F493528

General Info

Members Datasets Scaffolds Average Seq Length
1382 997 2764 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3000135777|3000139708
Length 330
Sequence APFAPLSLKPRPRRKRRFSRLSPDTTTELCLDMSIQAIEDTKVKVFPAPPEPSKVIAFAPKARRRFDPLAILSKLAGTLLPPVVVIVLMLVVWQVACSSPTASLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGLAAIVGVALGALVGQSVWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPVIINTAVGVRNIPEDYRNVARILRLNQIEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGGVVTRGTTAK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
86 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
101 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
111 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
112 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
189 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
223 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
224 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
225 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
363 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
367 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
368 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
378 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
379 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
380 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
381 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
382 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
383 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
384 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
385 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
386 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
387 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
388 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
389 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
390 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
391 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
392 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
393 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
394 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
395 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
396 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
397 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
398 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
399 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
400 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
401 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
402 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
403 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
404 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
405 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
406 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
407 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
408 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
409 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
410 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
411 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
412 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
413 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
414 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
415 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
416 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
417 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
418 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
419 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
420 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
421 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
422 2519899620 Rhizobium sp. Pop5 Isolate Nodule
423 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
424 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
425 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
426 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
427 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
428 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
429 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
430 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
431 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
432 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
433 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
434 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
435 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
436 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
437 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
438 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
439 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
440 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
441 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
442 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
443 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
444 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
445 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
446 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
447 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
448 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
449 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
450 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
451 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
452 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
453 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
454 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
455 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
456 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
457 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
458 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
459 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
460 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
461 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
462 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
463 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
464 2643221568 Rhizobium sp. Root564 Isolate Unclassified
465 2643221582 Rhizobium sp. Root651 Isolate Unclassified
466 2643221607 Rhizobium sp. Root73 Isolate Unclassified
467 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
468 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
469 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
470 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
471 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
472 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
473 2643221693 Rhizobium sp. Root491 Isolate Unclassified
474 2643221719 Rhizobium sp. Root274 Isolate Unclassified
475 2643221734 Bosea sp. Root670 Isolate Unclassified
476 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
477 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
478 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
479 2718217882 Rhizobium sp. N741 Isolate Nodule
480 2718217927 Rhizobium sp. N324 Isolate Nodule
481 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
482 2718218009 Rhizobium sp. N561 Isolate Nodule
483 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
484 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
485 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
486 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
487 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
488 2718218363 Rhizobium sp. N113 Isolate Nodule
489 2718218365 Rhizobium sp. N731 Isolate Nodule
490 2718218366 Rhizobium sp. N621 Isolate Nodule
491 2718218423 Rhizobium sp. N941 Isolate Nodule
492 2721755514 Rhizobium sp. N6212 Isolate Nodule
493 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
494 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
495 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
496 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
497 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
498 2721755809 Rhizobium sp. N541 Isolate Nodule
499 2721755810 Rhizobium sp. N871 Isolate Nodule
500 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
501 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
502 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
503 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
504 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
505 2728369365 Rhizobium sp. N1341 Isolate Nodule
506 2728369397 Rhizobium sp. N1314 Isolate Nodule
507 2738541293 Rhizobium sp. GV031 Isolate Unclassified
508 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
509 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
510 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
511 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
512 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
513 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
514 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
515 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
516 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
517 2791355199
518 2791355256 Rhizobium sp. M10 Isolate Nodule
519 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
520 2791355260 Rhizobium sp. L9 Isolate Nodule
521 2791355261 Rhizobium sp. J15 Isolate Nodule
522 2791355262 Rhizobium sp. M1 Isolate Nodule
523 2791355263 Rhizobium chutanense C5 Isolate Nodule
524 2791355264 Rhizobium sp. S9 Isolate Nodule
525 2791355265 Rhizobium sp. H4 Isolate Nodule
526 2791355266 Rhizobium sp. L43 Isolate Nodule
527 2791355267 Rhizobium sp. L18 Isolate Nodule
528 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
529 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
530 2802429633 Rhizobium anhuiense J3 Isolate Nodule
531 2802429634 Rhizobium anhuiense S10 Isolate Nodule
532 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
533 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
534 2802429637 Rhizobium anhuiense C15 Isolate Nodule
535 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
536 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
537 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
538 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
539 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
540 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
541 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
542 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
543 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
544 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
545 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
546 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
547 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
548 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
549 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
550 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
551 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
552 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
553 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
554 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
555 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
556 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
557 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
558 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
559 2838048938 Rhizobium pisi 27/80 Isolate Nodule
560 2838061910 Rhizobium phaseoli L15 Isolate Nodule
561 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
562 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
563 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
564 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
565 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
566 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
567 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
568 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
569 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
570 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
571 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
572 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
573 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
574 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
575 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
576 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
577 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
578 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
579 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
580 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
581 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
582 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
583 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
584 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
585 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
586 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
587 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
588 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
589 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
590 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
591 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
592 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
593 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
594 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
595 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
596 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
597 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
598 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
599 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
600 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
601 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
602 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
603 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
604 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
605 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
606 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
607 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
608 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
609 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
610 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
611 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
612 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
613 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
614 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
615 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
616 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
617 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
618 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
619 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
620 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
621 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
622 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
623 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
624 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
625 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
626 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
627 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
628 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
629 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
630 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
631 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
632 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
633 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
634 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
635 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
636 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
637 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
638 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
639 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
640 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
641 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
642 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
643 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
644 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
645 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
646 2851182111 Bosea sp. Tri-44 Isolate Nodule
647 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
648 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
649 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
650 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
651 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
652 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
653 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
654 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
655 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
656 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
657 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
658 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
659 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
660 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
661 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
662 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
663 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
664 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
665 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
666 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
667 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
668 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
669 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
670 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
671 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
672 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
673 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
674 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
675 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
676 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
677 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
678 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
679 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
680 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
681 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
682 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
683 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
684 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
685 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
686 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
687 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
688 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
689 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
690 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
691 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
692 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
693 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
694 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
695 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
696 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
697 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
698 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
699 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
700 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
701 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
702 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
703 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
704 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
705 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
706 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
707 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
708 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
709 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
710 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
711 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
712 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
713 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
714 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
715 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
716 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
717 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
718 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
719 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
720 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
721 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
722 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
723 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
724 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
725 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
726 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
727 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
728 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
729 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
730 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
731 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
732 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
733 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
734 2904699407
735 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
736 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
737 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
738 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
739 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
740 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
741 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
742 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
743 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
744 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
745 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
746 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
747 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
748 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
749 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
750 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
751 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
752 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
753 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
754 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
755 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
756 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
757 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
758 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
759 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
760 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
761 2922368715
762 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
763 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
764 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
765 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
766 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
767 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
768 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
769 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
770 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
771 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
772 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
773 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
774 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
775 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
776 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
777 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
778 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
779 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
780 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
781 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
782 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
783 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
784 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
785 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
786 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
787 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
788 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
789 2933599457 Rhizobium phaseoli M3 Isolate Nodule
790 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
791 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
792 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
793 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
794 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
795 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
796 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
797 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
798 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
799 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
800 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
801 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
802 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
803 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
804 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
805 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
806 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
807 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
808 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
809 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
810 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
811 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
812 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
813 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
814 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
815 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
816 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
817 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
818 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
819 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
820 2936381700 Rhizobium chutanense C16 Isolate Unclassified
821 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
822 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
823 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
824 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
825 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
826 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
827 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
828 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
829 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
830 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
831 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
832 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
833 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
834 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
835 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
836 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
837 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
838 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
839 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
840 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
841 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
842 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
843 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
844 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
845 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
846 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
847 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
848 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
849 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
850 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
851 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
852 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
853 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
854 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
855 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
856 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
857 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
858 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
859 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
860 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
861 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
862 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
863 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
864 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
865 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
866 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
867 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
868 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
869 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
870 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
871 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
872 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
873 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
874 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
875 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
876 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
877 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
878 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
879 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
880 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
881 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
882 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
883 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
884 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
885 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
886 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
887 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
888 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
889 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
890 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
891 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
892 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
893 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
894 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
895 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
896 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
897 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
898 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
899 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
900 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
901 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
902 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
903 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
904 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
905 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
906 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
907 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
908 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
909 2996887358 Rhizobium sp. R711 Isolate Nodule
910 2996893221 Rhizobium sp. R635 Isolate Nodule
911 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
912 3004167301 Mesorhizobium loti 582 Isolate Unclassified
913 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
914 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
915 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
916 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
917 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
918 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
919 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
920 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
921 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
922 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
923 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
924 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
925 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
926 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
927 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
928 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
929 641522639 Methylobacterium sp. 4-46 Isolate Nodule
930 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
931 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
932 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
933 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
934 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
935 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
936 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
937 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
938 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
939 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
940 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
941 8005258706 Rhizobium sp. R693 Isolate Nodule
942 8005275841 Rhizobium sp. N4311 Isolate Nodule
943 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
944 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
945 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
946 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
947 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
948 8005321885 Rhizobium sp. R72 Isolate Nodule
949 8005382845 Rhizobium sp. R634 Isolate Nodule
950 8005395548 Rhizobium sp. R339 Isolate Nodule
951 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
952 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
953 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
954 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
955 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
956 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
957 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
958 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
959 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
960 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
961 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
962 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
963 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
964 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
965 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
966 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
967 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
968 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
969 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
970 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
971 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
972 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
973 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
974 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
975 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
976 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
977 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
978 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
979 8018176218 Rhizobium sp. N122 Isolate Nodule
980 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
981 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
982 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
983 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
984 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
985 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
986 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
987 8024501048 Rhizobium sp. H4 Isolate Nodule
988 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
989 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
990 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
991 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
992 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
993 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
994 8056382006 Rhizobium croatiense 13T Isolate Nodule
995 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
996 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
997 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.33
Metatranscriptomes 0
Isolates 44.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 17.08
Nodule 34.15
Rhizoplane 3.47
Rhizosphere 29.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000538 3300001979 Bacteria 16194
2 JGI25155J39150_1000056 3300002704 Bacteria 73160
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1001472 3300002737 Bacteria 12352
5 JGI25162J39368_1002141 3300002737 Bacteria 8281
6 JGI25154J39366_1000013 3300002738 Bacteria 268260
7 JGI25157J39369_1000099 3300002741 Bacteria 73678
8 JGI25157J39369_1000789 3300002741 Bacteria 16171
9 JGI25152J39213_1000256 3300002773 Bacteria 35313
10 JGI25152J39213_1002687 3300002773 Bacteria 6526
11 JGI25150J39212_1000501 3300002774 Bacteria 16267
12 JGI25151J46595_10000007 3300003187 Bacteria 411751
13 JGI25151J46595_10000166 3300003187 Bacteria 85475
14 JGI25151J46595_10001633 3300003187 Bacteria 14780
15 JGI25151J46595_10034603 3300003187 Bacteria 1930
16 JGI25406J46586_10002619 3300003203 Bacteria 8483
17 JGI25406J46586_10023243 3300003203 Bacteria 2452
18 JGI25165J46597_1001164 3300003214 Bacteria 16187
19 JGI25165J46597_1001468 3300003214 Bacteria 12294
20 JGI25153J46596_10000313 3300003215 Bacteria 35777
21 JGI25153J46596_10005646 3300003215 Bacteria 6534
22 JGI25153J46596_10007051 3300003215 Bacteria 5592
23 JGI25153J46596_10014527 3300003215 Bacteria 3268
24 JGI25153J46596_10018377 3300003215 Bacteria 2718
25 rootH1_10020516 3300003316 Bacteria 1867
26 JGI25160J50197_1010224 3300003354 Bacteria 3406
27 JGI25161J50226_1001176 3300003374 Bacteria 8615
28 JGI25404J52841_10001894 3300003659 Bacteria 3828
29 Ga0055526_1001232 3300003771 Bacteria 18382
30 Ga0055526_1001408 3300003771 Bacteria 17103
31 Ga0055526_1001712 3300003771 Bacteria 15279
32 Ga0055526_1003004 3300003771 Bacteria 11014
33 Ga0055526_1010710 3300003771 Bacteria 4230
34 Ga0055524_1000518 3300003775 Bacteria 29714
35 Ga0055524_1004966 3300003775 Bacteria 6030
36 Ga0055524_1007981 3300003775 Bacteria 4442
37 Ga0055524_1011428 3300003775 Bacteria 3473
38 Ga0055536_1015097 3300003781 Bacteria 2665
39 Ga0055528_1000067 3300003790 Bacteria 83853
40 Ga0055528_1000515 3300003790 Bacteria 30346
41 Ga0055540_1000131 3300003792 Bacteria 75615
42 Ga0055540_1012983 3300003792 Bacteria 2573
43 Ga0055531_10008117 3300003794 Bacteria 5594
44 Ga0055531_10010658 3300003794 Bacteria 4539
45 Ga0058692_1006972 3300003856 Bacteria 3042
46 Ga0055543_1001269 3300004625 Bacteria 10400
47 Ga0065165_1000853 3300005262 Bacteria 39889
48 Ga0065165_1001807 3300005262 Bacteria 21012
49 Ga0065165_1010313 3300005262 Bacteria 4056
50 Ga0065165_1012631 3300005262 Bacteria 3422
51 Ga0065165_1040556 3300005262 Bacteria 1387
52 Ga0070658_10018138 3300005327 Bacteria 5631
53 Ga0070658_10245760 3300005327 Bacteria 1518
54 Ga0070676_10082362 3300005328 Bacteria 1955
55 Ga0068869_100059708 3300005334 Bacteria 2793
56 Ga0070666_10039936 3300005335 Bacteria 3129
57 Ga0070680_100000827 3300005336 Bacteria 21866
58 Ga0070661_100162391 3300005344 Bacteria 1692
59 Ga0070668_100007882 3300005347 Bacteria 7907
60 Ga0070668_100235246 3300005347 Bacteria 1516
61 Ga0070668_100296586 3300005347 Bacteria 1355
62 Ga0070675_100356182 3300005354 Bacteria 1298
63 Ga0070671_100024365 3300005355 Bacteria 4953
64 Ga0070671_100073928 3300005355 Bacteria 2847
65 Ga0070671_100253244 3300005355 Bacteria 1496
66 Ga0070674_100097276 3300005356 Bacteria 2138
67 Ga0070674_100140987 3300005356 Bacteria 1809
68 Ga0070688_100111268 3300005365 Bacteria 1822
69 Ga0070667_100009165 3300005367 Bacteria 8194
70 Ga0070667_100377141 3300005367 Bacteria 1288
71 Ga0070713_100000526 3300005436 Bacteria 24268
72 Ga0070711_100027954 3300005439 Bacteria 3707
73 Ga0070711_100122903 3300005439 Bacteria 1923
74 Ga0070694_100046563 3300005444 Bacteria 2912
75 Ga0070708_100518268 3300005445 Bacteria 1124
76 Ga0070663_100398778 3300005455 Bacteria 1124
77 Ga0070681_10000681 3300005458 Bacteria 28134
78 Ga0070685_10201166 3300005466 Bacteria 1295
79 Ga0070706_100131498 3300005467 Bacteria 2335
80 Ga0070699_100130139 3300005518 Bacteria 2218
81 Ga0070679_100008706 3300005530 Bacteria 9566
82 Ga0068853_100195167 3300005539 Bacteria 1841
83 Ga0070686_100088230 3300005544 Bacteria 2069
84 Ga0070695_100014398 3300005545 Bacteria 4768
85 Ga0070665_100002095 3300005548 Bacteria 22353
86 Ga0070665_100005120 3300005548 Bacteria 13587
87 Ga0070665_100076453 3300005548 Bacteria 3355
88 Ga0070665_100084443 3300005548 Bacteria 3181
89 Ga0070665_100087923 3300005548 Bacteria 3113
90 Ga0070665_100341725 3300005548 Bacteria 1502
91 Ga0068855_100381886 3300005563 Bacteria 1547
92 Ga0068857_100112605 3300005577 Bacteria 2446
93 Ga0068856_100036031 3300005614 Bacteria 4852
94 Ga0068856_100159392 3300005614 Bacteria 2267
95 Ga0068859_100073860 3300005617 Bacteria 3448
96 Ga0068859_100162981 3300005617 Bacteria 2309
97 Ga0068864_100519544 3300005618 Bacteria 1148
98 Ga0068863_100210085 3300005841 Bacteria 1874
99 Ga0068862_100334261 3300005844 Bacteria 1402
100 Ga0081455_10007852 3300005937 Bacteria 11173
101 Ga0081455_10007920 3300005937 Bacteria 11119
102 Ga0081455_10009013 3300005937 Bacteria 10299
103 Ga0081455_10034510 3300005937 Bacteria 4531
104 Ga0081455_10048637 3300005937 Bacteria 3662
105 Ga0081538_10009799 3300005981 Bacteria 7929
106 Ga0081538_10075112 3300005981 Bacteria 1836
107 Ga0081540_1000620 3300005983 Bacteria 33727
108 Ga0081540_1009656 3300005983 Bacteria 6631
109 Ga0081540_1014865 3300005983 Bacteria 4956
110 Ga0081540_1019574 3300005983 Bacteria 4106
111 Ga0081539_10000220 3300005985 Bacteria 133834
112 Ga0081539_10002437 3300005985 Bacteria 26263
113 Ga0081539_10008096 3300005985 Bacteria 9295
114 Ga0070717_10000425 3300006028 Bacteria 27019
115 Ga0070717_10381551 3300006028 Bacteria 1264
116 Ga0075365_10011544 3300006038 Bacteria 5198
117 Ga0075365_10011946 3300006038 Bacteria 5131
118 Ga0075365_10017754 3300006038 Bacteria 4361
119 Ga0075365_10018335 3300006038 Bacteria 4303
120 Ga0075365_10022109 3300006038 Bacteria 3979
121 Ga0075365_10057514 3300006038 Bacteria 2587
122 Ga0075365_10154006 3300006038 Bacteria 1599
123 Ga0075368_10008690 3300006042 Bacteria 3629
124 Ga0075368_10018661 3300006042 Bacteria 2608
125 Ga0075368_10023143 3300006042 Bacteria 2370
126 Ga0075368_10071327 3300006042 Bacteria 1403
127 Ga0075368_10071757 3300006042 Bacteria 1399
128 Ga0075363_100004037 3300006048 Bacteria 6352
129 Ga0075363_100135547 3300006048 Bacteria 1383
130 Ga0075364_10026122 3300006051 Bacteria 3722
131 Ga0075364_10047814 3300006051 Bacteria 2788
132 Ga0075364_10106883 3300006051 Bacteria 1865
133 Ga0075364_10140011 3300006051 Bacteria 1627
134 Ga0070716_100002328 3300006173 Bacteria 8746
135 Ga0070716_100220925 3300006173 Bacteria 1273
136 Ga0070712_100077880 3300006175 Bacteria 2391
137 Ga0070712_100120014 3300006175 Bacteria 1977
138 Ga0075362_10012384 3300006177 Bacteria 3387
139 Ga0075362_10023553 3300006177 Bacteria 2605
140 Ga0075367_10002198 3300006178 Bacteria 8795
141 Ga0075367_10002330 3300006178 Bacteria 8638
142 Ga0075367_10029612 3300006178 Bacteria 3133
143 Ga0075367_10035948 3300006178 Bacteria 2870
144 Ga0075367_10036519 3300006178 Bacteria 2850
145 Ga0075367_10043320 3300006178 Bacteria 2636
146 Ga0075367_10150714 3300006178 Bacteria 1443
147 Ga0075367_10163874 3300006178 Bacteria 1383
148 Ga0075369_10013828 3300006186 Bacteria 3212
149 Ga0075369_10121883 3300006186 Bacteria 1181
150 Ga0075427_10001903 3300006194 Bacteria 2742
151 Ga0075366_10009512 3300006195 Bacteria 5426
152 Ga0075366_10011331 3300006195 Bacteria 5032
153 Ga0075366_10072866 3300006195 Bacteria 2047
154 Ga0075370_10003168 3300006353 Bacteria 7782
155 Ga0075370_10020067 3300006353 Bacteria 3647
156 Ga0075370_10024134 3300006353 Bacteria 3356
157 Ga0075370_10080226 3300006353 Bacteria 1875
158 Ga0075370_10123501 3300006353 Bacteria 1508
159 Ga0075370_10129962 3300006353 Bacteria 1469
160 Ga0075428_100005390 3300006844 Bacteria 14222
161 Ga0075428_100026013 3300006844 Bacteria 6481
162 Ga0075428_100030504 3300006844 Bacteria 5962
163 Ga0075428_100115849 3300006844 Bacteria 2919
164 Ga0075428_100143877 3300006844 Bacteria 2592
165 Ga0075430_100000140 3300006846 Bacteria 46272
166 Ga0075430_100166447 3300006846 Bacteria 1834
167 Ga0075431_100001318 3300006847 Bacteria 22699
168 Ga0075431_100158117 3300006847 Bacteria 2331
169 Ga0075431_100203657 3300006847 Bacteria 2024
170 Ga0075431_100372918 3300006847 Bacteria 1432
171 Ga0075431_100411232 3300006847 Bacteria 1353
172 Ga0075433_10000050 3300006852 Bacteria 50089
173 Ga0075434_100000179 3300006871 Bacteria 41085
174 Ga0075429_100001170 3300006880 Bacteria 21187
175 Ga0075429_100116506 3300006880 Bacteria 2335
176 Ga0097620_100073871 3300006931 Bacteria 3448
177 Ga0097620_100162996 3300006931 Bacteria 2309
178 Ga0099825_1021826 3300006941 Bacteria 4258
179 Ga0099824_1029608 3300006942 Bacteria 2309
180 Ga0099822_1005398 3300006943 Bacteria 16681
181 Ga0099823_1024510 3300006944 Bacteria 5451
182 Ga0079104_1000014 3300006946 Bacteria 337362
183 Ga0099826_10000297 3300006948 Bacteria 22278
184 Ga0099826_10095024 3300006948 Bacteria 1813
185 Ga0075435_100001211 3300007076 Bacteria 16537
186 Ga0105240_10002521 3300009093 Bacteria 29396
187 Ga0111539_10000565 3300009094 Bacteria 47399
188 Ga0111539_10010599 3300009094 Bacteria 11607
189 Ga0111539_10225523 3300009094 Bacteria 2183
190 Ga0111539_10235929 3300009094 Bacteria 2129
191 Ga0105245_10006247 3300009098 Bacteria 10481
192 Ga0105245_10203045 3300009098 Bacteria 1904
193 Ga0105245_10364746 3300009098 Bacteria 1434
194 Ga0105247_10086689 3300009101 Bacteria 1982
195 Ga0114129_10003182 3300009147 Bacteria 23025
196 Ga0114129_10085173 3300009147 Bacteria 4385
197 Ga0114129_10400906 3300009147 Bacteria 1808
198 Ga0114129_10502866 3300009147 Bacteria 1583
199 Ga0114129_10690294 3300009147 Bacteria 1313
200 Ga0105243_10018705 3300009148 Bacteria 5248
201 Ga0105243_10060918 3300009148 Bacteria 3016
202 Ga0105248_10285149 3300009177 Bacteria 1859
203 Ga0105248_10777425 3300009177 Bacteria 1081
204 Ga0105237_10073940 3300009545 Bacteria 3400
205 Ga0105237_10436622 3300009545 Bacteria 1315
206 Ga0105238_10068422 3300009551 Bacteria 3552
207 Ga0105238_10171507 3300009551 Bacteria 2146
208 Ga0105249_10197633 3300009553 Bacteria 1966
209 Ga0105249_10420514 3300009553 Bacteria 1370
210 Ga0123341_1000019 3300009765 Bacteria 80932
211 Ga0123342_1014594 3300009766 Bacteria 7436
212 Ga0123342_1021209 3300009766 Bacteria 4598
213 Ga0099796_10016009 3300010159 Bacteria 2205
214 Ga0099796_10058057 3300010159 Bacteria 1363
215 Ga0105246_10052627 3300011119 Bacteria 2799
216 Ga0157373_10103869 3300013100 Bacteria 1998
217 Ga0157373_10160983 3300013100 Bacteria 1579
218 Ga0157371_10000304 3300013102 Bacteria 64521
219 Ga0157370_10013708 3300013104 Bacteria 8334
220 Ga0157370_10065483 3300013104 Bacteria 3438
221 Ga0157374_10388413 3300013296 Bacteria 1391
222 Ga0157375_10423927 3300013308 Bacteria 1496
223 Ga0157376_10183948 3300014969 Bacteria 1912
224 Ga0214544_1000001 3300021320 Bacteria 783667
225 Ga0214542_1000037 3300021321 Bacteria 159256
226 Ga0214545_1000003 3300021324 Bacteria 720274
227 Ga0214543_1000002 3300021327 Bacteria 712733
228 Ga0213872_10068402 3300021361 Bacteria 1602
229 Ga0209435_100006 3300025206 Bacteria 542459
230 Ga0209437_100023 3300025233 Bacteria 614195
231 Ga0209437_100341 3300025233 Bacteria 56114
232 Ga0207425_1000018 3300025245 Bacteria 411841
233 Ga0207425_1006064 3300025245 Bacteria 3356
234 Ga0209646_1000015 3300025246 Bacteria 542459
235 Ga0209026_1000023 3300025250 Bacteria 357521
236 Ga0209026_1000046 3300025250 Bacteria 262031
237 Ga0209677_112928 3300025253 Bacteria 1212
238 Ga0209148_1003099 3300025254 Bacteria 4863
239 Ga0209759_1000005 3300025256 Bacteria 542459
240 Ga0209759_1001309 3300025256 Bacteria 14669
241 Ga0209759_1018812 3300025256 Bacteria 1660
242 Ga0209129_1000026 3300025258 Bacteria 411839
243 Ga0209129_1001183 3300025258 Bacteria 15019
244 Ga0209129_1002648 3300025258 Bacteria 8493
245 Ga0209129_1010344 3300025258 Bacteria 2338
246 Ga0209233_1000062 3300025261 Bacteria 399685
247 Ga0209233_1000970 3300025261 Bacteria 12354
248 Ga0209233_1001664 3300025261 Bacteria 8655
249 Ga0209233_1003296 3300025261 Bacteria 5727
250 Ga0209233_1007903 3300025261 Bacteria 3332
251 Ga0209673_1000005 3300025273 Bacteria 692788
252 Ga0209673_1000310 3300025273 Bacteria 89821
253 Ga0209673_1001376 3300025273 Bacteria 23910
254 Ga0209673_1018003 3300025273 Bacteria 2584
255 Ga0209673_1018699 3300025273 Bacteria 2510
256 Ga0209673_1022555 3300025273 Bacteria 2169
257 Ga0209673_1023198 3300025273 Bacteria 2120
258 Ga0209130_1000709 3300025284 Bacteria 29714
259 Ga0209675_1003671 3300025291 Bacteria 7172
260 Ga0209675_1010802 3300025291 Bacteria 3081
261 Ga0209675_1014261 3300025291 Bacteria 2429
262 Ga0209675_1023374 3300025291 Bacteria 1602
263 Ga0209025_1000035 3300025294 Bacteria 411841
264 Ga0209025_1000053 3300025294 Bacteria 317600
265 Ga0209025_1000397 3300025294 Bacteria 89703
266 Ga0209025_1002007 3300025294 Bacteria 23295
267 Ga0209025_1002687 3300025294 Bacteria 18144
268 Ga0209025_1007209 3300025294 Bacteria 8376
269 Ga0209025_1007433 3300025294 Bacteria 8170
270 Ga0209025_1010571 3300025294 Bacteria 6236
271 Ga0209564_1000137 3300025295 Bacteria 183874
272 Ga0209564_1000150 3300025295 Bacteria 170318
273 Ga0209564_1000191 3300025295 Bacteria 142504
274 Ga0209564_1000511 3300025295 Bacteria 63773
275 Ga0209564_1005137 3300025295 Bacteria 7603
276 Ga0209564_1006466 3300025295 Bacteria 6311
277 Ga0209564_1007023 3300025295 Bacteria 5905
278 Ga0209758_1000011 3300025297 Bacteria 1049685
279 Ga0209758_1000040 3300025297 Bacteria 411841
280 Ga0209758_1000477 3300025297 Bacteria 66111
281 Ga0209758_1000585 3300025297 Bacteria 56861
282 Ga0209758_1000662 3300025297 Bacteria 51542
283 Ga0209758_1001274 3300025297 Bacteria 31178
284 Ga0209758_1001596 3300025297 Bacteria 25926
285 Ga0209758_1002622 3300025297 Bacteria 17886
286 Ga0209758_1002716 3300025297 Bacteria 17425
287 Ga0209758_1004840 3300025297 Bacteria 10864
288 Ga0209758_1005670 3300025297 Bacteria 9445
289 Ga0209758_1013489 3300025297 Bacteria 4449
290 Ga0209758_1023161 3300025297 Bacteria 2818
291 Ga0209050_1001525 3300025298 Bacteria 24412
292 Ga0209256_1000108 3300025299 Bacteria 185884
293 Ga0209256_1000243 3300025299 Bacteria 96714
294 Ga0209256_1000740 3300025299 Bacteria 42806
295 Ga0209256_1003072 3300025299 Bacteria 12269
296 Ga0209256_1003322 3300025299 Bacteria 11411
297 Ga0209256_1005504 3300025299 Bacteria 7245
298 Ga0209256_1008896 3300025299 Bacteria 4532
299 Ga0207426_1000198 3300025302 Bacteria 146241
300 Ga0207426_1000292 3300025302 Bacteria 99342
301 Ga0207426_1000355 3300025302 Bacteria 83450
302 Ga0207426_1003205 3300025302 Bacteria 9213
303 Ga0207426_1057592 3300025302 Bacteria 1130
304 Ga0209051_1000038 3300025303 Bacteria 320926
305 Ga0209051_1002277 3300025303 Bacteria 14058
306 Ga0209051_1002823 3300025303 Bacteria 11969
307 Ga0209051_1037393 3300025303 Bacteria 1780
308 Ga0209257_1000654 3300025304 Bacteria 54783
309 Ga0209257_1008917 3300025304 Bacteria 5523
310 Ga0209257_1012956 3300025304 Bacteria 3772
311 Ga0207655_1047574 3300025728 Bacteria 1769
312 Ga0207713_1038563 3300025735 Bacteria 2026
313 Ga0207710_10033864 3300025900 Bacteria 2242
314 Ga0207710_10117633 3300025900 Bacteria 1267
315 Ga0207680_10027354 3300025903 Bacteria 3174
316 Ga0207647_10019881 3300025904 Bacteria 4509
317 Ga0207645_10072761 3300025907 Bacteria 2201
318 Ga0207705_10008204 3300025909 Bacteria 7641
319 Ga0207705_10323885 3300025909 Bacteria 1184
320 Ga0207707_10014526 3300025912 Bacteria 6857
321 Ga0207695_10055812 3300025913 Bacteria 4114
322 Ga0207671_10008285 3300025914 Bacteria 8839
323 Ga0207693_10005998 3300025915 Bacteria 10074
324 Ga0207693_10022689 3300025915 Bacteria 4987
325 Ga0207693_10087797 3300025915 Bacteria 2437
326 Ga0207663_10040021 3300025916 Bacteria 2846
327 Ga0207662_10033751 3300025918 Bacteria 2985
328 Ga0207652_10039117 3300025921 Bacteria 4024
329 Ga0207681_10091151 3300025923 Bacteria 2177
330 Ga0207694_10047057 3300025924 Bacteria 3336
331 Ga0207650_10127444 3300025925 Bacteria 1988
332 Ga0207687_10009010 3300025927 Bacteria 6523
333 Ga0207687_10116915 3300025927 Bacteria 1988
334 Ga0207700_10001358 3300025928 Bacteria 13877
335 Ga0207644_10014803 3300025931 Bacteria 5228
336 Ga0207644_10150474 3300025931 Bacteria 1800
337 Ga0207686_10129469 3300025934 Bacteria 1729
338 Ga0207709_10031822 3300025935 Bacteria 3084
339 Ga0207670_10041485 3300025936 Bacteria 3027
340 Ga0207665_10000837 3300025939 Bacteria 20779
341 Ga0207711_10051640 3300025941 Bacteria 3522
342 Ga0207711_10187050 3300025941 Bacteria 1886
343 Ga0207689_10068552 3300025942 Bacteria 2915
344 Ga0207689_10071966 3300025942 Bacteria 2840
345 Ga0207689_10101561 3300025942 Bacteria 2362
346 Ga0207667_10011494 3300025949 Bacteria 10284
347 Ga0207712_10063367 3300025961 Bacteria 2632
348 Ga0207668_10172844 3300025972 Bacteria 1696
349 Ga0207658_10089841 3300025986 Bacteria 2379
350 Ga0207703_10077531 3300026035 Bacteria 2759
351 Ga0207703_10090163 3300026035 Bacteria 2576
352 Ga0207639_10120702 3300026041 Bacteria 2153
353 Ga0207639_10159169 3300026041 Bacteria 1901
354 Ga0207678_10091910 3300026067 Bacteria 2594
355 Ga0207678_10448528 3300026067 Bacteria 1121
356 Ga0207708_10036315 3300026075 Bacteria 3752
357 Ga0207702_10025869 3300026078 Bacteria 4872
358 Ga0207702_10286621 3300026078 Bacteria 1559
359 Ga0207674_10135330 3300026116 Bacteria 2426
360 Ga0207683_10039324 3300026121 Bacteria 4126
361 Ga0207698_10476688 3300026142 Bacteria 1210
362 Ga0209281_1000032 3300027111 Bacteria 401727
363 Ga0209389_1000014 3300027296 Bacteria 188621
364 Ga0209389_1000077 3300027296 Bacteria 91273
365 Ga0209371_1000035 3300027312 Bacteria 368979
366 Ga0209371_1000135 3300027312 Bacteria 121718
367 Ga0209371_1000703 3300027312 Bacteria 28337
368 Ga0209371_1004170 3300027312 Bacteria 6449
369 Ga0209589_1000011 3300027357 Bacteria 236981
370 Ga0209589_1000020 3300027357 Bacteria 188617
371 Ga0209489_100012 3300027361 Bacteria 236981
372 Ga0209489_100251 3300027361 Bacteria 91273
373 Ga0209489_102003 3300027361 Bacteria 41928
374 Ga0209700_100019 3300027363 Bacteria 236981
375 Ga0209700_100271 3300027363 Bacteria 91215
376 Ga0209282_1001209 3300027666 Bacteria 13945
377 Ga0209282_1076496 3300027666 Bacteria 1802
378 Ga0209588_1017885 3300027671 Bacteria 2203
379 Ga0209813_10003425 3300027866 Bacteria 3712
380 Ga0209813_10005539 3300027866 Bacteria 3070
381 Ga0207428_10000485 3300027907 Bacteria 47761
382 Ga0207428_10078186 3300027907 Bacteria 2589
383 Ga0207428_10128621 3300027907 Bacteria 1939
384 Ga0268266_10013114 3300028379 Bacteria 7146
385 Ga0268266_10023772 3300028379 Bacteria 5215
386 Ga0268266_10125650 3300028379 Bacteria 2288
387 Ga0268266_10130106 3300028379 Bacteria 2250
388 Ga0268266_10131120 3300028379 Bacteria 2242
389 Ga0268266_10454598 3300028379 Bacteria 1218
390 Ga0268265_10157703 3300028380 Bacteria 1923
391 Ga0307517_10000386 3300028786 Bacteria 75442
392 Ga0307515_10001947 3300028794 Bacteria 45737
393 Ga0307515_10025212 3300028794 Bacteria 10304
394 Ga0307515_10068995 3300028794 Bacteria 4844
395 Ga0307515_10190817 3300028794 Bacteria 1960
396 Ga0268256_1000037 3300030500 Bacteria 367024
397 Ga0268256_1000148 3300030500 Bacteria 94347
398 Ga0268256_1003172 3300030500 Bacteria 7645
399 Ga0268256_1004304 3300030500 Bacteria 5951
400 Ga0316181_1153204 3300030744 Bacteria 1989
401 Ga0307513_10066256 3300031456 Bacteria 3796
402 Ga0307513_10131730 3300031456 Bacteria 2445
403 Ga0307509_10433490 3300031507 Bacteria 1012
404 Ga0307508_10093724 3300031616 Bacteria 2593
405 Ga0307514_10216527 3300031649 Bacteria 1181
406 Ga0265314_10002234 3300031711 Bacteria 20137
407 Ga0265342_10035892 3300031712 Bacteria 3031
408 Ga0307516_10091312 3300031730 Bacteria 2873
409 Ga0307405_10002301 3300031731 Bacteria 8376
410 Ga0307413_10064463 3300031824 Bacteria 2277
411 Ga0307406_10078984 3300031901 Bacteria 2181
412 Ga0307406_10285295 3300031901 Bacteria 1261
413 Ga0307407_10109960 3300031903 Bacteria 1728
414 Ga0307412_10311584 3300031911 Bacteria 1248
415 Ga0307409_100119217 3300031995 Bacteria 2230
416 Ga0307416_100082885 3300032002 Bacteria 2718
417 Ga0307414_10044225 3300032004 Bacteria 3039
418 Ga0307414_10087796 3300032004 Bacteria 2299
419 Ga0307414_10095536 3300032004 Bacteria 2221
420 Ga0307411_10093942 3300032005 Bacteria 2101
421 Ga0307411_10118561 3300032005 Bacteria 1910
422 Ga0307415_100068432 3300032126 Bacteria 2485
423 Ga0307510_10045610 3300033180 Bacteria 4727
424 Ga0315911_1000003 3300033442 Bacteria 502217
425 Ga0373932_0038383 3300035112 Bacteria 1369
426 Ga0373939_0002189 3300035114 Bacteria 4634
427 Ga0373960_0003305 3300035121 Bacteria 3649
428 Ga0373931_0002261 3300035691 Bacteria 8511
429 Ga0373931_0010721 3300035691 Bacteria 4412
430 Ga0373931_0038360 3300035691 Bacteria 2505
431 Ga0373927_0109363 3300035695 Bacteria 1801
432 Ga0373937_0148376 3300036401 Bacteria 2196
433 Ga0373925_0152005 3300037068 Bacteria 1818
434 Ga0395898_0483238 3300037466 Bacteria 1178
435 Ga0395905_0002940 3300037471 Bacteria 18526
436 Ga0395905_0010005 3300037471 Bacteria 9243
437 Ga0436361_0285992 3300039447 Bacteria 2381
438 Ga0439436_0017499 3300041404 Bacteria 2144
439 Ga0451833_0340930 3300041491 Bacteria 2025
440 Ga0451839_0143081 3300041496 Bacteria 1815
441 Ga0451845_0454358 3300041501 Bacteria 1975
442 Ga0451847_0186492 3300041503 Bacteria 2778
443 Ga0451849_0091961 3300041505 Bacteria 1677
444 Ga0451851_0082640 3300041507 Bacteria 2073
445 Ga0451843_0039079 3300041509 Bacteria 2411
446 Ga0451853_1011766 3300041512 Bacteria 1153
447 Ga0439431_0035001 3300041997 Bacteria 1261
448 Ga0439432_042969 3300042006 Bacteria 1428
449 Ga0439452_027434 3300042010 Bacteria 1429
450 Ga0439462_0027554 3300042015 Bacteria 1500
451 Ga0439463_042250 3300042016 Bacteria 1159
452 Ga0450906_022453 3300042145 Bacteria 1125
453 Ga0439464_0005917 3300042439 Bacteria 3178
454 Ga0439464_0011374 3300042439 Bacteria 2357
455 Ga0466972_0000113 3300044658 Bacteria 69042
456 Ga0466972_0022304 3300044658 Bacteria 3153
457 Ga0466966_0274186 3300044684 Bacteria 1015
458 Ga0466963_0008496 3300044694 Bacteria 6156
459 Ga0466964_0016443 3300044706 Bacteria 2826
460 Ga0466968_0000931 3300044735 Bacteria 10307
461 Ga0466970_0000129 3300044765 Bacteria 34329
462 Ga0466970_0187647 3300044765 Bacteria 1148
463 Ga0466957_0081268 3300044842 Bacteria 2018
464 Ga0466957_0140093 3300044842 Bacteria 1558
465 Ga0466960_0026578 3300044901 Bacteria 2631
466 Ga0466959_0113087 3300045049 Bacteria 1936
467 Ga0466958_0047489 3300045836 Bacteria 2592
468 Ga0466967_0116352 3300045976 Bacteria 2463
469 Ga0495603_0009391 3300046455 Bacteria 5910
470 Ga0495629_0004287 3300046459 Bacteria 10692
471 Ga0495638_0002696 3300046460 Bacteria 14292
472 Ga0495638_0059304 3300046460 Bacteria 2370
473 Ga0495638_0061881 3300046460 Bacteria 2311
474 Ga0495638_0179994 3300046460 Bacteria 1207
475 Ga0495641_0039292 3300046461 Bacteria 2207
476 Ga0495641_0084849 3300046461 Bacteria 1418
477 Ga0495651_0017446 3300046462 Bacteria 5559
478 Ga0495651_0138161 3300046462 Bacteria 1771
479 Ga0495653_0012380 3300046463 Bacteria 6963
480 Ga0495605_0016951 3300046474 Bacteria 3934
481 Ga0495585_0019507 3300046492 Bacteria 3909
482 Ga0495585_0024557 3300046492 Bacteria 3455
483 Ga0495585_0089445 3300046492 Bacteria 1660
484 Ga0495596_0027468 3300046500 Bacteria 2288
485 Ga0495583_0024494 3300046506 Bacteria 3032
486 Ga0495583_0079975 3300046506 Bacteria 1421
487 Ga0495606_0000196 3300046507 Bacteria 105765
488 Ga0495606_0001140 3300046507 Bacteria 37797
489 Ga0495631_0011407 3300046518 Bacteria 4370
490 Ga0495631_0063652 3300046518 Bacteria 1597
491 Ga0495632_0016742 3300046519 Bacteria 4067
492 Ga0495632_0032562 3300046519 Bacteria 2684
493 Ga0495637_0130553 3300046520 Bacteria 960
494 Ga0495643_0067174 3300046522 Bacteria 1890
495 Ga0495648_0016438 3300046524 Bacteria 5337
496 Ga0495648_0020584 3300046524 Bacteria 4595
497 Ga0495648_0192713 3300046524 Bacteria 1027
498 Ga0495654_0000063 3300046530 Bacteria 128630
499 Ga0495609_0099290 3300046538 Bacteria 1262
500 Ga0495622_0030645 3300046557 Bacteria 2513
501 Ga0495667_0077911 3300046559 Bacteria 2155
502 Ga0495656_0012565 3300046615 Bacteria 3129
503 Ga0495656_0187407 3300046615 Bacteria 1020
504 Ga0495668_0052938 3300046616 Bacteria 2245
505 Ga0495668_0154984 3300046616 Bacteria 1254
506 Ga0495611_0015229 3300046648 Bacteria 3288
507 Ga0495625_0021115 3300046660 Bacteria 5018
508 Ga0495635_0006167 3300046663 Bacteria 8355
509 Ga0495659_0015392 3300046664 Bacteria 2514
510 Ga0495659_0068205 3300046664 Bacteria 1328
511 Ga0495661_0000030 3300046665 Bacteria 171980
512 Ga0495661_0165995 3300046665 Bacteria 1181
513 Ga0495588_0011793 3300046674 Bacteria 4112
514 Ga0495657_0014577 3300046675 Bacteria 5768
515 Ga0495657_0079707 3300046675 Bacteria 2120
516 Ga0495646_0128852 3300046680 Bacteria 1426
517 Ga0495624_0193715 3300046690 Bacteria 1236
518 Ga0495670_0049448 3300046691 Bacteria 2104
519 Ga0495671_0058046 3300046692 Bacteria 1915
520 Ga0495671_0104843 3300046692 Bacteria 1381
521 Ga0495649_0000288 3300046694 Bacteria 44617
522 Ga0495600_0126975 3300046809 Bacteria 1659
523 Ga0495581_0042551 3300047315 Bacteria 2629
524 Ga0495604_0009755 3300047317 Bacteria 7595
525 Ga0495604_0011995 3300047317 Bacteria 6890
526 Ga0495674_0269825 3300047319 Bacteria 1396
527 Ga0495672_0012863 3300047320 Bacteria 5808
528 Ga0495672_0049801 3300047320 Bacteria 2477
529 Ga0495672_0078158 3300047320 Bacteria 1852
530 Ga0495676_0017023 3300047321 Bacteria 6435
531 Ga0495676_0028770 3300047321 Bacteria 4741
532 Ga0495683_0000018 3300047323 Bacteria 185871
533 Ga0495673_0097508 3300047469 Bacteria 1193
534 Ga0495686_0133206 3300047472 Bacteria 1472
535 Ga0495602_0244103 3300048088 Bacteria 1342
536 Ga0496100_0017973 3300048903 Bacteria 4185
537 Ga0496100_0246446 3300048903 Bacteria 1320
538 Ga0496101_0002506 3300048904 Bacteria 11287
539 Ga0496101_0084746 3300048904 Bacteria 2347
540 Ga0496101_0293806 3300048904 Bacteria 1272
541 Ga0496102_0118582 3300048905 Bacteria 2470
542 Ga0496102_0120234 3300048905 Bacteria 2453
543 Ga0496102_0139154 3300048905 Bacteria 2275
544 Ga0496104_0001254 3300048907 Bacteria 21878
545 Ga0496104_0159198 3300048907 Bacteria 2166
546 Ga0496104_0315146 3300048907 Bacteria 1477
547 Ga0496105_0030374 3300048908 Bacteria 4428
548 Ga0496105_0061087 3300048908 Bacteria 3109
549 Ga0496105_0075113 3300048908 Bacteria 2791
550 Ga0496105_0195109 3300048908 Bacteria 1654
551 Ga0496106_0032006 3300048909 Bacteria 3920
552 Ga0496106_0039230 3300048909 Bacteria 3547
553 Ga0496106_0040480 3300048909 Bacteria 3490
554 Ga0496106_0084026 3300048909 Bacteria 2449
555 Ga0496107_0019239 3300048910 Bacteria 4817
556 Ga0496108_0101013 3300048911 Bacteria 2460
557 Ga0496108_0429083 3300048911 Bacteria 1154
558 Ga0496109_0033706 3300048912 Bacteria 4608
559 Ga0496109_0064980 3300048912 Bacteria 3340
560 Ga0496109_0143700 3300048912 Bacteria 2231
561 Ga0496109_0202435 3300048912 Bacteria 1867
562 Ga0496110_0035179 3300048913 Bacteria 4344
563 Ga0496110_0372551 3300048913 Bacteria 1301
564 Ga0496112_0015338 3300048915 Bacteria 7145
565 Ga0496112_0043464 3300048915 Bacteria 4399
566 Ga0496112_0323276 3300048915 Bacteria 1487
567 Ga0496112_0401976 3300048915 Bacteria 1309
568 Ga0496113_0042834 3300048916 Bacteria 3346
569 Ga0496113_0476842 3300048916 Bacteria 1002
570 Ga0496114_0037868 3300048917 Bacteria 3990
571 Ga0496114_0195087 3300048917 Bacteria 1772
572 Ga0496114_0392131 3300048917 Bacteria 1230
573 Ga0496114_0576165 3300048917 Bacteria 993
574 Ga0496115_0005702 3300048918 Bacteria 9062
575 Ga0496115_0098103 3300048918 Bacteria 2399
576 Ga0496116_0000167 3300048919 Bacteria 132540
577 Ga0496116_0009413 3300048919 Bacteria 8328
578 Ga0496116_0011068 3300048919 Bacteria 7505
579 Ga0496116_0012692 3300048919 Bacteria 6854
580 Ga0496116_0047130 3300048919 Bacteria 2903
581 Ga0496116_0107045 3300048919 Bacteria 1654
582 Ga0496116_0149098 3300048919 Bacteria 1302
583 Ga0496117_0000052 3300048920 Bacteria 280463
584 Ga0496117_0008030 3300048920 Bacteria 10116
585 Ga0496117_0009706 3300048920 Bacteria 8895
586 Ga0496117_0068125 3300048920 Bacteria 2404
587 Ga0496117_0074519 3300048920 Bacteria 2259
588 Ga0496117_0185523 3300048920 Bacteria 1191
589 Ga0496118_0018034 3300048921 Bacteria 6392
590 Ga0496118_0094285 3300048921 Bacteria 2047
591 Ga0496118_0190535 3300048921 Bacteria 1227
592 Ga0496119_0000407 3300048922 Bacteria 59063
593 Ga0496119_0009404 3300048922 Bacteria 8397
594 Ga0496119_0017837 3300048922 Bacteria 5321
595 Ga0496119_0020002 3300048922 Bacteria 4900
596 Ga0496119_0037750 3300048922 Bacteria 3133
597 Ga0496119_0042872 3300048922 Bacteria 2865
598 Ga0496119_0055788 3300048922 Bacteria 2398
599 Ga0496119_0112682 3300048922 Bacteria 1507
600 Ga0496120_0000019 3300048923 Bacteria 260115
601 Ga0496120_0169916 3300048923 Bacteria 1079
602 Ga0496121_0000005 3300048924 Bacteria 1034486
603 Ga0496121_0000230 3300048924 Bacteria 120616
604 Ga0496121_0003624 3300048924 Bacteria 21750
605 Ga0496121_0027118 3300048924 Bacteria 5370
606 Ga0496121_0028245 3300048924 Bacteria 5227
607 Ga0496121_0140568 3300048924 Bacteria 1792
608 Ga0496121_0259512 3300048924 Bacteria 1200
609 Ga0496122_0000053 3300048925 Bacteria 260120
610 Ga0496122_0003439 3300048925 Bacteria 20818
611 Ga0496122_0004580 3300048925 Bacteria 17027
612 Ga0496122_0024574 3300048925 Bacteria 5268
613 Ga0496122_0064306 3300048925 Bacteria 2670
614 Ga0496122_0139424 3300048925 Bacteria 1520
615 Ga0496122_0168519 3300048925 Bacteria 1324
616 Ga0496123_0000038 3300048926 Bacteria 260120
617 Ga0496123_0002783 3300048926 Bacteria 20818
618 Ga0496123_0014707 3300048926 Bacteria 6468
619 Ga0496123_0022880 3300048926 Bacteria 4801
620 Ga0496123_0067145 3300048926 Bacteria 2266
621 Ga0496123_0090192 3300048926 Bacteria 1823
622 Ga0496124_0001723 3300048927 Bacteria 30828
623 Ga0496124_0017334 3300048927 Bacteria 6790
624 Ga0496124_0039011 3300048927 Bacteria 4119
625 Ga0496124_0096255 3300048927 Bacteria 2405
626 Ga0496124_0104449 3300048927 Bacteria 2291
627 Ga0496124_0104925 3300048927 Bacteria 2284
628 Ga0496125_0000159 3300048928 Bacteria 151205
629 Ga0496125_0000763 3300048928 Bacteria 52688
630 Ga0496125_0000796 3300048928 Bacteria 51436
631 Ga0496125_0008276 3300048928 Bacteria 10921
632 Ga0496125_0050643 3300048928 Bacteria 3436
633 Ga0496125_0076051 3300048928 Bacteria 2594
634 Ga0496125_0080691 3300048928 Bacteria 2488
635 Ga0496125_0353606 3300048928 Bacteria 876
636 Ga0496126_0000768 3300048929 Bacteria 58074
637 Ga0496126_0003924 3300048929 Bacteria 18222
638 Ga0496126_0018413 3300048929 Bacteria 6919
639 Ga0496126_0372776 3300048929 Bacteria 1163
640 Ga0496126_0470649 3300048929 Bacteria 1008
641 Ga0495678_027086 3300049459 Bacteria 2436
642 Ga0495678_031570 3300049459 Bacteria 2207
643 Ga0495682_0038135 3300049460 Bacteria 1766
644 Ga0501033_0201231 3300049570 Bacteria 1422
645 Ga0501034_0328983 3300049571 Bacteria 1460
646 Ga0501037_0165632 3300049573 Bacteria 1574
647 Ga0501038_0215268 3300049574 Bacteria 1535
648 Ga0501040_0463128 3300049576 Bacteria 913
649 Ga0501042_0293844 3300049578 Bacteria 1174
650 Ga0501046_0055698 3300049580 Bacteria 3106
651 Ga0501047_0042993 3300049581 Bacteria 4365
652 Ga0501047_0099757 3300049581 Bacteria 2783
653 Ga0501069_0153000 3300049585 Bacteria 1326
654 Ga0501073_0138282 3300049589 Bacteria 1688
655 Ga0501075_0479701 3300049591 Bacteria 949
656 Ga0501076_0016532 3300049592 Bacteria 5593
657 Ga0501280_006997 3300049776 Bacteria 1584
658 Ga0501035_0045861 3300049822 Bacteria 3932
659 nmdc:mga03683_10325_c1 3300050489 Bacteria 3347
660 nmdc:mga03683_26726_c1 3300050489 Bacteria 2279
661 nmdc:mga03683_7842_c1 3300050489 Bacteria 3727
662 nmdc:mga03n38_1718_c1 3300050490 Bacteria 6456
663 nmdc:mga03n38_70090_c1 3300050490 Bacteria 1621
664 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
665 nmdc:mga00v17_21333_c1 3300050491 Bacteria 3723
666 nmdc:mga00v17_31758_c1 3300050491 Bacteria 3116
667 nmdc:mga00v17_67568_c1 3300050491 Bacteria 2208
668 nmdc:mga00v17_88516_c1 3300050491 Bacteria 1942
669 nmdc:mga0yw44_114571_c1 3300050492 Bacteria 1731
670 nmdc:mga0yw44_1949_c1 3300050492 Bacteria 8548
671 nmdc:mga0yw44_291285_c1 3300050492 Bacteria 1092
672 nmdc:mga0yw44_32216_c1 3300050492 Bacteria 3053
673 nmdc:mga0yw44_528_c1 3300050492 Bacteria 13715
674 nmdc:mga0yw44_61812_c1 3300050492 Bacteria 2299
675 nmdc:mga0yw44_76197_c1 3300050492 Bacteria 2093
676 nmdc:mga0k408_110770_c1 3300050493 Bacteria 1623
677 nmdc:mga0k408_171939_c1 3300050493 Bacteria 1292
678 nmdc:mga0k408_21150_c1 3300050493 Bacteria 3652
679 nmdc:mga0k408_61733_c1 3300050493 Bacteria 2179
680 nmdc:mga06z11_72078_c1 3300050494 Bacteria 1831
681 nmdc:mga06z11_76648_c1 3300050494 Bacteria 1783
682 nmdc:mga04h51_48492_c1 3300050495 Bacteria 1416
683 nmdc:mga07m45_18250_c1 3300050496 Bacteria 3783
684 nmdc:mga07m45_207910_c1 3300050496 Bacteria 1139
685 nmdc:mga07m45_31840_c1 3300050496 Bacteria 2923
686 nmdc:mga07m45_6280_c1 3300050496 Bacteria 3722
687 nmdc:mga05p37_195993_c1 3300050507 Bacteria 2449
688 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
689 nmdc:mga05p37_321350_c1 3300050507 Bacteria 1832
690 nmdc:mga09592_232851_c1 3300050508 Bacteria 1596
691 nmdc:mga09592_452_c1 3300050508 Bacteria 30462
692 nmdc:mga0qj67_396_c1 3300050509 Bacteria 30122
693 nmdc:mga0qj67_54201_c1 3300050509 Bacteria 3175
694 nmdc:mga0qj67_57041_c1 3300050509 Bacteria 3096
695 nmdc:mga06r32_190711_c1 3300050510 Bacteria 2037
696 nmdc:mga06r32_220643_c1 3300050510 Bacteria 1884
697 nmdc:mga06r32_274_c1 3300050510 Bacteria 42858
698 nmdc:mga06r32_364722_c1 3300050510 Bacteria 1428
699 nmdc:mga06r32_41092_c1 3300050510 Bacteria 4393
700 nmdc:mga08y16_15638_c1 3300050511 Bacteria 7979
701 nmdc:mga08y16_26695_c1 3300050511 Bacteria 6087
702 nmdc:mga08y16_32934_c1 3300050511 Bacteria 5446
703 nmdc:mga08y16_377326_c1 3300050511 Bacteria 1454
704 nmdc:mga0n895_124_c1 3300050512 Bacteria 45833
705 nmdc:mga0n895_328624_c1 3300050512 Bacteria 1549
706 nmdc:mga0rr50_268356_c1 3300050513 Bacteria 1421
707 nmdc:mga0rr50_4689_c1 3300050513 Bacteria 8056
708 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
709 nmdc:mga0sz30_18802_c1 3300050516 Bacteria 2769
710 nmdc:mga0sz30_70141_c1 3300050516 Bacteria 1508
711 nmdc:mga0sz30_8151_c1 3300050516 Bacteria 3948
712 Ga0495601_0002483 3300053077 Bacteria 10493
713 Ga0495595_0001110 3300053084 Bacteria 10438
714 Ga0495619_0000145 3300053085 Bacteria 52248
715 Ga0500643_000218 3300053087 Bacteria 53579
716 Ga0500644_0001583 3300053088 Bacteria 5959
717 Ga0500644_0056856 3300053088 Bacteria 1363
718 Ga0500651_0001206 3300053093 Bacteria 12837
719 Ga0500566_0000562 3300053094 Bacteria 20869
720 Ga0500566_0042130 3300053094 Bacteria 2635
721 Ga0500640_030487 3300053095 Bacteria 2362
722 Ga0500641_0005846 3300053096 Bacteria 4355
723 Ga0500641_0107573 3300053096 Bacteria 1199
724 Ga0500555_008865 3300053103 Bacteria 2871
725 Ga0500560_017881 3300053107 Bacteria 1966
726 Ga0500569_009618 3300053109 Bacteria 2252
727 Ga0500593_000025 3300053117 Bacteria 51890
728 Ga0500595_000848 3300053119 Bacteria 17450
729 Ga0500595_001223 3300053119 Bacteria 14197
730 Ga0500595_001276 3300053119 Bacteria 13715
731 Ga0500595_001896 3300053119 Bacteria 10770
732 Ga0500595_020910 3300053119 Bacteria 2344
733 Ga0500614_014399 3300053123 Bacteria 1750
734 Ga0500618_000726 3300053125 Bacteria 18853
735 Ga0500618_003240 3300053125 Bacteria 5665
736 Ga0500642_0077637 3300053130 Bacteria 1520
737 Ga0500568_0000005 3300053139 Bacteria 614296
738 Ga0500568_0001438 3300053139 Bacteria 15421
739 Ga0500568_0035067 3300053139 Bacteria 2049
740 Ga0500573_0038452 3300053140 Bacteria 2764
741 Ga0500577_0122988 3300053142 Bacteria 1081
742 Ga0500579_081517 3300053143 Bacteria 1806
743 Ga0500604_0001887 3300053151 Bacteria 5822
744 Ga0500616_0000256 3300053153 Bacteria 82461
745 Ga0500616_0000472 3300053153 Bacteria 52191
746 Ga0500616_0004193 3300053153 Bacteria 10390
747 Ga0500616_0009442 3300053153 Bacteria 5934
748 Ga0500616_0034287 3300053153 Bacteria 2765
749 Ga0500622_0009196 3300053156 Bacteria 5484
750 Ga0500622_0013905 3300053156 Bacteria 4332
751 Ga0500622_0092080 3300053156 Bacteria 1503
752 Ga0500627_0004511 3300053158 Bacteria 4488
753 Ga0500627_0018511 3300053158 Bacteria 2758
754 Ga0500627_0050943 3300053158 Bacteria 1804
755 Ga0500634_0000011 3300053161 Bacteria 133329
756 Ga0500634_0012826 3300053161 Bacteria 4375
757 Ga0500636_0000039 3300053177 Bacteria 69891
758 Ga0500636_0001036 3300053177 Bacteria 14900
759 Ga0500636_0053454 3300053177 Bacteria 2370
760 Ga0500637_0000231 3300053178 Bacteria 20786
761 Ga0500645_042682 3300053730 Bacteria 1337
762 Ga0500609_002839 3300053731 Bacteria 2470
763 Ga0500601_003054 3300053737 Bacteria 1805
764 3000139708 3000135777 Bacteria 6891109
765 2503200081 2503198000 Bacteria 6884444
766 2509140121 2508501127 Bacteria 7037543
767 2509371368 2509276018 Bacteria 6910194
768 2509390913 2509276021 Bacteria 7634384
769 2509445345 2509276033 Bacteria 7180565
770 2510137532 2510065019 Bacteria 6903379
771 2510292177 2510065055 Bacteria 5037935
772 2510315970 2510065059 Bacteria 6847884
773 2510839697 2510461069 Bacteria 5505000
774 2510893428 2510461076 Bacteria 8618824
775 2511133404 2510917022 Bacteria 6504556
776 2511170525 2510917026 Bacteria 7046020
777 2511184971 2510917028 Bacteria 6185411
778 2511195644 2510917030 Bacteria 7460662
779 2512932448 2512875016 Bacteria 6529530
780 2513573914 2513237084 Bacteria 7231967
781 2513575910 2513237085 Bacteria 7695351
782 2513592842 2513237087 Bacteria 5817514
783 2513608832 2513237090 Bacteria 7096802
784 2513621727 2513237092 Bacteria 8341956
785 2513633657 2513237093 Bacteria 7545552
786 2513651223 2513237095 Bacteria 8976980
787 2513661771 2513237096 Bacteria 8722461
788 2513712246 2513237103 Bacteria 7647401
789 2513720810 2513237104 Bacteria 10034502
790 2513910753 2513237144 Bacteria 7530820
791 2513923418 2513237145 Bacteria 8979722
792 2513927271 2513237146 Bacteria 7166346
793 2514002361 2513237159 Bacteria 6810126
794 2514019120 2513237162 Bacteria 7468464
795 2514036457 2513237164 Bacteria 7563725
796 2514422514 2513237305 Bacteria 7293571
797 2515109603 2515075009 Bacteria 7288508
798 2515634368 2515154113 Bacteria 7807172
799 2515641753 2515154114 Bacteria 7848616
800 2515658979 2515154116 Bacteria 7552979
801 2515742678 2515154134 Bacteria 7220242
802 2517042670 2516653077 Bacteria 7555578
803 2517081367 2516653085 Bacteria 7346596
804 2517100250 2517093000 Bacteria 7412387
805 2517411139 2517287029 Bacteria 6905599
806 2517891200 2517572143 Bacteria 9484767
807 2520377525 2519899620 Bacteria 6499161
808 2523469964 2523231067 Bacteria 5230452
809 2524436144 2524023205 Bacteria 8918781
810 2524468788 2524023210 Bacteria 9029266
811 2528848841 2528768022 Bacteria 10457665
812 2530648676 2529292951 Bacteria 6916614
813 2537873084 2537561587 Bacteria 5425293
814 2545674107 2545555834 Bacteria 8130841
815 2554245068 2554235003 Bacteria 5877155
816 2559297101 2558860242 Bacteria 5568029
817 2561467420 2558860983 Bacteria 4133860
818 2585167114 2582581283 Bacteria 6030556
819 2585222421 2582581298 Bacteria 7315509
820 2585227740 2582581299 Bacteria 6518058
821 2585255594 2582581304 Bacteria 5831370
822 2585266760 2582581306 Bacteria 6450535
823 2585276726 2582581307 Bacteria 6597605
824 2585332855 2582581316 Bacteria 7774528
825 2585387801 2582581865 Bacteria 6644329
826 2585402541 2582581867 Bacteria 7184437
827 2585526454 2585427526 Bacteria 7258840
828 2585538708 2585427528 Bacteria 6842387
829 2585544627 2585427529 Bacteria 7395659
830 2585562700 2585427531 Bacteria 6992870
831 2585820535 2585427590 Bacteria 6824633
832 2585836661 2585427593 Bacteria 7141551
833 2585847677 2585427594 Bacteria 6180594
834 2585899340 2585427608 Bacteria 6544331
835 2585908743 2585427609 Bacteria 6667127
836 2585997436 2585427633 Bacteria 6413184
837 2586002042 2585427634 Bacteria 6455027
838 2587984160 2585428125 Bacteria 6662905
839 2599415288 2599185170 Bacteria 7295545
840 2599604934 2599185210 Bacteria 5624189
841 2600376363 2600254933 Bacteria 4750527
842 2601611058 2600255279 Bacteria 5605316
843 2601747831 2600255308 Bacteria 5611129
844 2603860744 2602042107 Bacteria 6226103
845 2616294900 2615840624 Bacteria 6557588
846 2616552205 2615840698 Bacteria 7319877
847 2617352794 2617270735 Bacteria 9163226
848 2617372864 2617270741 Bacteria 8201522
849 2643858014 2643221568 Bacteria 5187270
850 2643916736 2643221582 Bacteria 5804683
851 2644048165 2643221607 Bacteria 6314006
852 2644195811 2643221634 Bacteria 6705461
853 2644201891 2643221636 Bacteria 6583769
854 2644241020 2643221643 Bacteria 5749658
855 2644297578 2643221653 Bacteria 4569637
856 2644480958 2643221686 Bacteria 6310811
857 2644497448 2643221689 Bacteria 6042950
858 2644521344 2643221693 Bacteria 5513853
859 2644655831 2643221719 Bacteria 4568197
860 2644734624 2643221734 Bacteria 5365412
861 2671116744 2667528174 Bacteria 6435400
862 2671123193 2667528175 Bacteria 7532676
863 2688597973 2687453392 Bacteria 6880454
864 2719184933 2718217882 Bacteria 6556348
865 2719389884 2718217927 Bacteria 6972593
866 2719668934 2718217997 Bacteria 6740740
867 2719728953 2718218009 Bacteria 6478651
868 2720489627 2718218199 Bacteria 6740745
869 2720610347 2718218232 Bacteria 6720332
870 2720617766 2718218233 Bacteria 6662049
871 2720628908 2718218235 Bacteria 6630699
872 2720772857 2718218269 Bacteria 6906114
873 2721144644 2718218363 Bacteria 6524337
874 2721156149 2718218365 Bacteria 6274507
875 2721162014 2718218366 Bacteria 6425255
876 2721403523 2718218423 Bacteria 6438183
877 2722843159 2721755514 Bacteria 6424414
878 2723030301 2721755556 Bacteria 6745503
879 2723564662 2721755684 Bacteria 6859907
880 2723569652 2721755685 Bacteria 6704835
881 2723576685 2721755686 Bacteria 7343952
882 2723843557 2721755755 Bacteria 8322773
883 2724035099 2721755809 Bacteria 6438790
884 2724041978 2721755810 Bacteria 6479005
885 2724092886 2721755819 Bacteria 6906405
886 2724101199 2721755822 Bacteria 6726041
887 2724113274 2721755823 Bacteria 6752556
888 2725950896 2724679232 Bacteria 7646494
889 2730110834 2728369352 Bacteria 6745171
890 2730161048 2728369365 Bacteria 6555560
891 2730295682 2728369397 Bacteria 6274511
892 2738799935 2738541293 Bacteria 7065685
893 2739034131 2738541333 Bacteria 7106503
894 2739350482 2738543031 Bacteria 5769731
895 2745080900 2744054633 Bacteria 8678936
896 2756672037 2756170246 Bacteria 7451806
897 2766068203 2765235942 Bacteria 7445910
898 2776910522 2775507049 Bacteria 6284736
899 2778178917 2775507266 Bacteria 7392367
900 2793061009 2791355196 Bacteria 7323613
901 2793066543 2791355197 Bacteria 8420563
902 2793083914
903 2793297345 2791355256 Bacteria 6798008
904 2793317758 2791355259 Bacteria 7254731
905 2793324435 2791355260 Bacteria 6598818
906 2793328028 2791355261 Bacteria 6661293
907 2793334151 2791355262 Bacteria 6774204
908 2793340752 2791355263 Bacteria 6872478
909 2793345821 2791355264 Bacteria 6429314
910 2793354546 2791355265 Bacteria 6539969
911 2793361840 2791355266 Bacteria 7116587
912 2793367363 2791355267 Bacteria 7222458
913 2805930196 2802429605 Bacteria 6875453
914 2805934779 2802429606 Bacteria 6346811
915 2806042928 2802429633 Bacteria 7341974
916 2806050881 2802429634 Bacteria 7083200
917 2806057951 2802429635 Bacteria 7650140
918 2806065336 2802429636 Bacteria 7597525
919 2806076819 2802429637 Bacteria 7067217
920 2808988938 2808606387 Bacteria 5697198
921 2818236698 2816332527 Bacteria 8933356
922 2819243340 2818991272 Bacteria 4622173
923 2819561180 2818991439 Bacteria 6907412
924 2819610119 2818991448 Bacteria 6772224
925 2821128962 2821123053 Bacteria 7836056
926 2821444334 2821443989 Bacteria 7658172
927 2824602916 2824600985 Bacteria 8488197
928 2824611861 2824609381 Bacteria 8672835
929 2824655092 2824653114 Bacteria 8493680
930 2824672242 2824671348 Bacteria 8369588
931 2824682187 2824679649 Bacteria 8248951
932 2824688875 2824687955 Bacteria 8360029
933 2824708447 2824704595 Bacteria 9667483
934 2824733948 2824732956 Bacteria 7810675
935 2824748380 2824746037 Bacteria 7911610
936 2824757988 2824753945 Bacteria 9787441
937 2824766477 2824763712 Bacteria 9792355
938 2828306949 2828305725 Bacteria 4916900
939 2829746898 2829745981 Bacteria 5406054
940 2838016982 2838016132 Bacteria 6577831
941 2838027467 2838022645 Bacteria 6494267
942 2838030641 2838029111 Bacteria 6603031
943 2838038987 2838035591 Bacteria 7166484
944 2838050197 2838048938 Bacteria 6044578
945 2838062309 2838061910 Bacteria 6794874
946 2838069318 2838068647 Bacteria 6208656
947 2838129354 2838122688 Bacteria 8803140
948 2838664421 2838661181 Bacteria 7385261
949 2838673087 2838668709 Bacteria 6671819
950 2838678449 2838675328 Bacteria 4909118
951 2838686140 2838680041 Bacteria 6545511
952 2838688384 2838686498 Bacteria 7807632
953 2838700489 2838694306 Bacteria 6853137
954 2838705709 2838701080 Bacteria 6669771
955 2838713768 2838707686 Bacteria 6619912
956 2838716643 2838714209 Bacteria 5525906
957 2838722745 2838719591 Bacteria 5523910
958 2838727394 2838724970 Bacteria 4908691
959 2838734481 2838729681 Bacteria 7400765
960 2838742277 2838736955 Bacteria 5760694
961 2838746940 2838742623 Bacteria 7396178
962 2841736037 2841734538 Bacteria 6784580
963 2841846133 2841840854 Bacteria 5761912
964 2841849012 2841846520 Bacteria 5345850
965 2841852125 2841851746 Bacteria 7532261
966 2841861967 2841859092 Bacteria 5436171
967 2841865753 2841864319 Bacteria 6742987
968 2841948966 2841941048 Bacteria 8688029
969 2841972983 2841966195 Bacteria 8673214
970 2841978346 2841974524 Bacteria 8931498
971 2841990559 2841983080 Bacteria 8395090
972 2842083079 2842077413 Bacteria 6508645
973 2842111597 2842110456 Bacteria 7656360
974 2842124113 2842118031 Bacteria 7033875
975 2842128239 2842124991 Bacteria 5346824
976 2842133342 2842130223 Bacteria 4909145
977 2842145837 2842140634 Bacteria 5759631
978 2842155335 2842152218 Bacteria 4908957
979 2842158800 2842156927 Bacteria 6894975
980 2842166229 2842163707 Bacteria 6916235
981 2842173835 2842170452 Bacteria 5525737
982 2842178956 2842175837 Bacteria 4908771
983 2842182414 2842180545 Bacteria 6888678
984 2842189751 2842187318 Bacteria 5524014
985 2842196662 2842192696 Bacteria 6147454
986 2842203007 2842198810 Bacteria 6608673
987 2842209198 2842205361 Bacteria 6340321
988 2842214065 2842211629 Bacteria 5523832
989 2842222447 2842217011 Bacteria 7497767
990 2842226785 2842224351 Bacteria 5524473
991 2842234573 2842229732 Bacteria 7475766
992 2842243181 2842237096 Bacteria 6620661
993 2842248306 2842243621 Bacteria 7421798
994 2842255389 2842250916 Bacteria 6579627
995 2842262521 2842257432 Bacteria 7401195
996 2842268568 2842264693 Bacteria 6472963
997 2842272666 2842271015 Bacteria 7807131
998 2842282756 2842278818 Bacteria 6340002
999 2842297338 2842291075 Bacteria 7076806
1000 2842307893 2842304105 Bacteria 7023636
1001 2842312855 2842311132 Bacteria 6616990
1002 2842320437 2842317721 Bacteria 6793725
1003 2842345703 2842341865 Bacteria 7003929
1004 2842363999 2842363717 Bacteria 6844742
1005 2842376241 2842370503 Bacteria 7038661
1006 2842383732 2842377471 Bacteria 7140707
1007 2842390871 2842384541 Bacteria 7057858
1008 2842405590 2842402390 Bacteria 6681310
1009 2842412174 2842409023 Bacteria 6687331
1010 2842418820 2842415677 Bacteria 6596907
1011 2842422509 2842422224 Bacteria 6239196
1012 2842432540 2842428310 Bacteria 6767288
1013 2842438844 2842434925 Bacteria 6502746
1014 2842445319 2842441272 Bacteria 6769273
1015 2842449671 2842447887 Bacteria 6754142
1016 2842466483 2842462802 Bacteria 6588055
1017 2842473459 2842469257 Bacteria 6752936
1018 2842477078 2842475841 Bacteria 6603183
1019 2842485689 2842482326 Bacteria 7212537
1020 2842489397 2842489311 Bacteria 6620893
1021 2842497944 2842495871 Bacteria 6820686
1022 2842503875 2842502639 Bacteria 6604161
1023 2842517767 2842515876 Bacteria 5436280
1024 2842524331 2842521101 Bacteria 6569494
1025 2844008015 2844002411 Bacteria 7168230
1026 2844013191 2844009547 Bacteria 6728125
1027 2844461564 2844454524 Bacteria 7952546
1028 2844538186 2844533157 Bacteria 7517899
1029 2847937458 2847930680 Bacteria 9342022
1030 2849078263 2849076700 Bacteria 7039503
1031 2851186955 2851182111 Bacteria 6047226
1032 2854901513 2854896431 Bacteria 5869725
1033 2854921310 2854916844 Bacteria 5725939
1034 2856323182 2856320880 Bacteria 7263508
1035 2856333682 2856328259 Bacteria 6528202
1036 2856338071 2856334872 Bacteria 7037011
1037 2856345789 2856342000 Bacteria 7176905
1038 2856355303 2856349417 Bacteria 6230045
1039 2856362539 2856356410 Bacteria 6297484
1040 2857370316 2857367948 Bacteria 6965560
1041 2857520614 2857516855 Bacteria 7787325
1042 2857536381 2857531043 Bacteria 6754041
1043 2861692517 2861691609 Bacteria 5628931
1044 2869176670 2869169390 Bacteria 6659796
1045 2869243431 2869242130 Bacteria 6609239
1046 2869250983 2869249662 Bacteria 6868783
1047 2869261233 2869256925 Bacteria 6981691
1048 2869264301 2869264136 Bacteria 6880765
1049 2869275052 2869271264 Bacteria 6908218
1050 2869282732 2869278585 Bacteria 7077053
1051 2871455929 2871451962 Bacteria 7336357
1052 2871460280 2871459585 Bacteria 6866887
1053 2871480063 2871474448 Bacteria 6806570
1054 2871483600 2871481445 Bacteria 6700002
1055 2871488858 2871488783 Bacteria 6929816
1056 2871496655 2871495908 Bacteria 6935695
1057 2874119895 2874116593 Bacteria 6674494
1058 2874131100 2874123672 Bacteria 7238285
1059 2874138248 2874131515 Bacteria 6820270
1060 2874142390 2874139085 Bacteria 7021506
1061 2874165064 2874162495 Bacteria 6174670
1062 2874169266 2874168670 Bacteria 8062617
1063 2874628210 2874620515 Bacteria 8290088
1064 2874630186 2874628541 Bacteria 8630250
1065 2876367518 2876363079 Bacteria 6544991
1066 2876386602 2876386047 Bacteria 6698674
1067 2876398304 2876392853 Bacteria 6660880
1068 2876404995 2876399893 Bacteria 6927900
1069 2876421538 2876420981 Bacteria 6687741
1070 2876768229 2876761206 Bacteria 10111113
1071 2878744425 2878738818 Bacteria 7136951
1072 2878753621 2878753008 Bacteria 6922523
1073 2878760882 2878760144 Bacteria 6823465
1074 2878767845 2878767105 Bacteria 6898628
1075 2878779778 2878774303 Bacteria 6108671
1076 2878785102 2878781027 Bacteria 6834456
1077 2879084871 2879083081 Bacteria 8587928
1078 2879107851 2879099564 Bacteria 10442239
1079 2881101603 2881101125 Bacteria 4590519
1080 2881151187 2881147464 Bacteria 7779814
1081 2881156640 2881155292 Bacteria 6461656
1082 2881167391 2881161766 Bacteria 7127907
1083 2881670066 2881665667 Bacteria 8175609
1084 2881852506 2881845957 Bacteria 6611900
1085 2881857559 2881853255 Bacteria 6698367
1086 2881866910 2881861095 Bacteria 7128710
1087 2882633538 2882632389 Bacteria 8154593
1088 2882918140 2882912400 Bacteria 6801539
1089 2885309293 2885305155 Bacteria 7348390
1090 2885314507 2885312484 Bacteria 6415165
1091 2885323789 2885318864 Bacteria 6729568
1092 2885330337 2885326080 Bacteria 7134805
1093 2885339538 2885334103 Bacteria 7216818
1094 2885349012 2885342637 Bacteria 7011821
1095 2885354520 2885350715 Bacteria 6787678
1096 2885382931 2885374607 Bacteria 8927485
1097 2885387781 2885383462 Bacteria 9473874
1098 2885413820 2885409591 Bacteria 9235467
1099 2888338400 2888337043 Bacteria 6629336
1100 2888344007 2888343758 Bacteria 6611049
1101 2888385600 2888378607 Bacteria 9652610
1102 2888392651 2888388044 Bacteria 7304136
1103 2888425728 2888419890 Bacteria 7857137
1104 2889037862 2889033259 Bacteria 9099371
1105 2894777215 2894772417 Bacteria 5305674
1106 2899794750 2899792073 Bacteria 4926588
1107 2899804370 2899803654 Bacteria 5577784
1108 2899845297 2899845264 Bacteria 5672268
1109 2903450298 2903448605 Bacteria 7357801
1110 2903495517 2903492973 Bacteria 13473544
1111 2903518072 2903513507 Bacteria 6344008
1112 2903521965 2903521522 Bacteria 6525694
1113 2903528342 2903528002 Bacteria 6586099
1114 2903541453 2903540706 Bacteria 7062119
1115 2903749678 2903748898 Bacteria 9972761
1116 2904664859 2904659560 Bacteria 6685615
1117 2904674172 2904666416 Bacteria 8226587
1118 2904698889 2904690495 Bacteria 9412302
1119 2904701087
1120 2904711825 2904711408 Bacteria 9771557
1121 2906367760 2906363423 Bacteria 6856682
1122 2906376784 2906370794 Bacteria 6881062
1123 2906381556 2906378014 Bacteria 6911440
1124 2906397940 2906393657 Bacteria 6790866
1125 2906407034 2906401398 Bacteria 6693206
1126 2906413671 2906408224 Bacteria 6162342
1127 2906427631 2906427513 Bacteria 6375796
1128 2906627736 2906626472 Bacteria 8826946
1129 2906638162 2906635258 Bacteria 8601019
1130 2906662837 2906660503 Bacteria 8595048
1131 2908741520 2908739725 Bacteria 8628932
1132 2908758685 2908756301 Bacteria 8864324
1133 2908781313 2908775508 Bacteria 8092255
1134 2917704073 2917699015 Bacteria 7043791
1135 2917832497 2917832318 Bacteria 5346010
1136 2919103005 2919100787 Bacteria 7710546
1137 2919116860 2919114240 Bacteria 5700270
1138 2919125296 2919125081 Bacteria 5385106
1139 2919171022 2919166419 Bacteria 4952238
1140 2919173732 2919171160 Bacteria 6499771
1141 2919413889 2919408235 Bacteria 6149349
1142 2919455535 2919450847 Bacteria 5631160
1143 2922156727 2922151315 Bacteria 6902399
1144 2922172679 2922172374 Bacteria 6167644
1145 2922361810 2922361189 Bacteria 7436256
1146 2922375857
1147 2922396937 2922393267 Bacteria 8285685
1148 2923562006 2923556063 Bacteria 6793593
1149 2924722549 2924718760 Bacteria 6331356
1150 2924734867 2924733363 Bacteria 7574837
1151 2924741643 2924741084 Bacteria 6661321
1152 2924750009 2924748358 Bacteria 6154725
1153 2924759774 2924754689 Bacteria 6774424
1154 2924769036 2924762789 Bacteria 6561353
1155 2924782455 2924776078 Bacteria 7492003
1156 2924790059 2924784321 Bacteria 7416538
1157 2926758373 2926754445 Bacteria 5964435
1158 2926764068 2926760298 Bacteria 5505990
1159 2929142991 2929138655 Bacteria 5810547
1160 2929203816 2929199973 Bacteria 7260745
1161 2929621169 2929615660 Bacteria 9193770
1162 2929626000 2929624759 Bacteria 9339455
1163 2932785122 2932784394 Bacteria 9704911
1164 2932810150 2932809354 Bacteria 9135765
1165 2932821723 2932818245 Bacteria 9955613
1166 2932828959 2932828146 Bacteria 9745859
1167 2933009286 2933006813 Bacteria 4912075
1168 2933013396 2933011516 Bacteria 5439334
1169 2933017889 2933016740 Bacteria 6355406
1170 2933574344 2933570622 Bacteria 7023390
1171 2933582962 2933577622 Bacteria 9116884
1172 2933590803 2933586486 Bacteria 7667493
1173 2933598267 2933594066 Bacteria 5594265
1174 2933599982 2933599457 Bacteria 5858799
1175 2935619622 2935616580 Bacteria 9032984
1176 2935635825 2935630451 Bacteria 8169952
1177 2935638602 2935638405 Bacteria 10015038
1178 2935666546 2935665750 Bacteria 9571747
1179 2935676411 2935675223 Bacteria 9928132
1180 2935691073 2935684952 Bacteria 9590419
1181 2935694493 2935694250 Bacteria 9291695
1182 2935703608 2935703347 Bacteria 10242284
1183 2935718454 2935713505 Bacteria 9608509
1184 2935727566 2935722832 Bacteria 9608746
1185 2935736269 2935732158 Bacteria 9706831
1186 2935745649 2935741537 Bacteria 9707219
1187 2935756030 2935750917 Bacteria 9590372
1188 2935760710 2935760218 Bacteria 9817913
1189 2935777121 2935769743 Bacteria 7878163
1190 2935793003 2935785616 Bacteria 7962367
1191 2935801032 2935793552 Bacteria 8012592
1192 2935801745 2935801545 Bacteria 9301974
1193 2935814839 2935810662 Bacteria 9401221
1194 2935828096 2935827899 Bacteria 10038562
1195 2935842301 2935837841 Bacteria 9454360
1196 2935858063 2935855204 Bacteria 9035059
1197 2935867967 2935864058 Bacteria 9784707
1198 2935874009 2935873716 Bacteria 9632195
1199 2935900806 2935894831 Bacteria 6620579
1200 2935907911 2935901341 Bacteria 7341747
1201 2935993066 2935992306 Bacteria 9802711
1202 2936002978 2936002035 Bacteria 9362176
1203 2936040518 2936037263 Bacteria 9446081
1204 2936370773 2936367885 Bacteria 7324495
1205 2936382455 2936381700 Bacteria 7006523
1206 2937822856 2937822353 Bacteria 7290551
1207 2937836730 2937836603 Bacteria 6811263
1208 2937851905 2937848649 Bacteria 6983481
1209 2937868811 2937861824 Bacteria 6660327
1210 2937870464 2937868953 Bacteria 6639878
1211 2937881096 2937877337 Bacteria 7246526
1212 2937977190 2937972304 Bacteria 7532020
1213 2937987072 2937980651 Bacteria 6517427
1214 2937995309 2937994558 Bacteria 7036190
1215 2940561995 2940556831 Bacteria 9590747
1216 2941512338 2941507105 Bacteria 8166816
1217 2941520157 2941515067 Bacteria 8166720
1218 2941528306 2941523033 Bacteria 8169134
1219 2941542350 2941538514 Bacteria 9402094
1220 2958039515 2958034702 Bacteria 6989922
1221 2958052856 2958041894 Bacteria 13082850
1222 2958076097 2958071322 Bacteria 6815895
1223 2958088347 2958084443 Bacteria 7312792
1224 2958094076 2958092219 Bacteria 6861151
1225 2958128690 2958122699 Bacteria 7280457
1226 2958141941 2958137437 Bacteria 6050276
1227 2958145497 2958144490 Bacteria 6677056
1228 2958158580 2958158011 Bacteria 6058449
1229 2958165785 2958165035 Bacteria 6906348
1230 2961119858 2961114664 Bacteria 6680456
1231 2961140192 2961136820 Bacteria 6775228
1232 2961164244 2961163497 Bacteria 6901077
1233 2961170811 2961170736 Bacteria 7072258
1234 2961189011 2961183825 Bacteria 6688536
1235 2963646755 2963644680 Bacteria 6530403
1236 2965019233 2965018300 Bacteria 6883036
1237 2965025975 2965025482 Bacteria 6532201
1238 2965034083 2965032056 Bacteria 6887443
1239 2965047021 2965040258 Bacteria 6855979
1240 2965053131 2965047637 Bacteria 6623551
1241 2965114709 2965110997 Bacteria 6693150
1242 2968003390 2967996073 Bacteria 6787468
1243 2968004157 2968003550 Bacteria 6929263
1244 2968020842 2968016561 Bacteria 7022047
1245 2968090454 2968083720 Bacteria 7351627
1246 2968116215 2968110612 Bacteria 6814636
1247 2968142174 2968138860 Bacteria 6605449
1248 2968172644 2968171901 Bacteria 6894245
1249 2970474139 2970469710 Bacteria 6969209
1250 2970493348 2970489779 Bacteria 6517260
1251 2970503401 2970503327 Bacteria 7099517
1252 2970512774 2970510686 Bacteria 7006402
1253 2970525711 2970524798 Bacteria 6840927
1254 2970532946 2970532167 Bacteria 6553173
1255 2970542497 2970540015 Bacteria 6977556
1256 2970551669 2970547951 Bacteria 6931819
1257 2970555737 2970554993 Bacteria 6814252
1258 2970597341 2970593180 Bacteria 7073582
1259 2970622660 2970619444 Bacteria 6986144
1260 2970630056 2970627176 Bacteria 6680862
1261 2977822838 2977821940 Bacteria 6906439
1262 2977833448 2977828996 Bacteria 7007971
1263 2977856524 2977851361 Bacteria 6694324
1264 2977870735 2977864932 Bacteria 7534097
1265 2977873195 2977872689 Bacteria 7270173
1266 2977903553 2977898635 Bacteria 6675551
1267 2977916569 2977915119 Bacteria 6829656
1268 2977925049 2977922695 Bacteria 6956781
1269 2977942065 2977935797 Bacteria 6252826
1270 2977954215 2977950692 Bacteria 6893264
1271 2977962971 2977957713 Bacteria 6877875
1272 2977988206 2977986579 Bacteria 6581278
1273 2978970453 2978969890 Bacteria 5400756
1274 2979090834 2979089926 Bacteria 5670289
1275 2979096359 2979095461 Bacteria 5669583
1276 2979101924 2979100975 Bacteria 5423623
1277 2979769581 2979764755 Bacteria 6610066
1278 2979774629 2979772303 Bacteria 6618277
1279 2979798065 2979793036 Bacteria 6808957
1280 2979815630 2979808191 Bacteria 7179355
1281 2984508503 2984504281 Bacteria 5262371
1282 2984510138 2984509177 Bacteria 5274802
1283 2984519159 2984518228 Bacteria 5277463
1284 2984538479 2984537506 Bacteria 5277481
1285 2984587484 2984587000 Bacteria 5263363
1286 2984605201 2984601300 Bacteria 5455244
1287 2987660250 2987659509 Bacteria 6966464
1288 2987672889 2987666974 Bacteria 6509233
1289 2987678258 2987673487 Bacteria 6884027
1290 2989777481 2989776772 Bacteria 4843317
1291 2990197571 2990196909 Bacteria 4054280
1292 2996352540 2996348954 Bacteria 7239054
1293 2996388848 2996386984 Bacteria 6978667
1294 2996887806 2996887358 Bacteria 5795980
1295 2996897260 2996893221 Bacteria 5823108
1296 3003933859 3003930520 Bacteria 5667563
1297 3004168247 3004167301 Bacteria 8330599
1298 3004189299 3004188549 Bacteria 6952365
1299 3004218160 3004211236 Bacteria 7417683
1300 3004220793 3004218560 Bacteria 7421728
1301 3004240577 3004239961 Bacteria 6892290
1302 3004251337 3004248173 Bacteria 6563236
1303 3004268745 3004268573 Bacteria 7043476
1304 3004279222 3004275668 Bacteria 7114440
1305 3004335632 3004334049 Bacteria 8449246
1306 3005417232 3005416602 Bacteria 7064308
1307 3005450913 3005445848 Bacteria 6906074
1308 3005481415 3005474847 Bacteria 9259049
1309 3005485534 3005483717 Bacteria 7877331
1310 3005588197 3005587118 Bacteria 7794411
1311 3007317415 3007315729 Bacteria 5076637
1312 637075546 637000159 Bacteria 7596297
1313 639650936 639633055 Bacteria 7751309
1314 641643914 641522639 Bacteria 7737025
1315 649872505 649633066 Bacteria 6690028
1316 650843528 650716007 Bacteria 5573770
1317 8001847348 8001845381 Bacteria 5804942
1318 8003573203 8003570095 Bacteria 5747666
1319 8004302941 8004300914 Bacteria 6132239
1320 8004366607 8004361976 Bacteria 6858373
1321 8004375194 8004374579 Bacteria 6898112
1322 8004634030 8004633249 Bacteria 6723080
1323 8004702349 8004695233 Bacteria 6731676
1324 8004728785 8004727605 Bacteria 6643904
1325 8005250049 8005246636 Bacteria 4933972
1326 8005259152 8005258706 Bacteria 6184835
1327 8005276007 8005275841 Bacteria 6929066
1328 8005285919 8005282627 Bacteria 6675747
1329 8005295349 8005289223 Bacteria 6634003
1330 8005307289 8005301065 Bacteria 6614431
1331 8005311967 8005307578 Bacteria 7395396
1332 8005320519 8005314921 Bacteria 7072929
1333 8005322333 8005321885 Bacteria 5795980
1334 8005382962 8005382845 Bacteria 6732062
1335 8005398561 8005395548 Bacteria 6806915
1336 8005433501 8005430974 Bacteria 6689030
1337 8005466129 8005460587 Bacteria 7157962
1338 8005487488 8005484373 Bacteria 6297373
1339 8005502074 8005497431 Bacteria 6477605
1340 8005563077 8005556819 Bacteria 6908598
1341 8005564925 8005563573 Bacteria 7153261
1342 8005575781 8005570704 Bacteria 6957481
1343 8005624367 8005619151 Bacteria 7030230
1344 8005629629 8005626139 Bacteria 6534237
1345 8005647892 8005645114 Bacteria 6950293
1346 8005673497 8005668836 Bacteria 6953162
1347 8005684258 8005682033 Bacteria 6726518
1348 8005688850 8005688590 Bacteria 6610080
1349 8005695412 8005695170 Bacteria 6912330
1350 8006939297 8006933436 Bacteria 10410654
1351 8006978954 8006973647 Bacteria 10679141
1352 8006984574 8006984368 Bacteria 9651211
1353 8016520503 8016511872 Bacteria 9921665
1354 8016533719 8016530956 Bacteria 8155261
1355 8016555179 8016548790 Bacteria 8155074
1356 8016563548 8016557553 Bacteria 8154380
1357 8016576248 8016575299 Bacteria 8154085
1358 8016594518 8016583857 Bacteria 10421953
1359 8016601284 8016595262 Bacteria 8149947
1360 8016729244 8016728285 Bacteria 5263933
1361 8017065072 8017057580 Bacteria 10023680
1362 8018129247 8018127388 Bacteria 7351159
1363 8018169952 8018163183 Bacteria 7277977
1364 8018180891 8018176218 Bacteria 6896178
1365 8019533495 8019530166 Bacteria 8155624
1366 8019584455 8019576017 Bacteria 10049540
1367 8019592229 8019586578 Bacteria 10212056
1368 8019609309 8019608314 Bacteria 10042931
1369 8023685957 8023680758 Bacteria 7729763
1370 8024485425 8024479707 Bacteria 6954785
1371 8024486655 8024486573 Bacteria 6540512
1372 8024502925 8024501048 Bacteria 6427847
1373 8054463614 8054460903 Bacteria 4872905
1374 8055432596 8055431914 Bacteria 4551896
1375 8055617524 8055617313 Bacteria 7548464
1376 8055744969 8055742211 Bacteria 9226248
1377 8055916465 8055909800 Bacteria 7278581
1378 8056381827 8056375014 Bacteria 7006639
1379 8056382289 8056382006 Bacteria 6408074
1380 8056680966 8056673599 Bacteria 7871253
1381 8056690654 8056689827 Bacteria 6712655
1382 8057876229 8057874678 Bacteria 7494653
1383 JGI24740J21852_10000538
1384 JGI25155J39150_1000056
1385 JGI25156J39149_1000007
1386 JGI25162J39368_1001472
1387 JGI25162J39368_1002141
1388 JGI25154J39366_1000013
1389 JGI25157J39369_1000099
1390 JGI25157J39369_1000789
1391 JGI25152J39213_1000256
1392 JGI25152J39213_1002687
1393 JGI25150J39212_1000501
1394 JGI25151J46595_10000007
1395 JGI25151J46595_10000166
1396 JGI25151J46595_10001633
1397 JGI25151J46595_10034603
1398 JGI25406J46586_10002619
1399 JGI25406J46586_10023243
1400 JGI25165J46597_1001164
1401 JGI25165J46597_1001468
1402 JGI25153J46596_10000313
1403 JGI25153J46596_10005646
1404 JGI25153J46596_10007051
1405 JGI25153J46596_10014527
1406 JGI25153J46596_10018377
1407 rootH1_10020516
1408 JGI25160J50197_1010224
1409 JGI25161J50226_1001176
1410 JGI25404J52841_10001894
1411 Ga0055526_1001232
1412 Ga0055526_1001408
1413 Ga0055526_1001712
1414 Ga0055526_1003004
1415 Ga0055526_1010710
1416 Ga0055524_1000518
1417 Ga0055524_1004966
1418 Ga0055524_1007981
1419 Ga0055524_1011428
1420 Ga0055536_1015097
1421 Ga0055528_1000067
1422 Ga0055528_1000515
1423 Ga0055540_1000131
1424 Ga0055540_1012983
1425 Ga0055531_10008117
1426 Ga0055531_10010658
1427 Ga0058692_1006972
1428 Ga0055543_1001269
1429 Ga0065165_1000853
1430 Ga0065165_1001807
1431 Ga0065165_1010313
1432 Ga0065165_1012631
1433 Ga0065165_1040556
1434 Ga0070658_10018138
1435 Ga0070658_10245760
1436 Ga0070676_10082362
1437 Ga0068869_100059708
1438 Ga0070666_10039936
1439 Ga0070680_100000827
1440 Ga0070661_100162391
1441 Ga0070668_100007882
1442 Ga0070668_100235246
1443 Ga0070668_100296586
1444 Ga0070675_100356182
1445 Ga0070671_100024365
1446 Ga0070671_100073928
1447 Ga0070671_100253244
1448 Ga0070674_100097276
1449 Ga0070674_100140987
1450 Ga0070688_100111268
1451 Ga0070667_100009165
1452 Ga0070667_100377141
1453 Ga0070713_100000526
1454 Ga0070711_100027954
1455 Ga0070711_100122903
1456 Ga0070694_100046563
1457 Ga0070708_100518268
1458 Ga0070663_100398778
1459 Ga0070681_10000681
1460 Ga0070685_10201166
1461 Ga0070706_100131498
1462 Ga0070699_100130139
1463 Ga0070679_100008706
1464 Ga0068853_100195167
1465 Ga0070686_100088230
1466 Ga0070695_100014398
1467 Ga0070665_100002095
1468 Ga0070665_100005120
1469 Ga0070665_100076453
1470 Ga0070665_100084443
1471 Ga0070665_100087923
1472 Ga0070665_100341725
1473 Ga0068855_100381886
1474 Ga0068857_100112605
1475 Ga0068856_100036031
1476 Ga0068856_100159392
1477 Ga0068859_100073860
1478 Ga0068859_100162981
1479 Ga0068864_100519544
1480 Ga0068863_100210085
1481 Ga0068862_100334261
1482 Ga0081455_10007852
1483 Ga0081455_10007920
1484 Ga0081455_10009013
1485 Ga0081455_10034510
1486 Ga0081455_10048637
1487 Ga0081538_10009799
1488 Ga0081538_10075112
1489 Ga0081540_1000620
1490 Ga0081540_1009656
1491 Ga0081540_1014865
1492 Ga0081540_1019574
1493 Ga0081539_10000220
1494 Ga0081539_10002437
1495 Ga0081539_10008096
1496 Ga0070717_10000425
1497 Ga0070717_10381551
1498 Ga0075365_10011544
1499 Ga0075365_10011946
1500 Ga0075365_10017754
1501 Ga0075365_10018335
1502 Ga0075365_10022109
1503 Ga0075365_10057514
1504 Ga0075365_10154006
1505 Ga0075368_10008690
1506 Ga0075368_10018661
1507 Ga0075368_10023143
1508 Ga0075368_10071327
1509 Ga0075368_10071757
1510 Ga0075363_100004037
1511 Ga0075363_100135547
1512 Ga0075364_10026122
1513 Ga0075364_10047814
1514 Ga0075364_10106883
1515 Ga0075364_10140011
1516 Ga0070716_100002328
1517 Ga0070716_100220925
1518 Ga0070712_100077880
1519 Ga0070712_100120014
1520 Ga0075362_10012384
1521 Ga0075362_10023553
1522 Ga0075367_10002198
1523 Ga0075367_10002330
1524 Ga0075367_10029612
1525 Ga0075367_10035948
1526 Ga0075367_10036519
1527 Ga0075367_10043320
1528 Ga0075367_10150714
1529 Ga0075367_10163874
1530 Ga0075369_10013828
1531 Ga0075369_10121883
1532 Ga0075427_10001903
1533 Ga0075366_10009512
1534 Ga0075366_10011331
1535 Ga0075366_10072866
1536 Ga0075370_10003168
1537 Ga0075370_10020067
1538 Ga0075370_10024134
1539 Ga0075370_10080226
1540 Ga0075370_10123501
1541 Ga0075370_10129962
1542 Ga0075428_100005390
1543 Ga0075428_100026013
1544 Ga0075428_100030504
1545 Ga0075428_100115849
1546 Ga0075428_100143877
1547 Ga0075430_100000140
1548 Ga0075430_100166447
1549 Ga0075431_100001318
1550 Ga0075431_100158117
1551 Ga0075431_100203657
1552 Ga0075431_100372918
1553 Ga0075431_100411232
1554 Ga0075433_10000050
1555 Ga0075434_100000179
1556 Ga0075429_100001170
1557 Ga0075429_100116506
1558 Ga0097620_100073871
1559 Ga0097620_100162996
1560 Ga0099825_1021826
1561 Ga0099824_1029608
1562 Ga0099822_1005398
1563 Ga0099823_1024510
1564 Ga0079104_1000014
1565 Ga0099826_10000297
1566 Ga0099826_10095024
1567 Ga0075435_100001211
1568 Ga0105240_10002521
1569 Ga0111539_10000565
1570 Ga0111539_10010599
1571 Ga0111539_10225523
1572 Ga0111539_10235929
1573 Ga0105245_10006247
1574 Ga0105245_10203045
1575 Ga0105245_10364746
1576 Ga0105247_10086689
1577 Ga0114129_10003182
1578 Ga0114129_10085173
1579 Ga0114129_10400906
1580 Ga0114129_10502866
1581 Ga0114129_10690294
1582 Ga0105243_10018705
1583 Ga0105243_10060918
1584 Ga0105248_10285149
1585 Ga0105248_10777425
1586 Ga0105237_10073940
1587 Ga0105237_10436622
1588 Ga0105238_10068422
1589 Ga0105238_10171507
1590 Ga0105249_10197633
1591 Ga0105249_10420514
1592 Ga0123341_1000019
1593 Ga0123342_1014594
1594 Ga0123342_1021209
1595 Ga0099796_10016009
1596 Ga0099796_10058057
1597 Ga0105246_10052627
1598 Ga0157373_10103869
1599 Ga0157373_10160983
1600 Ga0157371_10000304
1601 Ga0157370_10013708
1602 Ga0157370_10065483
1603 Ga0157374_10388413
1604 Ga0157375_10423927
1605 Ga0157376_10183948
1606 Ga0214544_1000001
1607 Ga0214542_1000037
1608 Ga0214545_1000003
1609 Ga0214543_1000002
1610 Ga0213872_10068402
1611 Ga0209435_100006
1612 Ga0209437_100023
1613 Ga0209437_100341
1614 Ga0207425_1000018
1615 Ga0207425_1006064
1616 Ga0209646_1000015
1617 Ga0209026_1000023
1618 Ga0209026_1000046
1619 Ga0209677_112928
1620 Ga0209148_1003099
1621 Ga0209759_1000005
1622 Ga0209759_1001309
1623 Ga0209759_1018812
1624 Ga0209129_1000026
1625 Ga0209129_1001183
1626 Ga0209129_1002648
1627 Ga0209129_1010344
1628 Ga0209233_1000062
1629 Ga0209233_1000970
1630 Ga0209233_1001664
1631 Ga0209233_1003296
1632 Ga0209233_1007903
1633 Ga0209673_1000005
1634 Ga0209673_1000310
1635 Ga0209673_1001376
1636 Ga0209673_1018003
1637 Ga0209673_1018699
1638 Ga0209673_1022555
1639 Ga0209673_1023198
1640 Ga0209130_1000709
1641 Ga0209675_1003671
1642 Ga0209675_1010802
1643 Ga0209675_1014261
1644 Ga0209675_1023374
1645 Ga0209025_1000035
1646 Ga0209025_1000053
1647 Ga0209025_1000397
1648 Ga0209025_1002007
1649 Ga0209025_1002687
1650 Ga0209025_1007209
1651 Ga0209025_1007433
1652 Ga0209025_1010571
1653 Ga0209564_1000137
1654 Ga0209564_1000150
1655 Ga0209564_1000191
1656 Ga0209564_1000511
1657 Ga0209564_1005137
1658 Ga0209564_1006466
1659 Ga0209564_1007023
1660 Ga0209758_1000011
1661 Ga0209758_1000040
1662 Ga0209758_1000477
1663 Ga0209758_1000585
1664 Ga0209758_1000662
1665 Ga0209758_1001274
1666 Ga0209758_1001596
1667 Ga0209758_1002622
1668 Ga0209758_1002716
1669 Ga0209758_1004840
1670 Ga0209758_1005670
1671 Ga0209758_1013489
1672 Ga0209758_1023161
1673 Ga0209050_1001525
1674 Ga0209256_1000108
1675 Ga0209256_1000243
1676 Ga0209256_1000740
1677 Ga0209256_1003072
1678 Ga0209256_1003322
1679 Ga0209256_1005504
1680 Ga0209256_1008896
1681 Ga0207426_1000198
1682 Ga0207426_1000292
1683 Ga0207426_1000355
1684 Ga0207426_1003205
1685 Ga0207426_1057592
1686 Ga0209051_1000038
1687 Ga0209051_1002277
1688 Ga0209051_1002823
1689 Ga0209051_1037393
1690 Ga0209257_1000654
1691 Ga0209257_1008917
1692 Ga0209257_1012956
1693 Ga0207655_1047574
1694 Ga0207713_1038563
1695 Ga0207710_10033864
1696 Ga0207710_10117633
1697 Ga0207680_10027354
1698 Ga0207647_10019881
1699 Ga0207645_10072761
1700 Ga0207705_10008204
1701 Ga0207705_10323885
1702 Ga0207707_10014526
1703 Ga0207695_10055812
1704 Ga0207671_10008285
1705 Ga0207693_10005998
1706 Ga0207693_10022689
1707 Ga0207693_10087797
1708 Ga0207663_10040021
1709 Ga0207662_10033751
1710 Ga0207652_10039117
1711 Ga0207681_10091151
1712 Ga0207694_10047057
1713 Ga0207650_10127444
1714 Ga0207687_10009010
1715 Ga0207687_10116915
1716 Ga0207700_10001358
1717 Ga0207644_10014803
1718 Ga0207644_10150474
1719 Ga0207686_10129469
1720 Ga0207709_10031822
1721 Ga0207670_10041485
1722 Ga0207665_10000837
1723 Ga0207711_10051640
1724 Ga0207711_10187050
1725 Ga0207689_10068552
1726 Ga0207689_10071966
1727 Ga0207689_10101561
1728 Ga0207667_10011494
1729 Ga0207712_10063367
1730 Ga0207668_10172844
1731 Ga0207658_10089841
1732 Ga0207703_10077531
1733 Ga0207703_10090163
1734 Ga0207639_10120702
1735 Ga0207639_10159169
1736 Ga0207678_10091910
1737 Ga0207678_10448528
1738 Ga0207708_10036315
1739 Ga0207702_10025869
1740 Ga0207702_10286621
1741 Ga0207674_10135330
1742 Ga0207683_10039324
1743 Ga0207698_10476688
1744 Ga0209281_1000032
1745 Ga0209389_1000014
1746 Ga0209389_1000077
1747 Ga0209371_1000035
1748 Ga0209371_1000135
1749 Ga0209371_1000703
1750 Ga0209371_1004170
1751 Ga0209589_1000011
1752 Ga0209589_1000020
1753 Ga0209489_100012
1754 Ga0209489_100251
1755 Ga0209489_102003
1756 Ga0209700_100019
1757 Ga0209700_100271
1758 Ga0209282_1001209
1759 Ga0209282_1076496
1760 Ga0209588_1017885
1761 Ga0209813_10003425
1762 Ga0209813_10005539
1763 Ga0207428_10000485
1764 Ga0207428_10078186
1765 Ga0207428_10128621
1766 Ga0268266_10013114
1767 Ga0268266_10023772
1768 Ga0268266_10125650
1769 Ga0268266_10130106
1770 Ga0268266_10131120
1771 Ga0268266_10454598
1772 Ga0268265_10157703
1773 Ga0307517_10000386
1774 Ga0307515_10001947
1775 Ga0307515_10025212
1776 Ga0307515_10068995
1777 Ga0307515_10190817
1778 Ga0268256_1000037
1779 Ga0268256_1000148
1780 Ga0268256_1003172
1781 Ga0268256_1004304
1782 Ga0316181_1153204
1783 Ga0307513_10066256
1784 Ga0307513_10131730
1785 Ga0307509_10433490
1786 Ga0307508_10093724
1787 Ga0307514_10216527
1788 Ga0265314_10002234
1789 Ga0265342_10035892
1790 Ga0307516_10091312
1791 Ga0307405_10002301
1792 Ga0307413_10064463
1793 Ga0307406_10078984
1794 Ga0307406_10285295
1795 Ga0307407_10109960
1796 Ga0307412_10311584
1797 Ga0307409_100119217
1798 Ga0307416_100082885
1799 Ga0307414_10044225
1800 Ga0307414_10087796
1801 Ga0307414_10095536
1802 Ga0307411_10093942
1803 Ga0307411_10118561
1804 Ga0307415_100068432
1805 Ga0307510_10045610
1806 Ga0315911_1000003
1807 Ga0373932_0038383
1808 Ga0373939_0002189
1809 Ga0373960_0003305
1810 Ga0373931_0002261
1811 Ga0373931_0010721
1812 Ga0373931_0038360
1813 Ga0373927_0109363
1814 Ga0373937_0148376
1815 Ga0373925_0152005
1816 Ga0395898_0483238
1817 Ga0395905_0002940
1818 Ga0395905_0010005
1819 Ga0436361_0285992
1820 Ga0439436_0017499
1821 Ga0451833_0340930
1822 Ga0451839_0143081
1823 Ga0451845_0454358
1824 Ga0451847_0186492
1825 Ga0451849_0091961
1826 Ga0451851_0082640
1827 Ga0451843_0039079
1828 Ga0451853_1011766
1829 Ga0439431_0035001
1830 Ga0439432_042969
1831 Ga0439452_027434
1832 Ga0439462_0027554
1833 Ga0439463_042250
1834 Ga0450906_022453
1835 Ga0439464_0005917
1836 Ga0439464_0011374
1837 Ga0466972_0000113
1838 Ga0466972_0022304
1839 Ga0466966_0274186
1840 Ga0466963_0008496
1841 Ga0466964_0016443
1842 Ga0466968_0000931
1843 Ga0466970_0000129
1844 Ga0466970_0187647
1845 Ga0466957_0081268
1846 Ga0466957_0140093
1847 Ga0466960_0026578
1848 Ga0466959_0113087
1849 Ga0466958_0047489
1850 Ga0466967_0116352
1851 Ga0495603_0009391
1852 Ga0495629_0004287
1853 Ga0495638_0002696
1854 Ga0495638_0059304
1855 Ga0495638_0061881
1856 Ga0495638_0179994
1857 Ga0495641_0039292
1858 Ga0495641_0084849
1859 Ga0495651_0017446
1860 Ga0495651_0138161
1861 Ga0495653_0012380
1862 Ga0495605_0016951
1863 Ga0495585_0019507
1864 Ga0495585_0024557
1865 Ga0495585_0089445
1866 Ga0495596_0027468
1867 Ga0495583_0024494
1868 Ga0495583_0079975
1869 Ga0495606_0000196
1870 Ga0495606_0001140
1871 Ga0495631_0011407
1872 Ga0495631_0063652
1873 Ga0495632_0016742
1874 Ga0495632_0032562
1875 Ga0495637_0130553
1876 Ga0495643_0067174
1877 Ga0495648_0016438
1878 Ga0495648_0020584
1879 Ga0495648_0192713
1880 Ga0495654_0000063
1881 Ga0495609_0099290
1882 Ga0495622_0030645
1883 Ga0495667_0077911
1884 Ga0495656_0012565
1885 Ga0495656_0187407
1886 Ga0495668_0052938
1887 Ga0495668_0154984
1888 Ga0495611_0015229
1889 Ga0495625_0021115
1890 Ga0495635_0006167
1891 Ga0495659_0015392
1892 Ga0495659_0068205
1893 Ga0495661_0000030
1894 Ga0495661_0165995
1895 Ga0495588_0011793
1896 Ga0495657_0014577
1897 Ga0495657_0079707
1898 Ga0495646_0128852
1899 Ga0495624_0193715
1900 Ga0495670_0049448
1901 Ga0495671_0058046
1902 Ga0495671_0104843
1903 Ga0495649_0000288
1904 Ga0495600_0126975
1905 Ga0495581_0042551
1906 Ga0495604_0009755
1907 Ga0495604_0011995
1908 Ga0495674_0269825
1909 Ga0495672_0012863
1910 Ga0495672_0049801
1911 Ga0495672_0078158
1912 Ga0495676_0017023
1913 Ga0495676_0028770
1914 Ga0495683_0000018
1915 Ga0495673_0097508
1916 Ga0495686_0133206
1917 Ga0495602_0244103
1918 Ga0496100_0017973
1919 Ga0496100_0246446
1920 Ga0496101_0002506
1921 Ga0496101_0084746
1922 Ga0496101_0293806
1923 Ga0496102_0118582
1924 Ga0496102_0120234
1925 Ga0496102_0139154
1926 Ga0496104_0001254
1927 Ga0496104_0159198
1928 Ga0496104_0315146
1929 Ga0496105_0030374
1930 Ga0496105_0061087
1931 Ga0496105_0075113
1932 Ga0496105_0195109
1933 Ga0496106_0032006
1934 Ga0496106_0039230
1935 Ga0496106_0040480
1936 Ga0496106_0084026
1937 Ga0496107_0019239
1938 Ga0496108_0101013
1939 Ga0496108_0429083
1940 Ga0496109_0033706
1941 Ga0496109_0064980
1942 Ga0496109_0143700
1943 Ga0496109_0202435
1944 Ga0496110_0035179
1945 Ga0496110_0372551
1946 Ga0496112_0015338
1947 Ga0496112_0043464
1948 Ga0496112_0323276
1949 Ga0496112_0401976
1950 Ga0496113_0042834
1951 Ga0496113_0476842
1952 Ga0496114_0037868
1953 Ga0496114_0195087
1954 Ga0496114_0392131
1955 Ga0496114_0576165
1956 Ga0496115_0005702
1957 Ga0496115_0098103
1958 Ga0496116_0000167
1959 Ga0496116_0009413
1960 Ga0496116_0011068
1961 Ga0496116_0012692
1962 Ga0496116_0047130
1963 Ga0496116_0107045
1964 Ga0496116_0149098
1965 Ga0496117_0000052
1966 Ga0496117_0008030
1967 Ga0496117_0009706
1968 Ga0496117_0068125
1969 Ga0496117_0074519
1970 Ga0496117_0185523
1971 Ga0496118_0018034
1972 Ga0496118_0094285
1973 Ga0496118_0190535
1974 Ga0496119_0000407
1975 Ga0496119_0009404
1976 Ga0496119_0017837
1977 Ga0496119_0020002
1978 Ga0496119_0037750
1979 Ga0496119_0042872
1980 Ga0496119_0055788
1981 Ga0496119_0112682
1982 Ga0496120_0000019
1983 Ga0496120_0169916
1984 Ga0496121_0000005
1985 Ga0496121_0000230
1986 Ga0496121_0003624
1987 Ga0496121_0027118
1988 Ga0496121_0028245
1989 Ga0496121_0140568
1990 Ga0496121_0259512
1991 Ga0496122_0000053
1992 Ga0496122_0003439
1993 Ga0496122_0004580
1994 Ga0496122_0024574
1995 Ga0496122_0064306
1996 Ga0496122_0139424
1997 Ga0496122_0168519
1998 Ga0496123_0000038
1999 Ga0496123_0002783
2000 Ga0496123_0014707
2001 Ga0496123_0022880
2002 Ga0496123_0067145
2003 Ga0496123_0090192
2004 Ga0496124_0001723
2005 Ga0496124_0017334
2006 Ga0496124_0039011
2007 Ga0496124_0096255
2008 Ga0496124_0104449
2009 Ga0496124_0104925
2010 Ga0496125_0000159
2011 Ga0496125_0000763
2012 Ga0496125_0000796
2013 Ga0496125_0008276
2014 Ga0496125_0050643
2015 Ga0496125_0076051
2016 Ga0496125_0080691
2017 Ga0496125_0353606
2018 Ga0496126_0000768
2019 Ga0496126_0003924
2020 Ga0496126_0018413
2021 Ga0496126_0372776
2022 Ga0496126_0470649
2023 Ga0495678_027086
2024 Ga0495678_031570
2025 Ga0495682_0038135
2026 Ga0501033_0201231
2027 Ga0501034_0328983
2028 Ga0501037_0165632
2029 Ga0501038_0215268
2030 Ga0501040_0463128
2031 Ga0501042_0293844
2032 Ga0501046_0055698
2033 Ga0501047_0042993
2034 Ga0501047_0099757
2035 Ga0501069_0153000
2036 Ga0501073_0138282
2037 Ga0501075_0479701
2038 Ga0501076_0016532
2039 Ga0501280_006997
2040 Ga0501035_0045861
2041 nmdc:mga03683_10325_c1
2042 nmdc:mga03683_26726_c1
2043 nmdc:mga03683_7842_c1
2044 nmdc:mga03n38_1718_c1
2045 nmdc:mga03n38_70090_c1
2046 nmdc:mga00v17_11_c1
2047 nmdc:mga00v17_21333_c1
2048 nmdc:mga00v17_31758_c1
2049 nmdc:mga00v17_67568_c1
2050 nmdc:mga00v17_88516_c1
2051 nmdc:mga0yw44_114571_c1
2052 nmdc:mga0yw44_1949_c1
2053 nmdc:mga0yw44_291285_c1
2054 nmdc:mga0yw44_32216_c1
2055 nmdc:mga0yw44_528_c1
2056 nmdc:mga0yw44_61812_c1
2057 nmdc:mga0yw44_76197_c1
2058 nmdc:mga0k408_110770_c1
2059 nmdc:mga0k408_171939_c1
2060 nmdc:mga0k408_21150_c1
2061 nmdc:mga0k408_61733_c1
2062 nmdc:mga06z11_72078_c1
2063 nmdc:mga06z11_76648_c1
2064 nmdc:mga04h51_48492_c1
2065 nmdc:mga07m45_18250_c1
2066 nmdc:mga07m45_207910_c1
2067 nmdc:mga07m45_31840_c1
2068 nmdc:mga07m45_6280_c1
2069 nmdc:mga05p37_195993_c1
2070 nmdc:mga05p37_219_c1
2071 nmdc:mga05p37_321350_c1
2072 nmdc:mga09592_232851_c1
2073 nmdc:mga09592_452_c1
2074 nmdc:mga0qj67_396_c1
2075 nmdc:mga0qj67_54201_c1
2076 nmdc:mga0qj67_57041_c1
2077 nmdc:mga06r32_190711_c1
2078 nmdc:mga06r32_220643_c1
2079 nmdc:mga06r32_274_c1
2080 nmdc:mga06r32_364722_c1
2081 nmdc:mga06r32_41092_c1
2082 nmdc:mga08y16_15638_c1
2083 nmdc:mga08y16_26695_c1
2084 nmdc:mga08y16_32934_c1
2085 nmdc:mga08y16_377326_c1
2086 nmdc:mga0n895_124_c1
2087 nmdc:mga0n895_328624_c1
2088 nmdc:mga0rr50_268356_c1
2089 nmdc:mga0rr50_4689_c1
2090 nmdc:mga0a205_97_c1
2091 nmdc:mga0sz30_18802_c1
2092 nmdc:mga0sz30_70141_c1
2093 nmdc:mga0sz30_8151_c1
2094 Ga0495601_0002483
2095 Ga0495595_0001110
2096 Ga0495619_0000145
2097 Ga0500643_000218
2098 Ga0500644_0001583
2099 Ga0500644_0056856
2100 Ga0500651_0001206
2101 Ga0500566_0000562
2102 Ga0500566_0042130
2103 Ga0500640_030487
2104 Ga0500641_0005846
2105 Ga0500641_0107573
2106 Ga0500555_008865
2107 Ga0500560_017881
2108 Ga0500569_009618
2109 Ga0500593_000025
2110 Ga0500595_000848
2111 Ga0500595_001223
2112 Ga0500595_001276
2113 Ga0500595_001896
2114 Ga0500595_020910
2115 Ga0500614_014399
2116 Ga0500618_000726
2117 Ga0500618_003240
2118 Ga0500642_0077637
2119 Ga0500568_0000005
2120 Ga0500568_0001438
2121 Ga0500568_0035067
2122 Ga0500573_0038452
2123 Ga0500577_0122988
2124 Ga0500579_081517
2125 Ga0500604_0001887
2126 Ga0500616_0000256
2127 Ga0500616_0000472
2128 Ga0500616_0004193
2129 Ga0500616_0009442
2130 Ga0500616_0034287
2131 Ga0500622_0009196
2132 Ga0500622_0013905
2133 Ga0500622_0092080
2134 Ga0500627_0004511
2135 Ga0500627_0018511
2136 Ga0500627_0050943
2137 Ga0500634_0000011
2138 Ga0500634_0012826
2139 Ga0500636_0000039
2140 Ga0500636_0001036
2141 Ga0500636_0053454
2142 Ga0500637_0000231
2143 Ga0500645_042682
2144 Ga0500609_002839
2145 Ga0500601_003054
2146 3000139708
2147 2503200081
2148 2509140121
2149 2509371368
2150 2509390913
2151 2509445345
2152 2510137532
2153 2510292177
2154 2510315970
2155 2510839697
2156 2510893428
2157 2511133404
2158 2511170525
2159 2511184971
2160 2511195644
2161 2512932448
2162 2513573914
2163 2513575910
2164 2513592842
2165 2513608832
2166 2513621727
2167 2513633657
2168 2513651223
2169 2513661771
2170 2513712246
2171 2513720810
2172 2513910753
2173 2513923418
2174 2513927271
2175 2514002361
2176 2514019120
2177 2514036457
2178 2514422514
2179 2515109603
2180 2515634368
2181 2515641753
2182 2515658979
2183 2515742678
2184 2517042670
2185 2517081367
2186 2517100250
2187 2517411139
2188 2517891200
2189 2520377525
2190 2523469964
2191 2524436144
2192 2524468788
2193 2528848841
2194 2530648676
2195 2537873084
2196 2545674107
2197 2554245068
2198 2559297101
2199 2561467420
2200 2585167114
2201 2585222421
2202 2585227740
2203 2585255594
2204 2585266760
2205 2585276726
2206 2585332855
2207 2585387801
2208 2585402541
2209 2585526454
2210 2585538708
2211 2585544627
2212 2585562700
2213 2585820535
2214 2585836661
2215 2585847677
2216 2585899340
2217 2585908743
2218 2585997436
2219 2586002042
2220 2587984160
2221 2599415288
2222 2599604934
2223 2600376363
2224 2601611058
2225 2601747831
2226 2603860744
2227 2616294900
2228 2616552205
2229 2617352794
2230 2617372864
2231 2643858014
2232 2643916736
2233 2644048165
2234 2644195811
2235 2644201891
2236 2644241020
2237 2644297578
2238 2644480958
2239 2644497448
2240 2644521344
2241 2644655831
2242 2644734624
2243 2671116744
2244 2671123193
2245 2688597973
2246 2719184933
2247 2719389884
2248 2719668934
2249 2719728953
2250 2720489627
2251 2720610347
2252 2720617766
2253 2720628908
2254 2720772857
2255 2721144644
2256 2721156149
2257 2721162014
2258 2721403523
2259 2722843159
2260 2723030301
2261 2723564662
2262 2723569652
2263 2723576685
2264 2723843557
2265 2724035099
2266 2724041978
2267 2724092886
2268 2724101199
2269 2724113274
2270 2725950896
2271 2730110834
2272 2730161048
2273 2730295682
2274 2738799935
2275 2739034131
2276 2739350482
2277 2745080900
2278 2756672037
2279 2766068203
2280 2776910522
2281 2778178917
2282 2793061009
2283 2793066543
2284 2793083914
2285 2793297345
2286 2793317758
2287 2793324435
2288 2793328028
2289 2793334151
2290 2793340752
2291 2793345821
2292 2793354546
2293 2793361840
2294 2793367363
2295 2805930196
2296 2805934779
2297 2806042928
2298 2806050881
2299 2806057951
2300 2806065336
2301 2806076819
2302 2808988938
2303 2818236698
2304 2819243340
2305 2819561180
2306 2819610119
2307 2821128962
2308 2821444334
2309 2824602916
2310 2824611861
2311 2824655092
2312 2824672242
2313 2824682187
2314 2824688875
2315 2824708447
2316 2824733948
2317 2824748380
2318 2824757988
2319 2824766477
2320 2828306949
2321 2829746898
2322 2838016982
2323 2838027467
2324 2838030641
2325 2838038987
2326 2838050197
2327 2838062309
2328 2838069318
2329 2838129354
2330 2838664421
2331 2838673087
2332 2838678449
2333 2838686140
2334 2838688384
2335 2838700489
2336 2838705709
2337 2838713768
2338 2838716643
2339 2838722745
2340 2838727394
2341 2838734481
2342 2838742277
2343 2838746940
2344 2841736037
2345 2841846133
2346 2841849012
2347 2841852125
2348 2841861967
2349 2841865753
2350 2841948966
2351 2841972983
2352 2841978346
2353 2841990559
2354 2842083079
2355 2842111597
2356 2842124113
2357 2842128239
2358 2842133342
2359 2842145837
2360 2842155335
2361 2842158800
2362 2842166229
2363 2842173835
2364 2842178956
2365 2842182414
2366 2842189751
2367 2842196662
2368 2842203007
2369 2842209198
2370 2842214065
2371 2842222447
2372 2842226785
2373 2842234573
2374 2842243181
2375 2842248306
2376 2842255389
2377 2842262521
2378 2842268568
2379 2842272666
2380 2842282756
2381 2842297338
2382 2842307893
2383 2842312855
2384 2842320437
2385 2842345703
2386 2842363999
2387 2842376241
2388 2842383732
2389 2842390871
2390 2842405590
2391 2842412174
2392 2842418820
2393 2842422509
2394 2842432540
2395 2842438844
2396 2842445319
2397 2842449671
2398 2842466483
2399 2842473459
2400 2842477078
2401 2842485689
2402 2842489397
2403 2842497944
2404 2842503875
2405 2842517767
2406 2842524331
2407 2844008015
2408 2844013191
2409 2844461564
2410 2844538186
2411 2847937458
2412 2849078263
2413 2851186955
2414 2854901513
2415 2854921310
2416 2856323182
2417 2856333682
2418 2856338071
2419 2856345789
2420 2856355303
2421 2856362539
2422 2857370316
2423 2857520614
2424 2857536381
2425 2861692517
2426 2869176670
2427 2869243431
2428 2869250983
2429 2869261233
2430 2869264301
2431 2869275052
2432 2869282732
2433 2871455929
2434 2871460280
2435 2871480063
2436 2871483600
2437 2871488858
2438 2871496655
2439 2874119895
2440 2874131100
2441 2874138248
2442 2874142390
2443 2874165064
2444 2874169266
2445 2874628210
2446 2874630186
2447 2876367518
2448 2876386602
2449 2876398304
2450 2876404995
2451 2876421538
2452 2876768229
2453 2878744425
2454 2878753621
2455 2878760882
2456 2878767845
2457 2878779778
2458 2878785102
2459 2879084871
2460 2879107851
2461 2881101603
2462 2881151187
2463 2881156640
2464 2881167391
2465 2881670066
2466 2881852506
2467 2881857559
2468 2881866910
2469 2882633538
2470 2882918140
2471 2885309293
2472 2885314507
2473 2885323789
2474 2885330337
2475 2885339538
2476 2885349012
2477 2885354520
2478 2885382931
2479 2885387781
2480 2885413820
2481 2888338400
2482 2888344007
2483 2888385600
2484 2888392651
2485 2888425728
2486 2889037862
2487 2894777215
2488 2899794750
2489 2899804370
2490 2899845297
2491 2903450298
2492 2903495517
2493 2903518072
2494 2903521965
2495 2903528342
2496 2903541453
2497 2903749678
2498 2904664859
2499 2904674172
2500 2904698889
2501 2904701087
2502 2904711825
2503 2906367760
2504 2906376784
2505 2906381556
2506 2906397940
2507 2906407034
2508 2906413671
2509 2906427631
2510 2906627736
2511 2906638162
2512 2906662837
2513 2908741520
2514 2908758685
2515 2908781313
2516 2917704073
2517 2917832497
2518 2919103005
2519 2919116860
2520 2919125296
2521 2919171022
2522 2919173732
2523 2919413889
2524 2919455535
2525 2922156727
2526 2922172679
2527 2922361810
2528 2922375857
2529 2922396937
2530 2923562006
2531 2924722549
2532 2924734867
2533 2924741643
2534 2924750009
2535 2924759774
2536 2924769036
2537 2924782455
2538 2924790059
2539 2926758373
2540 2926764068
2541 2929142991
2542 2929203816
2543 2929621169
2544 2929626000
2545 2932785122
2546 2932810150
2547 2932821723
2548 2932828959
2549 2933009286
2550 2933013396
2551 2933017889
2552 2933574344
2553 2933582962
2554 2933590803
2555 2933598267
2556 2933599982
2557 2935619622
2558 2935635825
2559 2935638602
2560 2935666546
2561 2935676411
2562 2935691073
2563 2935694493
2564 2935703608
2565 2935718454
2566 2935727566
2567 2935736269
2568 2935745649
2569 2935756030
2570 2935760710
2571 2935777121
2572 2935793003
2573 2935801032
2574 2935801745
2575 2935814839
2576 2935828096
2577 2935842301
2578 2935858063
2579 2935867967
2580 2935874009
2581 2935900806
2582 2935907911
2583 2935993066
2584 2936002978
2585 2936040518
2586 2936370773
2587 2936382455
2588 2937822856
2589 2937836730
2590 2937851905
2591 2937868811
2592 2937870464
2593 2937881096
2594 2937977190
2595 2937987072
2596 2937995309
2597 2940561995
2598 2941512338
2599 2941520157
2600 2941528306
2601 2941542350
2602 2958039515
2603 2958052856
2604 2958076097
2605 2958088347
2606 2958094076
2607 2958128690
2608 2958141941
2609 2958145497
2610 2958158580
2611 2958165785
2612 2961119858
2613 2961140192
2614 2961164244
2615 2961170811
2616 2961189011
2617 2963646755
2618 2965019233
2619 2965025975
2620 2965034083
2621 2965047021
2622 2965053131
2623 2965114709
2624 2968003390
2625 2968004157
2626 2968020842
2627 2968090454
2628 2968116215
2629 2968142174
2630 2968172644
2631 2970474139
2632 2970493348
2633 2970503401
2634 2970512774
2635 2970525711
2636 2970532946
2637 2970542497
2638 2970551669
2639 2970555737
2640 2970597341
2641 2970622660
2642 2970630056
2643 2977822838
2644 2977833448
2645 2977856524
2646 2977870735
2647 2977873195
2648 2977903553
2649 2977916569
2650 2977925049
2651 2977942065
2652 2977954215
2653 2977962971
2654 2977988206
2655 2978970453
2656 2979090834
2657 2979096359
2658 2979101924
2659 2979769581
2660 2979774629
2661 2979798065
2662 2979815630
2663 2984508503
2664 2984510138
2665 2984519159
2666 2984538479
2667 2984587484
2668 2984605201
2669 2987660250
2670 2987672889
2671 2987678258
2672 2989777481
2673 2990197571
2674 2996352540
2675 2996388848
2676 2996887806
2677 2996897260
2678 3003933859
2679 3004168247
2680 3004189299
2681 3004218160
2682 3004220793
2683 3004240577
2684 3004251337
2685 3004268745
2686 3004279222
2687 3004335632
2688 3005417232
2689 3005450913
2690 3005481415
2691 3005485534
2692 3005588197
2693 3007317415
2694 637075546
2695 639650936
2696 641643914
2697 649872505
2698 650843528
2699 8001847348
2700 8003573203
2701 8004302941
2702 8004366607
2703 8004375194
2704 8004634030
2705 8004702349
2706 8004728785
2707 8005250049
2708 8005259152
2709 8005276007
2710 8005285919
2711 8005295349
2712 8005307289
2713 8005311967
2714 8005320519
2715 8005322333
2716 8005382962
2717 8005398561
2718 8005433501
2719 8005466129
2720 8005487488
2721 8005502074
2722 8005563077
2723 8005564925
2724 8005575781
2725 8005624367
2726 8005629629
2727 8005647892
2728 8005673497
2729 8005684258
2730 8005688850
2731 8005695412
2732 8006939297
2733 8006978954
2734 8006984574
2735 8016520503
2736 8016533719
2737 8016555179
2738 8016563548
2739 8016576248
2740 8016594518
2741 8016601284
2742 8016729244
2743 8017065072
2744 8018129247
2745 8018169952
2746 8018180891
2747 8019533495
2748 8019584455
2749 8019592229
2750 8019609309
2751 8023685957
2752 8024485425
2753 8024486655
2754 8024502925
2755 8054463614
2756 8055432596
2757 8055617524
2758 8055744969
2759 8055916465
2760 8056381827
2761 8056382289
2762 8056680966
2763 8056690654
2764 8057876229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

150

321

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8947 99 289
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.8178 99 282
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7924 53 289
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7909 99 282
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7842 99 280
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9616 102 292 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9371 99 287 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9363 96 291 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9335 96 287 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9321 99 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A530M5U9-F1-model_v4 deleted 0.98 114 258
AF-A0A530M5U9-F1-model_v4 deleted 0.9604 114 258
AF-A0A7W8LYU9-F1-model_v4 Nitrate/nitrite transport system permease protein 0.9508 14 293 GO:0005886
GO:0006811
GO:0015112
AF-A0A3N5GYZ6-F1-model_v4 ABC transporter permease subunit 0.9488 147 292 GO:0005886
GO:0055085
AF-S4M7U5-F1-model_v4 Putative Glycine betaine/carnitine transport permease protein GbuB 0.9432 106 290 GO:0005275
GO:0015226
GO:0015871
GO:0031460
GO:0043190

Map