F493522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1382 | 429 | 2764 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300025919|Ga0207657_10451689|Ga0207657_104516892 |
| Length | 109 |
| Sequence | MRFCTALLRLMAIGWYLAVSALIFTIGAAGVMTRRNPLVVLLCLELMLNAANLALIAFSRMHGNGDGQIFAIIVMVVAACEVTVGLGVIVAMHRRNLPIDVDELRELQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 108 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 224 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 259 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 260 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 261 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 262 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 263 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 264 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 416 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 423 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 424 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 425 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 426 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 427 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 428 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 429 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.8 |
| Nodule | 0 |
| Rhizoplane | 10.78 |
| Rhizosphere | 85.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207657_10451689 | 3300025919 | Bacteria | 1008 |
| 2 | JGI24737J22298_10254867 | 3300001990 | Bacteria | 518 |
| 3 | JGI24743J22301_10002332 | 3300001991 | Bacteria | 2839 |
| 4 | JGI24743J22301_10121838 | 3300001991 | Bacteria | 572 |
| 5 | JGI24034J26672_10000088 | 3300002239 | Bacteria | 17296 |
| 6 | JGI24034J26672_10115251 | 3300002239 | Bacteria | 516 |
| 7 | JGI25406J46586_10114003 | 3300003203 | Bacteria | 799 |
| 8 | Ga0070658_10033438 | 3300005327 | Bacteria | 4137 |
| 9 | Ga0070658_10297601 | 3300005327 | Bacteria | 1376 |
| 10 | Ga0070658_10552196 | 3300005327 | Bacteria | 997 |
| 11 | Ga0070658_11230916 | 3300005327 | Bacteria | 651 |
| 12 | Ga0070676_10236108 | 3300005328 | Bacteria | 1214 |
| 13 | Ga0070676_10335175 | 3300005328 | Bacteria | 1036 |
| 14 | Ga0070676_11211171 | 3300005328 | Bacteria | 574 |
| 15 | Ga0070683_100003870 | 3300005329 | Bacteria | 12239 |
| 16 | Ga0070683_100041692 | 3300005329 | Bacteria | 4225 |
| 17 | Ga0070683_100044794 | 3300005329 | Bacteria | 4082 |
| 18 | Ga0070683_100044928 | 3300005329 | Bacteria | 4076 |
| 19 | Ga0070683_100095472 | 3300005329 | Bacteria | 2795 |
| 20 | Ga0070683_100112293 | 3300005329 | Bacteria | 2572 |
| 21 | Ga0070683_100288607 | 3300005329 | Bacteria | 1560 |
| 22 | Ga0070683_101276723 | 3300005329 | Bacteria | 706 |
| 23 | Ga0070683_102237323 | 3300005329 | Bacteria | 525 |
| 24 | Ga0070690_100341403 | 3300005330 | Bacteria | 1084 |
| 25 | Ga0070670_100654128 | 3300005331 | Bacteria | 943 |
| 26 | Ga0068869_100065885 | 3300005334 | Bacteria | 2668 |
| 27 | Ga0068869_100501344 | 3300005334 | Bacteria | 1014 |
| 28 | Ga0068869_101525507 | 3300005334 | Bacteria | 594 |
| 29 | Ga0070666_10002746 | 3300005335 | Bacteria | 10630 |
| 30 | Ga0070680_100809792 | 3300005336 | Bacteria | 807 |
| 31 | Ga0070680_100937879 | 3300005336 | Bacteria | 747 |
| 32 | Ga0070680_101705635 | 3300005336 | Bacteria | 546 |
| 33 | Ga0070682_100009432 | 3300005337 | Bacteria | 5522 |
| 34 | Ga0070682_100064076 | 3300005337 | Bacteria | 2332 |
| 35 | Ga0070682_100539573 | 3300005337 | Bacteria | 911 |
| 36 | Ga0068868_100000299 | 3300005338 | Bacteria | 33344 |
| 37 | Ga0068868_100007021 | 3300005338 | Bacteria | 8003 |
| 38 | Ga0068868_100040481 | 3300005338 | Bacteria | 3627 |
| 39 | Ga0068868_100117419 | 3300005338 | Bacteria | 2167 |
| 40 | Ga0068868_102410642 | 3300005338 | Bacteria | 503 |
| 41 | Ga0070660_100036127 | 3300005339 | Bacteria | 3742 |
| 42 | Ga0070660_100186293 | 3300005339 | Bacteria | 1680 |
| 43 | Ga0070660_100272281 | 3300005339 | Bacteria | 1384 |
| 44 | Ga0070660_100325226 | 3300005339 | Bacteria | 1264 |
| 45 | Ga0070660_100585923 | 3300005339 | Bacteria | 932 |
| 46 | Ga0070689_100230377 | 3300005340 | Bacteria | 1523 |
| 47 | Ga0070689_100511414 | 3300005340 | Bacteria | 1030 |
| 48 | Ga0070691_10000319 | 3300005341 | Bacteria | 17019 |
| 49 | Ga0070691_10000675 | 3300005341 | Bacteria | 13287 |
| 50 | Ga0070691_10013569 | 3300005341 | Bacteria | 3733 |
| 51 | Ga0070691_10409661 | 3300005341 | Bacteria | 766 |
| 52 | Ga0070687_100677687 | 3300005343 | Bacteria | 717 |
| 53 | Ga0070687_101044421 | 3300005343 | Bacteria | 594 |
| 54 | Ga0070661_100000045 | 3300005344 | Bacteria | 94702 |
| 55 | Ga0070661_100163673 | 3300005344 | Bacteria | 1686 |
| 56 | Ga0070661_101288909 | 3300005344 | Bacteria | 613 |
| 57 | Ga0070661_101521485 | 3300005344 | Bacteria | 565 |
| 58 | Ga0070692_10002309 | 3300005345 | Bacteria | 7346 |
| 59 | Ga0070692_11139064 | 3300005345 | Bacteria | 553 |
| 60 | Ga0070668_100142859 | 3300005347 | Bacteria | 1930 |
| 61 | Ga0070668_100179450 | 3300005347 | Bacteria | 1729 |
| 62 | Ga0070668_100392368 | 3300005347 | Bacteria | 1184 |
| 63 | Ga0070668_100545553 | 3300005347 | Bacteria | 1008 |
| 64 | Ga0070668_100844360 | 3300005347 | Bacteria | 816 |
| 65 | Ga0070669_100748225 | 3300005353 | Bacteria | 828 |
| 66 | Ga0070675_100000209 | 3300005354 | Bacteria | 37434 |
| 67 | Ga0070675_100036891 | 3300005354 | Bacteria | 3980 |
| 68 | Ga0070675_100840285 | 3300005354 | Bacteria | 840 |
| 69 | Ga0070675_100985889 | 3300005354 | Bacteria | 773 |
| 70 | Ga0070671_100222585 | 3300005355 | Bacteria | 1601 |
| 71 | Ga0070671_101091396 | 3300005355 | Bacteria | 701 |
| 72 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 73 | Ga0070674_100253703 | 3300005356 | Bacteria | 1383 |
| 74 | Ga0070674_100348966 | 3300005356 | Bacteria | 1195 |
| 75 | Ga0070674_100472193 | 3300005356 | Bacteria | 1039 |
| 76 | Ga0070674_100512827 | 3300005356 | Bacteria | 1000 |
| 77 | Ga0070674_100519972 | 3300005356 | Bacteria | 994 |
| 78 | Ga0070674_100915318 | 3300005356 | Bacteria | 765 |
| 79 | Ga0070674_101316393 | 3300005356 | Bacteria | 645 |
| 80 | Ga0070674_101669198 | 3300005356 | Bacteria | 576 |
| 81 | Ga0070674_101998817 | 3300005356 | Bacteria | 528 |
| 82 | Ga0070673_100002476 | 3300005364 | Bacteria | 11272 |
| 83 | Ga0070673_100161516 | 3300005364 | Bacteria | 1906 |
| 84 | Ga0070673_100274511 | 3300005364 | Bacteria | 1476 |
| 85 | Ga0070688_100000076 | 3300005365 | Bacteria | 49151 |
| 86 | Ga0070688_100086427 | 3300005365 | Bacteria | 2040 |
| 87 | Ga0070688_100095851 | 3300005365 | Bacteria | 1948 |
| 88 | Ga0070688_100887950 | 3300005365 | Bacteria | 702 |
| 89 | Ga0070659_100000176 | 3300005366 | Bacteria | 49062 |
| 90 | Ga0070659_100093608 | 3300005366 | Bacteria | 2412 |
| 91 | Ga0070659_100172685 | 3300005366 | Bacteria | 1771 |
| 92 | Ga0070659_100735492 | 3300005366 | Bacteria | 855 |
| 93 | Ga0070659_100987799 | 3300005366 | Bacteria | 738 |
| 94 | Ga0070659_101134877 | 3300005366 | Bacteria | 690 |
| 95 | Ga0070667_100054701 | 3300005367 | Bacteria | 3370 |
| 96 | Ga0070667_101242373 | 3300005367 | Bacteria | 697 |
| 97 | Ga0070667_102016118 | 3300005367 | Bacteria | 544 |
| 98 | Ga0070714_100024259 | 3300005435 | Bacteria | 4990 |
| 99 | Ga0070714_100107409 | 3300005435 | Bacteria | 2466 |
| 100 | Ga0070714_100339401 | 3300005435 | Bacteria | 1409 |
| 101 | Ga0070714_101869850 | 3300005435 | Bacteria | 586 |
| 102 | Ga0070713_100000628 | 3300005436 | Bacteria | 22525 |
| 103 | Ga0070710_10000013 | 3300005437 | Bacteria | 117825 |
| 104 | Ga0070710_10090521 | 3300005437 | Bacteria | 1804 |
| 105 | Ga0070710_10111748 | 3300005437 | Bacteria | 1642 |
| 106 | Ga0070710_11167163 | 3300005437 | Bacteria | 568 |
| 107 | Ga0070701_10131989 | 3300005438 | Bacteria | 1420 |
| 108 | Ga0070701_10217979 | 3300005438 | Bacteria | 1136 |
| 109 | Ga0070701_11125174 | 3300005438 | Bacteria | 554 |
| 110 | Ga0070711_100008103 | 3300005439 | Bacteria | 6421 |
| 111 | Ga0070711_100134314 | 3300005439 | Bacteria | 1847 |
| 112 | Ga0070711_100197262 | 3300005439 | Bacteria | 1551 |
| 113 | Ga0070711_100745101 | 3300005439 | Bacteria | 827 |
| 114 | Ga0070711_100756145 | 3300005439 | Bacteria | 822 |
| 115 | Ga0070705_100002829 | 3300005440 | Bacteria | 8643 |
| 116 | Ga0070705_101498643 | 3300005440 | Bacteria | 565 |
| 117 | Ga0070700_100000631 | 3300005441 | Bacteria | 17489 |
| 118 | Ga0070700_100054734 | 3300005441 | Bacteria | 2495 |
| 119 | Ga0070700_100076944 | 3300005441 | Bacteria | 2144 |
| 120 | Ga0070700_100105120 | 3300005441 | Bacteria | 1867 |
| 121 | Ga0070700_100123060 | 3300005441 | Bacteria | 1741 |
| 122 | Ga0070700_100132051 | 3300005441 | Bacteria | 1686 |
| 123 | Ga0070700_100890298 | 3300005441 | Bacteria | 724 |
| 124 | Ga0070700_101052430 | 3300005441 | Bacteria | 672 |
| 125 | Ga0070700_101261354 | 3300005441 | Bacteria | 619 |
| 126 | Ga0070694_100243814 | 3300005444 | Bacteria | 1356 |
| 127 | Ga0070663_100066678 | 3300005455 | Bacteria | 2609 |
| 128 | Ga0070663_100174680 | 3300005455 | Bacteria | 1663 |
| 129 | Ga0070663_100198477 | 3300005455 | Bacteria | 1565 |
| 130 | Ga0070663_100363920 | 3300005455 | Bacteria | 1174 |
| 131 | Ga0070663_100668836 | 3300005455 | Bacteria | 880 |
| 132 | Ga0070663_100829066 | 3300005455 | Bacteria | 795 |
| 133 | Ga0070663_101635683 | 3300005455 | Bacteria | 575 |
| 134 | Ga0070663_101878092 | 3300005455 | Bacteria | 538 |
| 135 | Ga0070663_101952164 | 3300005455 | Bacteria | 528 |
| 136 | Ga0070678_100051520 | 3300005456 | Bacteria | 2985 |
| 137 | Ga0070678_100385628 | 3300005456 | Bacteria | 1213 |
| 138 | Ga0070678_100796909 | 3300005456 | Bacteria | 858 |
| 139 | Ga0070662_100000109 | 3300005457 | Bacteria | 45782 |
| 140 | Ga0070662_100120849 | 3300005457 | Bacteria | 2007 |
| 141 | Ga0070662_100259730 | 3300005457 | Bacteria | 1399 |
| 142 | Ga0070662_100432629 | 3300005457 | Bacteria | 1090 |
| 143 | Ga0070681_10073153 | 3300005458 | Bacteria | 3390 |
| 144 | Ga0070681_11146333 | 3300005458 | Bacteria | 699 |
| 145 | Ga0068867_100004547 | 3300005459 | Bacteria | 9754 |
| 146 | Ga0068867_100037649 | 3300005459 | Bacteria | 3516 |
| 147 | Ga0068867_100207276 | 3300005459 | Bacteria | 1572 |
| 148 | Ga0070685_10000062 | 3300005466 | Bacteria | 62782 |
| 149 | Ga0070685_10009173 | 3300005466 | Bacteria | 5106 |
| 150 | Ga0070685_10173954 | 3300005466 | Bacteria | 1381 |
| 151 | Ga0070685_10181349 | 3300005466 | Bacteria | 1356 |
| 152 | Ga0070685_11427978 | 3300005466 | Bacteria | 532 |
| 153 | Ga0070699_102106370 | 3300005518 | Bacteria | 515 |
| 154 | Ga0070679_100010060 | 3300005530 | Bacteria | 8960 |
| 155 | Ga0070679_100296893 | 3300005530 | Bacteria | 1567 |
| 156 | Ga0070684_100001176 | 3300005535 | Bacteria | 18794 |
| 157 | Ga0070684_100026984 | 3300005535 | Bacteria | 4843 |
| 158 | Ga0070684_100068616 | 3300005535 | Bacteria | 3116 |
| 159 | Ga0070684_100083579 | 3300005535 | Bacteria | 2829 |
| 160 | Ga0070684_100259844 | 3300005535 | Bacteria | 1588 |
| 161 | Ga0070684_100502883 | 3300005535 | Bacteria | 1122 |
| 162 | Ga0070684_100581550 | 3300005535 | Bacteria | 1040 |
| 163 | Ga0070684_100935484 | 3300005535 | Bacteria | 812 |
| 164 | Ga0070684_100946552 | 3300005535 | Bacteria | 808 |
| 165 | Ga0070684_102246416 | 3300005535 | Bacteria | 515 |
| 166 | Ga0068853_100007277 | 3300005539 | Bacteria | 8861 |
| 167 | Ga0068853_100615877 | 3300005539 | Bacteria | 1032 |
| 168 | Ga0070672_100000003 | 3300005543 | Bacteria | 159532 |
| 169 | Ga0070672_101542682 | 3300005543 | Bacteria | 595 |
| 170 | Ga0070672_102085416 | 3300005543 | Bacteria | 511 |
| 171 | Ga0070686_100188221 | 3300005544 | Bacteria | 1471 |
| 172 | Ga0070686_100448838 | 3300005544 | Bacteria | 991 |
| 173 | Ga0070695_100495573 | 3300005545 | Bacteria | 944 |
| 174 | Ga0070695_100997421 | 3300005545 | Bacteria | 681 |
| 175 | Ga0070696_100152740 | 3300005546 | Bacteria | 1696 |
| 176 | Ga0070696_100783365 | 3300005546 | Bacteria | 784 |
| 177 | Ga0070693_100005595 | 3300005547 | Bacteria | 6055 |
| 178 | Ga0070693_100147659 | 3300005547 | Bacteria | 1486 |
| 179 | Ga0070693_100332297 | 3300005547 | Bacteria | 1035 |
| 180 | Ga0070693_100944190 | 3300005547 | Bacteria | 649 |
| 181 | Ga0070665_100000911 | 3300005548 | Bacteria | 37941 |
| 182 | Ga0070665_100007709 | 3300005548 | Bacteria | 10930 |
| 183 | Ga0070665_100867255 | 3300005548 | Bacteria | 916 |
| 184 | Ga0070665_101081839 | 3300005548 | Bacteria | 813 |
| 185 | Ga0070665_101185581 | 3300005548 | Bacteria | 775 |
| 186 | Ga0070665_101851165 | 3300005548 | Bacteria | 610 |
| 187 | Ga0070665_102400703 | 3300005548 | Bacteria | 530 |
| 188 | Ga0070704_100035398 | 3300005549 | Bacteria | 3393 |
| 189 | Ga0070704_101588918 | 3300005549 | Bacteria | 603 |
| 190 | Ga0068855_100246356 | 3300005563 | Bacteria | 1995 |
| 191 | Ga0068855_101944772 | 3300005563 | Bacteria | 595 |
| 192 | Ga0070664_100014589 | 3300005564 | Bacteria | 6410 |
| 193 | Ga0070664_100045853 | 3300005564 | Bacteria | 3692 |
| 194 | Ga0070664_100140463 | 3300005564 | Bacteria | 2127 |
| 195 | Ga0070664_100243283 | 3300005564 | Bacteria | 1615 |
| 196 | Ga0070664_100830404 | 3300005564 | Bacteria | 865 |
| 197 | Ga0070664_101090355 | 3300005564 | Bacteria | 752 |
| 198 | Ga0070664_101532821 | 3300005564 | Bacteria | 631 |
| 199 | Ga0068857_100552492 | 3300005577 | Bacteria | 1085 |
| 200 | Ga0068857_101839989 | 3300005577 | Bacteria | 593 |
| 201 | Ga0068854_100035147 | 3300005578 | Bacteria | 3506 |
| 202 | Ga0068854_100200729 | 3300005578 | Bacteria | 1568 |
| 203 | Ga0068854_100215381 | 3300005578 | Bacteria | 1517 |
| 204 | Ga0068854_100224957 | 3300005578 | Bacteria | 1486 |
| 205 | Ga0068854_100292170 | 3300005578 | Bacteria | 1316 |
| 206 | Ga0068854_100764086 | 3300005578 | Bacteria | 839 |
| 207 | Ga0068854_100903093 | 3300005578 | Bacteria | 776 |
| 208 | Ga0068854_101170584 | 3300005578 | Bacteria | 688 |
| 209 | Ga0068856_100030900 | 3300005614 | Bacteria | 5238 |
| 210 | Ga0068856_100063649 | 3300005614 | Bacteria | 3644 |
| 211 | Ga0068856_100070194 | 3300005614 | Bacteria | 3465 |
| 212 | Ga0068856_100214806 | 3300005614 | Bacteria | 1939 |
| 213 | Ga0068856_100329045 | 3300005614 | Bacteria | 1545 |
| 214 | Ga0068856_100331027 | 3300005614 | Bacteria | 1540 |
| 215 | Ga0068856_100382998 | 3300005614 | Bacteria | 1426 |
| 216 | Ga0068856_100560608 | 3300005614 | Bacteria | 1164 |
| 217 | Ga0068856_100631522 | 3300005614 | Bacteria | 1092 |
| 218 | Ga0068856_102357876 | 3300005614 | Bacteria | 540 |
| 219 | Ga0068856_102653729 | 3300005614 | Bacteria | 506 |
| 220 | Ga0070702_100013640 | 3300005615 | Bacteria | 4107 |
| 221 | Ga0070702_100250597 | 3300005615 | Bacteria | 1200 |
| 222 | Ga0070702_100287326 | 3300005615 | Bacteria | 1132 |
| 223 | Ga0070702_100550225 | 3300005615 | Bacteria | 856 |
| 224 | Ga0070702_101382547 | 3300005615 | Bacteria | 575 |
| 225 | Ga0068852_100047988 | 3300005616 | Bacteria | 3647 |
| 226 | Ga0068852_100626503 | 3300005616 | Bacteria | 1081 |
| 227 | Ga0068852_100654215 | 3300005616 | Bacteria | 1058 |
| 228 | Ga0068852_100750916 | 3300005616 | Bacteria | 988 |
| 229 | Ga0068852_100778817 | 3300005616 | Bacteria | 970 |
| 230 | Ga0068859_100231354 | 3300005617 | Bacteria | 1936 |
| 231 | Ga0068859_101610820 | 3300005617 | Bacteria | 717 |
| 232 | Ga0068859_102219467 | 3300005617 | Bacteria | 606 |
| 233 | Ga0068864_100007359 | 3300005618 | Bacteria | 9059 |
| 234 | Ga0068864_100073733 | 3300005618 | Bacteria | 2976 |
| 235 | Ga0068864_100484305 | 3300005618 | Bacteria | 1188 |
| 236 | Ga0068864_100855808 | 3300005618 | Bacteria | 896 |
| 237 | Ga0068864_101041450 | 3300005618 | Bacteria | 813 |
| 238 | Ga0068866_10000040 | 3300005718 | Bacteria | 49399 |
| 239 | Ga0068866_10031258 | 3300005718 | Bacteria | 2563 |
| 240 | Ga0068866_10414725 | 3300005718 | Bacteria | 872 |
| 241 | Ga0068866_10836101 | 3300005718 | Bacteria | 643 |
| 242 | Ga0068861_100014554 | 3300005719 | Bacteria | 5522 |
| 243 | Ga0068861_100055761 | 3300005719 | Bacteria | 3015 |
| 244 | Ga0068861_100156494 | 3300005719 | Bacteria | 1875 |
| 245 | Ga0068861_100274762 | 3300005719 | Bacteria | 1448 |
| 246 | Ga0068861_100370068 | 3300005719 | Bacteria | 1263 |
| 247 | Ga0068861_100392739 | 3300005719 | Bacteria | 1229 |
| 248 | Ga0068861_100951893 | 3300005719 | Bacteria | 817 |
| 249 | Ga0068851_10019999 | 3300005834 | Bacteria | 3238 |
| 250 | Ga0068851_10713850 | 3300005834 | Bacteria | 618 |
| 251 | Ga0068870_10176307 | 3300005840 | Bacteria | 1280 |
| 252 | Ga0068870_10179234 | 3300005840 | Bacteria | 1270 |
| 253 | Ga0068870_10279527 | 3300005840 | Bacteria | 1046 |
| 254 | Ga0068870_10303220 | 3300005840 | Bacteria | 1009 |
| 255 | Ga0068870_11432364 | 3300005840 | Bacteria | 507 |
| 256 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 257 | Ga0068863_100208039 | 3300005841 | Bacteria | 1884 |
| 258 | Ga0068858_100000244 | 3300005842 | Bacteria | 58744 |
| 259 | Ga0068858_100346958 | 3300005842 | Bacteria | 1421 |
| 260 | Ga0068858_100560041 | 3300005842 | Bacteria | 1107 |
| 261 | Ga0068860_100010843 | 3300005843 | Bacteria | 8994 |
| 262 | Ga0068860_100236591 | 3300005843 | Bacteria | 1776 |
| 263 | Ga0068860_100314173 | 3300005843 | Bacteria | 1537 |
| 264 | Ga0068860_100736110 | 3300005843 | Bacteria | 997 |
| 265 | Ga0068862_100133433 | 3300005844 | Bacteria | 2198 |
| 266 | Ga0068862_100222363 | 3300005844 | Bacteria | 1710 |
| 267 | Ga0081455_10010630 | 3300005937 | Bacteria | 9314 |
| 268 | Ga0081455_10193698 | 3300005937 | Bacteria | 1528 |
| 269 | Ga0081455_10864797 | 3300005937 | Bacteria | 564 |
| 270 | Ga0081540_1000568 | 3300005983 | Bacteria | 35821 |
| 271 | Ga0081540_1070851 | 3300005983 | Bacteria | 1613 |
| 272 | Ga0081539_10001489 | 3300005985 | Bacteria | 39599 |
| 273 | Ga0081539_10004262 | 3300005985 | Bacteria | 16052 |
| 274 | Ga0081539_10005444 | 3300005985 | Bacteria | 12992 |
| 275 | Ga0081539_10017508 | 3300005985 | Bacteria | 5026 |
| 276 | Ga0081539_10119657 | 3300005985 | Bacteria | 1310 |
| 277 | Ga0070717_10000061 | 3300006028 | Bacteria | 92257 |
| 278 | Ga0075365_10231017 | 3300006038 | Bacteria | 1298 |
| 279 | Ga0075432_10072403 | 3300006058 | Bacteria | 1240 |
| 280 | Ga0070715_10000036 | 3300006163 | Bacteria | 74811 |
| 281 | Ga0070716_100300188 | 3300006173 | Bacteria | 1117 |
| 282 | Ga0070716_100845593 | 3300006173 | Bacteria | 712 |
| 283 | Ga0070712_100004498 | 3300006175 | Bacteria | 8608 |
| 284 | Ga0070712_100048711 | 3300006175 | Bacteria | 2939 |
| 285 | Ga0070712_100808057 | 3300006175 | Bacteria | 805 |
| 286 | Ga0097621_100047249 | 3300006237 | Bacteria | 3488 |
| 287 | Ga0097621_100047782 | 3300006237 | Bacteria | 3469 |
| 288 | Ga0097621_101619892 | 3300006237 | Bacteria | 616 |
| 289 | Ga0068871_100227347 | 3300006358 | Bacteria | 1618 |
| 290 | Ga0068871_100544062 | 3300006358 | Bacteria | 1051 |
| 291 | Ga0075428_100303059 | 3300006844 | Bacteria | 1718 |
| 292 | Ga0075428_100444086 | 3300006844 | Bacteria | 1390 |
| 293 | Ga0075428_100581660 | 3300006844 | Bacteria | 1196 |
| 294 | Ga0075430_100057972 | 3300006846 | Bacteria | 3256 |
| 295 | Ga0075430_100129822 | 3300006846 | Bacteria | 2100 |
| 296 | Ga0075430_100504576 | 3300006846 | Bacteria | 998 |
| 297 | Ga0075430_101054601 | 3300006846 | Bacteria | 670 |
| 298 | Ga0075431_100141000 | 3300006847 | Bacteria | 2484 |
| 299 | Ga0075431_100180898 | 3300006847 | Bacteria | 2164 |
| 300 | Ga0075431_100823662 | 3300006847 | Bacteria | 900 |
| 301 | Ga0075431_101593036 | 3300006847 | Bacteria | 611 |
| 302 | Ga0075433_10170352 | 3300006852 | Bacteria | 1938 |
| 303 | Ga0075433_10250493 | 3300006852 | Bacteria | 1571 |
| 304 | Ga0075434_100042730 | 3300006871 | Bacteria | 4494 |
| 305 | Ga0075434_100721708 | 3300006871 | Bacteria | 1014 |
| 306 | Ga0075434_100878219 | 3300006871 | Bacteria | 912 |
| 307 | Ga0075434_101074855 | 3300006871 | Bacteria | 818 |
| 308 | Ga0075434_101459042 | 3300006871 | Bacteria | 694 |
| 309 | Ga0068865_100114896 | 3300006881 | Bacteria | 1991 |
| 310 | Ga0068865_101065361 | 3300006881 | Bacteria | 711 |
| 311 | Ga0075436_100034070 | 3300006914 | Bacteria | 3510 |
| 312 | Ga0097620_100231359 | 3300006931 | Bacteria | 1936 |
| 313 | Ga0097620_101610742 | 3300006931 | Bacteria | 717 |
| 314 | Ga0097620_102100752 | 3300006931 | Bacteria | 623 |
| 315 | Ga0097620_102219727 | 3300006931 | Bacteria | 606 |
| 316 | Ga0075435_100487315 | 3300007076 | Bacteria | 1065 |
| 317 | Ga0075435_100836204 | 3300007076 | Bacteria | 802 |
| 318 | Ga0105251_10212301 | 3300009011 | Bacteria | 871 |
| 319 | Ga0105240_10277545 | 3300009093 | Bacteria | 1926 |
| 320 | Ga0105240_11207701 | 3300009093 | Bacteria | 801 |
| 321 | Ga0111539_10179523 | 3300009094 | Bacteria | 2473 |
| 322 | Ga0111539_10836017 | 3300009094 | Bacteria | 1071 |
| 323 | Ga0111539_11423228 | 3300009094 | Bacteria | 804 |
| 324 | Ga0111539_11546865 | 3300009094 | Bacteria | 769 |
| 325 | Ga0111539_12744563 | 3300009094 | Bacteria | 571 |
| 326 | Ga0111539_12926660 | 3300009094 | Bacteria | 552 |
| 327 | Ga0105245_10000291 | 3300009098 | Bacteria | 47913 |
| 328 | Ga0105245_10003629 | 3300009098 | Bacteria | 13776 |
| 329 | Ga0105245_10034896 | 3300009098 | Bacteria | 4463 |
| 330 | Ga0105245_10217917 | 3300009098 | Bacteria | 1840 |
| 331 | Ga0105245_10280451 | 3300009098 | Bacteria | 1628 |
| 332 | Ga0105245_10522758 | 3300009098 | Bacteria | 1205 |
| 333 | Ga0105245_10702422 | 3300009098 | Bacteria | 1045 |
| 334 | Ga0105245_10705699 | 3300009098 | Bacteria | 1042 |
| 335 | Ga0105245_11275741 | 3300009098 | Bacteria | 783 |
| 336 | Ga0105245_13155642 | 3300009098 | Bacteria | 511 |
| 337 | Ga0105245_13256319 | 3300009098 | Bacteria | 503 |
| 338 | Ga0105247_10075526 | 3300009101 | Bacteria | 2115 |
| 339 | Ga0105247_10090935 | 3300009101 | Bacteria | 1937 |
| 340 | Ga0105247_10396358 | 3300009101 | Bacteria | 982 |
| 341 | Ga0105247_10476268 | 3300009101 | Bacteria | 905 |
| 342 | Ga0105247_11051848 | 3300009101 | Bacteria | 639 |
| 343 | Ga0114129_10170314 | 3300009147 | Bacteria | 2969 |
| 344 | Ga0114129_10895359 | 3300009147 | Bacteria | 1125 |
| 345 | Ga0114129_11230053 | 3300009147 | Bacteria | 931 |
| 346 | Ga0105243_10044051 | 3300009148 | Bacteria | 3499 |
| 347 | Ga0105243_10068071 | 3300009148 | Bacteria | 2869 |
| 348 | Ga0105243_10250659 | 3300009148 | Bacteria | 1580 |
| 349 | Ga0105243_10290909 | 3300009148 | Bacteria | 1476 |
| 350 | Ga0105243_10439296 | 3300009148 | Bacteria | 1221 |
| 351 | Ga0105243_10482327 | 3300009148 | Bacteria | 1170 |
| 352 | Ga0105243_10744969 | 3300009148 | Bacteria | 960 |
| 353 | Ga0105243_11451364 | 3300009148 | Bacteria | 708 |
| 354 | Ga0105243_11617002 | 3300009148 | Bacteria | 675 |
| 355 | Ga0105243_12824899 | 3300009148 | Bacteria | 526 |
| 356 | Ga0105242_10004751 | 3300009176 | Bacteria | 10519 |
| 357 | Ga0105242_11524983 | 3300009176 | Bacteria | 700 |
| 358 | Ga0105248_10069164 | 3300009177 | Bacteria | 3964 |
| 359 | Ga0105248_10399776 | 3300009177 | Bacteria | 1547 |
| 360 | Ga0105248_11141168 | 3300009177 | Bacteria | 881 |
| 361 | Ga0105248_11494660 | 3300009177 | Bacteria | 765 |
| 362 | Ga0105237_10454491 | 3300009545 | Bacteria | 1287 |
| 363 | Ga0105237_11704104 | 3300009545 | Bacteria | 637 |
| 364 | Ga0105237_11822650 | 3300009545 | Bacteria | 616 |
| 365 | Ga0105237_12728942 | 3300009545 | Bacteria | 505 |
| 366 | Ga0105238_10000051 | 3300009551 | Bacteria | 141705 |
| 367 | Ga0105238_11457398 | 3300009551 | Bacteria | 713 |
| 368 | Ga0105238_11793976 | 3300009551 | Bacteria | 645 |
| 369 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 370 | Ga0105249_10237981 | 3300009553 | Bacteria | 1799 |
| 371 | Ga0105249_10253061 | 3300009553 | Bacteria | 1747 |
| 372 | Ga0105249_10676101 | 3300009553 | Bacteria | 1091 |
| 373 | Ga0105249_10774304 | 3300009553 | Bacteria | 1023 |
| 374 | Ga0105249_10912660 | 3300009553 | Bacteria | 945 |
| 375 | Ga0105249_11121622 | 3300009553 | Bacteria | 857 |
| 376 | Ga0105249_11376001 | 3300009553 | Bacteria | 778 |
| 377 | Ga0105239_10020882 | 3300010375 | Bacteria | 7226 |
| 378 | Ga0105239_10128679 | 3300010375 | Bacteria | 2815 |
| 379 | Ga0105239_10260288 | 3300010375 | Bacteria | 1950 |
| 380 | Ga0105239_10411555 | 3300010375 | Bacteria | 1531 |
| 381 | Ga0105239_10741716 | 3300010375 | Bacteria | 1124 |
| 382 | Ga0105239_11280788 | 3300010375 | Bacteria | 845 |
| 383 | Ga0105239_12951051 | 3300010375 | Bacteria | 555 |
| 384 | Ga0105246_10017569 | 3300011119 | Bacteria | 4549 |
| 385 | Ga0105246_10854265 | 3300011119 | Bacteria | 812 |
| 386 | Ga0105246_11742110 | 3300011119 | Bacteria | 593 |
| 387 | Ga0105246_11858894 | 3300011119 | Bacteria | 577 |
| 388 | Ga0105246_12026119 | 3300011119 | Bacteria | 556 |
| 389 | Ga0157345_1024048 | 3300012498 | Bacteria | 641 |
| 390 | Ga0157342_1082862 | 3300012507 | Bacteria | 507 |
| 391 | Ga0157338_1052698 | 3300012515 | Bacteria | 589 |
| 392 | Ga0157371_10008383 | 3300013102 | Bacteria | 8241 |
| 393 | Ga0157371_10213254 | 3300013102 | Bacteria | 1386 |
| 394 | Ga0157371_11004812 | 3300013102 | Bacteria | 636 |
| 395 | Ga0157371_11249594 | 3300013102 | Bacteria | 573 |
| 396 | Ga0157370_10343717 | 3300013104 | Bacteria | 1375 |
| 397 | Ga0157369_10175305 | 3300013105 | Bacteria | 2258 |
| 398 | Ga0157369_10475857 | 3300013105 | Bacteria | 1293 |
| 399 | Ga0157374_10039495 | 3300013296 | Bacteria | 4343 |
| 400 | Ga0157374_10396326 | 3300013296 | Bacteria | 1377 |
| 401 | Ga0157374_10468033 | 3300013296 | Bacteria | 1263 |
| 402 | Ga0157374_10509878 | 3300013296 | Bacteria | 1208 |
| 403 | Ga0157374_11117032 | 3300013296 | Bacteria | 809 |
| 404 | Ga0157374_11782617 | 3300013296 | Bacteria | 641 |
| 405 | Ga0157378_10095057 | 3300013297 | Bacteria | 2714 |
| 406 | Ga0157378_10346904 | 3300013297 | Bacteria | 1449 |
| 407 | Ga0157378_13017794 | 3300013297 | Bacteria | 522 |
| 408 | Ga0157378_13041154 | 3300013297 | Bacteria | 520 |
| 409 | Ga0157378_13197397 | 3300013297 | Unclassified | 509 |
| 410 | Ga0157378_13251273 | 3300013297 | Bacteria | 505 |
| 411 | Ga0163162_10176490 | 3300013306 | Bacteria | 2262 |
| 412 | Ga0163162_10502797 | 3300013306 | Bacteria | 1342 |
| 413 | Ga0163162_10651789 | 3300013306 | Bacteria | 1177 |
| 414 | Ga0163162_10736838 | 3300013306 | Bacteria | 1105 |
| 415 | Ga0163162_10985767 | 3300013306 | Bacteria | 952 |
| 416 | Ga0163162_11230717 | 3300013306 | Bacteria | 850 |
| 417 | Ga0157372_10121159 | 3300013307 | Bacteria | 3004 |
| 418 | Ga0157372_10376171 | 3300013307 | Bacteria | 1655 |
| 419 | Ga0157372_10474523 | 3300013307 | Bacteria | 1458 |
| 420 | Ga0157372_10640753 | 3300013307 | Bacteria | 1238 |
| 421 | Ga0157372_10658269 | 3300013307 | Bacteria | 1220 |
| 422 | Ga0157372_10861424 | 3300013307 | Bacteria | 1052 |
| 423 | Ga0157372_11577431 | 3300013307 | Bacteria | 756 |
| 424 | Ga0157372_13155321 | 3300013307 | Bacteria | 526 |
| 425 | Ga0157375_10001056 | 3300013308 | Bacteria | 23764 |
| 426 | Ga0157375_10501149 | 3300013308 | Bacteria | 1378 |
| 427 | Ga0157375_10502195 | 3300013308 | Bacteria | 1377 |
| 428 | Ga0157375_10524910 | 3300013308 | Bacteria | 1347 |
| 429 | Ga0157375_10656430 | 3300013308 | Bacteria | 1205 |
| 430 | Ga0157375_10899471 | 3300013308 | Bacteria | 1029 |
| 431 | Ga0157375_10963460 | 3300013308 | Bacteria | 994 |
| 432 | Ga0157375_11311547 | 3300013308 | Bacteria | 851 |
| 433 | Ga0157375_12047906 | 3300013308 | Bacteria | 681 |
| 434 | Ga0157375_13328239 | 3300013308 | Bacteria | 536 |
| 435 | Ga0157375_13478110 | 3300013308 | Bacteria | 524 |
| 436 | Ga0157375_13774610 | 3300013308 | Bacteria | 503 |
| 437 | Ga0163163_10023648 | 3300014325 | Bacteria | 5834 |
| 438 | Ga0163163_10133668 | 3300014325 | Bacteria | 2521 |
| 439 | Ga0163163_10260542 | 3300014325 | Bacteria | 1785 |
| 440 | Ga0163163_10547721 | 3300014325 | Bacteria | 1219 |
| 441 | Ga0163163_11045578 | 3300014325 | Bacteria | 880 |
| 442 | Ga0163163_11433529 | 3300014325 | Bacteria | 752 |
| 443 | Ga0163163_11950487 | 3300014325 | Bacteria | 647 |
| 444 | Ga0163163_11962666 | 3300014325 | Bacteria | 645 |
| 445 | Ga0163163_13142434 | 3300014325 | Bacteria | 515 |
| 446 | Ga0157380_10015195 | 3300014326 | Bacteria | 5653 |
| 447 | Ga0157380_10135717 | 3300014326 | Bacteria | 2105 |
| 448 | Ga0157380_10406236 | 3300014326 | Bacteria | 1294 |
| 449 | Ga0157380_10715235 | 3300014326 | Bacteria | 1008 |
| 450 | Ga0182008_10074947 | 3300014497 | Bacteria | 1665 |
| 451 | Ga0182008_10677617 | 3300014497 | Bacteria | 587 |
| 452 | Ga0182008_10952577 | 3300014497 | Bacteria | 509 |
| 453 | Ga0157377_10002646 | 3300014745 | Bacteria | 7948 |
| 454 | Ga0157377_10107056 | 3300014745 | Bacteria | 1675 |
| 455 | Ga0157377_10182075 | 3300014745 | Bacteria | 1322 |
| 456 | Ga0157377_10207937 | 3300014745 | Bacteria | 1246 |
| 457 | Ga0157377_10616268 | 3300014745 | Bacteria | 776 |
| 458 | Ga0157377_10766114 | 3300014745 | Bacteria | 708 |
| 459 | Ga0157379_10135778 | 3300014968 | Bacteria | 2216 |
| 460 | Ga0157379_10237814 | 3300014968 | Bacteria | 1652 |
| 461 | Ga0157379_11397380 | 3300014968 | Bacteria | 678 |
| 462 | Ga0157379_12595334 | 3300014968 | Bacteria | 507 |
| 463 | Ga0157376_10020056 | 3300014969 | Bacteria | 5164 |
| 464 | Ga0157376_10036164 | 3300014969 | Bacteria | 3998 |
| 465 | Ga0157376_10124246 | 3300014969 | Bacteria | 2292 |
| 466 | Ga0157376_11419894 | 3300014969 | Bacteria | 726 |
| 467 | Ga0157376_12666211 | 3300014969 | Bacteria | 540 |
| 468 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 469 | Ga0163161_10203162 | 3300017792 | Bacteria | 1528 |
| 470 | Ga0163161_10613201 | 3300017792 | Bacteria | 898 |
| 471 | Ga0206354_10546389 | 3300020081 | Bacteria | 738 |
| 472 | Ga0206354_11486596 | 3300020081 | Bacteria | 1049 |
| 473 | Ga0206353_10584676 | 3300020082 | Bacteria | 697 |
| 474 | Ga0213873_10038511 | 3300021358 | Bacteria | 1222 |
| 475 | Ga0213874_10221763 | 3300021377 | Bacteria | 687 |
| 476 | Ga0213876_10727960 | 3300021384 | Bacteria | 528 |
| 477 | Ga0207672_1010329 | 3300025223 | Bacteria | 564 |
| 478 | Ga0207656_10011616 | 3300025321 | Bacteria | 3332 |
| 479 | Ga0207656_10036938 | 3300025321 | Bacteria | 2052 |
| 480 | Ga0207713_1190386 | 3300025735 | Bacteria | 635 |
| 481 | Ga0207682_10000102 | 3300025893 | Bacteria | 38757 |
| 482 | Ga0207682_10250492 | 3300025893 | Bacteria | 824 |
| 483 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 484 | Ga0207692_10014509 | 3300025898 | Bacteria | 3444 |
| 485 | Ga0207692_10070515 | 3300025898 | Bacteria | 1840 |
| 486 | Ga0207692_10120642 | 3300025898 | Bacteria | 1468 |
| 487 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 488 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 489 | Ga0207642_10022154 | 3300025899 | Bacteria | 2515 |
| 490 | Ga0207642_10334129 | 3300025899 | Bacteria | 889 |
| 491 | Ga0207642_10442642 | 3300025899 | Bacteria | 786 |
| 492 | Ga0207642_10878712 | 3300025899 | Bacteria | 573 |
| 493 | Ga0207710_10035925 | 3300025900 | Bacteria | 2182 |
| 494 | Ga0207710_10139889 | 3300025900 | Bacteria | 1168 |
| 495 | Ga0207710_10266660 | 3300025900 | Bacteria | 859 |
| 496 | Ga0207710_10691026 | 3300025900 | Bacteria | 535 |
| 497 | Ga0207688_10000979 | 3300025901 | Bacteria | 14558 |
| 498 | Ga0207688_10075497 | 3300025901 | Bacteria | 1918 |
| 499 | Ga0207688_10233938 | 3300025901 | Bacteria | 1109 |
| 500 | Ga0207688_10255287 | 3300025901 | Bacteria | 1063 |
| 501 | Ga0207680_10007622 | 3300025903 | Bacteria | 5285 |
| 502 | Ga0207680_10565766 | 3300025903 | Bacteria | 812 |
| 503 | Ga0207680_10717189 | 3300025903 | Bacteria | 717 |
| 504 | Ga0207647_10192570 | 3300025904 | Bacteria | 1181 |
| 505 | Ga0207647_10500327 | 3300025904 | Bacteria | 678 |
| 506 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 507 | Ga0207685_10222535 | 3300025905 | Bacteria | 898 |
| 508 | Ga0207699_10528191 | 3300025906 | Bacteria | 854 |
| 509 | Ga0207645_10077392 | 3300025907 | Bacteria | 2131 |
| 510 | Ga0207645_10270965 | 3300025907 | Bacteria | 1126 |
| 511 | Ga0207643_10034910 | 3300025908 | Bacteria | 2819 |
| 512 | Ga0207643_10754076 | 3300025908 | Bacteria | 630 |
| 513 | Ga0207705_10055513 | 3300025909 | Bacteria | 2856 |
| 514 | Ga0207705_10254172 | 3300025909 | Bacteria | 1341 |
| 515 | Ga0207705_10283133 | 3300025909 | Bacteria | 1269 |
| 516 | Ga0207705_11496068 | 3300025909 | Bacteria | 511 |
| 517 | Ga0207707_10422948 | 3300025912 | Bacteria | 1142 |
| 518 | Ga0207695_11115138 | 3300025913 | Bacteria | 669 |
| 519 | Ga0207695_11320840 | 3300025913 | Bacteria | 601 |
| 520 | Ga0207693_10005251 | 3300025915 | Bacteria | 10836 |
| 521 | Ga0207693_10052891 | 3300025915 | Bacteria | 3186 |
| 522 | Ga0207693_10595139 | 3300025915 | Bacteria | 861 |
| 523 | Ga0207663_10005434 | 3300025916 | Bacteria | 6418 |
| 524 | Ga0207663_10077672 | 3300025916 | Bacteria | 2162 |
| 525 | Ga0207663_10217062 | 3300025916 | Bacteria | 1390 |
| 526 | Ga0207663_10636366 | 3300025916 | Bacteria | 841 |
| 527 | Ga0207660_10556911 | 3300025917 | Bacteria | 933 |
| 528 | Ga0207660_10855914 | 3300025917 | Bacteria | 742 |
| 529 | Ga0207660_10901703 | 3300025917 | Bacteria | 721 |
| 530 | Ga0207662_10020390 | 3300025918 | Bacteria | 3783 |
| 531 | Ga0207662_10374015 | 3300025918 | Bacteria | 961 |
| 532 | Ga0207662_10567866 | 3300025918 | Bacteria | 787 |
| 533 | Ga0207662_10589929 | 3300025918 | Bacteria | 772 |
| 534 | Ga0207657_10027772 | 3300025919 | Bacteria | 5176 |
| 535 | Ga0207657_10122339 | 3300025919 | Bacteria | 2140 |
| 536 | Ga0207657_10197070 | 3300025919 | Bacteria | 1622 |
| 537 | Ga0207657_10277619 | 3300025919 | Bacteria | 1331 |
| 538 | Ga0207657_10338541 | 3300025919 | Bacteria | 1188 |
| 539 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 540 | Ga0207649_10394347 | 3300025920 | Bacteria | 1034 |
| 541 | Ga0207649_11260129 | 3300025920 | Bacteria | 585 |
| 542 | Ga0207649_11275683 | 3300025920 | Bacteria | 581 |
| 543 | Ga0207649_11539395 | 3300025920 | Bacteria | 526 |
| 544 | Ga0207652_10000444 | 3300025921 | Bacteria | 42675 |
| 545 | Ga0207652_11152013 | 3300025921 | Bacteria | 677 |
| 546 | Ga0207681_10003557 | 3300025923 | Bacteria | 9702 |
| 547 | Ga0207681_10272085 | 3300025923 | Bacteria | 1330 |
| 548 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 549 | Ga0207659_10000242 | 3300025926 | Bacteria | 33194 |
| 550 | Ga0207659_10231666 | 3300025926 | Bacteria | 1490 |
| 551 | Ga0207659_10378502 | 3300025926 | Bacteria | 1180 |
| 552 | Ga0207659_10963341 | 3300025926 | Bacteria | 734 |
| 553 | Ga0207687_10000058 | 3300025927 | Bacteria | 85860 |
| 554 | Ga0207687_10019427 | 3300025927 | Bacteria | 4502 |
| 555 | Ga0207687_10081140 | 3300025927 | Bacteria | 2343 |
| 556 | Ga0207687_10134629 | 3300025927 | Bacteria | 1868 |
| 557 | Ga0207687_10380193 | 3300025927 | Bacteria | 1157 |
| 558 | Ga0207687_10950081 | 3300025927 | Bacteria | 736 |
| 559 | Ga0207687_10973742 | 3300025927 | Bacteria | 727 |
| 560 | Ga0207687_11432632 | 3300025927 | Bacteria | 594 |
| 561 | Ga0207700_10000013 | 3300025928 | Bacteria | 230462 |
| 562 | Ga0207664_10000142 | 3300025929 | Bacteria | 59306 |
| 563 | Ga0207664_10005021 | 3300025929 | Bacteria | 9001 |
| 564 | Ga0207664_10326785 | 3300025929 | Bacteria | 1354 |
| 565 | Ga0207644_10152742 | 3300025931 | Bacteria | 1788 |
| 566 | Ga0207644_11341746 | 3300025931 | Bacteria | 601 |
| 567 | Ga0207690_10000054 | 3300025932 | Bacteria | 104097 |
| 568 | Ga0207690_10230836 | 3300025932 | Bacteria | 1421 |
| 569 | Ga0207690_10233920 | 3300025932 | Bacteria | 1412 |
| 570 | Ga0207690_10268418 | 3300025932 | Bacteria | 1325 |
| 571 | Ga0207690_10491564 | 3300025932 | Bacteria | 991 |
| 572 | Ga0207690_10584635 | 3300025932 | Bacteria | 910 |
| 573 | Ga0207690_10831323 | 3300025932 | Bacteria | 764 |
| 574 | Ga0207706_10000413 | 3300025933 | Bacteria | 45740 |
| 575 | Ga0207706_10044291 | 3300025933 | Bacteria | 3944 |
| 576 | Ga0207706_10051710 | 3300025933 | Bacteria | 3628 |
| 577 | Ga0207706_10338576 | 3300025933 | Bacteria | 1309 |
| 578 | Ga0207706_10409292 | 3300025933 | Bacteria | 1176 |
| 579 | Ga0207686_10000247 | 3300025934 | Bacteria | 41146 |
| 580 | Ga0207686_10102107 | 3300025934 | Bacteria | 1917 |
| 581 | Ga0207686_10454777 | 3300025934 | Bacteria | 986 |
| 582 | Ga0207686_11844084 | 3300025934 | Bacteria | 501 |
| 583 | Ga0207709_10006427 | 3300025935 | Bacteria | 6596 |
| 584 | Ga0207709_10045864 | 3300025935 | Bacteria | 2650 |
| 585 | Ga0207709_10116336 | 3300025935 | Bacteria | 1797 |
| 586 | Ga0207709_10231548 | 3300025935 | Bacteria | 1338 |
| 587 | Ga0207709_10268194 | 3300025935 | Bacteria | 1255 |
| 588 | Ga0207709_10268384 | 3300025935 | Bacteria | 1255 |
| 589 | Ga0207709_10495709 | 3300025935 | Bacteria | 952 |
| 590 | Ga0207709_11197846 | 3300025935 | Bacteria | 626 |
| 591 | Ga0207670_10034986 | 3300025936 | Bacteria | 3253 |
| 592 | Ga0207670_10269871 | 3300025936 | Bacteria | 1322 |
| 593 | Ga0207670_10380166 | 3300025936 | Bacteria | 1125 |
| 594 | Ga0207670_10890117 | 3300025936 | Bacteria | 745 |
| 595 | Ga0207669_10000099 | 3300025937 | Bacteria | 43726 |
| 596 | Ga0207669_10062566 | 3300025937 | Bacteria | 2293 |
| 597 | Ga0207669_10276406 | 3300025937 | Bacteria | 1264 |
| 598 | Ga0207669_11534311 | 3300025937 | Bacteria | 568 |
| 599 | Ga0207704_10150920 | 3300025938 | Bacteria | 1639 |
| 600 | Ga0207704_10753810 | 3300025938 | Bacteria | 810 |
| 601 | Ga0207704_10938071 | 3300025938 | Bacteria | 729 |
| 602 | Ga0207704_11096474 | 3300025938 | Bacteria | 676 |
| 603 | Ga0207665_10644921 | 3300025939 | Bacteria | 830 |
| 604 | Ga0207665_10949985 | 3300025939 | Bacteria | 683 |
| 605 | Ga0207691_10000005 | 3300025940 | Bacteria | 163117 |
| 606 | Ga0207691_10294280 | 3300025940 | Bacteria | 1396 |
| 607 | Ga0207691_10325298 | 3300025940 | Bacteria | 1318 |
| 608 | Ga0207691_10658991 | 3300025940 | Bacteria | 884 |
| 609 | Ga0207691_11282009 | 3300025940 | Bacteria | 605 |
| 610 | Ga0207711_10142458 | 3300025941 | Bacteria | 2157 |
| 611 | Ga0207711_11033314 | 3300025941 | Bacteria | 762 |
| 612 | Ga0207711_11177955 | 3300025941 | Bacteria | 708 |
| 613 | Ga0207689_10178902 | 3300025942 | Bacteria | 1749 |
| 614 | Ga0207689_10235902 | 3300025942 | Bacteria | 1512 |
| 615 | Ga0207689_10277176 | 3300025942 | Bacteria | 1389 |
| 616 | Ga0207689_10403257 | 3300025942 | Bacteria | 1140 |
| 617 | Ga0207661_10000333 | 3300025944 | Bacteria | 30072 |
| 618 | Ga0207661_10010720 | 3300025944 | Bacteria | 6606 |
| 619 | Ga0207661_10019879 | 3300025944 | Bacteria | 5011 |
| 620 | Ga0207661_10027205 | 3300025944 | Bacteria | 4367 |
| 621 | Ga0207661_10027861 | 3300025944 | Bacteria | 4321 |
| 622 | Ga0207661_10049048 | 3300025944 | Bacteria | 3359 |
| 623 | Ga0207661_10060797 | 3300025944 | Bacteria | 3050 |
| 624 | Ga0207661_10107115 | 3300025944 | Bacteria | 2357 |
| 625 | Ga0207661_10215848 | 3300025944 | Bacteria | 1693 |
| 626 | Ga0207661_10400268 | 3300025944 | Bacteria | 1245 |
| 627 | Ga0207661_10407097 | 3300025944 | Bacteria | 1234 |
| 628 | Ga0207661_10474577 | 3300025944 | Bacteria | 1141 |
| 629 | Ga0207679_10016670 | 3300025945 | Bacteria | 4880 |
| 630 | Ga0207679_10160193 | 3300025945 | Bacteria | 1842 |
| 631 | Ga0207679_10188083 | 3300025945 | Bacteria | 1714 |
| 632 | Ga0207679_10219185 | 3300025945 | Bacteria | 1600 |
| 633 | Ga0207679_10385649 | 3300025945 | Bacteria | 1229 |
| 634 | Ga0207679_10969756 | 3300025945 | Bacteria | 779 |
| 635 | Ga0207679_11118570 | 3300025945 | Bacteria | 723 |
| 636 | Ga0207679_11334696 | 3300025945 | Bacteria | 658 |
| 637 | Ga0207667_10319765 | 3300025949 | Bacteria | 1585 |
| 638 | Ga0207667_10353474 | 3300025949 | Bacteria | 1498 |
| 639 | Ga0207667_10708049 | 3300025949 | Bacteria | 1009 |
| 640 | Ga0207667_11681269 | 3300025949 | Bacteria | 602 |
| 641 | Ga0207667_11870910 | 3300025949 | Bacteria | 563 |
| 642 | Ga0207651_10001290 | 3300025960 | Bacteria | 11276 |
| 643 | Ga0207651_10504750 | 3300025960 | Bacteria | 1046 |
| 644 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 645 | Ga0207712_10282658 | 3300025961 | Bacteria | 1355 |
| 646 | Ga0207712_10608407 | 3300025961 | Bacteria | 946 |
| 647 | Ga0207712_11259060 | 3300025961 | Bacteria | 661 |
| 648 | Ga0207668_10126895 | 3300025972 | Bacteria | 1942 |
| 649 | Ga0207668_10154224 | 3300025972 | Bacteria | 1782 |
| 650 | Ga0207668_10988436 | 3300025972 | Bacteria | 752 |
| 651 | Ga0207640_10042521 | 3300025981 | Bacteria | 2898 |
| 652 | Ga0207640_11068735 | 3300025981 | Bacteria | 713 |
| 653 | Ga0207640_11323619 | 3300025981 | Bacteria | 644 |
| 654 | Ga0207658_10091020 | 3300025986 | Bacteria | 2365 |
| 655 | Ga0207658_10236894 | 3300025986 | Bacteria | 1544 |
| 656 | Ga0207658_10444879 | 3300025986 | Bacteria | 1146 |
| 657 | Ga0207677_10156309 | 3300026023 | Bacteria | 1766 |
| 658 | Ga0207677_10274037 | 3300026023 | Bacteria | 1382 |
| 659 | Ga0207677_10277325 | 3300026023 | Bacteria | 1374 |
| 660 | Ga0207677_10312526 | 3300026023 | Bacteria | 1303 |
| 661 | Ga0207677_10583258 | 3300026023 | Bacteria | 979 |
| 662 | Ga0207677_10706607 | 3300026023 | Bacteria | 895 |
| 663 | Ga0207677_11108960 | 3300026023 | Bacteria | 722 |
| 664 | Ga0207703_10000411 | 3300026035 | Bacteria | 45579 |
| 665 | Ga0207703_10419852 | 3300026035 | Bacteria | 1244 |
| 666 | Ga0207703_10566298 | 3300026035 | Bacteria | 1072 |
| 667 | Ga0207703_11041913 | 3300026035 | Bacteria | 785 |
| 668 | Ga0207639_10011691 | 3300026041 | Bacteria | 6103 |
| 669 | Ga0207639_10623813 | 3300026041 | Bacteria | 996 |
| 670 | Ga0207678_10080589 | 3300026067 | Bacteria | 2787 |
| 671 | Ga0207678_10117204 | 3300026067 | Bacteria | 2272 |
| 672 | Ga0207678_10283698 | 3300026067 | Bacteria | 1422 |
| 673 | Ga0207678_10372687 | 3300026067 | Bacteria | 1233 |
| 674 | Ga0207678_10413951 | 3300026067 | Bacteria | 1168 |
| 675 | Ga0207678_10585500 | 3300026067 | Bacteria | 978 |
| 676 | Ga0207678_10674581 | 3300026067 | Bacteria | 909 |
| 677 | Ga0207678_11600509 | 3300026067 | Bacteria | 574 |
| 678 | Ga0207708_10000604 | 3300026075 | Bacteria | 27706 |
| 679 | Ga0207708_10025143 | 3300026075 | Bacteria | 4503 |
| 680 | Ga0207708_10027516 | 3300026075 | Bacteria | 4305 |
| 681 | Ga0207708_10036375 | 3300026075 | Bacteria | 3748 |
| 682 | Ga0207708_10408189 | 3300026075 | Bacteria | 1124 |
| 683 | Ga0207708_10521617 | 3300026075 | Bacteria | 998 |
| 684 | Ga0207708_10667867 | 3300026075 | Bacteria | 886 |
| 685 | Ga0207708_10838111 | 3300026075 | Bacteria | 793 |
| 686 | Ga0207708_11253038 | 3300026075 | Bacteria | 649 |
| 687 | Ga0207708_11847111 | 3300026075 | Bacteria | 530 |
| 688 | Ga0207702_10011624 | 3300026078 | Bacteria | 7335 |
| 689 | Ga0207702_10015114 | 3300026078 | Bacteria | 6400 |
| 690 | Ga0207702_10024744 | 3300026078 | Bacteria | 4981 |
| 691 | Ga0207702_10314937 | 3300026078 | Bacteria | 1489 |
| 692 | Ga0207702_10431792 | 3300026078 | Bacteria | 1275 |
| 693 | Ga0207702_10561167 | 3300026078 | Bacteria | 1118 |
| 694 | Ga0207702_11193185 | 3300026078 | Bacteria | 755 |
| 695 | Ga0207702_11615869 | 3300026078 | Bacteria | 641 |
| 696 | Ga0207641_10000066 | 3300026088 | Bacteria | 155638 |
| 697 | Ga0207641_10224528 | 3300026088 | Bacteria | 1743 |
| 698 | Ga0207641_10432871 | 3300026088 | Bacteria | 1269 |
| 699 | Ga0207641_10970006 | 3300026088 | Bacteria | 846 |
| 700 | Ga0207641_11246442 | 3300026088 | Bacteria | 744 |
| 701 | Ga0207648_10003660 | 3300026089 | Bacteria | 16089 |
| 702 | Ga0207648_10034643 | 3300026089 | Bacteria | 4450 |
| 703 | Ga0207648_10250751 | 3300026089 | Bacteria | 1578 |
| 704 | Ga0207648_10854990 | 3300026089 | Bacteria | 848 |
| 705 | Ga0207676_10033098 | 3300026095 | Bacteria | 3903 |
| 706 | Ga0207676_10096043 | 3300026095 | Bacteria | 2446 |
| 707 | Ga0207676_10516079 | 3300026095 | Bacteria | 1137 |
| 708 | Ga0207674_10203728 | 3300026116 | Bacteria | 1928 |
| 709 | Ga0207675_100044331 | 3300026118 | Bacteria | 4156 |
| 710 | Ga0207675_100059574 | 3300026118 | Bacteria | 3563 |
| 711 | Ga0207675_100204481 | 3300026118 | Bacteria | 1897 |
| 712 | Ga0207675_100527872 | 3300026118 | Bacteria | 1177 |
| 713 | Ga0207675_100649796 | 3300026118 | Bacteria | 1061 |
| 714 | Ga0207675_102531159 | 3300026118 | Bacteria | 524 |
| 715 | Ga0207675_102595738 | 3300026118 | Bacteria | 516 |
| 716 | Ga0207683_10049953 | 3300026121 | Bacteria | 3662 |
| 717 | Ga0207683_10092170 | 3300026121 | Bacteria | 2700 |
| 718 | Ga0207683_10109855 | 3300026121 | Bacteria | 2468 |
| 719 | Ga0207683_10278263 | 3300026121 | Bacteria | 1529 |
| 720 | Ga0207683_11034576 | 3300026121 | Bacteria | 762 |
| 721 | Ga0207683_11272488 | 3300026121 | Bacteria | 681 |
| 722 | Ga0207683_11454384 | 3300026121 | Bacteria | 633 |
| 723 | Ga0207698_10022390 | 3300026142 | Bacteria | 4390 |
| 724 | Ga0207698_10288992 | 3300026142 | Bacteria | 1520 |
| 725 | Ga0207698_10417026 | 3300026142 | Bacteria | 1287 |
| 726 | Ga0207698_10511512 | 3300026142 | Bacteria | 1170 |
| 727 | Ga0207698_10808608 | 3300026142 | Bacteria | 940 |
| 728 | Ga0207698_12055368 | 3300026142 | Bacteria | 585 |
| 729 | Ga0209371_1072523 | 3300027312 | Bacteria | 609 |
| 730 | Ga0209966_1137832 | 3300027695 | Bacteria | 565 |
| 731 | Ga0207428_10060696 | 3300027907 | Bacteria | 2995 |
| 732 | Ga0207428_10475148 | 3300027907 | Bacteria | 910 |
| 733 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 734 | Ga0268266_10001583 | 3300028379 | Bacteria | 26570 |
| 735 | Ga0268266_10012449 | 3300028379 | Bacteria | 7352 |
| 736 | Ga0268266_10178666 | 3300028379 | Bacteria | 1931 |
| 737 | Ga0268266_10651660 | 3300028379 | Bacteria | 1013 |
| 738 | Ga0268266_10776337 | 3300028379 | Bacteria | 925 |
| 739 | Ga0268266_10858252 | 3300028379 | Bacteria | 878 |
| 740 | Ga0268266_11047613 | 3300028379 | Bacteria | 789 |
| 741 | Ga0268266_12303311 | 3300028379 | Bacteria | 510 |
| 742 | Ga0268265_10106261 | 3300028380 | Bacteria | 2280 |
| 743 | Ga0268265_11098305 | 3300028380 | Bacteria | 789 |
| 744 | Ga0268264_10002303 | 3300028381 | Bacteria | 16909 |
| 745 | Ga0268264_10028443 | 3300028381 | Bacteria | 4573 |
| 746 | Ga0268264_10244183 | 3300028381 | Bacteria | 1665 |
| 747 | Ga0265337_1000044 | 3300028556 | Bacteria | 54694 |
| 748 | Ga0265326_10000005 | 3300028558 | Bacteria | 257124 |
| 749 | Ga0265326_10000038 | 3300028558 | Bacteria | 88362 |
| 750 | Ga0265319_1002481 | 3300028563 | Bacteria | 10046 |
| 751 | Ga0265319_1003626 | 3300028563 | Bacteria | 7983 |
| 752 | Ga0265334_10000024 | 3300028573 | Bacteria | 118525 |
| 753 | Ga0265318_10015580 | 3300028577 | Bacteria | 3158 |
| 754 | Ga0265323_10141015 | 3300028653 | Bacteria | 776 |
| 755 | Ga0265322_10000006 | 3300028654 | Bacteria | 231685 |
| 756 | Ga0265336_10004085 | 3300028666 | Bacteria | 5561 |
| 757 | Ga0265336_10017857 | 3300028666 | Bacteria | 2305 |
| 758 | Ga0265338_10013188 | 3300028800 | Bacteria | 9353 |
| 759 | Ga0265338_10053056 | 3300028800 | Bacteria | 3631 |
| 760 | Ga0265338_10136466 | 3300028800 | Bacteria | 1928 |
| 761 | Ga0265324_10000171 | 3300029957 | Bacteria | 50487 |
| 762 | Ga0265324_10002344 | 3300029957 | Bacteria | 9784 |
| 763 | Ga0268256_1080677 | 3300030500 | Bacteria | 609 |
| 764 | Ga0265330_10410932 | 3300031235 | Bacteria | 573 |
| 765 | Ga0265332_10026496 | 3300031238 | Bacteria | 2543 |
| 766 | Ga0265328_10001776 | 3300031239 | Bacteria | 9841 |
| 767 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 768 | Ga0265320_10015630 | 3300031240 | Bacteria | 4285 |
| 769 | Ga0265320_10024350 | 3300031240 | Bacteria | 3202 |
| 770 | Ga0265320_10091679 | 3300031240 | Bacteria | 1407 |
| 771 | Ga0265320_10175825 | 3300031240 | Bacteria | 961 |
| 772 | Ga0265325_10269669 | 3300031241 | Bacteria | 766 |
| 773 | Ga0265329_10055875 | 3300031242 | Bacteria | 1252 |
| 774 | Ga0265339_10007603 | 3300031249 | Bacteria | 6983 |
| 775 | Ga0265331_10000624 | 3300031250 | Bacteria | 30780 |
| 776 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 777 | Ga0265327_10244047 | 3300031251 | Bacteria | 802 |
| 778 | Ga0265316_10020799 | 3300031344 | Bacteria | 5575 |
| 779 | Ga0265316_10074360 | 3300031344 | Bacteria | 2615 |
| 780 | Ga0307513_10108862 | 3300031456 | Bacteria | 2770 |
| 781 | Ga0265313_10064867 | 3300031595 | Bacteria | 1697 |
| 782 | Ga0265313_10179569 | 3300031595 | Bacteria | 890 |
| 783 | Ga0265314_10000103 | 3300031711 | Bacteria | 127956 |
| 784 | Ga0265314_10039634 | 3300031711 | Bacteria | 3390 |
| 785 | Ga0265314_10106751 | 3300031711 | Bacteria | 1788 |
| 786 | Ga0265342_10153155 | 3300031712 | Bacteria | 1279 |
| 787 | Ga0316576_10446825 | 3300031727 | Bacteria | 955 |
| 788 | Ga0316578_10125452 | 3300031728 | Bacteria | 1544 |
| 789 | Ga0307405_11475762 | 3300031731 | Bacteria | 597 |
| 790 | Ga0307405_11602413 | 3300031731 | Bacteria | 574 |
| 791 | Ga0307410_11704714 | 3300031852 | Bacteria | 558 |
| 792 | Ga0307406_11032027 | 3300031901 | Bacteria | 707 |
| 793 | Ga0307407_10797939 | 3300031903 | Bacteria | 718 |
| 794 | Ga0307407_11000776 | 3300031903 | Bacteria | 646 |
| 795 | Ga0307409_100153899 | 3300031995 | Bacteria | 2001 |
| 796 | Ga0307409_101148457 | 3300031995 | Bacteria | 799 |
| 797 | Ga0307409_101504255 | 3300031995 | Bacteria | 701 |
| 798 | Ga0307416_100410609 | 3300032002 | Bacteria | 1395 |
| 799 | Ga0307416_100569146 | 3300032002 | Bacteria | 1209 |
| 800 | Ga0307416_100832590 | 3300032002 | Bacteria | 1020 |
| 801 | Ga0307416_100862792 | 3300032002 | Bacteria | 1004 |
| 802 | Ga0307416_101765728 | 3300032002 | Bacteria | 723 |
| 803 | Ga0307416_102197832 | 3300032002 | Bacteria | 653 |
| 804 | Ga0307416_102392196 | 3300032002 | Bacteria | 628 |
| 805 | Ga0307414_11470185 | 3300032004 | Bacteria | 634 |
| 806 | Ga0307415_100039378 | 3300032126 | Bacteria | 3123 |
| 807 | Ga0307415_100289625 | 3300032126 | Bacteria | 1351 |
| 808 | Ga0307415_100762346 | 3300032126 | Bacteria | 880 |
| 809 | Ga0307415_101468251 | 3300032126 | Bacteria | 651 |
| 810 | Ga0373944_0042410 | 3300035089 | Bacteria | 1411 |
| 811 | Ga0373941_0337466 | 3300035115 | Bacteria | 610 |
| 812 | Ga0373954_0511807 | 3300035118 | Bacteria | 595 |
| 813 | Ga0373943_0051238 | 3300035170 | Bacteria | 2032 |
| 814 | Ga0373961_0384486 | 3300035241 | Bacteria | 536 |
| 815 | Ga0316574_0316492 | 3300035398 | Bacteria | 991 |
| 816 | Ga0373937_0106785 | 3300036401 | Bacteria | 2603 |
| 817 | Ga0373937_0117732 | 3300036401 | Bacteria | 2475 |
| 818 | Ga0373937_1707532 | 3300036401 | Bacteria | 576 |
| 819 | Ga0373925_0271347 | 3300037068 | Bacteria | 1365 |
| 820 | Ga0395899_0406261 | 3300037312 | Bacteria | 900 |
| 821 | Ga0395899_0532453 | 3300037312 | Bacteria | 758 |
| 822 | Ga0395900_0002246 | 3300037418 | Bacteria | 21499 |
| 823 | Ga0395900_0076780 | 3300037418 | Bacteria | 3433 |
| 824 | Ga0395900_0124749 | 3300037418 | Bacteria | 2641 |
| 825 | Ga0395900_0442340 | 3300037418 | Bacteria | 1257 |
| 826 | Ga0395900_0443578 | 3300037418 | Bacteria | 1255 |
| 827 | Ga0395900_0811972 | 3300037418 | Bacteria | 863 |
| 828 | Ga0395900_0995191 | 3300037418 | Bacteria | 759 |
| 829 | Ga0395898_0003455 | 3300037466 | Bacteria | 17662 |
| 830 | Ga0395898_0130476 | 3300037466 | Bacteria | 2408 |
| 831 | Ga0395898_0420296 | 3300037466 | Bacteria | 1274 |
| 832 | Ga0395898_0571917 | 3300037466 | Bacteria | 1072 |
| 833 | Ga0395898_0888329 | 3300037466 | Bacteria | 830 |
| 834 | Ga0395898_0897418 | 3300037466 | Bacteria | 825 |
| 835 | Ga0395898_0972358 | 3300037466 | Bacteria | 785 |
| 836 | Ga0395898_1544064 | 3300037466 | Bacteria | 589 |
| 837 | Ga0395898_1586621 | 3300037466 | Bacteria | 579 |
| 838 | Ga0395898_1798357 | 3300037466 | Bacteria | 534 |
| 839 | Ga0395898_1968613 | 3300037466 | Bacteria | 504 |
| 840 | Ga0395905_0314109 | 3300037471 | Bacteria | 1456 |
| 841 | Ga0395905_0460828 | 3300037471 | Bacteria | 1170 |
| 842 | Ga0395905_0879063 | 3300037471 | Bacteria | 799 |
| 843 | Ga0395905_0925181 | 3300037471 | Bacteria | 775 |
| 844 | Ga0436364_0492106 | 3300037853 | Bacteria | 4108 |
| 845 | Ga0395901_0096968 | 3300038443 | Bacteria | 3090 |
| 846 | Ga0395901_0125141 | 3300038443 | Bacteria | 2701 |
| 847 | Ga0395901_0168269 | 3300038443 | Bacteria | 2300 |
| 848 | Ga0395901_0190142 | 3300038443 | Bacteria | 2153 |
| 849 | Ga0395901_0279730 | 3300038443 | Bacteria | 1734 |
| 850 | Ga0395901_0304328 | 3300038443 | Bacteria | 1652 |
| 851 | Ga0395901_0325464 | 3300038443 | Bacteria | 1590 |
| 852 | Ga0395901_0434794 | 3300038443 | Bacteria | 1344 |
| 853 | Ga0395901_0838426 | 3300038443 | Bacteria | 906 |
| 854 | Ga0395901_1136479 | 3300038443 | Bacteria | 750 |
| 855 | Ga0395901_1202536 | 3300038443 | Bacteria | 724 |
| 856 | Ga0395901_1577955 | 3300038443 | Bacteria | 610 |
| 857 | Ga0395901_1585847 | 3300038443 | Bacteria | 608 |
| 858 | Ga0395901_1906462 | 3300038443 | Bacteria | 542 |
| 859 | Ga0395901_2053120 | 3300038443 | Bacteria | 517 |
| 860 | Ga0436365_0324463 | 3300039437 | Bacteria | 1181 |
| 861 | Ga0436365_1262671 | 3300039437 | Bacteria | 1463 |
| 862 | Ga0436363_0601680 | 3300039450 | Bacteria | 617 |
| 863 | Ga0436363_0690390 | 3300039450 | Bacteria | 720 |
| 864 | Ga0436363_0720174 | 3300039450 | Bacteria | 557 |
| 865 | Ga0436363_1384139 | 3300039450 | Bacteria | 654 |
| 866 | Ga0436363_1485415 | 3300039450 | Bacteria | 1261 |
| 867 | Ga0436362_0305135 | 3300039453 | Bacteria | 2751 |
| 868 | Ga0436362_0876822 | 3300039453 | Bacteria | 893 |
| 869 | Ga0436362_1000293 | 3300039453 | Bacteria | 1219 |
| 870 | Ga0451789_1118632 | 3300041443 | Bacteria | 777 |
| 871 | Ga0451791_0994167 | 3300041451 | Bacteria | 541 |
| 872 | Ga0451791_1854511 | 3300041451 | Bacteria | 524 |
| 873 | Ga0451793_0642526 | 3300041452 | Bacteria | 518 |
| 874 | Ga0451793_0828338 | 3300041452 | Bacteria | 640 |
| 875 | Ga0451798_0631904 | 3300041458 | Bacteria | 833 |
| 876 | Ga0451800_0269238 | 3300041459 | Bacteria | 544 |
| 877 | Ga0451800_1497219 | 3300041459 | Bacteria | 515 |
| 878 | Ga0451802_0055694 | 3300041460 | Bacteria | 542 |
| 879 | Ga0451802_0447237 | 3300041460 | Bacteria | 955 |
| 880 | Ga0451802_0448510 | 3300041460 | Bacteria | 547 |
| 881 | Ga0451806_392145 | 3300041462 | Bacteria | 589 |
| 882 | Ga0451807_0204767 | 3300041486 | Bacteria | 581 |
| 883 | Ga0451833_1316929 | 3300041491 | Bacteria | 634 |
| 884 | Ga0451835_0776220 | 3300041492 | Bacteria | 507 |
| 885 | Ga0451839_1022939 | 3300041496 | Bacteria | 1391 |
| 886 | Ga0451847_0685356 | 3300041503 | Bacteria | 595 |
| 887 | Ga0451849_1428499 | 3300041505 | Bacteria | 894 |
| 888 | Ga0451843_0472792 | 3300041509 | Bacteria | 565 |
| 889 | Ga0451855_1721508 | 3300041511 | Bacteria | 577 |
| 890 | Ga0451853_0911932 | 3300041512 | Bacteria | 1695 |
| 891 | Ga0451853_1719005 | 3300041512 | Bacteria | 501 |
| 892 | Ga0451853_2061650 | 3300041512 | Bacteria | 739 |
| 893 | Ga0451853_2898718 | 3300041512 | Bacteria | 869 |
| 894 | Ga0439449_0201463 | 3300042007 | Bacteria | 745 |
| 895 | Ga0450923_151310 | 3300042125 | Bacteria | 562 |
| 896 | Ga0466969_0018129 | 3300044656 | Bacteria | 3672 |
| 897 | Ga0466969_0168174 | 3300044656 | Bacteria | 1006 |
| 898 | Ga0466969_0501311 | 3300044656 | Bacteria | 554 |
| 899 | Ga0466972_0311825 | 3300044658 | Bacteria | 735 |
| 900 | Ga0466972_0533583 | 3300044658 | Bacteria | 553 |
| 901 | Ga0466965_0027818 | 3300044683 | Bacteria | 2745 |
| 902 | Ga0466965_0087737 | 3300044683 | Bacteria | 1579 |
| 903 | Ga0466965_0195581 | 3300044683 | Bacteria | 1071 |
| 904 | Ga0466965_0735972 | 3300044683 | Bacteria | 568 |
| 905 | Ga0466966_0021885 | 3300044684 | Bacteria | 4198 |
| 906 | Ga0466966_0044953 | 3300044684 | Bacteria | 2825 |
| 907 | Ga0466966_0329879 | 3300044684 | Bacteria | 917 |
| 908 | Ga0466966_0460977 | 3300044684 | Bacteria | 764 |
| 909 | Ga0466966_0560295 | 3300044684 | Bacteria | 688 |
| 910 | Ga0466966_0713487 | 3300044684 | Bacteria | 604 |
| 911 | Ga0466966_0862510 | 3300044684 | Bacteria | 546 |
| 912 | Ga0466961_0694240 | 3300044693 | Bacteria | 610 |
| 913 | Ga0466963_0000040 | 3300044694 | Bacteria | 41869 |
| 914 | Ga0466963_0046201 | 3300044694 | Bacteria | 2870 |
| 915 | Ga0466963_0113040 | 3300044694 | Bacteria | 1865 |
| 916 | Ga0466963_0266194 | 3300044694 | Bacteria | 1204 |
| 917 | Ga0466963_0378430 | 3300044694 | Bacteria | 998 |
| 918 | Ga0466971_0078400 | 3300044719 | Bacteria | 1505 |
| 919 | Ga0466971_0126173 | 3300044719 | Bacteria | 1186 |
| 920 | Ga0466971_0319474 | 3300044719 | Bacteria | 748 |
| 921 | Ga0466971_0382055 | 3300044719 | Bacteria | 685 |
| 922 | Ga0466968_0059944 | 3300044735 | Bacteria | 1640 |
| 923 | Ga0466970_0087629 | 3300044765 | Bacteria | 1688 |
| 924 | Ga0466970_0132396 | 3300044765 | Bacteria | 1370 |
| 925 | Ga0466970_0176473 | 3300044765 | Bacteria | 1185 |
| 926 | Ga0466957_0088292 | 3300044842 | Bacteria | 1940 |
| 927 | Ga0466957_0403919 | 3300044842 | Bacteria | 935 |
| 928 | Ga0466957_0614258 | 3300044842 | Bacteria | 762 |
| 929 | Ga0466960_0001240 | 3300044901 | Bacteria | 9232 |
| 930 | Ga0466960_0015315 | 3300044901 | Bacteria | 3303 |
| 931 | Ga0466960_0057380 | 3300044901 | Bacteria | 1898 |
| 932 | Ga0466960_0119744 | 3300044901 | Bacteria | 1377 |
| 933 | Ga0466960_0134530 | 3300044901 | Bacteria | 1308 |
| 934 | Ga0466960_0236451 | 3300044901 | Bacteria | 1010 |
| 935 | Ga0466960_0245699 | 3300044901 | Bacteria | 992 |
| 936 | Ga0466960_0277231 | 3300044901 | Bacteria | 939 |
| 937 | Ga0466960_0347226 | 3300044901 | Bacteria | 845 |
| 938 | Ga0466960_0381436 | 3300044901 | Bacteria | 809 |
| 939 | Ga0466960_0832664 | 3300044901 | Bacteria | 560 |
| 940 | Ga0466960_0998253 | 3300044901 | Bacteria | 514 |
| 941 | Ga0466959_0003771 | 3300045049 | Bacteria | 10040 |
| 942 | Ga0466959_0166075 | 3300045049 | Bacteria | 1550 |
| 943 | Ga0466959_0171772 | 3300045049 | Bacteria | 1520 |
| 944 | Ga0466959_0775371 | 3300045049 | Bacteria | 641 |
| 945 | Ga0466959_0853995 | 3300045049 | Bacteria | 608 |
| 946 | Ga0466958_0009064 | 3300045836 | Bacteria | 5528 |
| 947 | Ga0466958_0077972 | 3300045836 | Bacteria | 2036 |
| 948 | Ga0466958_0119972 | 3300045836 | Bacteria | 1646 |
| 949 | Ga0466958_0146593 | 3300045836 | Bacteria | 1488 |
| 950 | Ga0466958_1042692 | 3300045836 | Bacteria | 534 |
| 951 | Ga0466967_0042556 | 3300045976 | Bacteria | 3926 |
| 952 | Ga0466967_0054520 | 3300045976 | Bacteria | 3519 |
| 953 | Ga0466967_0060669 | 3300045976 | Bacteria | 3353 |
| 954 | Ga0466967_0123666 | 3300045976 | Bacteria | 2394 |
| 955 | Ga0466967_0202982 | 3300045976 | Bacteria | 1878 |
| 956 | Ga0466967_0230463 | 3300045976 | Bacteria | 1763 |
| 957 | Ga0466967_0415403 | 3300045976 | Bacteria | 1311 |
| 958 | Ga0466967_0488031 | 3300045976 | Bacteria | 1208 |
| 959 | Ga0466967_0783430 | 3300045976 | Bacteria | 946 |
| 960 | Ga0466967_0821778 | 3300045976 | Bacteria | 923 |
| 961 | Ga0466967_1234872 | 3300045976 | Bacteria | 744 |
| 962 | Ga0466967_1784871 | 3300045976 | Bacteria | 612 |
| 963 | Ga0466967_2233101 | 3300045976 | Bacteria | 543 |
| 964 | Ga0466967_2405617 | 3300045976 | Bacteria | 522 |
| 965 | Ga0466967_2461590 | 3300045976 | Bacteria | 516 |
| 966 | Ga0495592_0000458 | 3300046454 | Bacteria | 30514 |
| 967 | Ga0495603_0000167 | 3300046455 | Bacteria | 33276 |
| 968 | Ga0495603_0019700 | 3300046455 | Bacteria | 4085 |
| 969 | Ga0495603_0041481 | 3300046455 | Bacteria | 2752 |
| 970 | Ga0495629_0004505 | 3300046459 | Bacteria | 10424 |
| 971 | Ga0495629_0068363 | 3300046459 | Bacteria | 2479 |
| 972 | Ga0495629_0358391 | 3300046459 | Bacteria | 994 |
| 973 | Ga0495638_0013582 | 3300046460 | Bacteria | 5536 |
| 974 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 975 | Ga0495641_0011795 | 3300046461 | Bacteria | 4942 |
| 976 | Ga0495641_0031621 | 3300046461 | Bacteria | 2527 |
| 977 | Ga0495641_0089714 | 3300046461 | Bacteria | 1374 |
| 978 | Ga0495641_0540800 | 3300046461 | Bacteria | 532 |
| 979 | Ga0495651_0325049 | 3300046462 | Bacteria | 1024 |
| 980 | Ga0495653_0021778 | 3300046463 | Bacteria | 5189 |
| 981 | Ga0495653_0123846 | 3300046463 | Bacteria | 1838 |
| 982 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 983 | Ga0495582_0000007 | 3300046473 | Bacteria | 139882 |
| 984 | Ga0495582_0014705 | 3300046473 | Bacteria | 4301 |
| 985 | Ga0495605_0489191 | 3300046474 | Bacteria | 504 |
| 986 | Ga0495662_0000073 | 3300046476 | Bacteria | 35403 |
| 987 | Ga0495662_0116324 | 3300046476 | Bacteria | 1311 |
| 988 | Ga0495662_0626268 | 3300046476 | Bacteria | 526 |
| 989 | Ga0495584_0049432 | 3300046491 | Bacteria | 2119 |
| 990 | Ga0495584_0213521 | 3300046491 | Bacteria | 981 |
| 991 | Ga0495585_0532711 | 3300046492 | Bacteria | 556 |
| 992 | Ga0495606_0000131 | 3300046507 | Bacteria | 127298 |
| 993 | Ga0495608_0032931 | 3300046511 | Bacteria | 3504 |
| 994 | Ga0495618_0000241 | 3300046514 | Bacteria | 39957 |
| 995 | Ga0495620_0001188 | 3300046515 | Bacteria | 15939 |
| 996 | Ga0495628_0070210 | 3300046516 | Bacteria | 2731 |
| 997 | Ga0495628_0561789 | 3300046516 | Bacteria | 818 |
| 998 | Ga0495628_0996976 | 3300046516 | Bacteria | 576 |
| 999 | Ga0495630_0000053 | 3300046517 | Bacteria | 93065 |
| 1000 | Ga0495630_0003260 | 3300046517 | Bacteria | 11314 |
| 1001 | Ga0495630_0042175 | 3300046517 | Bacteria | 3408 |
| 1002 | Ga0495630_0290535 | 3300046517 | Bacteria | 1249 |
| 1003 | Ga0495630_0673579 | 3300046517 | Bacteria | 792 |
| 1004 | Ga0495630_0721913 | 3300046517 | Bacteria | 762 |
| 1005 | Ga0495631_0420203 | 3300046518 | Bacteria | 569 |
| 1006 | Ga0495637_0177175 | 3300046520 | Bacteria | 792 |
| 1007 | Ga0495644_0001319 | 3300046523 | Bacteria | 10171 |
| 1008 | Ga0495663_0242019 | 3300046525 | Bacteria | 639 |
| 1009 | Ga0495652_0160035 | 3300046529 | Bacteria | 1749 |
| 1010 | Ga0495665_0071796 | 3300046531 | Bacteria | 1823 |
| 1011 | Ga0495640_0333074 | 3300046533 | Bacteria | 939 |
| 1012 | Ga0495586_0002162 | 3300046535 | Bacteria | 10685 |
| 1013 | Ga0495586_0182007 | 3300046535 | Bacteria | 1189 |
| 1014 | Ga0495586_0530439 | 3300046535 | Bacteria | 679 |
| 1015 | Ga0495598_0264061 | 3300046537 | Bacteria | 641 |
| 1016 | Ga0495621_0010439 | 3300046539 | Bacteria | 2841 |
| 1017 | Ga0495645_0000119 | 3300046543 | Bacteria | 53463 |
| 1018 | Ga0495645_0057761 | 3300046543 | Bacteria | 2815 |
| 1019 | Ga0495645_0152575 | 3300046543 | Bacteria | 1603 |
| 1020 | Ga0495645_0238528 | 3300046543 | Bacteria | 1214 |
| 1021 | Ga0495656_0064162 | 3300046615 | Bacteria | 1612 |
| 1022 | Ga0495634_0000013 | 3300046642 | Bacteria | 130546 |
| 1023 | Ga0495634_0000840 | 3300046642 | Bacteria | 29619 |
| 1024 | Ga0495634_0002095 | 3300046642 | Bacteria | 16860 |
| 1025 | Ga0495634_0017346 | 3300046642 | Bacteria | 5140 |
| 1026 | Ga0495634_0112095 | 3300046642 | Bacteria | 1753 |
| 1027 | Ga0495634_0331758 | 3300046642 | Bacteria | 914 |
| 1028 | Ga0495625_0000117 | 3300046660 | Bacteria | 121901 |
| 1029 | Ga0495635_0345861 | 3300046663 | Bacteria | 992 |
| 1030 | Ga0495588_0000202 | 3300046674 | Bacteria | 59591 |
| 1031 | Ga0495588_0402162 | 3300046674 | Bacteria | 719 |
| 1032 | Ga0495588_0510877 | 3300046674 | Bacteria | 630 |
| 1033 | Ga0495657_0012257 | 3300046675 | Bacteria | 6371 |
| 1034 | Ga0495599_0025346 | 3300046678 | Bacteria | 3711 |
| 1035 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 1036 | Ga0495647_0007404 | 3300046681 | Bacteria | 3675 |
| 1037 | Ga0495647_0169079 | 3300046681 | Bacteria | 946 |
| 1038 | Ga0495647_0246204 | 3300046681 | Bacteria | 795 |
| 1039 | Ga0495658_0000007 | 3300046683 | Bacteria | 139822 |
| 1040 | Ga0495658_0362725 | 3300046683 | Bacteria | 921 |
| 1041 | Ga0495658_0488446 | 3300046683 | Bacteria | 787 |
| 1042 | Ga0495669_0000065 | 3300046684 | Bacteria | 69983 |
| 1043 | Ga0495613_0000066 | 3300046689 | Bacteria | 102122 |
| 1044 | Ga0495613_0184793 | 3300046689 | Bacteria | 1475 |
| 1045 | Ga0495624_0003688 | 3300046690 | Bacteria | 11320 |
| 1046 | Ga0495624_0006180 | 3300046690 | Bacteria | 8515 |
| 1047 | Ga0495624_0200348 | 3300046690 | Bacteria | 1213 |
| 1048 | Ga0495670_0115716 | 3300046691 | Bacteria | 1390 |
| 1049 | Ga0495670_0675684 | 3300046691 | Bacteria | 563 |
| 1050 | Ga0495670_0773092 | 3300046691 | Bacteria | 524 |
| 1051 | Ga0495671_0497210 | 3300046692 | Bacteria | 582 |
| 1052 | Ga0495649_0001991 | 3300046694 | Bacteria | 14824 |
| 1053 | Ga0495649_0682866 | 3300046694 | Bacteria | 504 |
| 1054 | Ga0495600_0003325 | 3300046809 | Bacteria | 9444 |
| 1055 | Ga0495600_0098027 | 3300046809 | Bacteria | 1911 |
| 1056 | Ga0495600_0275662 | 3300046809 | Bacteria | 1066 |
| 1057 | Ga0495604_0000081 | 3300047317 | Bacteria | 82621 |
| 1058 | Ga0495604_0180505 | 3300047317 | Bacteria | 1477 |
| 1059 | Ga0495604_0209849 | 3300047317 | Bacteria | 1346 |
| 1060 | Ga0495674_1152207 | 3300047319 | Bacteria | 588 |
| 1061 | Ga0495672_0004900 | 3300047320 | Bacteria | 10751 |
| 1062 | Ga0495672_0007339 | 3300047320 | Bacteria | 8312 |
| 1063 | Ga0495672_0262907 | 3300047320 | Bacteria | 832 |
| 1064 | Ga0495676_0004842 | 3300047321 | Bacteria | 12349 |
| 1065 | Ga0495676_0102422 | 3300047321 | Bacteria | 2115 |
| 1066 | Ga0495676_0191191 | 3300047321 | Bacteria | 1428 |
| 1067 | Ga0495676_0570314 | 3300047321 | Bacteria | 739 |
| 1068 | Ga0495676_0883386 | 3300047321 | Bacteria | 573 |
| 1069 | Ga0495680_0000629 | 3300047322 | Bacteria | 39576 |
| 1070 | Ga0495680_0001777 | 3300047322 | Bacteria | 22849 |
| 1071 | Ga0495675_0436657 | 3300047444 | Bacteria | 759 |
| 1072 | Ga0495679_021080 | 3300047446 | Bacteria | 2257 |
| 1073 | Ga0495679_044695 | 3300047446 | Bacteria | 1356 |
| 1074 | Ga0495673_0024900 | 3300047469 | Bacteria | 2882 |
| 1075 | Ga0495684_0125228 | 3300047471 | Bacteria | 1934 |
| 1076 | Ga0495686_0039936 | 3300047472 | Bacteria | 2995 |
| 1077 | Ga0495686_0397735 | 3300047472 | Bacteria | 740 |
| 1078 | Ga0495593_0177251 | 3300047673 | Bacteria | 1074 |
| 1079 | Ga0495602_0086632 | 3300048088 | Bacteria | 2614 |
| 1080 | Ga0495614_0433220 | 3300048089 | Bacteria | 621 |
| 1081 | Ga0495614_0614142 | 3300048089 | Bacteria | 523 |
| 1082 | Ga0496100_0000450 | 3300048903 | Bacteria | 19877 |
| 1083 | Ga0496100_0047684 | 3300048903 | Bacteria | 2762 |
| 1084 | Ga0496100_0074112 | 3300048903 | Bacteria | 2280 |
| 1085 | Ga0496100_0082586 | 3300048903 | Bacteria | 2173 |
| 1086 | Ga0496100_0135818 | 3300048903 | Bacteria | 1737 |
| 1087 | Ga0496100_0367493 | 3300048903 | Bacteria | 1090 |
| 1088 | Ga0496100_0789747 | 3300048903 | Bacteria | 744 |
| 1089 | Ga0496100_1350765 | 3300048903 | Bacteria | 562 |
| 1090 | Ga0496101_0001032 | 3300048904 | Bacteria | 16420 |
| 1091 | Ga0496101_0029096 | 3300048904 | Bacteria | 3863 |
| 1092 | Ga0496101_0034118 | 3300048904 | Bacteria | 3593 |
| 1093 | Ga0496101_0053422 | 3300048904 | Bacteria | 2915 |
| 1094 | Ga0496101_0061697 | 3300048904 | Bacteria | 2723 |
| 1095 | Ga0496101_0117980 | 3300048904 | Bacteria | 2004 |
| 1096 | Ga0496101_0142889 | 3300048904 | Bacteria | 1825 |
| 1097 | Ga0496101_0482658 | 3300048904 | Bacteria | 979 |
| 1098 | Ga0496101_0764986 | 3300048904 | Bacteria | 762 |
| 1099 | Ga0496102_0000061 | 3300048905 | Bacteria | 167066 |
| 1100 | Ga0496102_0038908 | 3300048905 | Bacteria | 4295 |
| 1101 | Ga0496102_0127354 | 3300048905 | Bacteria | 2381 |
| 1102 | Ga0496102_0170340 | 3300048905 | Bacteria | 2050 |
| 1103 | Ga0496102_0244991 | 3300048905 | Bacteria | 1690 |
| 1104 | Ga0496102_1076791 | 3300048905 | Bacteria | 724 |
| 1105 | Ga0496102_1361787 | 3300048905 | Bacteria | 629 |
| 1106 | Ga0496102_1460653 | 3300048905 | Bacteria | 602 |
| 1107 | Ga0496103_0000044 | 3300048906 | Bacteria | 167066 |
| 1108 | Ga0496103_0114540 | 3300048906 | Bacteria | 1714 |
| 1109 | Ga0496103_0136659 | 3300048906 | Bacteria | 1566 |
| 1110 | Ga0496104_0000120 | 3300048907 | Bacteria | 72797 |
| 1111 | Ga0496104_0000491 | 3300048907 | Bacteria | 34073 |
| 1112 | Ga0496104_0003288 | 3300048907 | Bacteria | 13948 |
| 1113 | Ga0496104_0046280 | 3300048907 | Bacteria | 4096 |
| 1114 | Ga0496104_0234435 | 3300048907 | Bacteria | 1747 |
| 1115 | Ga0496104_0247550 | 3300048907 | Bacteria | 1695 |
| 1116 | Ga0496104_0412589 | 3300048907 | Bacteria | 1263 |
| 1117 | Ga0496104_0463361 | 3300048907 | Bacteria | 1179 |
| 1118 | Ga0496104_0584198 | 3300048907 | Bacteria | 1027 |
| 1119 | Ga0496104_0740285 | 3300048907 | Bacteria | 890 |
| 1120 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 1121 | Ga0496105_0002659 | 3300048908 | Bacteria | 13013 |
| 1122 | Ga0496105_0003897 | 3300048908 | Bacteria | 11154 |
| 1123 | Ga0496105_0020754 | 3300048908 | Bacteria | 5310 |
| 1124 | Ga0496105_0166499 | 3300048908 | Bacteria | 1808 |
| 1125 | Ga0496105_0357502 | 3300048908 | Bacteria | 1165 |
| 1126 | Ga0496105_0974774 | 3300048908 | Bacteria | 635 |
| 1127 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 1128 | Ga0496106_0015185 | 3300048909 | Bacteria | 5700 |
| 1129 | Ga0496106_0043221 | 3300048909 | Bacteria | 3381 |
| 1130 | Ga0496106_0084492 | 3300048909 | Bacteria | 2442 |
| 1131 | Ga0496106_0150881 | 3300048909 | Bacteria | 1833 |
| 1132 | Ga0496106_0367544 | 3300048909 | Bacteria | 1156 |
| 1133 | Ga0496106_0430469 | 3300048909 | Bacteria | 1060 |
| 1134 | Ga0496106_0776867 | 3300048909 | Bacteria | 760 |
| 1135 | Ga0496106_1008441 | 3300048909 | Bacteria | 654 |
| 1136 | Ga0496107_0014349 | 3300048910 | Bacteria | 5547 |
| 1137 | Ga0496107_0087516 | 3300048910 | Bacteria | 2274 |
| 1138 | Ga0496107_0144142 | 3300048910 | Bacteria | 1761 |
| 1139 | Ga0496107_0364536 | 3300048910 | Bacteria | 1075 |
| 1140 | Ga0496107_0424583 | 3300048910 | Bacteria | 988 |
| 1141 | Ga0496107_0563255 | 3300048910 | Bacteria | 843 |
| 1142 | Ga0496108_0000032 | 3300048911 | Bacteria | 158930 |
| 1143 | Ga0496108_0000163 | 3300048911 | Bacteria | 62902 |
| 1144 | Ga0496108_0002529 | 3300048911 | Bacteria | 14633 |
| 1145 | Ga0496108_0014954 | 3300048911 | Bacteria | 6334 |
| 1146 | Ga0496108_0070149 | 3300048911 | Bacteria | 2957 |
| 1147 | Ga0496108_0101793 | 3300048911 | Bacteria | 2451 |
| 1148 | Ga0496108_0125256 | 3300048911 | Bacteria | 2205 |
| 1149 | Ga0496108_0143340 | 3300048911 | Bacteria | 2059 |
| 1150 | Ga0496108_0178988 | 3300048911 | Bacteria | 1836 |
| 1151 | Ga0496108_0293128 | 3300048911 | Bacteria | 1416 |
| 1152 | Ga0496108_0378806 | 3300048911 | Bacteria | 1235 |
| 1153 | Ga0496108_1145395 | 3300048911 | Bacteria | 659 |
| 1154 | Ga0496108_1400878 | 3300048911 | Bacteria | 585 |
| 1155 | Ga0496109_0000070 | 3300048912 | Bacteria | 108889 |
| 1156 | Ga0496109_0000103 | 3300048912 | Bacteria | 88192 |
| 1157 | Ga0496109_0002349 | 3300048912 | Bacteria | 15782 |
| 1158 | Ga0496109_0002676 | 3300048912 | Bacteria | 14960 |
| 1159 | Ga0496109_0024049 | 3300048912 | Bacteria | 5412 |
| 1160 | Ga0496109_0102683 | 3300048912 | Bacteria | 2653 |
| 1161 | Ga0496109_0151626 | 3300048912 | Bacteria | 2170 |
| 1162 | Ga0496109_0385333 | 3300048912 | Bacteria | 1324 |
| 1163 | Ga0496109_0511542 | 3300048912 | Bacteria | 1133 |
| 1164 | Ga0496109_0577560 | 3300048912 | Bacteria | 1059 |
| 1165 | Ga0496109_0945868 | 3300048912 | Bacteria | 799 |
| 1166 | Ga0496110_0001092 | 3300048913 | Bacteria | 19117 |
| 1167 | Ga0496110_0007172 | 3300048913 | Bacteria | 8875 |
| 1168 | Ga0496110_0009962 | 3300048913 | Bacteria | 7709 |
| 1169 | Ga0496110_0024180 | 3300048913 | Bacteria | 5174 |
| 1170 | Ga0496110_0034541 | 3300048913 | Bacteria | 4380 |
| 1171 | Ga0496110_0040324 | 3300048913 | Bacteria | 4069 |
| 1172 | Ga0496110_0517512 | 3300048913 | Bacteria | 1086 |
| 1173 | Ga0496110_0834613 | 3300048913 | Bacteria | 827 |
| 1174 | Ga0496110_1489469 | 3300048913 | Bacteria | 586 |
| 1175 | Ga0496110_1652290 | 3300048913 | Bacteria | 551 |
| 1176 | Ga0496111_0003080 | 3300048914 | Bacteria | 10242 |
| 1177 | Ga0496111_0005147 | 3300048914 | Bacteria | 8338 |
| 1178 | Ga0496111_0023858 | 3300048914 | Bacteria | 4298 |
| 1179 | Ga0496111_0031475 | 3300048914 | Bacteria | 3779 |
| 1180 | Ga0496111_0107662 | 3300048914 | Bacteria | 2052 |
| 1181 | Ga0496111_0132587 | 3300048914 | Bacteria | 1844 |
| 1182 | Ga0496111_0224202 | 3300048914 | Bacteria | 1396 |
| 1183 | Ga0496111_0448869 | 3300048914 | Bacteria | 951 |
| 1184 | Ga0496111_0635762 | 3300048914 | Bacteria | 779 |
| 1185 | Ga0496111_0798772 | 3300048914 | Bacteria | 683 |
| 1186 | Ga0496111_1085098 | 3300048914 | Bacteria | 571 |
| 1187 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 1188 | Ga0496112_0003041 | 3300048915 | Bacteria | 13723 |
| 1189 | Ga0496112_0027770 | 3300048915 | Bacteria | 5458 |
| 1190 | Ga0496112_0068959 | 3300048915 | Bacteria | 3493 |
| 1191 | Ga0496112_0121010 | 3300048915 | Bacteria | 2587 |
| 1192 | Ga0496112_0134840 | 3300048915 | Bacteria | 2439 |
| 1193 | Ga0496112_0187828 | 3300048915 | Bacteria | 2029 |
| 1194 | Ga0496112_0243063 | 3300048915 | Bacteria | 1752 |
| 1195 | Ga0496112_0378249 | 3300048915 | Bacteria | 1357 |
| 1196 | Ga0496112_0508388 | 3300048915 | Bacteria | 1140 |
| 1197 | Ga0496112_0573377 | 3300048915 | Bacteria | 1061 |
| 1198 | Ga0496112_0717903 | 3300048915 | Bacteria | 927 |
| 1199 | Ga0496112_1069460 | 3300048915 | Bacteria | 725 |
| 1200 | Ga0496113_0020338 | 3300048916 | Bacteria | 4665 |
| 1201 | Ga0496113_0032580 | 3300048916 | Bacteria | 3787 |
| 1202 | Ga0496113_0166476 | 3300048916 | Bacteria | 1744 |
| 1203 | Ga0496113_0186950 | 3300048916 | Bacteria | 1643 |
| 1204 | Ga0496113_0231172 | 3300048916 | Bacteria | 1474 |
| 1205 | Ga0496113_0263845 | 3300048916 | Bacteria | 1376 |
| 1206 | Ga0496113_0359280 | 3300048916 | Bacteria | 1168 |
| 1207 | Ga0496113_0416127 | 3300048916 | Bacteria | 1079 |
| 1208 | Ga0496113_1017395 | 3300048916 | Bacteria | 652 |
| 1209 | Ga0496114_0000042 | 3300048917 | Bacteria | 133043 |
| 1210 | Ga0496114_0064533 | 3300048917 | Bacteria | 3067 |
| 1211 | Ga0496114_0527235 | 3300048917 | Bacteria | 1044 |
| 1212 | Ga0496115_0003718 | 3300048918 | Bacteria | 10971 |
| 1213 | Ga0496115_0013924 | 3300048918 | Bacteria | 6085 |
| 1214 | Ga0496115_0015952 | 3300048918 | Bacteria | 5710 |
| 1215 | Ga0496115_0236215 | 3300048918 | Bacteria | 1507 |
| 1216 | Ga0496115_0322849 | 3300048918 | Bacteria | 1262 |
| 1217 | Ga0496115_0797543 | 3300048918 | Bacteria | 735 |
| 1218 | Ga0496117_0505509 | 3300048920 | Bacteria | 585 |
| 1219 | Ga0496118_0130124 | 3300048921 | Bacteria | 1618 |
| 1220 | Ga0496121_0001938 | 3300048924 | Bacteria | 33016 |
| 1221 | Ga0496121_0008540 | 3300048924 | Bacteria | 12016 |
| 1222 | Ga0496122_0001068 | 3300048925 | Bacteria | 47630 |
| 1223 | Ga0496122_0290199 | 3300048925 | Bacteria | 889 |
| 1224 | Ga0496123_0000612 | 3300048926 | Bacteria | 60039 |
| 1225 | Ga0496124_0008131 | 3300048927 | Bacteria | 11014 |
| 1226 | Ga0496124_0055890 | 3300048927 | Bacteria | 3333 |
| 1227 | Ga0496124_0616402 | 3300048927 | Bacteria | 703 |
| 1228 | Ga0496125_0026961 | 3300048928 | Bacteria | 5217 |
| 1229 | Ga0496125_0108206 | 3300048928 | Bacteria | 2023 |
| 1230 | Ga0496126_0497771 | 3300048929 | Bacteria | 974 |
| 1231 | Ga0501031_0014435 | 3300049568 | Bacteria | 5134 |
| 1232 | Ga0501031_0837118 | 3300049568 | Bacteria | 590 |
| 1233 | Ga0501032_0001522 | 3300049569 | Bacteria | 18477 |
| 1234 | Ga0501032_0004746 | 3300049569 | Bacteria | 10198 |
| 1235 | Ga0501032_0192389 | 3300049569 | Bacteria | 1333 |
| 1236 | Ga0501033_0078143 | 3300049570 | Bacteria | 2428 |
| 1237 | Ga0501033_0575292 | 3300049570 | Bacteria | 774 |
| 1238 | Ga0501033_0911689 | 3300049570 | Bacteria | 590 |
| 1239 | Ga0501034_0019380 | 3300049571 | Bacteria | 6958 |
| 1240 | Ga0501034_0103350 | 3300049571 | Bacteria | 2842 |
| 1241 | Ga0501034_0263058 | 3300049571 | Bacteria | 1667 |
| 1242 | Ga0501036_0007434 | 3300049572 | Bacteria | 8923 |
| 1243 | Ga0501036_0037378 | 3300049572 | Bacteria | 4108 |
| 1244 | Ga0501036_0510427 | 3300049572 | Bacteria | 1000 |
| 1245 | Ga0501036_0658725 | 3300049572 | Bacteria | 866 |
| 1246 | Ga0501036_0673316 | 3300049572 | Bacteria | 856 |
| 1247 | Ga0501037_0127650 | 3300049573 | Bacteria | 1825 |
| 1248 | Ga0501037_0235202 | 3300049573 | Bacteria | 1285 |
| 1249 | Ga0501038_0001100 | 3300049574 | Bacteria | 24469 |
| 1250 | Ga0501038_0005589 | 3300049574 | Bacteria | 11667 |
| 1251 | Ga0501038_0050225 | 3300049574 | Bacteria | 3604 |
| 1252 | Ga0501039_0013047 | 3300049575 | Bacteria | 6353 |
| 1253 | Ga0501039_0525473 | 3300049575 | Bacteria | 929 |
| 1254 | Ga0501041_0625903 | 3300049577 | Bacteria | 687 |
| 1255 | Ga0501042_0144336 | 3300049578 | Bacteria | 1716 |
| 1256 | Ga0501042_0194993 | 3300049578 | Bacteria | 1461 |
| 1257 | Ga0501042_0199640 | 3300049578 | Bacteria | 1442 |
| 1258 | Ga0501042_0298678 | 3300049578 | Bacteria | 1163 |
| 1259 | Ga0501042_0401375 | 3300049578 | Bacteria | 993 |
| 1260 | Ga0501043_0005179 | 3300049579 | Bacteria | 10551 |
| 1261 | Ga0501043_0012976 | 3300049579 | Bacteria | 6511 |
| 1262 | Ga0501043_0025123 | 3300049579 | Bacteria | 4674 |
| 1263 | Ga0501046_0002368 | 3300049580 | Bacteria | 17730 |
| 1264 | Ga0501046_0012323 | 3300049580 | Bacteria | 7285 |
| 1265 | Ga0501046_0012522 | 3300049580 | Bacteria | 7217 |
| 1266 | Ga0501046_0298547 | 3300049580 | Bacteria | 1177 |
| 1267 | Ga0501046_0872874 | 3300049580 | Bacteria | 628 |
| 1268 | Ga0501047_0006447 | 3300049581 | Bacteria | 11040 |
| 1269 | Ga0501047_0181264 | 3300049581 | Bacteria | 1972 |
| 1270 | Ga0501048_0005421 | 3300049582 | Bacteria | 9699 |
| 1271 | Ga0501048_0163388 | 3300049582 | Bacteria | 1576 |
| 1272 | Ga0501067_0025255 | 3300049583 | Bacteria | 3293 |
| 1273 | Ga0501067_0078248 | 3300049583 | Bacteria | 1832 |
| 1274 | Ga0501067_0317682 | 3300049583 | Bacteria | 867 |
| 1275 | Ga0501067_0753197 | 3300049583 | Bacteria | 548 |
| 1276 | Ga0501068_0004722 | 3300049584 | Bacteria | 7407 |
| 1277 | Ga0501068_0269569 | 3300049584 | Bacteria | 1087 |
| 1278 | Ga0501068_1180836 | 3300049584 | Bacteria | 507 |
| 1279 | Ga0501069_0440527 | 3300049585 | Bacteria | 774 |
| 1280 | Ga0501070_0011924 | 3300049586 | Bacteria | 7343 |
| 1281 | Ga0501070_0029444 | 3300049586 | Bacteria | 4603 |
| 1282 | Ga0501071_0109894 | 3300049587 | Bacteria | 2037 |
| 1283 | Ga0501071_0578877 | 3300049587 | Bacteria | 863 |
| 1284 | Ga0501071_0704087 | 3300049587 | Bacteria | 778 |
| 1285 | Ga0501072_0071156 | 3300049588 | Bacteria | 2748 |
| 1286 | Ga0501072_0132608 | 3300049588 | Bacteria | 1986 |
| 1287 | Ga0501073_0052911 | 3300049589 | Bacteria | 2842 |
| 1288 | Ga0501074_0040081 | 3300049590 | Bacteria | 3392 |
| 1289 | Ga0501074_0601872 | 3300049590 | Bacteria | 777 |
| 1290 | Ga0501075_0031294 | 3300049591 | Bacteria | 3948 |
| 1291 | Ga0501076_0318513 | 3300049592 | Bacteria | 1276 |
| 1292 | Ga0501076_0872053 | 3300049592 | Bacteria | 742 |
| 1293 | Ga0501077_0563014 | 3300049593 | Bacteria | 732 |
| 1294 | Ga0501079_0254177 | 3300049741 | Bacteria | 1373 |
| 1295 | Ga0501079_0589608 | 3300049741 | Bacteria | 875 |
| 1296 | Ga0501080_0031399 | 3300049742 | Bacteria | 4949 |
| 1297 | Ga0501080_1084344 | 3300049742 | Bacteria | 692 |
| 1298 | Ga0501081_1293466 | 3300049743 | Bacteria | 553 |
| 1299 | Ga0501081_1413857 | 3300049743 | Bacteria | 528 |
| 1300 | Ga0501083_0001813 | 3300049744 | Bacteria | 14632 |
| 1301 | Ga0501083_0006354 | 3300049744 | Bacteria | 8375 |
| 1302 | Ga0501083_0495776 | 3300049744 | Bacteria | 795 |
| 1303 | Ga0501035_0016754 | 3300049822 | Bacteria | 6757 |
| 1304 | Ga0501035_0022707 | 3300049822 | Bacteria | 5763 |
| 1305 | Ga0501035_0221186 | 3300049822 | Bacteria | 1616 |
| 1306 | Ga0501044_0012895 | 3300049823 | Bacteria | 9047 |
| 1307 | Ga0501044_0054417 | 3300049823 | Bacteria | 4113 |
| 1308 | Ga0501044_0104738 | 3300049823 | Bacteria | 2842 |
| 1309 | Ga0501045_0163035 | 3300049824 | Bacteria | 1660 |
| 1310 | Ga0501045_0866427 | 3300049824 | Bacteria | 664 |
| 1311 | Ga0501045_1233153 | 3300049824 | Bacteria | 545 |
| 1312 | nmdc:mga00v17_931005_c1 | 3300050491 | Bacteria | 549 |
| 1313 | nmdc:mga0yw44_1206744_c1 | 3300050492 | Bacteria | 510 |
| 1314 | nmdc:mga05p37_61854_c1 | 3300050507 | Bacteria | 4608 |
| 1315 | nmdc:mga0qj67_310560_c1 | 3300050509 | Bacteria | 1277 |
| 1316 | nmdc:mga0qj67_33320_c1 | 3300050509 | Bacteria | 4019 |
| 1317 | nmdc:mga0qj67_41059_c1 | 3300050509 | Bacteria | 3638 |
| 1318 | nmdc:mga0qj67_579578_c1 | 3300050509 | Bacteria | 898 |
| 1319 | nmdc:mga06r32_1119477_c1 | 3300050510 | Bacteria | 736 |
| 1320 | nmdc:mga06r32_1471980_c1 | 3300050510 | Bacteria | 622 |
| 1321 | nmdc:mga06r32_1584828_c1 | 3300050510 | Bacteria | 594 |
| 1322 | nmdc:mga08y16_2130592_c1 | 3300050511 | Bacteria | 508 |
| 1323 | nmdc:mga08y16_351211_c1 | 3300050511 | Bacteria | 1515 |
| 1324 | nmdc:mga08y16_434368_c1 | 3300050511 | Bacteria | 1341 |
| 1325 | nmdc:mga08y16_69971_c1 | 3300050511 | Bacteria | 3658 |
| 1326 | nmdc:mga0n895_35025_c1 | 3300050512 | Bacteria | 4837 |
| 1327 | nmdc:mga0n895_413623_c1 | 3300050512 | Bacteria | 1363 |
| 1328 | nmdc:mga0n895_468742_c1 | 3300050512 | Bacteria | 1270 |
| 1329 | nmdc:mga0n895_731064_c1 | 3300050512 | Bacteria | 984 |
| 1330 | nmdc:mga0rr50_862371_c1 | 3300050513 | Bacteria | 772 |
| 1331 | nmdc:mga0rr50_918688_c1 | 3300050513 | Bacteria | 746 |
| 1332 | nmdc:mga08x19_492455_c1 | 3300050514 | Bacteria | 865 |
| 1333 | nmdc:mga0a205_245218_c1 | 3300050515 | Bacteria | 1672 |
| 1334 | nmdc:mga0a205_51936_c1 | 3300050515 | Bacteria | 3957 |
| 1335 | nmdc:mga0a205_916745_c1 | 3300050515 | Bacteria | 723 |
| 1336 | Ga0495601_0001916 | 3300053077 | Bacteria | 11637 |
| 1337 | Ga0495601_0016065 | 3300053077 | Bacteria | 4530 |
| 1338 | Ga0495601_0079192 | 3300053077 | Bacteria | 2106 |
| 1339 | Ga0495601_0137704 | 3300053077 | Bacteria | 1592 |
| 1340 | Ga0495601_0206144 | 3300053077 | Bacteria | 1284 |
| 1341 | Ga0495601_0521708 | 3300053077 | Bacteria | 765 |
| 1342 | Ga0495601_0797566 | 3300053077 | Bacteria | 600 |
| 1343 | Ga0495612_0000116 | 3300053078 | Bacteria | 33433 |
| 1344 | Ga0495612_0001792 | 3300053078 | Bacteria | 8800 |
| 1345 | Ga0495612_0022179 | 3300053078 | Bacteria | 2545 |
| 1346 | Ga0495612_0077276 | 3300053078 | Bacteria | 1395 |
| 1347 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 1348 | Ga0495655_0023793 | 3300053083 | Bacteria | 1417 |
| 1349 | Ga0495655_0046624 | 3300053083 | Bacteria | 1131 |
| 1350 | Ga0495655_0169542 | 3300053083 | Bacteria | 698 |
| 1351 | Ga0495655_0267853 | 3300053083 | Bacteria | 579 |
| 1352 | Ga0495595_0299637 | 3300053084 | Bacteria | 809 |
| 1353 | Ga0495595_0387991 | 3300053084 | Bacteria | 707 |
| 1354 | Ga0495619_0000869 | 3300053085 | Bacteria | 19824 |
| 1355 | Ga0495619_0002049 | 3300053085 | Bacteria | 13384 |
| 1356 | Ga0495619_0014777 | 3300053085 | Bacteria | 4932 |
| 1357 | Ga0495619_0020518 | 3300053085 | Bacteria | 4210 |
| 1358 | Ga0500566_0011809 | 3300053094 | Bacteria | 5146 |
| 1359 | Ga0500641_0006228 | 3300053096 | Bacteria | 4234 |
| 1360 | Ga0500556_0000262 | 3300053104 | Bacteria | 41714 |
| 1361 | Ga0500614_001269 | 3300053123 | Bacteria | 6109 |
| 1362 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 1363 | Ga0500559_0524027 | 3300053136 | Bacteria | 543 |
| 1364 | Ga0500616_0003982 | 3300053153 | Bacteria | 10800 |
| 1365 | Ga0500616_0026966 | 3300053153 | Bacteria | 3175 |
| 1366 | Ga0501084_0135836 | 3300054114 | Bacteria | 2070 |
| 1367 | Ga0501084_0215179 | 3300054114 | Bacteria | 1621 |
| 1368 | Ga0501084_0233423 | 3300054114 | Bacteria | 1553 |
| 1369 | Ga0501084_0448362 | 3300054114 | Bacteria | 1091 |
| 1370 | Ga0501082_0007429 | 3300060353 | Bacteria | 9455 |
| 1371 | Ga0501082_0008662 | 3300060353 | Bacteria | 8770 |
| 1372 | Ga0466962_0021427 | 3300061719 | Bacteria | 3103 |
| 1373 | Ga0466962_0204233 | 3300061719 | Bacteria | 966 |
| 1374 | Ga0466962_0634446 | 3300061719 | Bacteria | 546 |
| 1375 | Ga0530510_1096421 | 3300061734 | Bacteria | 610 |
| 1376 | 2774394956 | 2773857762 | Bacteria | 5971770 |
| 1377 | 2804845657 | 2802429296 | Bacteria | 7227771 |
| 1378 | 2809194195 | 2808606439 | Bacteria | 5952208 |
| 1379 | 2812348944 | 2811994878 | Bacteria | 5992952 |
| 1380 | 2867373123 | 2867369537 | Bacteria | 6501581 |
| 1381 | 2891973309 | 2891968417 | Bacteria | 5821697 |
| 1382 | 8025419673 | 8025413630 | Bacteria | 7014048 |
| 1383 | Ga0207657_10451689 | |||
| 1384 | JGI24737J22298_10254867 | |||
| 1385 | JGI24743J22301_10002332 | |||
| 1386 | JGI24743J22301_10121838 | |||
| 1387 | JGI24034J26672_10000088 | |||
| 1388 | JGI24034J26672_10115251 | |||
| 1389 | JGI25406J46586_10114003 | |||
| 1390 | Ga0070658_10033438 | |||
| 1391 | Ga0070658_10297601 | |||
| 1392 | Ga0070658_10552196 | |||
| 1393 | Ga0070658_11230916 | |||
| 1394 | Ga0070676_10236108 | |||
| 1395 | Ga0070676_10335175 | |||
| 1396 | Ga0070676_11211171 | |||
| 1397 | Ga0070683_100003870 | |||
| 1398 | Ga0070683_100041692 | |||
| 1399 | Ga0070683_100044794 | |||
| 1400 | Ga0070683_100044928 | |||
| 1401 | Ga0070683_100095472 | |||
| 1402 | Ga0070683_100112293 | |||
| 1403 | Ga0070683_100288607 | |||
| 1404 | Ga0070683_101276723 | |||
| 1405 | Ga0070683_102237323 | |||
| 1406 | Ga0070690_100341403 | |||
| 1407 | Ga0070670_100654128 | |||
| 1408 | Ga0068869_100065885 | |||
| 1409 | Ga0068869_100501344 | |||
| 1410 | Ga0068869_101525507 | |||
| 1411 | Ga0070666_10002746 | |||
| 1412 | Ga0070680_100809792 | |||
| 1413 | Ga0070680_100937879 | |||
| 1414 | Ga0070680_101705635 | |||
| 1415 | Ga0070682_100009432 | |||
| 1416 | Ga0070682_100064076 | |||
| 1417 | Ga0070682_100539573 | |||
| 1418 | Ga0068868_100000299 | |||
| 1419 | Ga0068868_100007021 | |||
| 1420 | Ga0068868_100040481 | |||
| 1421 | Ga0068868_100117419 | |||
| 1422 | Ga0068868_102410642 | |||
| 1423 | Ga0070660_100036127 | |||
| 1424 | Ga0070660_100186293 | |||
| 1425 | Ga0070660_100272281 | |||
| 1426 | Ga0070660_100325226 | |||
| 1427 | Ga0070660_100585923 | |||
| 1428 | Ga0070689_100230377 | |||
| 1429 | Ga0070689_100511414 | |||
| 1430 | Ga0070691_10000319 | |||
| 1431 | Ga0070691_10000675 | |||
| 1432 | Ga0070691_10013569 | |||
| 1433 | Ga0070691_10409661 | |||
| 1434 | Ga0070687_100677687 | |||
| 1435 | Ga0070687_101044421 | |||
| 1436 | Ga0070661_100000045 | |||
| 1437 | Ga0070661_100163673 | |||
| 1438 | Ga0070661_101288909 | |||
| 1439 | Ga0070661_101521485 | |||
| 1440 | Ga0070692_10002309 | |||
| 1441 | Ga0070692_11139064 | |||
| 1442 | Ga0070668_100142859 | |||
| 1443 | Ga0070668_100179450 | |||
| 1444 | Ga0070668_100392368 | |||
| 1445 | Ga0070668_100545553 | |||
| 1446 | Ga0070668_100844360 | |||
| 1447 | Ga0070669_100748225 | |||
| 1448 | Ga0070675_100000209 | |||
| 1449 | Ga0070675_100036891 | |||
| 1450 | Ga0070675_100840285 | |||
| 1451 | Ga0070675_100985889 | |||
| 1452 | Ga0070671_100222585 | |||
| 1453 | Ga0070671_101091396 | |||
| 1454 | Ga0070674_100000011 | |||
| 1455 | Ga0070674_100253703 | |||
| 1456 | Ga0070674_100348966 | |||
| 1457 | Ga0070674_100472193 | |||
| 1458 | Ga0070674_100512827 | |||
| 1459 | Ga0070674_100519972 | |||
| 1460 | Ga0070674_100915318 | |||
| 1461 | Ga0070674_101316393 | |||
| 1462 | Ga0070674_101669198 | |||
| 1463 | Ga0070674_101998817 | |||
| 1464 | Ga0070673_100002476 | |||
| 1465 | Ga0070673_100161516 | |||
| 1466 | Ga0070673_100274511 | |||
| 1467 | Ga0070688_100000076 | |||
| 1468 | Ga0070688_100086427 | |||
| 1469 | Ga0070688_100095851 | |||
| 1470 | Ga0070688_100887950 | |||
| 1471 | Ga0070659_100000176 | |||
| 1472 | Ga0070659_100093608 | |||
| 1473 | Ga0070659_100172685 | |||
| 1474 | Ga0070659_100735492 | |||
| 1475 | Ga0070659_100987799 | |||
| 1476 | Ga0070659_101134877 | |||
| 1477 | Ga0070667_100054701 | |||
| 1478 | Ga0070667_101242373 | |||
| 1479 | Ga0070667_102016118 | |||
| 1480 | Ga0070714_100024259 | |||
| 1481 | Ga0070714_100107409 | |||
| 1482 | Ga0070714_100339401 | |||
| 1483 | Ga0070714_101869850 | |||
| 1484 | Ga0070713_100000628 | |||
| 1485 | Ga0070710_10000013 | |||
| 1486 | Ga0070710_10090521 | |||
| 1487 | Ga0070710_10111748 | |||
| 1488 | Ga0070710_11167163 | |||
| 1489 | Ga0070701_10131989 | |||
| 1490 | Ga0070701_10217979 | |||
| 1491 | Ga0070701_11125174 | |||
| 1492 | Ga0070711_100008103 | |||
| 1493 | Ga0070711_100134314 | |||
| 1494 | Ga0070711_100197262 | |||
| 1495 | Ga0070711_100745101 | |||
| 1496 | Ga0070711_100756145 | |||
| 1497 | Ga0070705_100002829 | |||
| 1498 | Ga0070705_101498643 | |||
| 1499 | Ga0070700_100000631 | |||
| 1500 | Ga0070700_100054734 | |||
| 1501 | Ga0070700_100076944 | |||
| 1502 | Ga0070700_100105120 | |||
| 1503 | Ga0070700_100123060 | |||
| 1504 | Ga0070700_100132051 | |||
| 1505 | Ga0070700_100890298 | |||
| 1506 | Ga0070700_101052430 | |||
| 1507 | Ga0070700_101261354 | |||
| 1508 | Ga0070694_100243814 | |||
| 1509 | Ga0070663_100066678 | |||
| 1510 | Ga0070663_100174680 | |||
| 1511 | Ga0070663_100198477 | |||
| 1512 | Ga0070663_100363920 | |||
| 1513 | Ga0070663_100668836 | |||
| 1514 | Ga0070663_100829066 | |||
| 1515 | Ga0070663_101635683 | |||
| 1516 | Ga0070663_101878092 | |||
| 1517 | Ga0070663_101952164 | |||
| 1518 | Ga0070678_100051520 | |||
| 1519 | Ga0070678_100385628 | |||
| 1520 | Ga0070678_100796909 | |||
| 1521 | Ga0070662_100000109 | |||
| 1522 | Ga0070662_100120849 | |||
| 1523 | Ga0070662_100259730 | |||
| 1524 | Ga0070662_100432629 | |||
| 1525 | Ga0070681_10073153 | |||
| 1526 | Ga0070681_11146333 | |||
| 1527 | Ga0068867_100004547 | |||
| 1528 | Ga0068867_100037649 | |||
| 1529 | Ga0068867_100207276 | |||
| 1530 | Ga0070685_10000062 | |||
| 1531 | Ga0070685_10009173 | |||
| 1532 | Ga0070685_10173954 | |||
| 1533 | Ga0070685_10181349 | |||
| 1534 | Ga0070685_11427978 | |||
| 1535 | Ga0070699_102106370 | |||
| 1536 | Ga0070679_100010060 | |||
| 1537 | Ga0070679_100296893 | |||
| 1538 | Ga0070684_100001176 | |||
| 1539 | Ga0070684_100026984 | |||
| 1540 | Ga0070684_100068616 | |||
| 1541 | Ga0070684_100083579 | |||
| 1542 | Ga0070684_100259844 | |||
| 1543 | Ga0070684_100502883 | |||
| 1544 | Ga0070684_100581550 | |||
| 1545 | Ga0070684_100935484 | |||
| 1546 | Ga0070684_100946552 | |||
| 1547 | Ga0070684_102246416 | |||
| 1548 | Ga0068853_100007277 | |||
| 1549 | Ga0068853_100615877 | |||
| 1550 | Ga0070672_100000003 | |||
| 1551 | Ga0070672_101542682 | |||
| 1552 | Ga0070672_102085416 | |||
| 1553 | Ga0070686_100188221 | |||
| 1554 | Ga0070686_100448838 | |||
| 1555 | Ga0070695_100495573 | |||
| 1556 | Ga0070695_100997421 | |||
| 1557 | Ga0070696_100152740 | |||
| 1558 | Ga0070696_100783365 | |||
| 1559 | Ga0070693_100005595 | |||
| 1560 | Ga0070693_100147659 | |||
| 1561 | Ga0070693_100332297 | |||
| 1562 | Ga0070693_100944190 | |||
| 1563 | Ga0070665_100000911 | |||
| 1564 | Ga0070665_100007709 | |||
| 1565 | Ga0070665_100867255 | |||
| 1566 | Ga0070665_101081839 | |||
| 1567 | Ga0070665_101185581 | |||
| 1568 | Ga0070665_101851165 | |||
| 1569 | Ga0070665_102400703 | |||
| 1570 | Ga0070704_100035398 | |||
| 1571 | Ga0070704_101588918 | |||
| 1572 | Ga0068855_100246356 | |||
| 1573 | Ga0068855_101944772 | |||
| 1574 | Ga0070664_100014589 | |||
| 1575 | Ga0070664_100045853 | |||
| 1576 | Ga0070664_100140463 | |||
| 1577 | Ga0070664_100243283 | |||
| 1578 | Ga0070664_100830404 | |||
| 1579 | Ga0070664_101090355 | |||
| 1580 | Ga0070664_101532821 | |||
| 1581 | Ga0068857_100552492 | |||
| 1582 | Ga0068857_101839989 | |||
| 1583 | Ga0068854_100035147 | |||
| 1584 | Ga0068854_100200729 | |||
| 1585 | Ga0068854_100215381 | |||
| 1586 | Ga0068854_100224957 | |||
| 1587 | Ga0068854_100292170 | |||
| 1588 | Ga0068854_100764086 | |||
| 1589 | Ga0068854_100903093 | |||
| 1590 | Ga0068854_101170584 | |||
| 1591 | Ga0068856_100030900 | |||
| 1592 | Ga0068856_100063649 | |||
| 1593 | Ga0068856_100070194 | |||
| 1594 | Ga0068856_100214806 | |||
| 1595 | Ga0068856_100329045 | |||
| 1596 | Ga0068856_100331027 | |||
| 1597 | Ga0068856_100382998 | |||
| 1598 | Ga0068856_100560608 | |||
| 1599 | Ga0068856_100631522 | |||
| 1600 | Ga0068856_102357876 | |||
| 1601 | Ga0068856_102653729 | |||
| 1602 | Ga0070702_100013640 | |||
| 1603 | Ga0070702_100250597 | |||
| 1604 | Ga0070702_100287326 | |||
| 1605 | Ga0070702_100550225 | |||
| 1606 | Ga0070702_101382547 | |||
| 1607 | Ga0068852_100047988 | |||
| 1608 | Ga0068852_100626503 | |||
| 1609 | Ga0068852_100654215 | |||
| 1610 | Ga0068852_100750916 | |||
| 1611 | Ga0068852_100778817 | |||
| 1612 | Ga0068859_100231354 | |||
| 1613 | Ga0068859_101610820 | |||
| 1614 | Ga0068859_102219467 | |||
| 1615 | Ga0068864_100007359 | |||
| 1616 | Ga0068864_100073733 | |||
| 1617 | Ga0068864_100484305 | |||
| 1618 | Ga0068864_100855808 | |||
| 1619 | Ga0068864_101041450 | |||
| 1620 | Ga0068866_10000040 | |||
| 1621 | Ga0068866_10031258 | |||
| 1622 | Ga0068866_10414725 | |||
| 1623 | Ga0068866_10836101 | |||
| 1624 | Ga0068861_100014554 | |||
| 1625 | Ga0068861_100055761 | |||
| 1626 | Ga0068861_100156494 | |||
| 1627 | Ga0068861_100274762 | |||
| 1628 | Ga0068861_100370068 | |||
| 1629 | Ga0068861_100392739 | |||
| 1630 | Ga0068861_100951893 | |||
| 1631 | Ga0068851_10019999 | |||
| 1632 | Ga0068851_10713850 | |||
| 1633 | Ga0068870_10176307 | |||
| 1634 | Ga0068870_10179234 | |||
| 1635 | Ga0068870_10279527 | |||
| 1636 | Ga0068870_10303220 | |||
| 1637 | Ga0068870_11432364 | |||
| 1638 | Ga0068863_100000042 | |||
| 1639 | Ga0068863_100208039 | |||
| 1640 | Ga0068858_100000244 | |||
| 1641 | Ga0068858_100346958 | |||
| 1642 | Ga0068858_100560041 | |||
| 1643 | Ga0068860_100010843 | |||
| 1644 | Ga0068860_100236591 | |||
| 1645 | Ga0068860_100314173 | |||
| 1646 | Ga0068860_100736110 | |||
| 1647 | Ga0068862_100133433 | |||
| 1648 | Ga0068862_100222363 | |||
| 1649 | Ga0081455_10010630 | |||
| 1650 | Ga0081455_10193698 | |||
| 1651 | Ga0081455_10864797 | |||
| 1652 | Ga0081540_1000568 | |||
| 1653 | Ga0081540_1070851 | |||
| 1654 | Ga0081539_10001489 | |||
| 1655 | Ga0081539_10004262 | |||
| 1656 | Ga0081539_10005444 | |||
| 1657 | Ga0081539_10017508 | |||
| 1658 | Ga0081539_10119657 | |||
| 1659 | Ga0070717_10000061 | |||
| 1660 | Ga0075365_10231017 | |||
| 1661 | Ga0075432_10072403 | |||
| 1662 | Ga0070715_10000036 | |||
| 1663 | Ga0070716_100300188 | |||
| 1664 | Ga0070716_100845593 | |||
| 1665 | Ga0070712_100004498 | |||
| 1666 | Ga0070712_100048711 | |||
| 1667 | Ga0070712_100808057 | |||
| 1668 | Ga0097621_100047249 | |||
| 1669 | Ga0097621_100047782 | |||
| 1670 | Ga0097621_101619892 | |||
| 1671 | Ga0068871_100227347 | |||
| 1672 | Ga0068871_100544062 | |||
| 1673 | Ga0075428_100303059 | |||
| 1674 | Ga0075428_100444086 | |||
| 1675 | Ga0075428_100581660 | |||
| 1676 | Ga0075430_100057972 | |||
| 1677 | Ga0075430_100129822 | |||
| 1678 | Ga0075430_100504576 | |||
| 1679 | Ga0075430_101054601 | |||
| 1680 | Ga0075431_100141000 | |||
| 1681 | Ga0075431_100180898 | |||
| 1682 | Ga0075431_100823662 | |||
| 1683 | Ga0075431_101593036 | |||
| 1684 | Ga0075433_10170352 | |||
| 1685 | Ga0075433_10250493 | |||
| 1686 | Ga0075434_100042730 | |||
| 1687 | Ga0075434_100721708 | |||
| 1688 | Ga0075434_100878219 | |||
| 1689 | Ga0075434_101074855 | |||
| 1690 | Ga0075434_101459042 | |||
| 1691 | Ga0068865_100114896 | |||
| 1692 | Ga0068865_101065361 | |||
| 1693 | Ga0075436_100034070 | |||
| 1694 | Ga0097620_100231359 | |||
| 1695 | Ga0097620_101610742 | |||
| 1696 | Ga0097620_102100752 | |||
| 1697 | Ga0097620_102219727 | |||
| 1698 | Ga0075435_100487315 | |||
| 1699 | Ga0075435_100836204 | |||
| 1700 | Ga0105251_10212301 | |||
| 1701 | Ga0105240_10277545 | |||
| 1702 | Ga0105240_11207701 | |||
| 1703 | Ga0111539_10179523 | |||
| 1704 | Ga0111539_10836017 | |||
| 1705 | Ga0111539_11423228 | |||
| 1706 | Ga0111539_11546865 | |||
| 1707 | Ga0111539_12744563 | |||
| 1708 | Ga0111539_12926660 | |||
| 1709 | Ga0105245_10000291 | |||
| 1710 | Ga0105245_10003629 | |||
| 1711 | Ga0105245_10034896 | |||
| 1712 | Ga0105245_10217917 | |||
| 1713 | Ga0105245_10280451 | |||
| 1714 | Ga0105245_10522758 | |||
| 1715 | Ga0105245_10702422 | |||
| 1716 | Ga0105245_10705699 | |||
| 1717 | Ga0105245_11275741 | |||
| 1718 | Ga0105245_13155642 | |||
| 1719 | Ga0105245_13256319 | |||
| 1720 | Ga0105247_10075526 | |||
| 1721 | Ga0105247_10090935 | |||
| 1722 | Ga0105247_10396358 | |||
| 1723 | Ga0105247_10476268 | |||
| 1724 | Ga0105247_11051848 | |||
| 1725 | Ga0114129_10170314 | |||
| 1726 | Ga0114129_10895359 | |||
| 1727 | Ga0114129_11230053 | |||
| 1728 | Ga0105243_10044051 | |||
| 1729 | Ga0105243_10068071 | |||
| 1730 | Ga0105243_10250659 | |||
| 1731 | Ga0105243_10290909 | |||
| 1732 | Ga0105243_10439296 | |||
| 1733 | Ga0105243_10482327 | |||
| 1734 | Ga0105243_10744969 | |||
| 1735 | Ga0105243_11451364 | |||
| 1736 | Ga0105243_11617002 | |||
| 1737 | Ga0105243_12824899 | |||
| 1738 | Ga0105242_10004751 | |||
| 1739 | Ga0105242_11524983 | |||
| 1740 | Ga0105248_10069164 | |||
| 1741 | Ga0105248_10399776 | |||
| 1742 | Ga0105248_11141168 | |||
| 1743 | Ga0105248_11494660 | |||
| 1744 | Ga0105237_10454491 | |||
| 1745 | Ga0105237_11704104 | |||
| 1746 | Ga0105237_11822650 | |||
| 1747 | Ga0105237_12728942 | |||
| 1748 | Ga0105238_10000051 | |||
| 1749 | Ga0105238_11457398 | |||
| 1750 | Ga0105238_11793976 | |||
| 1751 | Ga0105249_10000085 | |||
| 1752 | Ga0105249_10237981 | |||
| 1753 | Ga0105249_10253061 | |||
| 1754 | Ga0105249_10676101 | |||
| 1755 | Ga0105249_10774304 | |||
| 1756 | Ga0105249_10912660 | |||
| 1757 | Ga0105249_11121622 | |||
| 1758 | Ga0105249_11376001 | |||
| 1759 | Ga0105239_10020882 | |||
| 1760 | Ga0105239_10128679 | |||
| 1761 | Ga0105239_10260288 | |||
| 1762 | Ga0105239_10411555 | |||
| 1763 | Ga0105239_10741716 | |||
| 1764 | Ga0105239_11280788 | |||
| 1765 | Ga0105239_12951051 | |||
| 1766 | Ga0105246_10017569 | |||
| 1767 | Ga0105246_10854265 | |||
| 1768 | Ga0105246_11742110 | |||
| 1769 | Ga0105246_11858894 | |||
| 1770 | Ga0105246_12026119 | |||
| 1771 | Ga0157345_1024048 | |||
| 1772 | Ga0157342_1082862 | |||
| 1773 | Ga0157338_1052698 | |||
| 1774 | Ga0157371_10008383 | |||
| 1775 | Ga0157371_10213254 | |||
| 1776 | Ga0157371_11004812 | |||
| 1777 | Ga0157371_11249594 | |||
| 1778 | Ga0157370_10343717 | |||
| 1779 | Ga0157369_10175305 | |||
| 1780 | Ga0157369_10475857 | |||
| 1781 | Ga0157374_10039495 | |||
| 1782 | Ga0157374_10396326 | |||
| 1783 | Ga0157374_10468033 | |||
| 1784 | Ga0157374_10509878 | |||
| 1785 | Ga0157374_11117032 | |||
| 1786 | Ga0157374_11782617 | |||
| 1787 | Ga0157378_10095057 | |||
| 1788 | Ga0157378_10346904 | |||
| 1789 | Ga0157378_13017794 | |||
| 1790 | Ga0157378_13041154 | |||
| 1791 | Ga0157378_13197397 | |||
| 1792 | Ga0157378_13251273 | |||
| 1793 | Ga0163162_10176490 | |||
| 1794 | Ga0163162_10502797 | |||
| 1795 | Ga0163162_10651789 | |||
| 1796 | Ga0163162_10736838 | |||
| 1797 | Ga0163162_10985767 | |||
| 1798 | Ga0163162_11230717 | |||
| 1799 | Ga0157372_10121159 | |||
| 1800 | Ga0157372_10376171 | |||
| 1801 | Ga0157372_10474523 | |||
| 1802 | Ga0157372_10640753 | |||
| 1803 | Ga0157372_10658269 | |||
| 1804 | Ga0157372_10861424 | |||
| 1805 | Ga0157372_11577431 | |||
| 1806 | Ga0157372_13155321 | |||
| 1807 | Ga0157375_10001056 | |||
| 1808 | Ga0157375_10501149 | |||
| 1809 | Ga0157375_10502195 | |||
| 1810 | Ga0157375_10524910 | |||
| 1811 | Ga0157375_10656430 | |||
| 1812 | Ga0157375_10899471 | |||
| 1813 | Ga0157375_10963460 | |||
| 1814 | Ga0157375_11311547 | |||
| 1815 | Ga0157375_12047906 | |||
| 1816 | Ga0157375_13328239 | |||
| 1817 | Ga0157375_13478110 | |||
| 1818 | Ga0157375_13774610 | |||
| 1819 | Ga0163163_10023648 | |||
| 1820 | Ga0163163_10133668 | |||
| 1821 | Ga0163163_10260542 | |||
| 1822 | Ga0163163_10547721 | |||
| 1823 | Ga0163163_11045578 | |||
| 1824 | Ga0163163_11433529 | |||
| 1825 | Ga0163163_11950487 | |||
| 1826 | Ga0163163_11962666 | |||
| 1827 | Ga0163163_13142434 | |||
| 1828 | Ga0157380_10015195 | |||
| 1829 | Ga0157380_10135717 | |||
| 1830 | Ga0157380_10406236 | |||
| 1831 | Ga0157380_10715235 | |||
| 1832 | Ga0182008_10074947 | |||
| 1833 | Ga0182008_10677617 | |||
| 1834 | Ga0182008_10952577 | |||
| 1835 | Ga0157377_10002646 | |||
| 1836 | Ga0157377_10107056 | |||
| 1837 | Ga0157377_10182075 | |||
| 1838 | Ga0157377_10207937 | |||
| 1839 | Ga0157377_10616268 | |||
| 1840 | Ga0157377_10766114 | |||
| 1841 | Ga0157379_10135778 | |||
| 1842 | Ga0157379_10237814 | |||
| 1843 | Ga0157379_11397380 | |||
| 1844 | Ga0157379_12595334 | |||
| 1845 | Ga0157376_10020056 | |||
| 1846 | Ga0157376_10036164 | |||
| 1847 | Ga0157376_10124246 | |||
| 1848 | Ga0157376_11419894 | |||
| 1849 | Ga0157376_12666211 | |||
| 1850 | Ga0163161_10000018 | |||
| 1851 | Ga0163161_10203162 | |||
| 1852 | Ga0163161_10613201 | |||
| 1853 | Ga0206354_10546389 | |||
| 1854 | Ga0206354_11486596 | |||
| 1855 | Ga0206353_10584676 | |||
| 1856 | Ga0213873_10038511 | |||
| 1857 | Ga0213874_10221763 | |||
| 1858 | Ga0213876_10727960 | |||
| 1859 | Ga0207672_1010329 | |||
| 1860 | Ga0207656_10011616 | |||
| 1861 | Ga0207656_10036938 | |||
| 1862 | Ga0207713_1190386 | |||
| 1863 | Ga0207682_10000102 | |||
| 1864 | Ga0207682_10250492 | |||
| 1865 | Ga0207692_10000003 | |||
| 1866 | Ga0207692_10014509 | |||
| 1867 | Ga0207692_10070515 | |||
| 1868 | Ga0207692_10120642 | |||
| 1869 | Ga0207642_10000001 | |||
| 1870 | Ga0207642_10000003 | |||
| 1871 | Ga0207642_10022154 | |||
| 1872 | Ga0207642_10334129 | |||
| 1873 | Ga0207642_10442642 | |||
| 1874 | Ga0207642_10878712 | |||
| 1875 | Ga0207710_10035925 | |||
| 1876 | Ga0207710_10139889 | |||
| 1877 | Ga0207710_10266660 | |||
| 1878 | Ga0207710_10691026 | |||
| 1879 | Ga0207688_10000979 | |||
| 1880 | Ga0207688_10075497 | |||
| 1881 | Ga0207688_10233938 | |||
| 1882 | Ga0207688_10255287 | |||
| 1883 | Ga0207680_10007622 | |||
| 1884 | Ga0207680_10565766 | |||
| 1885 | Ga0207680_10717189 | |||
| 1886 | Ga0207647_10192570 | |||
| 1887 | Ga0207647_10500327 | |||
| 1888 | Ga0207685_10000001 | |||
| 1889 | Ga0207685_10222535 | |||
| 1890 | Ga0207699_10528191 | |||
| 1891 | Ga0207645_10077392 | |||
| 1892 | Ga0207645_10270965 | |||
| 1893 | Ga0207643_10034910 | |||
| 1894 | Ga0207643_10754076 | |||
| 1895 | Ga0207705_10055513 | |||
| 1896 | Ga0207705_10254172 | |||
| 1897 | Ga0207705_10283133 | |||
| 1898 | Ga0207705_11496068 | |||
| 1899 | Ga0207707_10422948 | |||
| 1900 | Ga0207695_11115138 | |||
| 1901 | Ga0207695_11320840 | |||
| 1902 | Ga0207693_10005251 | |||
| 1903 | Ga0207693_10052891 | |||
| 1904 | Ga0207693_10595139 | |||
| 1905 | Ga0207663_10005434 | |||
| 1906 | Ga0207663_10077672 | |||
| 1907 | Ga0207663_10217062 | |||
| 1908 | Ga0207663_10636366 | |||
| 1909 | Ga0207660_10556911 | |||
| 1910 | Ga0207660_10855914 | |||
| 1911 | Ga0207660_10901703 | |||
| 1912 | Ga0207662_10020390 | |||
| 1913 | Ga0207662_10374015 | |||
| 1914 | Ga0207662_10567866 | |||
| 1915 | Ga0207662_10589929 | |||
| 1916 | Ga0207657_10027772 | |||
| 1917 | Ga0207657_10122339 | |||
| 1918 | Ga0207657_10197070 | |||
| 1919 | Ga0207657_10277619 | |||
| 1920 | Ga0207657_10338541 | |||
| 1921 | Ga0207649_10000021 | |||
| 1922 | Ga0207649_10394347 | |||
| 1923 | Ga0207649_11260129 | |||
| 1924 | Ga0207649_11275683 | |||
| 1925 | Ga0207649_11539395 | |||
| 1926 | Ga0207652_10000444 | |||
| 1927 | Ga0207652_11152013 | |||
| 1928 | Ga0207681_10003557 | |||
| 1929 | Ga0207681_10272085 | |||
| 1930 | Ga0207694_10000035 | |||
| 1931 | Ga0207659_10000242 | |||
| 1932 | Ga0207659_10231666 | |||
| 1933 | Ga0207659_10378502 | |||
| 1934 | Ga0207659_10963341 | |||
| 1935 | Ga0207687_10000058 | |||
| 1936 | Ga0207687_10019427 | |||
| 1937 | Ga0207687_10081140 | |||
| 1938 | Ga0207687_10134629 | |||
| 1939 | Ga0207687_10380193 | |||
| 1940 | Ga0207687_10950081 | |||
| 1941 | Ga0207687_10973742 | |||
| 1942 | Ga0207687_11432632 | |||
| 1943 | Ga0207700_10000013 | |||
| 1944 | Ga0207664_10000142 | |||
| 1945 | Ga0207664_10005021 | |||
| 1946 | Ga0207664_10326785 | |||
| 1947 | Ga0207644_10152742 | |||
| 1948 | Ga0207644_11341746 | |||
| 1949 | Ga0207690_10000054 | |||
| 1950 | Ga0207690_10230836 | |||
| 1951 | Ga0207690_10233920 | |||
| 1952 | Ga0207690_10268418 | |||
| 1953 | Ga0207690_10491564 | |||
| 1954 | Ga0207690_10584635 | |||
| 1955 | Ga0207690_10831323 | |||
| 1956 | Ga0207706_10000413 | |||
| 1957 | Ga0207706_10044291 | |||
| 1958 | Ga0207706_10051710 | |||
| 1959 | Ga0207706_10338576 | |||
| 1960 | Ga0207706_10409292 | |||
| 1961 | Ga0207686_10000247 | |||
| 1962 | Ga0207686_10102107 | |||
| 1963 | Ga0207686_10454777 | |||
| 1964 | Ga0207686_11844084 | |||
| 1965 | Ga0207709_10006427 | |||
| 1966 | Ga0207709_10045864 | |||
| 1967 | Ga0207709_10116336 | |||
| 1968 | Ga0207709_10231548 | |||
| 1969 | Ga0207709_10268194 | |||
| 1970 | Ga0207709_10268384 | |||
| 1971 | Ga0207709_10495709 | |||
| 1972 | Ga0207709_11197846 | |||
| 1973 | Ga0207670_10034986 | |||
| 1974 | Ga0207670_10269871 | |||
| 1975 | Ga0207670_10380166 | |||
| 1976 | Ga0207670_10890117 | |||
| 1977 | Ga0207669_10000099 | |||
| 1978 | Ga0207669_10062566 | |||
| 1979 | Ga0207669_10276406 | |||
| 1980 | Ga0207669_11534311 | |||
| 1981 | Ga0207704_10150920 | |||
| 1982 | Ga0207704_10753810 | |||
| 1983 | Ga0207704_10938071 | |||
| 1984 | Ga0207704_11096474 | |||
| 1985 | Ga0207665_10644921 | |||
| 1986 | Ga0207665_10949985 | |||
| 1987 | Ga0207691_10000005 | |||
| 1988 | Ga0207691_10294280 | |||
| 1989 | Ga0207691_10325298 | |||
| 1990 | Ga0207691_10658991 | |||
| 1991 | Ga0207691_11282009 | |||
| 1992 | Ga0207711_10142458 | |||
| 1993 | Ga0207711_11033314 | |||
| 1994 | Ga0207711_11177955 | |||
| 1995 | Ga0207689_10178902 | |||
| 1996 | Ga0207689_10235902 | |||
| 1997 | Ga0207689_10277176 | |||
| 1998 | Ga0207689_10403257 | |||
| 1999 | Ga0207661_10000333 | |||
| 2000 | Ga0207661_10010720 | |||
| 2001 | Ga0207661_10019879 | |||
| 2002 | Ga0207661_10027205 | |||
| 2003 | Ga0207661_10027861 | |||
| 2004 | Ga0207661_10049048 | |||
| 2005 | Ga0207661_10060797 | |||
| 2006 | Ga0207661_10107115 | |||
| 2007 | Ga0207661_10215848 | |||
| 2008 | Ga0207661_10400268 | |||
| 2009 | Ga0207661_10407097 | |||
| 2010 | Ga0207661_10474577 | |||
| 2011 | Ga0207679_10016670 | |||
| 2012 | Ga0207679_10160193 | |||
| 2013 | Ga0207679_10188083 | |||
| 2014 | Ga0207679_10219185 | |||
| 2015 | Ga0207679_10385649 | |||
| 2016 | Ga0207679_10969756 | |||
| 2017 | Ga0207679_11118570 | |||
| 2018 | Ga0207679_11334696 | |||
| 2019 | Ga0207667_10319765 | |||
| 2020 | Ga0207667_10353474 | |||
| 2021 | Ga0207667_10708049 | |||
| 2022 | Ga0207667_11681269 | |||
| 2023 | Ga0207667_11870910 | |||
| 2024 | Ga0207651_10001290 | |||
| 2025 | Ga0207651_10504750 | |||
| 2026 | Ga0207712_10000033 | |||
| 2027 | Ga0207712_10282658 | |||
| 2028 | Ga0207712_10608407 | |||
| 2029 | Ga0207712_11259060 | |||
| 2030 | Ga0207668_10126895 | |||
| 2031 | Ga0207668_10154224 | |||
| 2032 | Ga0207668_10988436 | |||
| 2033 | Ga0207640_10042521 | |||
| 2034 | Ga0207640_11068735 | |||
| 2035 | Ga0207640_11323619 | |||
| 2036 | Ga0207658_10091020 | |||
| 2037 | Ga0207658_10236894 | |||
| 2038 | Ga0207658_10444879 | |||
| 2039 | Ga0207677_10156309 | |||
| 2040 | Ga0207677_10274037 | |||
| 2041 | Ga0207677_10277325 | |||
| 2042 | Ga0207677_10312526 | |||
| 2043 | Ga0207677_10583258 | |||
| 2044 | Ga0207677_10706607 | |||
| 2045 | Ga0207677_11108960 | |||
| 2046 | Ga0207703_10000411 | |||
| 2047 | Ga0207703_10419852 | |||
| 2048 | Ga0207703_10566298 | |||
| 2049 | Ga0207703_11041913 | |||
| 2050 | Ga0207639_10011691 | |||
| 2051 | Ga0207639_10623813 | |||
| 2052 | Ga0207678_10080589 | |||
| 2053 | Ga0207678_10117204 | |||
| 2054 | Ga0207678_10283698 | |||
| 2055 | Ga0207678_10372687 | |||
| 2056 | Ga0207678_10413951 | |||
| 2057 | Ga0207678_10585500 | |||
| 2058 | Ga0207678_10674581 | |||
| 2059 | Ga0207678_11600509 | |||
| 2060 | Ga0207708_10000604 | |||
| 2061 | Ga0207708_10025143 | |||
| 2062 | Ga0207708_10027516 | |||
| 2063 | Ga0207708_10036375 | |||
| 2064 | Ga0207708_10408189 | |||
| 2065 | Ga0207708_10521617 | |||
| 2066 | Ga0207708_10667867 | |||
| 2067 | Ga0207708_10838111 | |||
| 2068 | Ga0207708_11253038 | |||
| 2069 | Ga0207708_11847111 | |||
| 2070 | Ga0207702_10011624 | |||
| 2071 | Ga0207702_10015114 | |||
| 2072 | Ga0207702_10024744 | |||
| 2073 | Ga0207702_10314937 | |||
| 2074 | Ga0207702_10431792 | |||
| 2075 | Ga0207702_10561167 | |||
| 2076 | Ga0207702_11193185 | |||
| 2077 | Ga0207702_11615869 | |||
| 2078 | Ga0207641_10000066 | |||
| 2079 | Ga0207641_10224528 | |||
| 2080 | Ga0207641_10432871 | |||
| 2081 | Ga0207641_10970006 | |||
| 2082 | Ga0207641_11246442 | |||
| 2083 | Ga0207648_10003660 | |||
| 2084 | Ga0207648_10034643 | |||
| 2085 | Ga0207648_10250751 | |||
| 2086 | Ga0207648_10854990 | |||
| 2087 | Ga0207676_10033098 | |||
| 2088 | Ga0207676_10096043 | |||
| 2089 | Ga0207676_10516079 | |||
| 2090 | Ga0207674_10203728 | |||
| 2091 | Ga0207675_100044331 | |||
| 2092 | Ga0207675_100059574 | |||
| 2093 | Ga0207675_100204481 | |||
| 2094 | Ga0207675_100527872 | |||
| 2095 | Ga0207675_100649796 | |||
| 2096 | Ga0207675_102531159 | |||
| 2097 | Ga0207675_102595738 | |||
| 2098 | Ga0207683_10049953 | |||
| 2099 | Ga0207683_10092170 | |||
| 2100 | Ga0207683_10109855 | |||
| 2101 | Ga0207683_10278263 | |||
| 2102 | Ga0207683_11034576 | |||
| 2103 | Ga0207683_11272488 | |||
| 2104 | Ga0207683_11454384 | |||
| 2105 | Ga0207698_10022390 | |||
| 2106 | Ga0207698_10288992 | |||
| 2107 | Ga0207698_10417026 | |||
| 2108 | Ga0207698_10511512 | |||
| 2109 | Ga0207698_10808608 | |||
| 2110 | Ga0207698_12055368 | |||
| 2111 | Ga0209371_1072523 | |||
| 2112 | Ga0209966_1137832 | |||
| 2113 | Ga0207428_10060696 | |||
| 2114 | Ga0207428_10475148 | |||
| 2115 | Ga0268266_10000076 | |||
| 2116 | Ga0268266_10001583 | |||
| 2117 | Ga0268266_10012449 | |||
| 2118 | Ga0268266_10178666 | |||
| 2119 | Ga0268266_10651660 | |||
| 2120 | Ga0268266_10776337 | |||
| 2121 | Ga0268266_10858252 | |||
| 2122 | Ga0268266_11047613 | |||
| 2123 | Ga0268266_12303311 | |||
| 2124 | Ga0268265_10106261 | |||
| 2125 | Ga0268265_11098305 | |||
| 2126 | Ga0268264_10002303 | |||
| 2127 | Ga0268264_10028443 | |||
| 2128 | Ga0268264_10244183 | |||
| 2129 | Ga0265337_1000044 | |||
| 2130 | Ga0265326_10000005 | |||
| 2131 | Ga0265326_10000038 | |||
| 2132 | Ga0265319_1002481 | |||
| 2133 | Ga0265319_1003626 | |||
| 2134 | Ga0265334_10000024 | |||
| 2135 | Ga0265318_10015580 | |||
| 2136 | Ga0265323_10141015 | |||
| 2137 | Ga0265322_10000006 | |||
| 2138 | Ga0265336_10004085 | |||
| 2139 | Ga0265336_10017857 | |||
| 2140 | Ga0265338_10013188 | |||
| 2141 | Ga0265338_10053056 | |||
| 2142 | Ga0265338_10136466 | |||
| 2143 | Ga0265324_10000171 | |||
| 2144 | Ga0265324_10002344 | |||
| 2145 | Ga0268256_1080677 | |||
| 2146 | Ga0265330_10410932 | |||
| 2147 | Ga0265332_10026496 | |||
| 2148 | Ga0265328_10001776 | |||
| 2149 | Ga0265320_10000001 | |||
| 2150 | Ga0265320_10015630 | |||
| 2151 | Ga0265320_10024350 | |||
| 2152 | Ga0265320_10091679 | |||
| 2153 | Ga0265320_10175825 | |||
| 2154 | Ga0265325_10269669 | |||
| 2155 | Ga0265329_10055875 | |||
| 2156 | Ga0265339_10007603 | |||
| 2157 | Ga0265331_10000624 | |||
| 2158 | Ga0265327_10000003 | |||
| 2159 | Ga0265327_10244047 | |||
| 2160 | Ga0265316_10020799 | |||
| 2161 | Ga0265316_10074360 | |||
| 2162 | Ga0307513_10108862 | |||
| 2163 | Ga0265313_10064867 | |||
| 2164 | Ga0265313_10179569 | |||
| 2165 | Ga0265314_10000103 | |||
| 2166 | Ga0265314_10039634 | |||
| 2167 | Ga0265314_10106751 | |||
| 2168 | Ga0265342_10153155 | |||
| 2169 | Ga0316576_10446825 | |||
| 2170 | Ga0316578_10125452 | |||
| 2171 | Ga0307405_11475762 | |||
| 2172 | Ga0307405_11602413 | |||
| 2173 | Ga0307410_11704714 | |||
| 2174 | Ga0307406_11032027 | |||
| 2175 | Ga0307407_10797939 | |||
| 2176 | Ga0307407_11000776 | |||
| 2177 | Ga0307409_100153899 | |||
| 2178 | Ga0307409_101148457 | |||
| 2179 | Ga0307409_101504255 | |||
| 2180 | Ga0307416_100410609 | |||
| 2181 | Ga0307416_100569146 | |||
| 2182 | Ga0307416_100832590 | |||
| 2183 | Ga0307416_100862792 | |||
| 2184 | Ga0307416_101765728 | |||
| 2185 | Ga0307416_102197832 | |||
| 2186 | Ga0307416_102392196 | |||
| 2187 | Ga0307414_11470185 | |||
| 2188 | Ga0307415_100039378 | |||
| 2189 | Ga0307415_100289625 | |||
| 2190 | Ga0307415_100762346 | |||
| 2191 | Ga0307415_101468251 | |||
| 2192 | Ga0373944_0042410 | |||
| 2193 | Ga0373941_0337466 | |||
| 2194 | Ga0373954_0511807 | |||
| 2195 | Ga0373943_0051238 | |||
| 2196 | Ga0373961_0384486 | |||
| 2197 | Ga0316574_0316492 | |||
| 2198 | Ga0373937_0106785 | |||
| 2199 | Ga0373937_0117732 | |||
| 2200 | Ga0373937_1707532 | |||
| 2201 | Ga0373925_0271347 | |||
| 2202 | Ga0395899_0406261 | |||
| 2203 | Ga0395899_0532453 | |||
| 2204 | Ga0395900_0002246 | |||
| 2205 | Ga0395900_0076780 | |||
| 2206 | Ga0395900_0124749 | |||
| 2207 | Ga0395900_0442340 | |||
| 2208 | Ga0395900_0443578 | |||
| 2209 | Ga0395900_0811972 | |||
| 2210 | Ga0395900_0995191 | |||
| 2211 | Ga0395898_0003455 | |||
| 2212 | Ga0395898_0130476 | |||
| 2213 | Ga0395898_0420296 | |||
| 2214 | Ga0395898_0571917 | |||
| 2215 | Ga0395898_0888329 | |||
| 2216 | Ga0395898_0897418 | |||
| 2217 | Ga0395898_0972358 | |||
| 2218 | Ga0395898_1544064 | |||
| 2219 | Ga0395898_1586621 | |||
| 2220 | Ga0395898_1798357 | |||
| 2221 | Ga0395898_1968613 | |||
| 2222 | Ga0395905_0314109 | |||
| 2223 | Ga0395905_0460828 | |||
| 2224 | Ga0395905_0879063 | |||
| 2225 | Ga0395905_0925181 | |||
| 2226 | Ga0436364_0492106 | |||
| 2227 | Ga0395901_0096968 | |||
| 2228 | Ga0395901_0125141 | |||
| 2229 | Ga0395901_0168269 | |||
| 2230 | Ga0395901_0190142 | |||
| 2231 | Ga0395901_0279730 | |||
| 2232 | Ga0395901_0304328 | |||
| 2233 | Ga0395901_0325464 | |||
| 2234 | Ga0395901_0434794 | |||
| 2235 | Ga0395901_0838426 | |||
| 2236 | Ga0395901_1136479 | |||
| 2237 | Ga0395901_1202536 | |||
| 2238 | Ga0395901_1577955 | |||
| 2239 | Ga0395901_1585847 | |||
| 2240 | Ga0395901_1906462 | |||
| 2241 | Ga0395901_2053120 | |||
| 2242 | Ga0436365_0324463 | |||
| 2243 | Ga0436365_1262671 | |||
| 2244 | Ga0436363_0601680 | |||
| 2245 | Ga0436363_0690390 | |||
| 2246 | Ga0436363_0720174 | |||
| 2247 | Ga0436363_1384139 | |||
| 2248 | Ga0436363_1485415 | |||
| 2249 | Ga0436362_0305135 | |||
| 2250 | Ga0436362_0876822 | |||
| 2251 | Ga0436362_1000293 | |||
| 2252 | Ga0451789_1118632 | |||
| 2253 | Ga0451791_0994167 | |||
| 2254 | Ga0451791_1854511 | |||
| 2255 | Ga0451793_0642526 | |||
| 2256 | Ga0451793_0828338 | |||
| 2257 | Ga0451798_0631904 | |||
| 2258 | Ga0451800_0269238 | |||
| 2259 | Ga0451800_1497219 | |||
| 2260 | Ga0451802_0055694 | |||
| 2261 | Ga0451802_0447237 | |||
| 2262 | Ga0451802_0448510 | |||
| 2263 | Ga0451806_392145 | |||
| 2264 | Ga0451807_0204767 | |||
| 2265 | Ga0451833_1316929 | |||
| 2266 | Ga0451835_0776220 | |||
| 2267 | Ga0451839_1022939 | |||
| 2268 | Ga0451847_0685356 | |||
| 2269 | Ga0451849_1428499 | |||
| 2270 | Ga0451843_0472792 | |||
| 2271 | Ga0451855_1721508 | |||
| 2272 | Ga0451853_0911932 | |||
| 2273 | Ga0451853_1719005 | |||
| 2274 | Ga0451853_2061650 | |||
| 2275 | Ga0451853_2898718 | |||
| 2276 | Ga0439449_0201463 | |||
| 2277 | Ga0450923_151310 | |||
| 2278 | Ga0466969_0018129 | |||
| 2279 | Ga0466969_0168174 | |||
| 2280 | Ga0466969_0501311 | |||
| 2281 | Ga0466972_0311825 | |||
| 2282 | Ga0466972_0533583 | |||
| 2283 | Ga0466965_0027818 | |||
| 2284 | Ga0466965_0087737 | |||
| 2285 | Ga0466965_0195581 | |||
| 2286 | Ga0466965_0735972 | |||
| 2287 | Ga0466966_0021885 | |||
| 2288 | Ga0466966_0044953 | |||
| 2289 | Ga0466966_0329879 | |||
| 2290 | Ga0466966_0460977 | |||
| 2291 | Ga0466966_0560295 | |||
| 2292 | Ga0466966_0713487 | |||
| 2293 | Ga0466966_0862510 | |||
| 2294 | Ga0466961_0694240 | |||
| 2295 | Ga0466963_0000040 | |||
| 2296 | Ga0466963_0046201 | |||
| 2297 | Ga0466963_0113040 | |||
| 2298 | Ga0466963_0266194 | |||
| 2299 | Ga0466963_0378430 | |||
| 2300 | Ga0466971_0078400 | |||
| 2301 | Ga0466971_0126173 | |||
| 2302 | Ga0466971_0319474 | |||
| 2303 | Ga0466971_0382055 | |||
| 2304 | Ga0466968_0059944 | |||
| 2305 | Ga0466970_0087629 | |||
| 2306 | Ga0466970_0132396 | |||
| 2307 | Ga0466970_0176473 | |||
| 2308 | Ga0466957_0088292 | |||
| 2309 | Ga0466957_0403919 | |||
| 2310 | Ga0466957_0614258 | |||
| 2311 | Ga0466960_0001240 | |||
| 2312 | Ga0466960_0015315 | |||
| 2313 | Ga0466960_0057380 | |||
| 2314 | Ga0466960_0119744 | |||
| 2315 | Ga0466960_0134530 | |||
| 2316 | Ga0466960_0236451 | |||
| 2317 | Ga0466960_0245699 | |||
| 2318 | Ga0466960_0277231 | |||
| 2319 | Ga0466960_0347226 | |||
| 2320 | Ga0466960_0381436 | |||
| 2321 | Ga0466960_0832664 | |||
| 2322 | Ga0466960_0998253 | |||
| 2323 | Ga0466959_0003771 | |||
| 2324 | Ga0466959_0166075 | |||
| 2325 | Ga0466959_0171772 | |||
| 2326 | Ga0466959_0775371 | |||
| 2327 | Ga0466959_0853995 | |||
| 2328 | Ga0466958_0009064 | |||
| 2329 | Ga0466958_0077972 | |||
| 2330 | Ga0466958_0119972 | |||
| 2331 | Ga0466958_0146593 | |||
| 2332 | Ga0466958_1042692 | |||
| 2333 | Ga0466967_0042556 | |||
| 2334 | Ga0466967_0054520 | |||
| 2335 | Ga0466967_0060669 | |||
| 2336 | Ga0466967_0123666 | |||
| 2337 | Ga0466967_0202982 | |||
| 2338 | Ga0466967_0230463 | |||
| 2339 | Ga0466967_0415403 | |||
| 2340 | Ga0466967_0488031 | |||
| 2341 | Ga0466967_0783430 | |||
| 2342 | Ga0466967_0821778 | |||
| 2343 | Ga0466967_1234872 | |||
| 2344 | Ga0466967_1784871 | |||
| 2345 | Ga0466967_2233101 | |||
| 2346 | Ga0466967_2405617 | |||
| 2347 | Ga0466967_2461590 | |||
| 2348 | Ga0495592_0000458 | |||
| 2349 | Ga0495603_0000167 | |||
| 2350 | Ga0495603_0019700 | |||
| 2351 | Ga0495603_0041481 | |||
| 2352 | Ga0495629_0004505 | |||
| 2353 | Ga0495629_0068363 | |||
| 2354 | Ga0495629_0358391 | |||
| 2355 | Ga0495638_0013582 | |||
| 2356 | Ga0495641_0000001 | |||
| 2357 | Ga0495641_0011795 | |||
| 2358 | Ga0495641_0031621 | |||
| 2359 | Ga0495641_0089714 | |||
| 2360 | Ga0495641_0540800 | |||
| 2361 | Ga0495651_0325049 | |||
| 2362 | Ga0495653_0021778 | |||
| 2363 | Ga0495653_0123846 | |||
| 2364 | Ga0495650_0000053 | |||
| 2365 | Ga0495582_0000007 | |||
| 2366 | Ga0495582_0014705 | |||
| 2367 | Ga0495605_0489191 | |||
| 2368 | Ga0495662_0000073 | |||
| 2369 | Ga0495662_0116324 | |||
| 2370 | Ga0495662_0626268 | |||
| 2371 | Ga0495584_0049432 | |||
| 2372 | Ga0495584_0213521 | |||
| 2373 | Ga0495585_0532711 | |||
| 2374 | Ga0495606_0000131 | |||
| 2375 | Ga0495608_0032931 | |||
| 2376 | Ga0495618_0000241 | |||
| 2377 | Ga0495620_0001188 | |||
| 2378 | Ga0495628_0070210 | |||
| 2379 | Ga0495628_0561789 | |||
| 2380 | Ga0495628_0996976 | |||
| 2381 | Ga0495630_0000053 | |||
| 2382 | Ga0495630_0003260 | |||
| 2383 | Ga0495630_0042175 | |||
| 2384 | Ga0495630_0290535 | |||
| 2385 | Ga0495630_0673579 | |||
| 2386 | Ga0495630_0721913 | |||
| 2387 | Ga0495631_0420203 | |||
| 2388 | Ga0495637_0177175 | |||
| 2389 | Ga0495644_0001319 | |||
| 2390 | Ga0495663_0242019 | |||
| 2391 | Ga0495652_0160035 | |||
| 2392 | Ga0495665_0071796 | |||
| 2393 | Ga0495640_0333074 | |||
| 2394 | Ga0495586_0002162 | |||
| 2395 | Ga0495586_0182007 | |||
| 2396 | Ga0495586_0530439 | |||
| 2397 | Ga0495598_0264061 | |||
| 2398 | Ga0495621_0010439 | |||
| 2399 | Ga0495645_0000119 | |||
| 2400 | Ga0495645_0057761 | |||
| 2401 | Ga0495645_0152575 | |||
| 2402 | Ga0495645_0238528 | |||
| 2403 | Ga0495656_0064162 | |||
| 2404 | Ga0495634_0000013 | |||
| 2405 | Ga0495634_0000840 | |||
| 2406 | Ga0495634_0002095 | |||
| 2407 | Ga0495634_0017346 | |||
| 2408 | Ga0495634_0112095 | |||
| 2409 | Ga0495634_0331758 | |||
| 2410 | Ga0495625_0000117 | |||
| 2411 | Ga0495635_0345861 | |||
| 2412 | Ga0495588_0000202 | |||
| 2413 | Ga0495588_0402162 | |||
| 2414 | Ga0495588_0510877 | |||
| 2415 | Ga0495657_0012257 | |||
| 2416 | Ga0495599_0025346 | |||
| 2417 | Ga0495647_0000003 | |||
| 2418 | Ga0495647_0007404 | |||
| 2419 | Ga0495647_0169079 | |||
| 2420 | Ga0495647_0246204 | |||
| 2421 | Ga0495658_0000007 | |||
| 2422 | Ga0495658_0362725 | |||
| 2423 | Ga0495658_0488446 | |||
| 2424 | Ga0495669_0000065 | |||
| 2425 | Ga0495613_0000066 | |||
| 2426 | Ga0495613_0184793 | |||
| 2427 | Ga0495624_0003688 | |||
| 2428 | Ga0495624_0006180 | |||
| 2429 | Ga0495624_0200348 | |||
| 2430 | Ga0495670_0115716 | |||
| 2431 | Ga0495670_0675684 | |||
| 2432 | Ga0495670_0773092 | |||
| 2433 | Ga0495671_0497210 | |||
| 2434 | Ga0495649_0001991 | |||
| 2435 | Ga0495649_0682866 | |||
| 2436 | Ga0495600_0003325 | |||
| 2437 | Ga0495600_0098027 | |||
| 2438 | Ga0495600_0275662 | |||
| 2439 | Ga0495604_0000081 | |||
| 2440 | Ga0495604_0180505 | |||
| 2441 | Ga0495604_0209849 | |||
| 2442 | Ga0495674_1152207 | |||
| 2443 | Ga0495672_0004900 | |||
| 2444 | Ga0495672_0007339 | |||
| 2445 | Ga0495672_0262907 | |||
| 2446 | Ga0495676_0004842 | |||
| 2447 | Ga0495676_0102422 | |||
| 2448 | Ga0495676_0191191 | |||
| 2449 | Ga0495676_0570314 | |||
| 2450 | Ga0495676_0883386 | |||
| 2451 | Ga0495680_0000629 | |||
| 2452 | Ga0495680_0001777 | |||
| 2453 | Ga0495675_0436657 | |||
| 2454 | Ga0495679_021080 | |||
| 2455 | Ga0495679_044695 | |||
| 2456 | Ga0495673_0024900 | |||
| 2457 | Ga0495684_0125228 | |||
| 2458 | Ga0495686_0039936 | |||
| 2459 | Ga0495686_0397735 | |||
| 2460 | Ga0495593_0177251 | |||
| 2461 | Ga0495602_0086632 | |||
| 2462 | Ga0495614_0433220 | |||
| 2463 | Ga0495614_0614142 | |||
| 2464 | Ga0496100_0000450 | |||
| 2465 | Ga0496100_0047684 | |||
| 2466 | Ga0496100_0074112 | |||
| 2467 | Ga0496100_0082586 | |||
| 2468 | Ga0496100_0135818 | |||
| 2469 | Ga0496100_0367493 | |||
| 2470 | Ga0496100_0789747 | |||
| 2471 | Ga0496100_1350765 | |||
| 2472 | Ga0496101_0001032 | |||
| 2473 | Ga0496101_0029096 | |||
| 2474 | Ga0496101_0034118 | |||
| 2475 | Ga0496101_0053422 | |||
| 2476 | Ga0496101_0061697 | |||
| 2477 | Ga0496101_0117980 | |||
| 2478 | Ga0496101_0142889 | |||
| 2479 | Ga0496101_0482658 | |||
| 2480 | Ga0496101_0764986 | |||
| 2481 | Ga0496102_0000061 | |||
| 2482 | Ga0496102_0038908 | |||
| 2483 | Ga0496102_0127354 | |||
| 2484 | Ga0496102_0170340 | |||
| 2485 | Ga0496102_0244991 | |||
| 2486 | Ga0496102_1076791 | |||
| 2487 | Ga0496102_1361787 | |||
| 2488 | Ga0496102_1460653 | |||
| 2489 | Ga0496103_0000044 | |||
| 2490 | Ga0496103_0114540 | |||
| 2491 | Ga0496103_0136659 | |||
| 2492 | Ga0496104_0000120 | |||
| 2493 | Ga0496104_0000491 | |||
| 2494 | Ga0496104_0003288 | |||
| 2495 | Ga0496104_0046280 | |||
| 2496 | Ga0496104_0234435 | |||
| 2497 | Ga0496104_0247550 | |||
| 2498 | Ga0496104_0412589 | |||
| 2499 | Ga0496104_0463361 | |||
| 2500 | Ga0496104_0584198 | |||
| 2501 | Ga0496104_0740285 | |||
| 2502 | Ga0496105_0000020 | |||
| 2503 | Ga0496105_0002659 | |||
| 2504 | Ga0496105_0003897 | |||
| 2505 | Ga0496105_0020754 | |||
| 2506 | Ga0496105_0166499 | |||
| 2507 | Ga0496105_0357502 | |||
| 2508 | Ga0496105_0974774 | |||
| 2509 | Ga0496106_0000015 | |||
| 2510 | Ga0496106_0015185 | |||
| 2511 | Ga0496106_0043221 | |||
| 2512 | Ga0496106_0084492 | |||
| 2513 | Ga0496106_0150881 | |||
| 2514 | Ga0496106_0367544 | |||
| 2515 | Ga0496106_0430469 | |||
| 2516 | Ga0496106_0776867 | |||
| 2517 | Ga0496106_1008441 | |||
| 2518 | Ga0496107_0014349 | |||
| 2519 | Ga0496107_0087516 | |||
| 2520 | Ga0496107_0144142 | |||
| 2521 | Ga0496107_0364536 | |||
| 2522 | Ga0496107_0424583 | |||
| 2523 | Ga0496107_0563255 | |||
| 2524 | Ga0496108_0000032 | |||
| 2525 | Ga0496108_0000163 | |||
| 2526 | Ga0496108_0002529 | |||
| 2527 | Ga0496108_0014954 | |||
| 2528 | Ga0496108_0070149 | |||
| 2529 | Ga0496108_0101793 | |||
| 2530 | Ga0496108_0125256 | |||
| 2531 | Ga0496108_0143340 | |||
| 2532 | Ga0496108_0178988 | |||
| 2533 | Ga0496108_0293128 | |||
| 2534 | Ga0496108_0378806 | |||
| 2535 | Ga0496108_1145395 | |||
| 2536 | Ga0496108_1400878 | |||
| 2537 | Ga0496109_0000070 | |||
| 2538 | Ga0496109_0000103 | |||
| 2539 | Ga0496109_0002349 | |||
| 2540 | Ga0496109_0002676 | |||
| 2541 | Ga0496109_0024049 | |||
| 2542 | Ga0496109_0102683 | |||
| 2543 | Ga0496109_0151626 | |||
| 2544 | Ga0496109_0385333 | |||
| 2545 | Ga0496109_0511542 | |||
| 2546 | Ga0496109_0577560 | |||
| 2547 | Ga0496109_0945868 | |||
| 2548 | Ga0496110_0001092 | |||
| 2549 | Ga0496110_0007172 | |||
| 2550 | Ga0496110_0009962 | |||
| 2551 | Ga0496110_0024180 | |||
| 2552 | Ga0496110_0034541 | |||
| 2553 | Ga0496110_0040324 | |||
| 2554 | Ga0496110_0517512 | |||
| 2555 | Ga0496110_0834613 | |||
| 2556 | Ga0496110_1489469 | |||
| 2557 | Ga0496110_1652290 | |||
| 2558 | Ga0496111_0003080 | |||
| 2559 | Ga0496111_0005147 | |||
| 2560 | Ga0496111_0023858 | |||
| 2561 | Ga0496111_0031475 | |||
| 2562 | Ga0496111_0107662 | |||
| 2563 | Ga0496111_0132587 | |||
| 2564 | Ga0496111_0224202 | |||
| 2565 | Ga0496111_0448869 | |||
| 2566 | Ga0496111_0635762 | |||
| 2567 | Ga0496111_0798772 | |||
| 2568 | Ga0496111_1085098 | |||
| 2569 | Ga0496112_0000003 | |||
| 2570 | Ga0496112_0003041 | |||
| 2571 | Ga0496112_0027770 | |||
| 2572 | Ga0496112_0068959 | |||
| 2573 | Ga0496112_0121010 | |||
| 2574 | Ga0496112_0134840 | |||
| 2575 | Ga0496112_0187828 | |||
| 2576 | Ga0496112_0243063 | |||
| 2577 | Ga0496112_0378249 | |||
| 2578 | Ga0496112_0508388 | |||
| 2579 | Ga0496112_0573377 | |||
| 2580 | Ga0496112_0717903 | |||
| 2581 | Ga0496112_1069460 | |||
| 2582 | Ga0496113_0020338 | |||
| 2583 | Ga0496113_0032580 | |||
| 2584 | Ga0496113_0166476 | |||
| 2585 | Ga0496113_0186950 | |||
| 2586 | Ga0496113_0231172 | |||
| 2587 | Ga0496113_0263845 | |||
| 2588 | Ga0496113_0359280 | |||
| 2589 | Ga0496113_0416127 | |||
| 2590 | Ga0496113_1017395 | |||
| 2591 | Ga0496114_0000042 | |||
| 2592 | Ga0496114_0064533 | |||
| 2593 | Ga0496114_0527235 | |||
| 2594 | Ga0496115_0003718 | |||
| 2595 | Ga0496115_0013924 | |||
| 2596 | Ga0496115_0015952 | |||
| 2597 | Ga0496115_0236215 | |||
| 2598 | Ga0496115_0322849 | |||
| 2599 | Ga0496115_0797543 | |||
| 2600 | Ga0496117_0505509 | |||
| 2601 | Ga0496118_0130124 | |||
| 2602 | Ga0496121_0001938 | |||
| 2603 | Ga0496121_0008540 | |||
| 2604 | Ga0496122_0001068 | |||
| 2605 | Ga0496122_0290199 | |||
| 2606 | Ga0496123_0000612 | |||
| 2607 | Ga0496124_0008131 | |||
| 2608 | Ga0496124_0055890 | |||
| 2609 | Ga0496124_0616402 | |||
| 2610 | Ga0496125_0026961 | |||
| 2611 | Ga0496125_0108206 | |||
| 2612 | Ga0496126_0497771 | |||
| 2613 | Ga0501031_0014435 | |||
| 2614 | Ga0501031_0837118 | |||
| 2615 | Ga0501032_0001522 | |||
| 2616 | Ga0501032_0004746 | |||
| 2617 | Ga0501032_0192389 | |||
| 2618 | Ga0501033_0078143 | |||
| 2619 | Ga0501033_0575292 | |||
| 2620 | Ga0501033_0911689 | |||
| 2621 | Ga0501034_0019380 | |||
| 2622 | Ga0501034_0103350 | |||
| 2623 | Ga0501034_0263058 | |||
| 2624 | Ga0501036_0007434 | |||
| 2625 | Ga0501036_0037378 | |||
| 2626 | Ga0501036_0510427 | |||
| 2627 | Ga0501036_0658725 | |||
| 2628 | Ga0501036_0673316 | |||
| 2629 | Ga0501037_0127650 | |||
| 2630 | Ga0501037_0235202 | |||
| 2631 | Ga0501038_0001100 | |||
| 2632 | Ga0501038_0005589 | |||
| 2633 | Ga0501038_0050225 | |||
| 2634 | Ga0501039_0013047 | |||
| 2635 | Ga0501039_0525473 | |||
| 2636 | Ga0501041_0625903 | |||
| 2637 | Ga0501042_0144336 | |||
| 2638 | Ga0501042_0194993 | |||
| 2639 | Ga0501042_0199640 | |||
| 2640 | Ga0501042_0298678 | |||
| 2641 | Ga0501042_0401375 | |||
| 2642 | Ga0501043_0005179 | |||
| 2643 | Ga0501043_0012976 | |||
| 2644 | Ga0501043_0025123 | |||
| 2645 | Ga0501046_0002368 | |||
| 2646 | Ga0501046_0012323 | |||
| 2647 | Ga0501046_0012522 | |||
| 2648 | Ga0501046_0298547 | |||
| 2649 | Ga0501046_0872874 | |||
| 2650 | Ga0501047_0006447 | |||
| 2651 | Ga0501047_0181264 | |||
| 2652 | Ga0501048_0005421 | |||
| 2653 | Ga0501048_0163388 | |||
| 2654 | Ga0501067_0025255 | |||
| 2655 | Ga0501067_0078248 | |||
| 2656 | Ga0501067_0317682 | |||
| 2657 | Ga0501067_0753197 | |||
| 2658 | Ga0501068_0004722 | |||
| 2659 | Ga0501068_0269569 | |||
| 2660 | Ga0501068_1180836 | |||
| 2661 | Ga0501069_0440527 | |||
| 2662 | Ga0501070_0011924 | |||
| 2663 | Ga0501070_0029444 | |||
| 2664 | Ga0501071_0109894 | |||
| 2665 | Ga0501071_0578877 | |||
| 2666 | Ga0501071_0704087 | |||
| 2667 | Ga0501072_0071156 | |||
| 2668 | Ga0501072_0132608 | |||
| 2669 | Ga0501073_0052911 | |||
| 2670 | Ga0501074_0040081 | |||
| 2671 | Ga0501074_0601872 | |||
| 2672 | Ga0501075_0031294 | |||
| 2673 | Ga0501076_0318513 | |||
| 2674 | Ga0501076_0872053 | |||
| 2675 | Ga0501077_0563014 | |||
| 2676 | Ga0501079_0254177 | |||
| 2677 | Ga0501079_0589608 | |||
| 2678 | Ga0501080_0031399 | |||
| 2679 | Ga0501080_1084344 | |||
| 2680 | Ga0501081_1293466 | |||
| 2681 | Ga0501081_1413857 | |||
| 2682 | Ga0501083_0001813 | |||
| 2683 | Ga0501083_0006354 | |||
| 2684 | Ga0501083_0495776 | |||
| 2685 | Ga0501035_0016754 | |||
| 2686 | Ga0501035_0022707 | |||
| 2687 | Ga0501035_0221186 | |||
| 2688 | Ga0501044_0012895 | |||
| 2689 | Ga0501044_0054417 | |||
| 2690 | Ga0501044_0104738 | |||
| 2691 | Ga0501045_0163035 | |||
| 2692 | Ga0501045_0866427 | |||
| 2693 | Ga0501045_1233153 | |||
| 2694 | nmdc:mga00v17_931005_c1 | |||
| 2695 | nmdc:mga0yw44_1206744_c1 | |||
| 2696 | nmdc:mga05p37_61854_c1 | |||
| 2697 | nmdc:mga0qj67_310560_c1 | |||
| 2698 | nmdc:mga0qj67_33320_c1 | |||
| 2699 | nmdc:mga0qj67_41059_c1 | |||
| 2700 | nmdc:mga0qj67_579578_c1 | |||
| 2701 | nmdc:mga06r32_1119477_c1 | |||
| 2702 | nmdc:mga06r32_1471980_c1 | |||
| 2703 | nmdc:mga06r32_1584828_c1 | |||
| 2704 | nmdc:mga08y16_2130592_c1 | |||
| 2705 | nmdc:mga08y16_351211_c1 | |||
| 2706 | nmdc:mga08y16_434368_c1 | |||
| 2707 | nmdc:mga08y16_69971_c1 | |||
| 2708 | nmdc:mga0n895_35025_c1 | |||
| 2709 | nmdc:mga0n895_413623_c1 | |||
| 2710 | nmdc:mga0n895_468742_c1 | |||
| 2711 | nmdc:mga0n895_731064_c1 | |||
| 2712 | nmdc:mga0rr50_862371_c1 | |||
| 2713 | nmdc:mga0rr50_918688_c1 | |||
| 2714 | nmdc:mga08x19_492455_c1 | |||
| 2715 | nmdc:mga0a205_245218_c1 | |||
| 2716 | nmdc:mga0a205_51936_c1 | |||
| 2717 | nmdc:mga0a205_916745_c1 | |||
| 2718 | Ga0495601_0001916 | |||
| 2719 | Ga0495601_0016065 | |||
| 2720 | Ga0495601_0079192 | |||
| 2721 | Ga0495601_0137704 | |||
| 2722 | Ga0495601_0206144 | |||
| 2723 | Ga0495601_0521708 | |||
| 2724 | Ga0495601_0797566 | |||
| 2725 | Ga0495612_0000116 | |||
| 2726 | Ga0495612_0001792 | |||
| 2727 | Ga0495612_0022179 | |||
| 2728 | Ga0495612_0077276 | |||
| 2729 | Ga0495655_0000003 | |||
| 2730 | Ga0495655_0023793 | |||
| 2731 | Ga0495655_0046624 | |||
| 2732 | Ga0495655_0169542 | |||
| 2733 | Ga0495655_0267853 | |||
| 2734 | Ga0495595_0299637 | |||
| 2735 | Ga0495595_0387991 | |||
| 2736 | Ga0495619_0000869 | |||
| 2737 | Ga0495619_0002049 | |||
| 2738 | Ga0495619_0014777 | |||
| 2739 | Ga0495619_0020518 | |||
| 2740 | Ga0500566_0011809 | |||
| 2741 | Ga0500641_0006228 | |||
| 2742 | Ga0500556_0000262 | |||
| 2743 | Ga0500614_001269 | |||
| 2744 | Ga0500628_000002 | |||
| 2745 | Ga0500559_0524027 | |||
| 2746 | Ga0500616_0003982 | |||
| 2747 | Ga0500616_0026966 | |||
| 2748 | Ga0501084_0135836 | |||
| 2749 | Ga0501084_0215179 | |||
| 2750 | Ga0501084_0233423 | |||
| 2751 | Ga0501084_0448362 | |||
| 2752 | Ga0501082_0007429 | |||
| 2753 | Ga0501082_0008662 | |||
| 2754 | Ga0466962_0021427 | |||
| 2755 | Ga0466962_0204233 | |||
| 2756 | Ga0466962_0634446 | |||
| 2757 | Ga0530510_1096421 | |||
| 2758 | 2774394956 | |||
| 2759 | 2804845657 | |||
| 2760 | 2809194195 | |||
| 2761 | 2812348944 | |||
| 2762 | 2867373123 | |||
| 2763 | 2891973309 | |||
| 2764 | 8025419673 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rwx-assembly1.cif.gz_A-2 | crystal structure of a zn-bound ridc1 variant in the presence of reductant | 0.9537 | 7 | 45 |
| 6ot8-assembly1.cif.gz_A | bimetallic hexameric cage design 4 (bmc4) from cytochrome cb562 | 0.9517 | 7 | 45 |
| 3tol-assembly2.cif.gz_C | crystal structure of an engineered cytochrome cb562 that forms 1d, zn-mediated coordination polymers | 0.9514 | 7 | 45 |
| 3m4c-assembly1.cif.gz_D | a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase | 0.9509 | 7 | 45 |
| 3iq6-assembly1.cif.gz_B | crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces | 0.9481 | 7 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qw1C00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9452 | 7 | 45 | 1.20.120.10 |
| 3u8pA02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9414 | 6 | 45 | 1.20.120.10 |
| 4u9dA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9205 | 7 | 45 | 1.20.120.10 |
| 5xtdk00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8849 | 4 | 82 | 1.10.287.3510 |
| af_P18934_2_96_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8673 | 2 | 95 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0HIU2-F1-model_v4 | Cation:proton antiporter | 0.9388 | 3 | 79 |
GO:0005886
GO:0015385 |
| AF-H5USQ3-F1-model_v4 | Putative PH adaptation potassium efflux system protein | 0.9292 | 3 | 81 |
GO:0005886
GO:0015075 |
| AF-A0A1F2VWW3-F1-model_v4 | Cation:proton antiporter | 0.9268 | 3 | 86 |
GO:0005886
GO:0015385 |
| AF-R6W0M8-F1-model_v4 | Na+/H+ antiporter MnhF component | 0.9242 | 3 | 86 |
GO:0005886
GO:0015385 |
| AF-A0A7G9G3V0-F1-model_v4 | Sodium:proton antiporter | 0.923 | 3 | 86 |
GO:0005886
GO:0015385 |