455_10099099 | Ga0081455_100990992 | 299 |
| 435 | 3300005983 | Ga0081540_1004220 | Ga0081540_10042205 | 299 |
| 436 | 3300005983 | Ga0081540_1005132 | Ga0081540_10051322 | 299 |
| 437 | 3300005983 | Ga0081540_1012953 | Ga0081540_10129534 | 299 |
| 438 | 3300005983 | Ga0081540_1025835 | Ga0081540_10258354 | 299 |
| 439 | 3300005985 | Ga0081539_10010493 | Ga0081539_100104933 | 299 |
| 440 | 3300006038 | Ga0075365_10007730 | Ga0075365_100077304 | 299 |
| 441 | 3300006051 | Ga0075364_10046279 | Ga0075364_100462793 | 299 |
| 442 | 3300006195 | Ga0075366_10013043 | Ga0075366_100130434 | 299 |
| 443 | 3300006942 | Ga0099824_1011798 | Ga0099824_10117982 | 299 |
| 444 | 3300006942 | Ga0099824_1013115 | Ga0099824_10131154 | 299 |
| 445 | 3300006943 | Ga0099822_1000072 | Ga0099822_100007249 | 299 |
| 446 | 3300009093 | Ga0105240_10010472 | Ga0105240_100104724 | 299 |
| 447 | 3300009093 | Ga0105240_10571886 | Ga0105240_105718862 | 299 |
| 448 | 3300009148 | Ga0105243_10247646 | Ga0105243_102476462 | 299 |
| 449 | 3300009174 | Ga0105241_10028754 | Ga0105241_100287542 | 299 |
| 450 | 3300009174 | Ga0105241_10034445 | Ga0105241_100344453 | 299 |
| 451 | 3300009177 | Ga0105248_10517023 | Ga0105248_105170232 | 299 |
| 452 | 3300009545 | Ga0105237_10004025 | Ga0105237_1000402514 | 299 |
| 453 | 3300009545 | Ga0105237_10097146 | Ga0105237_100971463 | 299 |
| 454 | 3300010375 | Ga0105239_10088799 | Ga0105239_100887992 | 299 |
| 455 | 3300010375 | Ga0105239_10601272 | Ga0105239_106012721 | 299 |
| 456 | 3300010375 | Ga0105239_10656089 | Ga0105239_106560892 | 299 |
| 457 | 3300010375 | Ga0105239_10660041 | Ga0105239_106600412 | 299 |
| 458 | 3300013105 | Ga0157369_10039801 | Ga0157369_100398013 | 299 |
| 459 | 3300013105 | Ga0157369_10167802 | Ga0157369_101678023 | 299 |
| 460 | 3300013306 | Ga0163162_10192939 | Ga0163162_101929392 | 299 |
| 461 | 3300013306 | Ga0163162_10459239 | Ga0163162_104592391 | 299 |
| 462 | 3300013307 | Ga0157372_10101368 | Ga0157372_101013684 | 299 |
| 463 | 3300013308 | Ga0157375_10183660 | Ga0157375_101836602 | 299 |
| 464 | 3300015262 | Ga0182007_10034693 | Ga0182007_100346932 | 299 |
| 465 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001741 | 299 |
| 466 | 3300021321 | Ga0214542_1000037 | Ga0214542_1000037126 | 299 |
| 467 | 3300021324 | Ga0214545_1000003 | Ga0214545_100000319 | 299 |
| 468 | 3300021327 | Ga0214543_1003164 | Ga0214543_100316419 | 299 |
| 469 | 3300021384 | Ga0213876_10048676 | Ga0213876_100486763 | 299 |
| 470 | 3300021384 | Ga0213876_10051082 | Ga0213876_100510823 | 299 |
| 471 | 3300021388 | Ga0213875_10002147 | Ga0213875_1000214711 | 299 |
| 472 | 3300025253 | Ga0209677_106221 | Ga0209677_1062213 | 299 |
| 473 | 3300025254 | Ga0209148_1000699 | Ga0209148_100069924 | 299 |
| 474 | 3300025261 | Ga0209233_1002356 | Ga0209233_10023566 | 299 |
| 475 | 3300025261 | Ga0209233_1011713 | Ga0209233_10117133 | 299 |
| 476 | 3300025261 | Ga0209233_1012838 | Ga0209233_10128383 | 299 |
| 477 | 3300025272 | Ga0209455_1004211 | Ga0209455_10042113 | 299 |
| 478 | 3300025295 | Ga0209564_1009146 | Ga0209564_10091464 | 299 |
| 479 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011348 | 299 |
| 480 | 3300025297 | Ga0209758_1000133 | Ga0209758_100013378 | 299 |
| 481 | 3300025297 | Ga0209758_1001858 | Ga0209758_100185818 | 299 |
| 482 | 3300025297 | Ga0209758_1002537 | Ga0209758_100253713 | 299 |
| 483 | 3300025297 | Ga0209758_1006910 | Ga0209758_10069105 | 299 |
| 484 | 3300025299 | Ga0209256_1005335 | Ga0209256_10053353 | 299 |
| 485 | 3300025299 | Ga0209256_1035539 | Ga0209256_10355391 | 299 |
| 486 | 3300025302 | Ga0207426_1001289 | Ga0207426_10012897 | 299 |
| 487 | 3300025302 | Ga0207426_1002137 | Ga0207426_100213713 | 299 |
| 488 | 3300025302 | Ga0207426_1002396 | Ga0207426_10023965 | 299 |
| 489 | 3300025304 | Ga0209257_1006326 | Ga0209257_10063265 | 299 |
| 490 | 3300025900 | Ga0207710_10042705 | Ga0207710_100427052 | 299 |
| 491 | 3300025901 | Ga0207688_10131512 | Ga0207688_101315122 | 299 |
| 492 | 3300025901 | Ga0207688_10185181 | Ga0207688_101851811 | 299 |
| 493 | 3300025903 | Ga0207680_10114777 | Ga0207680_101147772 | 299 |
| 494 | 3300025904 | Ga0207647_10019836 | Ga0207647_100198365 | 299 |
| 495 | 3300025911 | Ga0207654_10003032 | Ga0207654_100030323 | 299 |
| 496 | 3300025911 | Ga0207654_10100931 | Ga0207654_101009312 | 299 |
| 497 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008823 | 299 |
| 498 | 3300025913 | Ga0207695_10051139 | Ga0207695_100511394 | 299 |
| 499 | 3300025914 | Ga0207671_10004403 | Ga0207671_100044038 | 299 |
| 500 | 3300025914 | Ga0207671_10150587 | Ga0207671_101505872 | 299 |
| 501 | 3300025914 | Ga0207671_10157263 | Ga0207671_101572632 | 299 |
| 502 | 3300025923 | Ga0207681_10151435 | Ga0207681_101514352 | 299 |
| 503 | 3300025924 | Ga0207694_10293618 | Ga0207694_102936182 | 299 |
| 504 | 3300025927 | Ga0207687_10102387 | Ga0207687_101023872 | 299 |
| 505 | 3300025931 | Ga0207644_10099161 | Ga0207644_100991612 | 299 |
| 506 | 3300025933 | Ga0207706_10081774 | Ga0207706_100817743 | 299 |
| 507 | 3300025935 | Ga0207709_10199986 | Ga0207709_101999862 | 299 |
| 508 | 3300025942 | Ga0207689_10156514 | Ga0207689_101565142 | 299 |
| 509 | 3300025949 | Ga0207667_10058635 | Ga0207667_100586354 | 299 |
| 510 | 3300025981 | Ga0207640_10129322 | Ga0207640_101293222 | 299 |
| 511 | 3300025981 | Ga0207640_10236370 | Ga0207640_102363702 | 299 |
| 512 | 3300026067 | Ga0207678_10063124 | Ga0207678_100631242 | 299 |
| 513 | 3300026089 | Ga0207648_10168528 | Ga0207648_101685282 | 299 |
| 514 | 3300026116 | Ga0207674_10205149 | Ga0207674_102051493 | 299 |
| 515 | 3300026142 | Ga0207698_10047807 | Ga0207698_100478072 | 299 |
| 516 | 3300026142 | Ga0207698_10074151 | Ga0207698_100741512 | 299 |
| 517 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001133 | 299 |
| 518 | 3300027296 | Ga0209389_1000014 | Ga0209389_1000014163 | 299 |
| 519 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011192 | 299 |
| 520 | 3300027357 | Ga0209589_1000020 | Ga0209589_1000020163 | 299 |
| 521 | 3300027361 | Ga0209489_100012 | Ga0209489_100012192 | 299 |
| 522 | 3300027361 | Ga0209489_100060 | Ga0209489_100060122 | 299 |
| 523 | 3300027361 | Ga0209489_100612 | Ga0209489_10061213 | 299 |
| 524 | 3300027363 | Ga0209700_100007 | Ga0209700_100007292 | 299 |
| 525 | 3300027363 | Ga0209700_100019 | Ga0209700_100019192 | 299 |
| 526 | 3300028379 | Ga0268266_10018792 | Ga0268266_100187924 | 299 |
| 527 | 3300028379 | Ga0268266_10303435 | Ga0268266_103034352 | 299 |
| 528 | 3300031838 | Ga0307518_10137357 | Ga0307518_101373572 | 299 |
| 529 | 3300033180 | Ga0307510_10022493 | Ga0307510_100224935 | 299 |
| 530 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002110 | 299 |
| 531 | 3300035113 | Ga0373936_0109198 | Ga0373936_0109198_239_1150 | 299 |
| 532 | 3300035118 | Ga0373954_0099424 | Ga0373954_0099424_391_1302 | 299 |
| 533 | 3300035119 | Ga0373956_0086044 | Ga0373956_0086044_499_1410 | 299 |
| 534 | 3300035170 | Ga0373943_0033284 | Ga0373943_0033284_614_1525 | 299 |
| 535 | 3300035170 | Ga0373943_0068086 | Ga0373943_0068086_161_1153 | 299 |
| 536 | 3300035172 | Ga0373955_0023258 | Ga0373955_0023258_183_1094 | 299 |
| 537 | 3300035410 | Ga0373924_0006636 | Ga0373924_0006636_183_1094 | 299 |
| 538 | 3300035692 | Ga0373935_0068682 | Ga0373935_0068682_1221_2132 | 299 |
| 539 | 3300035695 | Ga0373927_0061213 | Ga0373927_0061213_1238_2149 | 299 |
| 540 | 3300037068 | Ga0373925_0120691 | Ga0373925_0120691_940_1851 | 299 |
| 541 | 3300037068 | Ga0373925_0139625 | Ga0373925_0139625_208_1200 | 299 |
| 542 | 3300037312 | Ga0395899_0075081 | Ga0395899_0075081_492_1409 | 299 |
| 543 | 3300037312 | Ga0395899_0094459 | Ga0395899_0094459_977_1888 | 299 |
| 544 | 3300037418 | Ga0395900_0000851 | Ga0395900_0000851_22452_23369 | 299 |
| 545 | 3300037466 | Ga0395898_0157231 | Ga0395898_0157231_948_1859 | 299 |
| 546 | 3300037471 | Ga0395905_0005304 | Ga0395905_0005304_7666_8583 | 299 |
| 547 | 3300037853 | Ga0436364_0416519 | Ga0436364_0416519_38677_39603 | 299 |
| 548 | 3300038443 | Ga0395901_0009809 | Ga0395901_0009809_698_1615 | 299 |
| 549 | 3300039437 | Ga0436365_0627243 | Ga0436365_0627243_1024_1935 | 299 |
| 550 | 3300044656 | Ga0466969_0045804 | Ga0466969_0045804_1228_2145 | 299 |
| 551 | 3300044658 | Ga0466972_0000325 | Ga0466972_0000325_9271_10188 | 299 |
| 552 | 3300044658 | Ga0466972_0028367 | Ga0466972_0028367_992_1909 | 299 |
| 553 | 3300044683 | Ga0466965_0019908 | Ga0466965_0019908_1611_2528 | 299 |
| 554 | 3300044684 | Ga0466966_0012258 | Ga0466966_0012258_3765_4682 | 299 |
| 555 | 3300044684 | Ga0466966_0118327 | Ga0466966_0118327_371_1282 | 299 |
| 556 | 3300044693 | Ga0466961_0000132 | Ga0466961_0000132_34237_35154 | 299 |
| 557 | 3300044693 | Ga0466961_0071535 | Ga0466961_0071535_619_1530 | 299 |
| 558 | 3300044694 | Ga0466963_0021127 | Ga0466963_0021127_2381_3298 | 299 |
| 559 | 3300044735 | Ga0466968_0004242 | Ga0466968_0004242_2750_3667 | 299 |
| 560 | 3300044842 | Ga0466957_0045106 | Ga0466957_0045106_655_1566 | 299 |
| 561 | 3300044842 | Ga0466957_0108073 | Ga0466957_0108073_814_1731 | 299 |
| 562 | 3300044901 | Ga0466960_0007335 | Ga0466960_0007335_2531_3448 | 299 |
| 563 | 3300045049 | Ga0466959_0000295 | Ga0466959_0000295_24674_25591 | 299 |
| 564 | 3300045049 | Ga0466959_0089733 | Ga0466959_0089733_500_1411 | 299 |
| 565 | 3300045976 | Ga0466967_0073807 | Ga0466967_0073807_1160_2077 | 299 |
| 566 | 3300046452 | Ga0495617_027153 | Ga0495617_027153_155_1072 | 299 |
| 567 | 3300046454 | Ga0495592_0023956 | Ga0495592_0023956_2121_3038 | 299 |
| 568 | 3300046455 | Ga0495603_0102118 | Ga0495603_0102118_24_941 | 299 |
| 569 | 3300046459 | Ga0495629_0106813 | Ga0495629_0106813_126_1118 | 299 |
| 570 | 3300046460 | Ga0495638_0013009 | Ga0495638_0013009_1285_2202 | 299 |
| 571 | 3300046461 | Ga0495641_0132254 | Ga0495641_0132254_129_1040 | 299 |
| 572 | 3300046462 | Ga0495651_0000271 | Ga0495651_0000271_11473_12390 | 299 |
| 573 | 3300046462 | Ga0495651_0023165 | Ga0495651_0023165_2775_3692 | 299 |
| 574 | 3300046472 | Ga0495580_0004422 | Ga0495580_0004422_2263_3174 | 299 |
| 575 | 3300046473 | Ga0495582_0052261 | Ga0495582_0052261_623_1534 | 299 |
| 576 | 3300046475 | Ga0495639_0020094 | Ga0495639_0020094_706_1617 | 299 |
| 577 | 3300046476 | Ga0495662_0084561 | Ga0495662_0084561_249_1160 | 299 |
| 578 | 3300046476 | Ga0495662_0189151 | Ga0495662_0189151_28_945 | 299 |
| 579 | 3300046477 | Ga0495664_0028905 | Ga0495664_0028905_789_1706 | 299 |
| 580 | 3300046477 | Ga0495664_0066710 | Ga0495664_0066710_613_1524 | 299 |
| 581 | 3300046511 | Ga0495608_0026863 | Ga0495608_0026863_1725_2642 | 299 |
| 582 | 3300046513 | Ga0495616_0039835 | Ga0495616_0039835_687_1604 | 299 |
| 583 | 3300046513 | Ga0495616_0126353 | Ga0495616_0126353_179_1096 | 299 |
| 584 | 3300046516 | Ga0495628_0050238 | Ga0495628_0050238_771_1688 | 299 |
| 585 | 3300046517 | Ga0495630_0197713 | Ga0495630_0197713_358_1275 | 299 |
| 586 | 3300046522 | Ga0495643_0024447 | Ga0495643_0024447_784_1701 | 299 |
| 587 | 3300046524 | Ga0495648_0075054 | Ga0495648_0075054_523_1440 | 299 |
| 588 | 3300046529 | Ga0495652_0004764 | Ga0495652_0004764_5389_6306 | 299 |
| 589 | 3300046531 | Ga0495665_0165372 | Ga0495665_0165372_182_1093 | 299 |
| 590 | 3300046533 | Ga0495640_0010408 | Ga0495640_0010408_2798_3715 | 299 |
| 591 | 3300046535 | Ga0495586_0052280 | Ga0495586_0052280_719_1630 | 299 |
| 592 | 3300046536 | Ga0495587_0044816 | Ga0495587_0044816_680_1597 | 299 |
| 593 | 3300046543 | Ga0495645_0008894 | Ga0495645_0008894_1764_2681 | 299 |
| 594 | 3300046543 | Ga0495645_0024316 | Ga0495645_0024316_2944_3855 | 299 |
| 595 | 3300046557 | Ga0495622_0008052 | Ga0495622_0008052_914_1831 | 299 |
| 596 | 3300046559 | Ga0495667_0010094 | Ga0495667_0010094_1960_2877 | 299 |
| 597 | 3300046559 | Ga0495667_0035944 | Ga0495667_0035944_1725_2636 | 299 |
| 598 | 3300046616 | Ga0495668_0032597 | Ga0495668_0032597_432_1349 | 299 |
| 599 | 3300046616 | Ga0495668_0051728 | Ga0495668_0051728_659_1576 | 299 |
| 600 | 3300046642 | Ga0495634_0047380 | Ga0495634_0047380_1152_2069 | 299 |
| 601 | 3300046642 | Ga0495634_0053945 | Ga0495634_0053945_385_1302 | 299 |
| 602 | 3300046642 | Ga0495634_0074637 | Ga0495634_0074637_164_1075 | 299 |
| 603 | 3300046660 | Ga0495625_0084999 | Ga0495625_0084999_778_1695 | 299 |
| 604 | 3300046663 | Ga0495635_0015570 | Ga0495635_0015570_2106_3023 | 299 |
| 605 | 3300046663 | Ga0495635_0050962 | Ga0495635_0050962_1516_2433 | 299 |
| 606 | 3300046663 | Ga0495635_0257922 | Ga0495635_0257922_146_1057 | 299 |
| 607 | 3300046674 | Ga0495588_0001382 | Ga0495588_0001382_8694_9611 | 299 |
| 608 | 3300046675 | Ga0495657_0003332 | Ga0495657_0003332_348_1265 | 299 |
| 609 | 3300046675 | Ga0495657_0054766 | Ga0495657_0054766_1722_2639 | 299 |
| 610 | 3300046678 | Ga0495599_0019003 | Ga0495599_0019003_600_1517 | 299 |
| 611 | 3300046679 | Ga0495623_0004419 | Ga0495623_0004419_3051_3968 | 299 |
| 612 | 3300046680 | Ga0495646_0025141 | Ga0495646_0025141_1092_2003 | 299 |
| 613 | 3300046680 | Ga0495646_0043300 | Ga0495646_0043300_351_1268 | 299 |
| 614 | 3300046681 | Ga0495647_0042605 | Ga0495647_0042605_397_1308 | 299 |
| 615 | 3300046683 | Ga0495658_0019954 | Ga0495658_0019954_1745_2656 | 299 |
| 616 | 3300046689 | Ga0495613_0052618 | Ga0495613_0052618_565_1482 | 299 |
| 617 | 3300046689 | Ga0495613_0269400 | Ga0495613_0269400_88_1005 | 299 |
| 618 | 3300046690 | Ga0495624_0119709 | Ga0495624_0119709_668_1579 | 299 |
| 619 | 3300046692 | Ga0495671_0124526 | Ga0495671_0124526_65_982 | 299 |
| 620 | 3300046694 | Ga0495649_0040650 | Ga0495649_0040650_498_1415 | 299 |
| 621 | 3300046809 | Ga0495600_0001932 | Ga0495600_0001932_8983_9900 | 299 |
| 622 | 3300046809 | Ga0495600_0030740 | Ga0495600_0030740_45_962 | 299 |
| 623 | 3300047315 | Ga0495581_0007817 | Ga0495581_0007817_1133_2044 | 299 |
| 624 | 3300047317 | Ga0495604_0002485 | Ga0495604_0002485_1295_2212 | 299 |
| 625 | 3300047317 | Ga0495604_0004984 | Ga0495604_0004984_8175_9092 | 299 |
| 626 | 3300047317 | Ga0495604_0121713 | Ga0495604_0121713_918_1829 | 299 |
| 627 | 3300047319 | Ga0495674_0013696 | Ga0495674_0013696_1487_2404 | 299 |
| 628 | 3300047319 | Ga0495674_0041838 | Ga0495674_0041838_2701_3612 | 299 |
| 629 | 3300047321 | Ga0495676_0033175 | Ga0495676_0033175_2422_3339 | 299 |
| 630 | 3300047322 | Ga0495680_0001198 | Ga0495680_0001198_22404_23321 | 299 |
| 631 | 3300047323 | Ga0495683_0021057 | Ga0495683_0021057_1511_2428 | 299 |
| 632 | 3300047443 | Ga0495687_025008 | Ga0495687_025008_754_1671 | 299 |
| 633 | 3300047444 | Ga0495675_0003907 | Ga0495675_0003907_7576_8493 | 299 |
| 634 | 3300047444 | Ga0495675_0206245 | Ga0495675_0206245_70_987 | 299 |
| 635 | 3300047471 | Ga0495684_0025140 | Ga0495684_0025140_369_1280 | 299 |
| 636 | 3300047471 | Ga0495684_0117110 | Ga0495684_0117110_137_1054 | 299 |
| 637 | 3300047472 | Ga0495686_0119814 | Ga0495686_0119814_180_1097 | 299 |
| 638 | 3300047673 | Ga0495593_0031542 | Ga0495593_0031542_493_1404 | 299 |
| 639 | 3300047673 | Ga0495593_0074513 | Ga0495593_0074513_609_1526 | 299 |
| 640 | 3300048088 | Ga0495602_0001578 | Ga0495602_0001578_13302_14219 | 299 |
| 641 | 3300048088 | Ga0495602_0015304 | Ga0495602_0015304_43_960 | 299 |
| 642 | 3300048089 | Ga0495614_0088486 | Ga0495614_0088486_402_1313 | 299 |
| 643 | 3300048089 | Ga0495614_0177202 | Ga0495614_0177202_19_936 | 299 |
| 644 | 3300048903 | Ga0496100_0077186 | Ga0496100_0077186_745_1662 | 299 |
| 645 | 3300048904 | Ga0496101_0161563 | Ga0496101_0161563_149_1066 | 299 |
| 646 | 3300048905 | Ga0496102_0056022 | Ga0496102_0056022_1148_2065 | 299 |
| 647 | 3300048907 | Ga0496104_0001744 | Ga0496104_0001744_6444_7361 | 299 |
| 648 | 3300048907 | Ga0496104_0078243 | Ga0496104_0078243_1316_2233 | 299 |
| 649 | 3300048908 | Ga0496105_0002142 | Ga0496105_0002142_980_1897 | 299 |
| 650 | 3300048910 | Ga0496107_0011833 | Ga0496107_0011833_330_1247 | 299 |
| 651 | 3300048911 | Ga0496108_0127426 | Ga0496108_0127426_668_1585 | 299 |
| 652 | 3300048912 | Ga0496109_0037911 | Ga0496109_0037911_1754_2671 | 299 |
| 653 | 3300048913 | Ga0496110_0150182 | Ga0496110_0150182_659_1576 | 299 |
| 654 | 3300048913 | Ga0496110_0224236 | Ga0496110_0224236_14_931 | 299 |
| 655 | 3300048914 | Ga0496111_0192179 | Ga0496111_0192179_98_1015 | 299 |
| 656 | 3300048914 | Ga0496111_0314913 | Ga0496111_0314913_56_973 | 299 |
| 657 | 3300048916 | Ga0496113_0081737 | Ga0496113_0081737_415_1332 | 299 |
| 658 | 3300048916 | Ga0496113_0174718 | Ga0496113_0174718_112_1077 | 299 |
| 659 | 3300048916 | Ga0496113_0395442 | Ga0496113_0395442_60_977 | 299 |
| 660 | 3300048917 | Ga0496114_0135248 | Ga0496114_0135248_1195_2112 | 299 |
| 661 | 3300048918 | Ga0496115_0067618 | Ga0496115_0067618_775_1692 | 299 |
| 662 | 3300048919 | Ga0496116_0027016 | Ga0496116_0027016_945_1862 | 299 |
| 663 | 3300048920 | Ga0496117_0100523 | Ga0496117_0100523_493_1410 | 299 |
| 664 | 3300048921 | Ga0496118_0076350 | Ga0496118_0076350_594_1511 | 299 |
| 665 | 3300048921 | Ga0496118_0129688 | Ga0496118_0129688_275_1192 | 299 |
| 666 | 3300048922 | Ga0496119_0096025 | Ga0496119_0096025_592_1509 | 299 |
| 667 | 3300048923 | Ga0496120_0009024 | Ga0496120_0009024_4676_5593 | 299 |
| 668 | 3300048923 | Ga0496120_0079037 | Ga0496120_0079037_273_1190 | 299 |
| 669 | 3300048923 | Ga0496120_0101831 | Ga0496120_0101831_232_1149 | 299 |
| 670 | 3300048924 | Ga0496121_0025495 | Ga0496121_0025495_3112_4029 | 299 |
| 671 | 3300048924 | Ga0496121_0103153 | Ga0496121_0103153_331_1242 | 299 |
| 672 | 3300048924 | Ga0496121_0108787 | Ga0496121_0108787_97_1014 | 299 |
| 673 | 3300048927 | Ga0496124_0069807 | Ga0496124_0069807_846_1763 | 299 |
| 674 | 3300048927 | Ga0496124_0105539 | Ga0496124_0105539_879_1796 | 299 |
| 675 | 3300048928 | Ga0496125_0052034 | Ga0496125_0052034_1920_2837 | 299 |
| 676 | 3300048928 | Ga0496125_0103617 | Ga0496125_0103617_225_1142 | 299 |
| 677 | 3300048929 | Ga0496126_0020645 | Ga0496126_0020645_1246_2163 | 299 |
| 678 | 3300048929 | Ga0496126_0122534 | Ga0496126_0122534_1236_2153 | 299 |
| 679 | 3300048929 | Ga0496126_0131606 | Ga0496126_0131606_628_1545 | 299 |
| 680 | 3300048929 | Ga0496126_0215692 | Ga0496126_0215692_67_984 | 299 |
| 681 | 3300048929 | Ga0496126_0235250 | Ga0496126_0235250_552_1469 | 299 |
| 682 | 3300049571 | Ga0501034_0251834 | Ga0501034_0251834_558_1553 | 299 |
| 683 | 3300049741 | Ga0501079_0299247 | Ga0501079_0299247_327_1238 | 299 |
| 684 | 3300050491 | nmdc:mga00v17_110651_c1 | nmdc:mga00v17_110651_c1_433_1350 | 299 |
| 685 | 3300050492 | nmdc:mga0yw44_160354_c1 | nmdc:mga0yw44_160354_c1_153_1070 | 299 |
| 686 | 3300050493 | nmdc:mga0k408_13681_c1 | nmdc:mga0k408_13681_c1_482_1399 | 299 |
| 687 | 3300050494 | nmdc:mga06z11_68549_c1 | nmdc:mga06z11_68549_c1_365_1297 | 299 |
| 688 | 3300050512 | nmdc:mga0n895_687443_c1 | nmdc:mga0n895_687443_c1_35_946 | 299 |
| 689 | 3300050514 | nmdc:mga08x19_239436_c1 | nmdc:mga08x19_239436_c1_103_1014 | 299 |
| 690 | 3300050516 | nmdc:mga0sz30_32419_c1 | nmdc:mga0sz30_32419_c1_841_1758 | 299 |
| 691 | 3300053077 | Ga0495601_0102088 | Ga0495601_0102088_870_1781 | 299 |
| 692 | 3300053078 | Ga0495612_0151909 | Ga0495612_0151909_73_984 | 299 |
| 693 | 3300053079 | Ga0500610_0040047 | Ga0500610_0040047_770_1687 | 299 |
| 694 | 3300053085 | Ga0495619_0208246 | Ga0495619_0208246_205_1116 | 299 |
| 695 | 3300053086 | Ga0500578_0077899 | Ga0500578_0077899_556_1473 | 299 |
| 696 | 3300053087 | Ga0500643_000069 | Ga0500643_000069_81941_82858 | 299 |
| 697 | 3300053094 | Ga0500566_0000479 | Ga0500566_0000479_11712_12629 | 299 |
| 698 | 3300053103 | Ga0500555_005858 | Ga0500555_005858_607_1524 | 299 |
| 699 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_59994_60911 | 299 |
| 700 | 3300053122 | Ga0500608_021825 | Ga0500608_021825_363_1280 | 299 |
| 701 | 3300053130 | Ga0500642_0000114 | Ga0500642_0000114_24250_25167 | 299 |
| 702 | 3300053136 | Ga0500559_0085045 | Ga0500559_0085045_131_1048 | 299 |
| 703 | 3300053148 | Ga0500590_049087 | Ga0500590_049087_222_1139 | 299 |
| 704 | 3300053154 | Ga0500619_013213 | Ga0500619_013213_174_1091 | 299 |
| 705 | 3300053155 | Ga0500620_016047 | Ga0500620_016047_531_1448 | 299 |
| 706 | 3300053156 | Ga0500622_0038867 | Ga0500622_0038867_396_1313 | 299 |
| 707 | 3300053162 | Ga0500638_070179 | Ga0500638_070179_508_1425 | 299 |
| 708 | 3300053177 | Ga0500636_0001860 | Ga0500636_0001860_907_1824 | 299 |
| 709 | 3300053177 | Ga0500636_0071286 | Ga0500636_0071286_51_968 | 299 |
| 710 | 3300053733 | Ga0500552_001614 | Ga0500552_001614_450_1367 | 299 |
| 711 | 3300053736 | Ga0500599_008745 | Ga0500599_008745_121_1038 | 299 |
| 712 | 3300053737 | Ga0500601_000092 | Ga0500601_000092_6915_7832 | 299 |
| 713 | 3300061719 | Ga0466962_0061949 | Ga0466962_0061949_624_1541 | 299 |
| 714 | 3300061719 | Ga0466962_0136920 | Ga0466962_0136920_153_1064 | 299 |
| 715 | iso_pu_bacteria | 2517572143 | 2517891313 | 299 |
| 716 | iso_pu_bacteria | 2935732158 | 2935733556 | 299 |
| 717 | 3300003215 | JGI25153J46596_10000952 | JGI25153J46596_100009522 | 300 |
| 718 | 3300003659 | JGI25404J52841_10026578 | JGI25404J52841_100265781 | 300 |
| 719 | 3300003752 | Ga0055539_1002463 | Ga0055539_10024632 | 300 |
| 720 | 3300005329 | Ga0070683_100005150 | Ga0070683_1000051505 | 300 |
| 721 | 3300005334 | Ga0068869_100058281 | Ga0068869_1000582814 | 300 |
| 722 | 3300005336 | Ga0070680_100014277 | Ga0070680_1000142775 | 300 |
| 723 | 3300005336 | Ga0070680_100395881 | Ga0070680_1003958811 | 300 |
| 724 | 3300005337 | Ga0070682_100116584 | Ga0070682_1001165842 | 300 |
| 725 | 3300005340 | Ga0070689_100106246 | Ga0070689_1001062462 | 300 |
| 726 | 3300005347 | Ga0070668_100037793 | Ga0070668_1000377933 | 300 |
| 727 | 3300005347 | Ga0070668_100083103 | Ga0070668_1000831033 | 300 |
| 728 | 3300005347 | Ga0070668_100232245 | Ga0070668_1002322452 | 300 |
| 729 | 3300005347 | Ga0070668_100512793 | Ga0070668_1005127931 | 300 |
| 730 | 3300005355 | Ga0070671_100261884 | Ga0070671_1002618842 | 300 |
| 731 | 3300005366 | Ga0070659_100117117 | Ga0070659_1001171172 | 300 |
| 732 | 3300005367 | Ga0070667_100184773 | Ga0070667_1001847732 | 300 |
| 733 | 3300005367 | Ga0070667_100260544 | Ga0070667_1002605442 | 300 |
| 734 | 3300005434 | Ga0070709_10000900 | Ga0070709_100009003 | 300 |
| 735 | 3300005435 | Ga0070714_100039125 | Ga0070714_1000391253 | 300 |
| 736 | 3300005436 | Ga0070713_100003714 | Ga0070713_1000037146 | 300 |
| 737 | 3300005436 | Ga0070713_100006598 | Ga0070713_1000065985 | 300 |
| 738 | 3300005436 | Ga0070713_100030680 | Ga0070713_1000306802 | 300 |
| 739 | 3300005436 | Ga0070713_100609448 | Ga0070713_1006094481 | 300 |
| 740 | 3300005437 | Ga0070710_10000221 | Ga0070710_1000022125 | 300 |
| 741 | 3300005439 | Ga0070711_100002818 | Ga0070711_1000028186 | 300 |
| 742 | 3300005439 | Ga0070711_100011819 | Ga0070711_1000118193 | 300 |
| 743 | 3300005439 | Ga0070711_100037529 | Ga0070711_1000375292 | 300 |
| 744 | 3300005439 | Ga0070711_100133917 | Ga0070711_1001339172 | 300 |
| 745 | 3300005441 | Ga0070700_100127190 | Ga0070700_1001271902 | 300 |
| 746 | 3300005455 | Ga0070663_100026611 | Ga0070663_1000266113 | 300 |
| 747 | 3300005455 | Ga0070663_100267226 | Ga0070663_1002672262 | 300 |
| 748 | 3300005455 | Ga0070663_100345222 | Ga0070663_1003452222 | 300 |
| 749 | 3300005456 | Ga0070678_100064537 | Ga0070678_1000645373 | 300 |
| 750 | 3300005456 | Ga0070678_100101721 | Ga0070678_1001017213 | 300 |
| 751 | 3300005457 | Ga0070662_100162508 | Ga0070662_1001625081 | 300 |
| 752 | 3300005457 | Ga0070662_100365725 | Ga0070662_1003657251 | 300 |
| 753 | 3300005466 | Ga0070685_10175755 | Ga0070685_101757551 | 300 |
| 754 | 3300005530 | Ga0070679_100079100 | Ga0070679_1000791003 | 300 |
| 755 | 3300005535 | Ga0070684_100003497 | Ga0070684_1000034975 | 300 |
| 756 | 3300005539 | Ga0068853_100312664 | Ga0068853_1003126642 | 300 |
| 757 | 3300005543 | Ga0070672_100121938 | Ga0070672_1001219382 | 300 |
| 758 | 3300005543 | Ga0070672_100242415 | Ga0070672_1002424152 | 300 |
| 759 | 3300005544 | Ga0070686_100211036 | Ga0070686_1002110362 | 300 |
| 760 | 3300005548 | Ga0070665_100062271 | Ga0070665_1000622712 | 300 |
| 761 | 3300005548 | Ga0070665_100141313 | Ga0070665_1001413132 | 300 |
| 762 | 3300005548 | Ga0070665_100147619 | Ga0070665_1001476191 | 300 |
| 763 | 3300005563 | Ga0068855_100279475 | Ga0068855_1002794751 | 300 |
| 764 | 3300005564 | Ga0070664_100196369 | Ga0070664_1001963692 | 300 |
| 765 | 3300005578 | Ga0068854_100062848 | Ga0068854_1000628482 | 300 |
| 766 | 3300005578 | Ga0068854_100081760 | Ga0068854_1000817603 | 300 |
| 767 | 3300005614 | Ga0068856_100009329 | Ga0068856_1000093294 | 300 |
| 768 | 3300005614 | Ga0068856_100036241 | Ga0068856_1000362414 | 300 |
| 769 | 3300005614 | Ga0068856_100221455 | Ga0068856_1002214552 | 300 |
| 770 | 3300005614 | Ga0068856_100237100 | Ga0068856_1002371002 | 300 |
| 771 | 3300005719 | Ga0068861_100059216 | Ga0068861_1000592164 | 300 |
| 772 | 3300005719 | Ga0068861_100169834 | Ga0068861_1001698342 | 300 |
| 773 | 3300005841 | Ga0068863_100380715 | Ga0068863_1003807152 | 300 |
| 774 | 3300005842 | Ga0068858_100099471 | Ga0068858_1000994713 | 300 |
| 775 | 3300005842 | Ga0068858_100137131 | Ga0068858_1001371312 | 300 |
| 776 | 3300005843 | Ga0068860_100000081 | Ga0068860_10000008145 | 300 |
| 777 | 3300005843 | Ga0068860_100221004 | Ga0068860_1002210042 | 300 |
| 778 | 3300005843 | Ga0068860_100499257 | Ga0068860_1004992572 | 300 |
| 779 | 3300005844 | Ga0068862_100131326 | Ga0068862_1001313262 | 300 |
| 780 | 3300005937 | Ga0081455_10052548 | Ga0081455_100525483 | 300 |
| 781 | 3300005937 | Ga0081455_10082536 | Ga0081455_100825362 | 300 |
| 782 | 3300005981 | Ga0081538_10066586 | Ga0081538_100665862 | 300 |
| 783 | 3300005983 | Ga0081540_1000884 | Ga0081540_10008845 | 300 |
| 784 | 3300005983 | Ga0081540_1003783 | Ga0081540_10037833 | 300 |
| 785 | 3300005983 | Ga0081540_1014508 | Ga0081540_10145084 | 300 |
| 786 | 3300005983 | Ga0081540_1019658 | Ga0081540_10196581 | 300 |
| 787 | 3300005985 | Ga0081539_10063223 | Ga0081539_100632232 | 300 |
| 788 | 3300006028 | Ga0070717_10003635 | Ga0070717_100036357 | 300 |
| 789 | 3300006028 | Ga0070717_10292090 | Ga0070717_102920902 | 300 |
| 790 | 3300006048 | Ga0075363_100017124 | Ga0075363_1000171242 | 300 |
| 791 | 3300006048 | Ga0075363_100072858 | Ga0075363_1000728582 | 300 |
| 792 | 3300006051 | Ga0075364_10329003 | Ga0075364_103290031 | 300 |
| 793 | 3300006163 | Ga0070715_10001911 | Ga0070715_100019113 | 300 |
| 794 | 3300006173 | Ga0070716_100001730 | Ga0070716_1000017304 | 300 |
| 795 | 3300006175 | Ga0070712_100021309 | Ga0070712_1000213092 | 300 |
| 796 | 3300006178 | Ga0075367_10060179 | Ga0075367_100601792 | 300 |
| 797 | 3300006195 | Ga0075366_10095579 | Ga0075366_100955792 | 300 |
| 798 | 3300006353 | Ga0075370_10044333 | Ga0075370_100443333 | 300 |
| 799 | 3300006353 | Ga0075370_10141513 | Ga0075370_101415131 | 300 |
| 800 | 3300006881 | Ga0068865_100043959 | Ga0068865_1000439593 | 300 |
| 801 | 3300007265 | Ga0099794_10122087 | Ga0099794_101220871 | 300 |
| 802 | 3300007788 | Ga0099795_10022343 | Ga0099795_100223432 | 300 |
| 803 | 3300007788 | Ga0099795_10104640 | Ga0099795_101046401 | 300 |
| 804 | 3300009093 | Ga0105240_10052653 | Ga0105240_100526532 | 300 |
| 805 | 3300009093 | Ga0105240_10306338 | Ga0105240_103063382 | 300 |
| 806 | 3300009094 | Ga0111539_10076396 | Ga0111539_100763962 | 300 |
| 807 | 3300009098 | Ga0105245_10021491 | Ga0105245_100214914 | 300 |
| 808 | 3300009101 | Ga0105247_10310904 | Ga0105247_103109041 | 300 |
| 809 | 3300009148 | Ga0105243_10542532 | Ga0105243_105425321 | 300 |
| 810 | 3300009177 | Ga0105248_10117215 | Ga0105248_101172154 | 300 |
| 811 | 3300009545 | Ga0105237_10043095 | Ga0105237_100430952 | 300 |
| 812 | 3300009545 | Ga0105237_10508237 | Ga0105237_105082372 | 300 |
| 813 | 3300009551 | Ga0105238_10098901 | Ga0105238_100989012 | 300 |
| 814 | 3300009551 | Ga0105238_10275191 | Ga0105238_102751912 | 300 |
| 815 | 3300009765 | Ga0123341_1000054 | Ga0123341_100005417 | 300 |
| 816 | 3300010375 | Ga0105239_10224672 | Ga0105239_102246723 | 300 |
| 817 | 3300011119 | Ga0105246_10020341 | Ga0105246_100203412 | 300 |
| 818 | 3300011119 | Ga0105246_10232918 | Ga0105246_102329181 | 300 |
| 819 | 3300013105 | Ga0157369_10017188 | Ga0157369_100171885 | 300 |
| 820 | 3300013296 | Ga0157374_10418799 | Ga0157374_104187992 | 300 |
| 821 | 3300013297 | Ga0157378_10246331 | Ga0157378_102463312 | 300 |
| 822 | 3300013306 | Ga0163162_10118943 | Ga0163162_101189433 | 300 |
| 823 | 3300013308 | Ga0157375_10058051 | Ga0157375_100580513 | 300 |
| 824 | 3300014325 | Ga0163163_10045337 | Ga0163163_100453374 | 300 |
| 825 | 3300014969 | Ga0157376_10148203 | Ga0157376_101482031 | 300 |
| 826 | 3300014969 | Ga0157376_10156358 | Ga0157376_101563582 | 300 |
| 827 | 3300021384 | Ga0213876_10157207 | Ga0213876_101572071 | 300 |
| 828 | 3300025253 | Ga0209677_100908 | Ga0209677_1009084 | 300 |
| 829 | 3300025261 | Ga0209233_1001449 | Ga0209233_10014495 | 300 |
| 830 | 3300025295 | Ga0209564_1001822 | Ga0209564_100182214 | 300 |
| 831 | 3300025297 | Ga0209758_1011139 | Ga0209758_10111395 | 300 |
| 832 | 3300025321 | Ga0207656_10048015 | Ga0207656_100480152 | 300 |
| 833 | 3300025898 | Ga0207692_10000364 | Ga0207692_1000036412 | 300 |
| 834 | 3300025898 | Ga0207692_10005642 | Ga0207692_100056422 | 300 |
| 835 | 3300025901 | Ga0207688_10108501 | Ga0207688_101085012 | 300 |
| 836 | 3300025901 | Ga0207688_10184203 | Ga0207688_101842031 | 300 |
| 837 | 3300025906 | Ga0207699_10000319 | Ga0207699_1000031913 | 300 |
| 838 | 3300025906 | Ga0207699_10002988 | Ga0207699_100029885 | 300 |
| 839 | 3300025912 | Ga0207707_10000378 | Ga0207707_1000037823 | 300 |
| 840 | 3300025912 | Ga0207707_10080028 | Ga0207707_100800283 | 300 |
| 841 | 3300025913 | Ga0207695_10158677 | Ga0207695_101586773 | 300 |
| 842 | 3300025913 | Ga0207695_10207041 | Ga0207695_102070412 | 300 |
| 843 | 3300025914 | Ga0207671_10086765 | Ga0207671_100867652 | 300 |
| 844 | 3300025914 | Ga0207671_10211504 | Ga0207671_102115042 | 300 |
| 845 | 3300025914 | Ga0207671_10389942 | Ga0207671_103899421 | 300 |
| 846 | 3300025915 | Ga0207693_10009252 | Ga0207693_100092528 | 300 |
| 847 | 3300025915 | Ga0207693_10043239 | Ga0207693_100432392 | 300 |
| 848 | 3300025916 | Ga0207663_10000417 | Ga0207663_1000041712 | 300 |
| 849 | 3300025916 | Ga0207663_10015030 | Ga0207663_100150304 | 300 |
| 850 | 3300025916 | Ga0207663_10328661 | Ga0207663_103286611 | 300 |
| 851 | 3300025917 | Ga0207660_10372938 | Ga0207660_103729381 | 300 |
| 852 | 3300025921 | Ga0207652_10004828 | Ga0207652_100048281 | 300 |
| 853 | 3300025921 | Ga0207652_10186135 | Ga0207652_101861352 | 300 |
| 854 | 3300025927 | Ga0207687_10046879 | Ga0207687_100468793 | 300 |
| 855 | 3300025927 | Ga0207687_10119174 | Ga0207687_101191742 | 300 |
| 856 | 3300025928 | Ga0207700_10025289 | Ga0207700_100252895 | 300 |
| 857 | 3300025928 | Ga0207700_10081431 | Ga0207700_100814313 | 300 |
| 858 | 3300025928 | Ga0207700_10252975 | Ga0207700_102529752 | 300 |
| 859 | 3300025931 | Ga0207644_10446221 | Ga0207644_104462211 | 300 |
| 860 | 3300025935 | Ga0207709_10295360 | Ga0207709_102953602 | 300 |
| 861 | 3300025937 | Ga0207669_10211307 | Ga0207669_102113071 | 300 |
| 862 | 3300025938 | Ga0207704_10238137 | Ga0207704_102381372 | 300 |
| 863 | 3300025938 | Ga0207704_10288326 | Ga0207704_102883262 | 300 |
| 864 | 3300025939 | Ga0207665_10000190 | Ga0207665_1000019011 | 300 |
| 865 | 3300025939 | Ga0207665_10016066 | Ga0207665_100160664 | 300 |
| 866 | 3300025940 | Ga0207691_10079196 | Ga0207691_100791962 | 300 |
| 867 | 3300025940 | Ga0207691_10115388 | Ga0207691_101153882 | 300 |
| 868 | 3300025940 | Ga0207691_10167890 | Ga0207691_101678902 | 300 |
| 869 | 3300025941 | Ga0207711_10335540 | Ga0207711_103355402 | 300 |
| 870 | 3300025942 | Ga0207689_10013133 | Ga0207689_100131335 | 300 |
| 871 | 3300025942 | Ga0207689_10112409 | Ga0207689_101124092 | 300 |
| 872 | 3300025944 | Ga0207661_10000217 | Ga0207661_1000021721 | 300 |
| 873 | 3300025944 | Ga0207661_10007635 | Ga0207661_100076356 | 300 |
| 874 | 3300025945 | Ga0207679_10031445 | Ga0207679_100314452 | 300 |
| 875 | 3300025949 | Ga0207667_10122118 | Ga0207667_101221182 | 300 |
| 876 | 3300025949 | Ga0207667_10293395 | Ga0207667_102933952 | 300 |
| 877 | 3300025960 | Ga0207651_10181677 | Ga0207651_101816772 | 300 |
| 878 | 3300025972 | Ga0207668_10059335 | Ga0207668_100593352 | 300 |
| 879 | 3300025972 | Ga0207668_10061439 | Ga0207668_100614392 | 300 |
| 880 | 3300025981 | Ga0207640_10136772 | Ga0207640_101367721 | 300 |
| 881 | 3300025981 | Ga0207640_10160435 | Ga0207640_101604351 | 300 |
| 882 | 3300025986 | Ga0207658_10145331 | Ga0207658_101453313 | 300 |
| 883 | 3300025986 | Ga0207658_10306924 | Ga0207658_103069241 | 300 |
| 884 | 3300026023 | Ga0207677_10066181 | Ga0207677_100661812 | 300 |
| 885 | 3300026035 | Ga0207703_10039547 | Ga0207703_100395473 | 300 |
| 886 | 3300026041 | Ga0207639_10107575 | Ga0207639_101075752 | 300 |
| 887 | 3300026041 | Ga0207639_10405447 | Ga0207639_104054471 | 300 |
| 888 | 3300026067 | Ga0207678_10048644 | Ga0207678_100486442 | 300 |
| 889 | 3300026067 | Ga0207678_10068316 | Ga0207678_100683163 | 300 |
| 890 | 3300026067 | Ga0207678_10125182 | Ga0207678_101251822 | 300 |
| 891 | 3300026067 | Ga0207678_10232327 | Ga0207678_102323272 | 300 |
| 892 | 3300026075 | Ga0207708_10174169 | Ga0207708_101741691 | 300 |
| 893 | 3300026078 | Ga0207702_10000779 | Ga0207702_1000077923 | 300 |
| 894 | 3300026078 | Ga0207702_10691314 | Ga0207702_106913141 | 300 |
| 895 | 3300026089 | Ga0207648_10167678 | Ga0207648_101676782 | 300 |
| 896 | 3300026116 | Ga0207674_10109148 | Ga0207674_101091483 | 300 |
| 897 | 3300026118 | Ga0207675_100772183 | Ga0207675_1007721831 | 300 |
| 898 | 3300026121 | Ga0207683_10008222 | Ga0207683_100082226 | 300 |
| 899 | 3300026121 | Ga0207683_10031453 | Ga0207683_100314533 | 300 |
| 900 | 3300026121 | Ga0207683_10112708 | Ga0207683_101127082 | 300 |
| 901 | 3300026121 | Ga0207683_10148222 | Ga0207683_101482222 | 300 |
| 902 | 3300027671 | Ga0209588_1051125 | Ga0209588_10511251 | 300 |
| 903 | 3300028379 | Ga0268266_10001082 | Ga0268266_100010824 | 300 |
| 904 | 3300028379 | Ga0268266_10020256 | Ga0268266_100202564 | 300 |
| 905 | 3300028379 | Ga0268266_10068666 | Ga0268266_100686662 | 300 |
| 906 | 3300028379 | Ga0268266_10142512 | Ga0268266_101425122 | 300 |
| 907 | 3300028379 | Ga0268266_10177582 | Ga0268266_101775823 | 300 |
| 908 | 3300028379 | Ga0268266_10186986 | Ga0268266_101869862 | 300 |
| 909 | 3300028380 | Ga0268265_10209060 | Ga0268265_102090601 | 300 |
| 910 | 3300028381 | Ga0268264_10000048 | Ga0268264_1000004842 | 300 |
| 911 | 3300028556 | Ga0265337_1006052 | Ga0265337_10060525 | 300 |
| 912 | 3300028558 | Ga0265326_10003632 | Ga0265326_100036323 | 300 |
| 913 | 3300028563 | Ga0265319_1009562 | Ga0265319_10095623 | 300 |
| 914 | 3300028573 | Ga0265334_10018461 | Ga0265334_100184613 | 300 |
| 915 | 3300028577 | Ga0265318_10014529 | Ga0265318_100145293 | 300 |
| 916 | 3300028653 | Ga0265323_10002008 | Ga0265323_100020088 | 300 |
| 917 | 3300028654 | Ga0265322_10022080 | Ga0265322_100220801 | 300 |
| 918 | 3300028666 | Ga0265336_10002276 | Ga0265336_100022763 | 300 |
| 919 | 3300028786 | Ga0307517_10004833 | Ga0307517_1000483313 | 300 |
| 920 | 3300028794 | Ga0307515_10025331 | Ga0307515_100253315 | 300 |
| 921 | 3300028794 | Ga0307515_10343633 | Ga0307515_103436331 | 300 |
| 922 | 3300028800 | Ga0265338_10007046 | Ga0265338_100070466 | 300 |
| 923 | 3300029957 | Ga0265324_10012696 | Ga0265324_100126961 | 300 |
| 924 | 3300030521 | Ga0307511_10059327 | Ga0307511_100593272 | 300 |
| 925 | 3300031235 | Ga0265330_10008271 | Ga0265330_100082715 | 300 |
| 926 | 3300031238 | Ga0265332_10006592 | Ga0265332_100065925 | 300 |
| 927 | 3300031238 | Ga0265332_10011731 | Ga0265332_100117313 | 300 |
| 928 | 3300031247 | Ga0265340_10003690 | Ga0265340_100036903 | 300 |
| 929 | 3300031250 | Ga0265331_10014784 | Ga0265331_100147842 | 300 |
| 930 | 3300031456 | Ga0307513_10084452 | Ga0307513_100844523 | 300 |
| 931 | 3300031507 | Ga0307509_10009225 | Ga0307509_1000922510 | 300 |
| 932 | 3300031507 | Ga0307509_10082147 | Ga0307509_100821472 | 300 |
| 933 | 3300031616 | Ga0307508_10288874 | Ga0307508_102888741 | 300 |
| 934 | 3300031711 | Ga0265314_10002744 | Ga0265314_100027446 | 300 |
| 935 | 3300031711 | Ga0265314_10012438 | Ga0265314_100124387 | 300 |
| 936 | 3300031712 | Ga0265342_10057586 | Ga0265342_100575864 | 300 |
| 937 | 3300031730 | Ga0307516_10033133 | Ga0307516_100331333 | 300 |
| 938 | 3300031730 | Ga0307516_10064792 | Ga0307516_100647925 | 300 |
| 939 | 3300031824 | Ga0307413_10055476 | Ga0307413_100554762 | 300 |
| 940 | 3300031824 | Ga0307413_10176186 | Ga0307413_101761862 | 300 |
| 941 | 3300031995 | Ga0307409_100325739 | Ga0307409_1003257391 | 300 |
| 942 | 3300031995 | Ga0307409_100552428 | Ga0307409_1005524281 | 300 |
| 943 | 3300032002 | Ga0307416_100324786 | Ga0307416_1003247862 | 300 |
| 944 | 3300033179 | Ga0307507_10007449 | Ga0307507_1000744915 | 300 |
| 945 | 3300033180 | Ga0307510_10063819 | Ga0307510_100638193 | 300 |
| 946 | 3300034820 | Ga0373959_0033648 | Ga0373959_0033648_14_928 | 300 |
| 947 | 3300035086 | Ga0373934_0016121 | Ga0373934_0016121_918_1838 | 300 |
| 948 | 3300035111 | Ga0373923_0000289 | Ga0373923_0000289_6052_6972 | 300 |
| 949 | 3300035113 | Ga0373936_0015885 | Ga0373936_0015885_1526_2440 | 300 |
| 950 | 3300035113 | Ga0373936_0148917 | Ga0373936_0148917_61_975 | 300 |
| 951 | 3300035117 | Ga0373953_0019685 | Ga0373953_0019685_845_1765 | 300 |
| 952 | 3300035118 | Ga0373954_0015594 | Ga0373954_0015594_1741_2661 | 300 |
| 953 | 3300035119 | Ga0373956_0010705 | Ga0373956_0010705_1575_2495 | 300 |
| 954 | 3300035120 | Ga0373957_0009960 | Ga0373957_0009960_1194_2114 | 300 |
| 955 | 3300035171 | Ga0373946_0003713 | Ga0373946_0003713_2697_3617 | 300 |
| 956 | 3300035172 | Ga0373955_0092995 | Ga0373955_0092995_43_963 | 300 |
| 957 | 3300035172 | Ga0373955_0287716 | Ga0373955_0287716_32_958 | 300 |
| 958 | 3300035410 | Ga0373924_0012573 | Ga0373924_0012573_669_1589 | 300 |
| 959 | 3300035692 | Ga0373935_0000499 | Ga0373935_0000499_18193_19113 | 300 |
| 960 | 3300035692 | Ga0373935_0039296 | Ga0373935_0039296_250_1164 | 300 |
| 961 | 3300035695 | Ga0373927_0000437 | Ga0373927_0000437_651_1571 | 300 |
| 962 | 3300035724 | Ga0373933_0001296 | Ga0373933_0001296_13015_13935 | 300 |
| 963 | 3300035724 | Ga0373933_0001914 | Ga0373933_0001914_8322_9242 | 300 |
| 964 | 3300035724 | Ga0373933_0028125 | Ga0373933_0028125_153_1079 | 300 |
| 965 | 3300035724 | Ga0373933_0127537 | Ga0373933_0127537_279_1193 | 300 |
| 966 | 3300035725 | Ga0373947_0001481 | Ga0373947_0001481_11245_12165 | 300 |
| 967 | 3300035725 | Ga0373947_0104142 | Ga0373947_0104142_599_1513 | 300 |
| 968 | 3300035725 | Ga0373947_0139127 | Ga0373947_0139127_318_1232 | 300 |
| 969 | 3300036401 | Ga0373937_0004047 | Ga0373937_0004047_4478_5398 | 300 |
| 970 | 3300036401 | Ga0373937_0014169 | Ga0373937_0014169_487_1407 | 300 |
| 971 | 3300036401 | Ga0373937_0113131 | Ga0373937_0113131_857_1783 | 300 |
| 972 | 3300036459 | Ga0372808_015058 | Ga0372808_015058_127_1041 | 300 |
| 973 | 3300037068 | Ga0373925_0010291 | Ga0373925_0010291_4112_5032 | 300 |
| 974 | 3300037068 | Ga0373925_0062730 | Ga0373925_0062730_59_1183 | 300 |
| 975 | 3300037068 | Ga0373925_0063599 | Ga0373925_0063599_1046_1960 | 300 |
| 976 | 3300037068 | Ga0373925_0139802 | Ga0373925_0139802_719_1633 | 300 |
| 977 | 3300037312 | Ga0395899_0166010 | Ga0395899_0166010_133_1050 | 300 |
| 978 | 3300037466 | Ga0395898_0047986 | Ga0395898_0047986_96_1010 | 300 |
| 979 | 3300037466 | Ga0395898_0167177 | Ga0395898_0167177_629_1543 | 300 |
| 980 | 3300037471 | Ga0395905_0070968 | Ga0395905_0070968_1894_2808 | 300 |
| 981 | 3300037853 | Ga0436364_1189271 | Ga0436364_1189271_927_1841 | 300 |
| 982 | 3300038443 | Ga0395901_0116985 | Ga0395901_0116985_1486_2400 | 300 |
| 983 | 3300039437 | Ga0436365_0802449 | Ga0436365_0802449_88_1002 | 300 |
| 984 | 3300039437 | Ga0436365_1890002 | Ga0436365_1890002_125_1039 | 300 |
| 985 | 3300039447 | Ga0436361_0989106 | Ga0436361_0989106_132_1046 | 300 |
| 986 | 3300039453 | Ga0436362_0328324 | Ga0436362_0328324_1367_2281 | 300 |
| 987 | 3300044656 | Ga0466969_0038255 | Ga0466969_0038255_1252_2166 | 300 |
| 988 | 3300045976 | Ga0466967_0021340 | Ga0466967_0021340_152_1066 | 300 |
| 989 | 3300045976 | Ga0466967_0344879 | Ga0466967_0344879_468_1382 | 300 |
| 990 | 3300046452 | Ga0495617_052860 | Ga0495617_052860_239_1153 | 300 |
| 991 | 3300046454 | Ga0495592_0003354 | Ga0495592_0003354_1436_2356 | 300 |
| 992 | 3300046454 | Ga0495592_0018326 | Ga0495592_0018326_2600_3520 | 300 |
| 993 | 3300046454 | Ga0495592_0149639 | Ga0495592_0149639_268_1194 | 300 |
| 994 | 3300046455 | Ga0495603_0000040 | Ga0495603_0000040_5618_6538 | 300 |
| 995 | 3300046455 | Ga0495603_0044454 | Ga0495603_0044454_845_1759 | 300 |
| 996 | 3300046455 | Ga0495603_0089349 | Ga0495603_0089349_629_1543 | 300 |
| 997 | 3300046455 | Ga0495603_0091424 | Ga0495603_0091424_547_1461 | 300 |
| 998 | 3300046457 | Ga0495590_0053509 | Ga0495590_0053509_386_1300 | 300 |
| 999 | 3300046459 | Ga0495629_0000077 | Ga0495629_0000077_1530_2450 | 300 |
| 1000 | 3300046459 | Ga0495629_0000188 | Ga0495629_0000188_34536_35456 | 300 |
| 1001 | 3300046460 | Ga0495638_0179570 | Ga0495638_0179570_18_932 | 300 |
| 1002 | 3300046461 | Ga0495641_0008119 | Ga0495641_0008119_5050_5970 | 300 |
| 1003 | 3300046462 | Ga0495651_0023797 | Ga0495651_0023797_2744_3658 | 300 |
| 1004 | 3300046462 | Ga0495651_0074528 | Ga0495651_0074528_906_1826 | 300 |
| 1005 | 3300046463 | Ga0495653_0004244 | Ga0495653_0004244_9786_10706 | 300 |
| 1006 | 3300046463 | Ga0495653_0104811 | Ga0495653_0104811_619_1539 | 300 |
| 1007 | 3300046463 | Ga0495653_0175933 | Ga0495653_0175933_458_1384 | 300 |
| 1008 | 3300046472 | Ga0495580_0003456 | Ga0495580_0003456_8396_9316 | 300 |
| 1009 | 3300046472 | Ga0495580_0298139 | Ga0495580_0298139_19_933 | 300 |
| 1010 | 3300046473 | Ga0495582_0000020 | Ga0495582_0000020_67277_68197 | 300 |
| 1011 | 3300046475 | Ga0495639_0000011 | Ga0495639_0000011_59925_60845 | 300 |
| 1012 | 3300046476 | Ga0495662_0000229 | Ga0495662_0000229_16511_17431 | 300 |
| 1013 | 3300046477 | Ga0495664_0006970 | Ga0495664_0006970_5175_6095 | 300 |
| 1014 | 3300046491 | Ga0495584_0133370 | Ga0495584_0133370_55_969 | 300 |
| 1015 | 3300046492 | Ga0495585_0062171 | Ga0495585_0062171_575_1489 | 300 |
| 1016 | 3300046500 | Ga0495596_0071301 | Ga0495596_0071301_309_1223 | 300 |
| 1017 | 3300046501 | Ga0495607_0039575 | Ga0495607_0039575_1348_2265 | 300 |
| 1018 | 3300046507 | Ga0495606_0043102 | Ga0495606_0043102_1083_1997 | 300 |
| 1019 | 3300046511 | Ga0495608_0006190 | Ga0495608_0006190_1541_2461 | 300 |
| 1020 | 3300046511 | Ga0495608_0131387 | Ga0495608_0131387_505_1431 | 300 |
| 1021 | 3300046513 | Ga0495616_0108459 | Ga0495616_0108459_248_1162 | 300 |
| 1022 | 3300046514 | Ga0495618_0036142 | Ga0495618_0036142_1006_1932 | 300 |
| 1023 | 3300046514 | Ga0495618_0256246 | Ga0495618_0256246_61_981 | 300 |
| 1024 | 3300046515 | Ga0495620_0044658 | Ga0495620_0044658_282_1196 | 300 |
| 1025 | 3300046516 | Ga0495628_0036603 | Ga0495628_0036603_699_1619 | 300 |
| 1026 | 3300046517 | Ga0495630_0005419 | Ga0495630_0005419_2736_3656 | 300 |
| 1027 | 3300046518 | Ga0495631_0041980 | Ga0495631_0041980_247_1161 | 300 |
| 1028 | 3300046519 | Ga0495632_0090724 | Ga0495632_0090724_32_946 | 300 |
| 1029 | 3300046522 | Ga0495643_0131436 | Ga0495643_0131436_17_931 | 300 |
| 1030 | 3300046524 | Ga0495648_0006381 | Ga0495648_0006381_4929_5846 | 300 |
| 1031 | 3300046524 | Ga0495648_0097879 | Ga0495648_0097879_607_1521 | 300 |
| 1032 | 3300046529 | Ga0495652_0020613 | Ga0495652_0020613_4369_5295 | 300 |
| 1033 | 3300046529 | Ga0495652_0055109 | Ga0495652_0055109_1557_2477 | 300 |
| 1034 | 3300046529 | Ga0495652_0112922 | Ga0495652_0112922_655_1569 | 300 |
| 1035 | 3300046531 | Ga0495665_0000133 | Ga0495665_0000133_29837_30757 | 300 |
| 1036 | 3300046533 | Ga0495640_0006645 | Ga0495640_0006645_5884_6804 | 300 |
| 1037 | 3300046533 | Ga0495640_0050384 | Ga0495640_0050384_808_1728 | 300 |
| 1038 | 3300046533 | Ga0495640_0223939 | Ga0495640_0223939_220_1146 | 300 |
| 1039 | 3300046536 | Ga0495587_0003226 | Ga0495587_0003226_9238_10158 | 300 |
| 1040 | 3300046536 | Ga0495587_0045939 | Ga0495587_0045939_1046_1972 | 300 |
| 1041 | 3300046537 | Ga0495598_0009153 | Ga0495598_0009153_1205_2119 | 300 |
| 1042 | 3300046539 | Ga0495621_0003331 | Ga0495621_0003331_798_1712 | 300 |
| 1043 | 3300046543 | Ga0495645_0013345 | Ga0495645_0013345_256_1176 | 300 |
| 1044 | 3300046543 | Ga0495645_0037041 | Ga0495645_0037041_1307_2227 | 300 |
| 1045 | 3300046557 | Ga0495622_0021201 | Ga0495622_0021201_1688_2602 | 300 |
| 1046 | 3300046557 | Ga0495622_0119717 | Ga0495622_0119717_144_1058 | 300 |
| 1047 | 3300046559 | Ga0495667_0001104 | Ga0495667_0001104_15883_16803 | 300 |
| 1048 | 3300046559 | Ga0495667_0007596 | Ga0495667_0007596_5756_6676 | 300 |
| 1049 | 3300046559 | Ga0495667_0026308 | Ga0495667_0026308_2350_3276 | 300 |
| 1050 | 3300046559 | Ga0495667_0252021 | Ga0495667_0252021_122_1042 | 300 |
| 1051 | 3300046615 | Ga0495656_0005561 | Ga0495656_0005561_140_1054 | 300 |
| 1052 | 3300046615 | Ga0495656_0028536 | Ga0495656_0028536_651_1565 | 300 |
| 1053 | 3300046615 | Ga0495656_0050930 | Ga0495656_0050930_351_1265 | 300 |
| 1054 | 3300046616 | Ga0495668_0010958 | Ga0495668_0010958_3154_4068 | 300 |
| 1055 | 3300046616 | Ga0495668_0117269 | Ga0495668_0117269_222_1136 | 300 |
| 1056 | 3300046642 | Ga0495634_0000402 | Ga0495634_0000402_29527_30447 | 300 |
| 1057 | 3300046642 | Ga0495634_0009196 | Ga0495634_0009196_5349_6269 | 300 |
| 1058 | 3300046648 | Ga0495611_0033915 | Ga0495611_0033915_826_1740 | 300 |
| 1059 | 3300046660 | Ga0495625_0307521 | Ga0495625_0307521_48_962 | 300 |
| 1060 | 3300046663 | Ga0495635_0000196 | Ga0495635_0000196_1560_2480 | 300 |
| 1061 | 3300046663 | Ga0495635_0012249 | Ga0495635_0012249_2293_3213 | 300 |
| 1062 | 3300046664 | Ga0495659_0040465 | Ga0495659_0040465_414_1328 | 300 |
| 1063 | 3300046674 | Ga0495588_0010446 | Ga0495588_0010446_670_1584 | 300 |
| 1064 | 3300046675 | Ga0495657_0001347 | Ga0495657_0001347_1519_2439 | 300 |
| 1065 | 3300046675 | Ga0495657_0138339 | Ga0495657_0138339_210_1136 | 300 |
| 1066 | 3300046675 | Ga0495657_0159888 | Ga0495657_0159888_239_1159 | 300 |
| 1067 | 3300046678 | Ga0495599_0015309 | Ga0495599_0015309_2449_3375 | 300 |
| 1068 | 3300046678 | Ga0495599_0036386 | Ga0495599_0036386_749_1669 | 300 |
| 1069 | 3300046678 | Ga0495599_0170988 | Ga0495599_0170988_297_1217 | 300 |
| 1070 | 3300046679 | Ga0495623_0037495 | Ga0495623_0037495_749_1669 | 300 |
| 1071 | 3300046679 | Ga0495623_0090059 | Ga0495623_0090059_184_1110 | 300 |
| 1072 | 3300046680 | Ga0495646_0009557 | Ga0495646_0009557_5084_6004 | 300 |
| 1073 | 3300046680 | Ga0495646_0044961 | Ga0495646_0044961_229_1149 | 300 |
| 1074 | 3300046680 | Ga0495646_0060392 | Ga0495646_0060392_304_1230 | 300 |
| 1075 | 3300046681 | Ga0495647_0010003 | Ga0495647_0010003_1150_2070 | 300 |
| 1076 | 3300046683 | Ga0495658_0000538 | Ga0495658_0000538_17045_17965 | 300 |
| 1077 | 3300046683 | Ga0495658_0193917 | Ga0495658_0193917_15_929 | 300 |
| 1078 | 3300046684 | Ga0495669_0008807 | Ga0495669_0008807_739_1653 | 300 |
| 1079 | 3300046689 | Ga0495613_0000873 | Ga0495613_0000873_6674_7594 | 300 |
| 1080 | 3300046689 | Ga0495613_0027935 | Ga0495613_0027935_1291_2211 | 300 |
| 1081 | 3300046689 | Ga0495613_0169878 | Ga0495613_0169878_461_1387 | 300 |
| 1082 | 3300046690 | Ga0495624_0000819 | Ga0495624_0000819_20357_21277 | 300 |
| 1083 | 3300046692 | Ga0495671_0082806 | Ga0495671_0082806_579_1493 | 300 |
| 1084 | 3300046809 | Ga0495600_0012427 | Ga0495600_0012427_2873_3793 | 300 |
| 1085 | 3300046809 | Ga0495600_0103745 | Ga0495600_0103745_638_1558 | 300 |
| 1086 | 3300046809 | Ga0495600_0188945 | Ga0495600_0188945_23_949 | 300 |
| 1087 | 3300047315 | Ga0495581_0000518 | Ga0495581_0000518_16497_17417 | 300 |
| 1088 | 3300047315 | Ga0495581_0129026 | Ga0495581_0129026_246_1160 | 300 |
| 1089 | 3300047317 | Ga0495604_0017542 | Ga0495604_0017542_1153_2079 | 300 |
| 1090 | 3300047317 | Ga0495604_0020026 | Ga0495604_0020026_1554_2474 | 300 |
| 1091 | 3300047317 | Ga0495604_0146058 | Ga0495604_0146058_153_1073 | 300 |
| 1092 | 3300047319 | Ga0495674_0001070 | Ga0495674_0001070_18552_19472 | 300 |
| 1093 | 3300047319 | Ga0495674_0066903 | Ga0495674_0066903_982_1902 | 300 |
| 1094 | 3300047319 | Ga0495674_0211732 | Ga0495674_0211732_439_1353 | 300 |
| 1095 | 3300047319 | Ga0495674_0334735 | Ga0495674_0334735_190_1116 | 300 |
| 1096 | 3300047322 | Ga0495680_0013711 | Ga0495680_0013711_2525_3445 | 300 |
| 1097 | 3300047322 | Ga0495680_0089446 | Ga0495680_0089446_382_1308 | 300 |
| 1098 | 3300047444 | Ga0495675_0000638 | Ga0495675_0000638_1339_2259 | 300 |
| 1099 | 3300047444 | Ga0495675_0058177 | Ga0495675_0058177_513_1439 | 300 |
| 1100 | 3300047444 | Ga0495675_0145751 | Ga0495675_0145751_323_1243 | 300 |
| 1101 | 3300047445 | Ga0495677_0056715 | Ga0495677_0056715_302_1216 | 300 |
| 1102 | 3300047471 | Ga0495684_0000068 | Ga0495684_0000068_60597_61517 | 300 |
| 1103 | 3300047471 | Ga0495684_0063761 | Ga0495684_0063761_709_1629 | 300 |
| 1104 | 3300047471 | Ga0495684_0088205 | Ga0495684_0088205_871_1797 | 300 |
| 1105 | 3300047472 | Ga0495686_0155136 | Ga0495686_0155136_288_1202 | 300 |
| 1106 | 3300047673 | Ga0495593_0000006 | Ga0495593_0000006_15692_16612 | 300 |
| 1107 | 3300047673 | Ga0495593_0007104 | Ga0495593_0007104_4530_5450 | 300 |
| 1108 | 3300048088 | Ga0495602_0011453 | Ga0495602_0011453_1087_2013 | 300 |
| 1109 | 3300048088 | Ga0495602_0066086 | Ga0495602_0066086_1449_2369 | 300 |
| 1110 | 3300048089 | Ga0495614_0004871 | Ga0495614_0004871_544_1464 | 300 |
| 1111 | 3300048090 | Ga0495615_0007661 | Ga0495615_0007661_558_1472 | 300 |
| 1112 | 3300048903 | Ga0496100_0066259 | Ga0496100_0066259_93_1007 | 300 |
| 1113 | 3300048903 | Ga0496100_0245954 | Ga0496100_0245954_119_1033 | 300 |
| 1114 | 3300048904 | Ga0496101_0026205 | Ga0496101_0026205_3012_3926 | 300 |
| 1115 | 3300048905 | Ga0496102_0003559 | Ga0496102_0003559_8597_9511 | 300 |
| 1116 | 3300048905 | Ga0496102_0036626 | Ga0496102_0036626_865_1803 | 300 |
| 1117 | 3300048905 | Ga0496102_0057999 | Ga0496102_0057999_52_966 | 300 |
| 1118 | 3300048906 | Ga0496103_0030094 | Ga0496103_0030094_819_1733 | 300 |
| 1119 | 3300048907 | Ga0496104_0035142 | Ga0496104_0035142_193_1107 | 300 |
| 1120 | 3300048907 | Ga0496104_0107877 | Ga0496104_0107877_1540_2478 | 300 |
| 1121 | 3300048907 | Ga0496104_0122241 | Ga0496104_0122241_1093_2007 | 300 |
| 1122 | 3300048908 | Ga0496105_0011609 | Ga0496105_0011609_4280_5194 | 300 |
| 1123 | 3300048908 | Ga0496105_0083831 | Ga0496105_0083831_218_1156 | 300 |
| 1124 | 3300048909 | Ga0496106_0000627 | Ga0496106_0000627_3938_4873 | 300 |
| 1125 | 3300048909 | Ga0496106_0006300 | Ga0496106_0006300_289_1203 | 300 |
| 1126 | 3300048909 | Ga0496106_0006841 | Ga0496106_0006841_4917_5831 | 300 |
| 1127 | 3300048909 | Ga0496106_0085203 | Ga0496106_0085203_740_1678 | 300 |
| 1128 | 3300048909 | Ga0496106_0113709 | Ga0496106_0113709_559_1473 | 300 |
| 1129 | 3300048910 | Ga0496107_0005103 | Ga0496107_0005103_3707_4621 | 300 |
| 1130 | 3300048910 | Ga0496107_0013020 | Ga0496107_0013020_1089_2003 | 300 |
| 1131 | 3300048910 | Ga0496107_0091698 | Ga0496107_0091698_587_1501 | 300 |
| 1132 | 3300048910 | Ga0496107_0171468 | Ga0496107_0171468_492_1406 | 300 |
| 1133 | 3300048911 | Ga0496108_0000259 | Ga0496108_0000259_12882_13796 | 300 |
| 1134 | 3300048912 | Ga0496109_0000250 | Ga0496109_0000250_30998_31912 | 300 |
| 1135 | 3300048912 | Ga0496109_0017185 | Ga0496109_0017185_3168_4082 | 300 |
| 1136 | 3300048912 | Ga0496109_0096845 | Ga0496109_0096845_506_1420 | 300 |
| 1137 | 3300048913 | Ga0496110_0010988 | Ga0496110_0010988_4539_5453 | 300 |
| 1138 | 3300048913 | Ga0496110_0037452 | Ga0496110_0037452_2221_3135 | 300 |
| 1139 | 3300048913 | Ga0496110_0048968 | Ga0496110_0048968_1786_2721 | 300 |
| 1140 | 3300048913 | Ga0496110_0094810 | Ga0496110_0094810_1680_2594 | 300 |
| 1141 | 3300048913 | Ga0496110_0106383 | Ga0496110_0106383_867_1781 | 300 |
| 1142 | 3300048914 | Ga0496111_0020268 | Ga0496111_0020268_1175_2089 | 300 |
| 1143 | 3300048914 | Ga0496111_0029410 | Ga0496111_0029410_1961_2875 | 300 |
| 1144 | 3300048914 | Ga0496111_0186563 | Ga0496111_0186563_44_964 | 300 |
| 1145 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_183756_184676 | 300 |
| 1146 | 3300048915 | Ga0496112_0052717 | Ga0496112_0052717_1282_2196 | 300 |
| 1147 | 3300048915 | Ga0496112_0082096 | Ga0496112_0082096_2137_3051 | 300 |
| 1148 | 3300048915 | Ga0496112_0202931 | Ga0496112_0202931_16_930 | 300 |
| 1149 | 3300048916 | Ga0496113_0029385 | Ga0496113_0029385_337_1350 | 300 |
| 1150 | 3300048916 | Ga0496113_0036230 | Ga0496113_0036230_1836_2750 | 300 |
| 1151 | 3300048916 | Ga0496113_0059155 | Ga0496113_0059155_846_1760 | 300 |
| 1152 | 3300048917 | Ga0496114_0053748 | Ga0496114_0053748_308_1222 | 300 |
| 1153 | 3300048917 | Ga0496114_0173409 | Ga0496114_0173409_411_1325 | 300 |
| 1154 | 3300048918 | Ga0496115_0003885 | Ga0496115_0003885_9032_9946 | 300 |
| 1155 | 3300048918 | Ga0496115_0015437 | Ga0496115_0015437_1128_2042 | 300 |
| 1156 | 3300048918 | Ga0496115_0040567 | Ga0496115_0040567_1954_2868 | 300 |
| 1157 | 3300048918 | Ga0496115_0051006 | Ga0496115_0051006_735_1649 | 300 |
| 1158 | 3300048918 | Ga0496115_0335258 | Ga0496115_0335258_213_1148 | 300 |
| 1159 | 3300048919 | Ga0496116_0001079 | Ga0496116_0001079_9822_10754 | 300 |
| 1160 | 3300048920 | Ga0496117_0027627 | Ga0496117_0027627_98_1012 | 300 |
| 1161 | 3300048920 | Ga0496117_0044446 | Ga0496117_0044446_1893_2807 | 300 |
| 1162 | 3300048921 | Ga0496118_0005263 | Ga0496118_0005263_8672_9586 | 300 |
| 1163 | 3300048921 | Ga0496118_0047345 | Ga0496118_0047345_2290_3222 | 300 |
| 1164 | 3300048922 | Ga0496119_0108049 | Ga0496119_0108049_486_1406 | 300 |
| 1165 | 3300048922 | Ga0496119_0162604 | Ga0496119_0162604_115_1029 | 300 |
| 1166 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_208724_209638 | 300 |
| 1167 | 3300048924 | Ga0496121_0001488 | Ga0496121_0001488_1161_2081 | 300 |
| 1168 | 3300048924 | Ga0496121_0011984 | Ga0496121_0011984_3048_3962 | 300 |
| 1169 | 3300048924 | Ga0496121_0014293 | Ga0496121_0014293_1657_2577 | 300 |
| 1170 | 3300048924 | Ga0496121_0061849 | Ga0496121_0061849_1219_2133 | 300 |
| 1171 | 3300048924 | Ga0496121_0256017 | Ga0496121_0256017_224_1141 | 300 |
| 1172 | 3300048924 | Ga0496121_0265938 | Ga0496121_0265938_158_1072 | 300 |
| 1173 | 3300048925 | Ga0496122_0019761 | Ga0496122_0019761_3145_4062 | 300 |
| 1174 | 3300048925 | Ga0496122_0071868 | Ga0496122_0071868_392_1306 | 300 |
| 1175 | 3300048926 | Ga0496123_0053912 | Ga0496123_0053912_548_1465 | 300 |
| 1176 | 3300048926 | Ga0496123_0140078 | Ga0496123_0140078_60_974 | 300 |
| 1177 | 3300048927 | Ga0496124_0001646 | Ga0496124_0001646_20804_21718 | 300 |
| 1178 | 3300048927 | Ga0496124_0136445 | Ga0496124_0136445_964_1881 | 300 |
| 1179 | 3300048928 | Ga0496125_0018563 | Ga0496125_0018563_5432_6364 | 300 |
| 1180 | 3300048928 | Ga0496125_0020254 | Ga0496125_0020254_4613_5527 | 300 |
| 1181 | 3300048928 | Ga0496125_0048379 | Ga0496125_0048379_171_1085 | 300 |
| 1182 | 3300048928 | Ga0496125_0131027 | Ga0496125_0131027_747_1661 | 300 |
| 1183 | 3300048929 | Ga0496126_0005288 | Ga0496126_0005288_4609_5526 | 300 |
| 1184 | 3300048929 | Ga0496126_0005411 | Ga0496126_0005411_3364_4278 | 300 |
| 1185 | 3300048929 | Ga0496126_0006081 | Ga0496126_0006081_5241_6155 | 300 |
| 1186 | 3300048929 | Ga0496126_0032207 | Ga0496126_0032207_267_1181 | 300 |
| 1187 | 3300048929 | Ga0496126_0065925 | Ga0496126_0065925_131_1048 | 300 |
| 1188 | 3300048929 | Ga0496126_0068821 | Ga0496126_0068821_1998_2912 | 300 |
| 1189 | 3300048929 | Ga0496126_0090667 | Ga0496126_0090667_1430_2344 | 300 |
| 1190 | 3300048929 | Ga0496126_0109374 | Ga0496126_0109374_867_1787 | 300 |
| 1191 | 3300048929 | Ga0496126_0135001 | Ga0496126_0135001_346_1266 | 300 |
| 1192 | 3300048929 | Ga0496126_0328725 | Ga0496126_0328725_194_1111 | 300 |
| 1193 | 3300049570 | Ga0501033_0019714 | Ga0501033_0019714_2808_3725 | 300 |
| 1194 | 3300049571 | Ga0501034_0479742 | Ga0501034_0479742_66_983 | 300 |
| 1195 | 3300049575 | Ga0501039_0036113 | Ga0501039_0036113_999_1976 | 300 |
| 1196 | 3300049575 | Ga0501039_0286137 | Ga0501039_0286137_86_1003 | 300 |
| 1197 | 3300049578 | Ga0501042_0060090 | Ga0501042_0060090_843_1820 | 300 |
| 1198 | 3300049579 | Ga0501043_0063197 | Ga0501043_0063197_234_1151 | 300 |
| 1199 | 3300049580 | Ga0501046_0038560 | Ga0501046_0038560_119_1096 | 300 |
| 1200 | 3300049585 | Ga0501069_0109798 | Ga0501069_0109798_344_1258 | 300 |
| 1201 | 3300049586 | Ga0501070_0077515 | Ga0501070_0077515_41_970 | 300 |
| 1202 | 3300049586 | Ga0501070_0174909 | Ga0501070_0174909_246_1229 | 300 |
| 1203 | 3300049587 | Ga0501071_0036003 | Ga0501071_0036003_1352_2329 | 300 |
| 1204 | 3300049743 | Ga0501081_0163805 | Ga0501081_0163805_451_1428 | 300 |
| 1205 | 3300049744 | Ga0501083_0003716 | Ga0501083_0003716_2745_3674 | 300 |
| 1206 | 3300049822 | Ga0501035_0325637 | Ga0501035_0325637_248_1165 | 300 |
| 1207 | 3300049823 | Ga0501044_0006616 | Ga0501044_0006616_7287_8219 | 300 |
| 1208 | 3300050490 | nmdc:mga03n38_7548_c1 | nmdc:mga03n38_7548_c1_1611_2525 | 300 |
| 1209 | 3300050491 | nmdc:mga00v17_271279_c1 | nmdc:mga00v17_271279_c1_68_982 | 300 |
| 1210 | 3300050492 | nmdc:mga0yw44_51827_c1 | nmdc:mga0yw44_51827_c1_319_1233 | 300 |
| 1211 | 3300050494 | nmdc:mga06z11_54938_c1 | nmdc:mga06z11_54938_c1_347_1261 | 300 |
| 1212 | 3300050496 | nmdc:mga07m45_102699_c1 | nmdc:mga07m45_102699_c1_82_996 | 300 |
| 1213 | 3300050496 | nmdc:mga07m45_145902_c1 | nmdc:mga07m45_145902_c1_108_1022 | 300 |
| 1214 | 3300050511 | nmdc:mga08y16_104785_c1 | nmdc:mga08y16_104785_c1_1720_2634 | 300 |
| 1215 | 3300050514 | nmdc:mga08x19_229594_c1 | nmdc:mga08x19_229594_c1_312_1226 | 300 |
| 1216 | 3300050516 | nmdc:mga0sz30_25482_c1 | nmdc:mga0sz30_25482_c1_529_1443 | 300 |
| 1217 | 3300053077 | Ga0495601_0071383 | Ga0495601_0071383_1093_2019 | 300 |
| 1218 | 3300053080 | Ga0500635_0001266 | Ga0500635_0001266_2057_2971 | 300 |
| 1219 | 3300053083 | Ga0495655_0053123 | Ga0495655_0053123_24_938 | 300 |
| 1220 | 3300053084 | Ga0495595_0011980 | Ga0495595_0011980_1139_2059 | 300 |
| 1221 | 3300053085 | Ga0495619_0000829 | Ga0495619_0000829_8514_9434 | 300 |
| 1222 | 3300053085 | Ga0495619_0018115 | Ga0495619_0018115_829_1755 | 300 |
| 1223 | 3300053085 | Ga0495619_0039802 | Ga0495619_0039802_1766_2680 | 300 |
| 1224 | 3300053085 | Ga0495619_0118554 | Ga0495619_0118554_795_1715 | 300 |
| 1225 | 3300053087 | Ga0500643_013747 | Ga0500643_013747_1129_2043 | 300 |
| 1226 | 3300053093 | Ga0500651_0037460 | Ga0500651_0037460_1833_2750 | 300 |
| 1227 | 3300053094 | Ga0500566_0000043 | Ga0500566_0000043_863_1777 | 300 |
| 1228 | 3300053094 | Ga0500566_0001303 | Ga0500566_0001303_1859_2776 | 300 |
| 1229 | 3300053096 | Ga0500641_0005452 | Ga0500641_0005452_723_1637 | 300 |
| 1230 | 3300053096 | Ga0500641_0006170 | Ga0500641_0006170_3108_4022 | 300 |
| 1231 | 3300053103 | Ga0500555_016917 | Ga0500555_016917_615_1529 | 300 |
| 1232 | 3300053108 | Ga0500562_017164 | Ga0500562_017164_451_1368 | 300 |
| 1233 | 3300053108 | Ga0500562_030941 | Ga0500562_030941_436_1350 | 300 |
| 1234 | 3300053109 | Ga0500569_027465 | Ga0500569_027465_139_1056 | 300 |
| 1235 | 3300053111 | Ga0500572_001745 | Ga0500572_001745_1081_1995 | 300 |
| 1236 | 3300053118 | Ga0500594_0072417 | Ga0500594_0072417_82_996 | 300 |
| 1237 | 3300053119 | Ga0500595_000722 | Ga0500595_000722_4787_5707 | 300 |
| 1238 | 3300053119 | Ga0500595_004127 | Ga0500595_004127_1683_2603 | 300 |
| 1239 | 3300053119 | Ga0500595_049370 | Ga0500595_049370_186_1100 | 300 |
| 1240 | 3300053122 | Ga0500608_013224 | Ga0500608_013224_1817_2731 | 300 |
| 1241 | 3300053122 | Ga0500608_018017 | Ga0500608_018017_1657_2574 | 300 |
| 1242 | 3300053134 | Ga0500658_0145375 | Ga0500658_0145375_37_951 | 300 |
| 1243 | 3300053136 | Ga0500559_0001123 | Ga0500559_0001123_15152_16069 | 300 |
| 1244 | 3300053136 | Ga0500559_0002307 | Ga0500559_0002307_991_1905 | 300 |
| 1245 | 3300053136 | Ga0500559_0009193 | Ga0500559_0009193_3233_4147 | 300 |
| 1246 | 3300053136 | Ga0500559_0030298 | Ga0500559_0030298_1372_2286 | 300 |
| 1247 | 3300053140 | Ga0500573_0053716 | Ga0500573_0053716_494_1408 | 300 |
| 1248 | 3300053142 | Ga0500577_0001256 | Ga0500577_0001256_4303_5217 | 300 |
| 1249 | 3300053150 | Ga0500603_016007 | Ga0500603_016007_81_995 | 300 |
| 1250 | 3300053151 | Ga0500604_0045811 | Ga0500604_0045811_406_1320 | 300 |
| 1251 | 3300053159 | Ga0500630_001851 | Ga0500630_001851_890_1804 | 300 |
| 1252 | 3300053160 | Ga0500633_0037242 | Ga0500633_0037242_635_1549 | 300 |
| 1253 | 3300053161 | Ga0500634_0109761 | Ga0500634_0109761_342_1259 | 300 |
| 1254 | 3300053162 | Ga0500638_063273 | Ga0500638_063273_23_937 | 300 |
| 1255 | 3300053163 | Ga0500639_000099 | Ga0500639_000099_28280_29194 | 300 |
| 1256 | 3300053177 | Ga0500636_0004209 | Ga0500636_0004209_4917_5834 | 300 |
| 1257 | 3300053177 | Ga0500636_0058733 | Ga0500636_0058733_129_1040 | 300 |
| 1258 | 3300053178 | Ga0500637_0185181 | Ga0500637_0185181_156_1070 | 300 |
| 1259 | 3300053725 | Ga0500576_052040 | Ga0500576_052040_122_1036 | 300 |
| 1260 | 3300053730 | Ga0500645_033245 | Ga0500645_033245_119_1033 | 300 |
| 1261 | 3300053735 | Ga0500596_005195 | Ga0500596_005195_694_1608 | 300 |
| 1262 | 3300054114 | Ga0501084_0110470 | Ga0501084_0110470_829_1806 | 300 |
| 1263 | 3300060353 | Ga0501082_0232769 | Ga0501082_0232769_41_970 | 300 |
| 1264 | 3300060353 | Ga0501082_0266726 | Ga0501082_0266726_240_1154 | 300 |
| 1265 | iso_pu_bacteria | 2597489875 | 2597812371 | 300 |
| 1266 | iso_pu_bacteria | 2856342000 | 2856348463 | 300 |
| 1267 | iso_pu_bacteria | 2874123672 | 2874123953 | 300 |
| 1268 | iso_pu_bacteria | 2885305155 | 2885305870 | 300 |
| 1269 | iso_pu_bacteria | 2888343758 | 2888346135 | 300 |
| 1270 | iso_pu_bacteria | 2924754689 | 2924755746 | 300 |
| 1271 | iso_pu_bacteria | 2970524798 | 2970527633 | 300 |
| 1272 | iso_pu_bacteria | 2970540015 | 2970545260 | 300 |
| 1273 | iso_pu_bacteria | 2977858184 | 2977863811 | 300 |
| 1274 | iso_pu_bacteria | 8004445564 | 8004451298 | 300 |
| 1275 | iso_pu_bacteria | 8055617313 | 8055619861 | 300 |
| 1276 | 3300005327 | Ga0070658_10406454 | Ga0070658_104064542 | 301 |
| 1277 | 3300005336 | Ga0070680_100008704 | Ga0070680_1000087049 | 301 |
| 1278 | 3300005339 | Ga0070660_100047303 | Ga0070660_1000473031 | 301 |
| 1279 | 3300005341 | Ga0070691_10114389 | Ga0070691_101143892 | 301 |
| 1280 | 3300005344 | Ga0070661_100122022 | Ga0070661_1001220222 | 301 |
| 1281 | 3300005445 | Ga0070708_100236693 | Ga0070708_1002366932 | 301 |
| 1282 | 3300005459 | Ga0068867_100381336 | Ga0068867_1003813361 | 301 |
| 1283 | 3300005535 | Ga0070684_100065035 | Ga0070684_1000650352 | 301 |
| 1284 | 3300005539 | Ga0068853_100055518 | Ga0068853_1000555183 | 301 |
| 1285 | 3300005548 | Ga0070665_100008803 | Ga0070665_1000088037 | 301 |
| 1286 | 3300005563 | Ga0068855_100121344 | Ga0068855_1001213442 | 301 |
| 1287 | 3300005577 | Ga0068857_100013693 | Ga0068857_1000136935 | 301 |
| 1288 | 3300005577 | Ga0068857_100430756 | Ga0068857_1004307561 | 301 |
| 1289 | 3300005616 | Ga0068852_100251038 | Ga0068852_1002510382 | 301 |
| 1290 | 3300005834 | Ga0068851_10035787 | Ga0068851_100357873 | 301 |
| 1291 | 3300006871 | Ga0075434_100043289 | Ga0075434_1000432892 | 301 |
| 1292 | 3300007788 | Ga0099795_10040428 | Ga0099795_100404282 | 301 |
| 1293 | 3300009093 | Ga0105240_10030277 | Ga0105240_100302774 | 301 |
| 1294 | 3300010159 | Ga0099796_10024830 | Ga0099796_100248302 | 301 |
| 1295 | 3300010375 | Ga0105239_10291284 | Ga0105239_102912842 | 301 |
| 1296 | 3300020070 | Ga0206356_11198058 | Ga0206356_111980582 | 301 |
| 1297 | 3300025321 | Ga0207656_10015273 | Ga0207656_100152732 | 301 |
| 1298 | 3300025912 | Ga0207707_10004078 | Ga0207707_1000407813 | 301 |
| 1299 | 3300025913 | Ga0207695_10048138 | Ga0207695_100481382 | 301 |
| 1300 | 3300025917 | Ga0207660_10003159 | Ga0207660_100031593 | 301 |
| 1301 | 3300025919 | Ga0207657_10004372 | Ga0207657_1000437213 | 301 |
| 1302 | 3300025944 | Ga0207661_10013657 | Ga0207661_100136573 | 301 |
| 1303 | 3300025949 | Ga0207667_10005778 | Ga0207667_1000577812 | 301 |
| 1304 | 3300026116 | Ga0207674_10046213 | Ga0207674_100462132 | 301 |
| 1305 | 3300027512 | Ga0209179_1021838 | Ga0209179_10218381 | 301 |
| 1306 | 3300027671 | Ga0209588_1014042 | Ga0209588_10140422 | 301 |
| 1307 | 3300028379 | Ga0268266_10022851 | Ga0268266_100228514 | 301 |
| 1308 | 3300031249 | Ga0265339_10001505 | Ga0265339_100015054 | 301 |
| 1309 | 3300031344 | Ga0265316_10110918 | Ga0265316_101109181 | 301 |
| 1310 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003220 | 301 |
| 1311 | 3300035695 | Ga0373927_0028546 | Ga0373927_0028546_32_958 | 301 |
| 1312 | 3300035725 | Ga0373947_0009460 | Ga0373947_0009460_2240_3166 | 301 |
| 1313 | 3300035725 | Ga0373947_0125977 | Ga0373947_0125977_207_1136 | 301 |
| 1314 | 3300039438 | Ga0436360_0063161 | Ga0436360_0063161_680_1603 | 301 |
| 1315 | 3300046455 | Ga0495603_0002873 | Ga0495603_0002873_2437_3363 | 301 |
| 1316 | 3300046471 | Ga0495650_0060222 | Ga0495650_0060222_115_1095 | 301 |
| 1317 | 3300046492 | Ga0495585_0001246 | Ga0495585_0001246_3115_4074 | 301 |
| 1318 | 3300046507 | Ga0495606_0000186 | Ga0495606_0000186_21049_22008 | 301 |
| 1319 | 3300046507 | Ga0495606_0027650 | Ga0495606_0027650_1826_2815 | 301 |
| 1320 | 3300046512 | Ga0495610_0002153 | Ga0495610_0002153_8355_9344 | 301 |
| 1321 | 3300046519 | Ga0495632_0018833 | Ga0495632_0018833_2124_3083 | 301 |
| 1322 | 3300046524 | Ga0495648_0001821 | Ga0495648_0001821_10736_11725 | 301 |
| 1323 | 3300046690 | Ga0495624_0044349 | Ga0495624_0044349_1162_2088 | 301 |
| 1324 | 3300047315 | Ga0495581_0142230 | Ga0495581_0142230_355_1275 | 301 |
| 1325 | 3300047323 | Ga0495683_0000532 | Ga0495683_0000532_10779_11759 | 301 |
| 1326 | 3300047469 | Ga0495673_0006897 | Ga0495673_0006897_4762_5751 | 301 |
| 1327 | 3300047472 | Ga0495686_0004768 | Ga0495686_0004768_2862_3851 | 301 |
| 1328 | 3300047472 | Ga0495686_0025525 | Ga0495686_0025525_265_1245 | 301 |
| 1329 | 3300048924 | Ga0496121_0007872 | Ga0496121_0007872_8963_9922 | 301 |
| 1330 | 3300048924 | Ga0496121_0014476 | Ga0496121_0014476_3943_4863 | 301 |
| 1331 | 3300053077 | Ga0495601_0077685 | Ga0495601_0077685_66_995 | 301 |
| 1332 | 3300053085 | Ga0495619_0234646 | Ga0495619_0234646_266_1195 | 301 |
| 1333 | iso_pu_bacteria | 2599185170 | 2599415339 | 301 |
| 1334 | iso_pu_bacteria | 2718218334 | 2721025340 | 301 |
| 1335 | iso_pu_bacteria | 2738543009 | 2739226149 | 301 |
| 1336 | iso_pu_bacteria | 2838035591 | 2838038936 | 301 |
| 1337 | iso_pu_bacteria | 2838661181 | 2838664474 | 301 |
| 1338 | iso_pu_bacteria | 2958115193 | 2958118200 | 301 |
| 1339 | iso_pu_bacteria | 2965062239 | 2965062642 | 301 |
| 1340 | iso_pu_bacteria | 2968091066 | 2968092105 | 301 |
| 1341 | iso_pu_bacteria | 2968097103 | 2968098606 | 301 |
| 1342 | iso_pu_bacteria | 2968128360 | 2968130733 | 301 |
| 1343 | iso_pu_bacteria | 2979779861 | 2979782506 | 301 |
| 1344 | iso_pu_bacteria | 2996341866 | 2996346514 | 301 |
| 1345 | iso_pu_bacteria | 3005409236 | 3005413791 | 301 |
| 1346 | iso_pu_bacteria | 8004703790 | 8004709103 | 301 |
| 1347 | 3300031852 | Ga0307410_10073292 | Ga0307410_100732922 | 302 |
| 1348 | 3300010375 | Ga0105239_10313566 | Ga0105239_103135662 | 303 |
| 1349 | 3300031728 | Ga0316578_10028219 | Ga0316578_100282192 | 303 |
| 1350 | 3300036647 | Ga0316582_0011480 | Ga0316582_0011480_2537_3466 | 303 |
| 1351 | 3300046474 | Ga0495605_0008346 | Ga0495605_0008346_1358_2272 | 303 |
| 1352 | 3300046492 | Ga0495585_0084374 | Ga0495585_0084374_166_1080 | 303 |
| 1353 | 3300046506 | Ga0495583_0024110 | Ga0495583_0024110_882_1796 | 303 |
| 1354 | 3300046513 | Ga0495616_0025893 | Ga0495616_0025893_1013_1927 | 303 |
| 1355 | 3300046515 | Ga0495620_0026829 | Ga0495620_0026829_351_1265 | 303 |
| 1356 | 3300046518 | Ga0495631_0016680 | Ga0495631_0016680_2215_3129 | 303 |
| 1357 | 3300046538 | Ga0495609_0047167 | Ga0495609_0047167_160_1074 | 303 |
| 1358 | 3300046616 | Ga0495668_0006779 | Ga0495668_0006779_4214_5128 | 303 |
| 1359 | 3300046660 | Ga0495625_0002662 | Ga0495625_0002662_13644_14558 | 303 |
| 1360 | 3300053079 | Ga0500610_0002697 | Ga0500610_0002697_5340_6254 | 303 |
| 1361 | 3300053108 | Ga0500562_046085 | Ga0500562_046085_88_1080 | 303 |
| 1362 | 3300053118 | Ga0500594_0003721 | Ga0500594_0003721_1701_2615 | 303 |
| 1363 | 3300053139 | Ga0500568_0000331 | Ga0500568_0000331_13_1005 | 303 |
| 1364 | 3300053153 | Ga0500616_0007504 | Ga0500616_0007504_4532_5524 | 303 |
| 1365 | 3300053736 | Ga0500599_006575 | Ga0500599_006575_168_1082 | 303 |
| 1366 | 3300036647 | Ga0316582_0134341 | Ga0316582_0134341_266_1180 | 304 |
| 1367 | 3300037471 | Ga0395905_0000972 | Ga0395905_0000972_23202_24116 | 304 |
| 1368 | 3300003187 | JGI25151J46595_10002636 | JGI25151J46595_1000263610 | 305 |
| 1369 | 3300003323 | rootH1_10365848 | rootH1_103658481 | 305 |
| 1370 | 3300005262 | Ga0065165_1008347 | Ga0065165_10083473 | 305 |
| 1371 | 3300005563 | Ga0068855_100120294 | Ga0068855_1001202942 | 305 |
| 1372 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016331 | 305 |
| 1373 | 3300025294 | Ga0209025_1000126 | Ga0209025_100012665 | 305 |
| 1374 | 3300025303 | Ga0209051_1006374 | Ga0209051_10063744 | 305 |
| 1375 | 3300025949 | Ga0207667_10438642 | Ga0207667_104386422 | 305 |
| 1376 | 3300038443 | Ga0395901_0102446 | Ga0395901_0102446_1687_2691 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
241
361
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pef-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ | 0.9647 | 7 | 290 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9643 | 7 | 291 |
| 2uyy-assembly1.cif.gz_D | structure of the cytokine-like nuclear factor n-pac | 0.9563 | 8 | 289 |
| 3pef-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ | 0.9516 | 7 | 290 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9513 | 7 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4IAP5_485_617_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9913 | 171 | 298 | 1.10.1040.10 |
| af_A0A1D6LWN3_490_603_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9903 | 171 | 273 | 1.10.1040.10 |
| 3g0oA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9827 | 172 | 290 | 1.10.1040.10 |
| af_F4IAP5_318_484_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9777 | 7 | 166 | 3.40.50.720 |
| 5y8iB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 7 | 168 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A094E1N2-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein | 0.9774 | 160 | 289 |
GO:0051287
|
| AF-A0A0H3LJV3-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) | 0.9769 | 1 | 297 |
GO:0008442
GO:0016054 GO:0050661 GO:0051287 |
| AF-A0A4R3T858-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase | 0.9761 | 7 | 291 |
GO:0016054
GO:0016491 GO:0050661 GO:0051287 |
| AF-A0A7I7G549-F1-model_v4 | deleted | 0.9756 | 7 | 183 |
|
| AF-A0A2N1RZ29-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9742 | 97 | 290 |
GO:0016054
GO:0050661 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar