metagRoot

F493534

General Info

Members	Datasets	Scaffolds	Average Seq Length
1383	1093	527	420

Family's Representative Sequence

Representative Sequence	3300013104\|Ga0157370_10000274\|Ga0157370_1000027431
Length	443
Sequence	MDMPTSSGLRPDRGGKDTSMNIQTTNRLTSAETALIEAYNDQLGDLPGDGEVFAVRDRLLDDLKTAGLPTRRIEAWHYTDFKNLLRLVPTDIGKGLAEALAPTVEGASVLSVLQGKASEKAAVKGLTIGRYADSLISGTAAAGLEALDKDDAIGRINASFVRDGYVIDFPDGTELDAPLEVQFIHAGGQIHSRLPVSFGADVKATVIERHQAVEGAAALVSSVSEVKIGARAEVTWIILQEQGSEDTHLGQIRIDLGTDAKLRLFVINAGGKLVRQELYIKVAGEGADLTLRGINLLGGDTHTDVTMVLGHDVPNTGSTEVIRNVVFDRARGVFQGMIRVAPDAQKTDAKMACNTLLMSDDAEFSVKPELEIFADDVQCGHGATVADIDRNHLFYLMARGVPENKARAMLVNAFVAEIVEELEDEALVEALEGVISAWLEKHA

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
3	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
4	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
5	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
6	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
7	2509276019	Ensifer aridi TW10	Isolate	Nodule
8	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
9	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
10	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
11	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
12	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
13	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
14	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
15	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
16	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
17	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
18	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
19	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
20	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
21	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
22	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
23	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
24	2512875024	Mesorhizobium loti R88b	Isolate	Nodule
25	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
26	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
27	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
28	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
29	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
30	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
31	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
32	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
33	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
34	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
35	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
36	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
37	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
38	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
39	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
40	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
41	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
42	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
43	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
44	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
45	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
46	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
47	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
48	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
49	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
50	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
51	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
52	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
53	2516143018	Ensifer sp. BR816	Isolate	Nodule
54	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
55	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
56	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
57	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
58	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
59	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
60	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
61	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
62	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
63	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
64	2534681786	Brucella suis 92/29	Isolate	Unclassified
65	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
66	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
67	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
68	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
69	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
70	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
71	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
72	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
73	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
74	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
75	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
76	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
77	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
78	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
79	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
80	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
81	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
82	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
83	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
84	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
85	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
86	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
87	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
88	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
89	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
90	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
91	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
92	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
93	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
94	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
95	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
96	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
97	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
98	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
99	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
100	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
101	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
102	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
103	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
104	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
105	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
106	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
107	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
108	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
109	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
110	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
111	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
112	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
113	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
114	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
115	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
116	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
117	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
118	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
119	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
120	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
121	2643221550	Mesorhizobium sp. Root552	Isolate	Unclassified
122	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
123	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
124	2643221557	Ensifer sp. Root558	Isolate	Unclassified
125	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
126	2643221564	Mesorhizobium sp. Root157	Isolate	Unclassified
127	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
128	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
129	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
130	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
131	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
132	2643221610	Ensifer sp. Root74	Isolate	Unclassified
133	2643221618	Ensifer sp. Root231	Isolate	Unclassified
134	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
135	2643221626	Ensifer sp. Root31	Isolate	Unclassified
136	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
137	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
138	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
139	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
140	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
141	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
142	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
143	2643221659	Ensifer sp. Root127	Isolate	Unclassified
144	2643221668	Ensifer sp. Root423	Isolate	Unclassified
145	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
146	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
147	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
148	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
149	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
150	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
151	2643221698	Ensifer sp. Root142	Isolate	Unclassified
152	2643221712	Ensifer sp. Root258	Isolate	Unclassified
153	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
154	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
155	2643221723	Ensifer sp. Root278	Isolate	Unclassified
156	2643221726	Ensifer sp. Root954	Isolate	Unclassified
157	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
158	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
159	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
160	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
161	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
162	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
163	2718217882	Rhizobium sp. N741	Isolate	Nodule
164	2718217927	Rhizobium sp. N324	Isolate	Nodule
165	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
166	2718218009	Rhizobium sp. N561	Isolate	Nodule
167	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
168	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
169	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
170	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
171	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
172	2718218363	Rhizobium sp. N113	Isolate	Nodule
173	2718218365	Rhizobium sp. N731	Isolate	Nodule
174	2718218366	Rhizobium sp. N621	Isolate	Nodule
175	2718218423	Rhizobium sp. N941	Isolate	Nodule
176	2721755514	Rhizobium sp. N6212	Isolate	Nodule
177	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
178	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
179	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
180	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
181	2721755809	Rhizobium sp. N541	Isolate	Nodule
182	2721755810	Rhizobium sp. N871	Isolate	Nodule
183	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
184	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
185	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
186	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
187	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
188	2728369365	Rhizobium sp. N1341	Isolate	Nodule
189	2728369397	Rhizobium sp. N1314	Isolate	Nodule
190	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
191	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
192	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
193	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
194	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
195	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
196	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
197	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
198	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
199	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
200	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
201	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
202	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
203	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
204	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
205	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
206	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
207	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
208	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
209	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
210	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
211	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
212	2791355256	Rhizobium sp. M10	Isolate	Nodule
213	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
214	2791355260	Rhizobium sp. L9	Isolate	Nodule
215	2791355261	Rhizobium sp. J15	Isolate	Nodule
216	2791355262	Rhizobium sp. M1	Isolate	Nodule
217	2791355263	Rhizobium chutanense C5	Isolate	Nodule
218	2791355264	Rhizobium sp. S9	Isolate	Nodule
219	2791355265	Rhizobium sp. H4	Isolate	Nodule
220	2791355266	Rhizobium sp. L43	Isolate	Nodule
221	2791355267	Rhizobium sp. L18	Isolate	Nodule
222	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
223	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
224	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
225	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
226	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
227	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
228	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
229	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
230	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
231	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
232	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
233	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
234	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
235	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
236	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
237	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
238	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
239	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
240	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
241	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
242	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
243	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
244	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
245	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
246	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
247	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
248	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
249	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
250	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
251	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
252	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
253	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
254	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
255	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
256	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
257	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
258	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
259	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
260	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
261	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
262	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
263	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
264	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
265	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
266	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
267	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
268	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
269	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
270	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
271	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
272	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
273	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
274	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
275	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
276	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
277	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
278	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
279	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
280	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
281	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
282	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
283	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
284	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
285	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
286	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
287	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
288	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
289	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
290	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
291	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
292	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
293	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
294	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
295	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
296	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
297	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
298	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
299	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
300	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
301	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
302	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
303	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
304	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
305	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
306	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
307	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
308	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
309	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
310	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
311	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
312	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
313	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
314	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
315	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
316	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
317	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
318	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
319	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
320	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
321	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
322	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
323	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
324	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
325	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
326	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
327	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
328	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
329	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
330	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
331	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
332	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
333	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
334	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
335	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
336	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
337	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
338	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
339	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
340	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
341	2847670302	Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1	Isolate	Nodule
342	2847686936	Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1	Isolate	Nodule
343	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
344	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
345	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
346	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
347	2854911287	Brucella lupini LUP21	Isolate	Unclassified
348	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
349	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
350	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
351	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
352	2856314179	Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1	Isolate	Nodule
353	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
354	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
355	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
356	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
357	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
358	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
359	2857349434	Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1	Isolate	Nodule
360	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
361	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
362	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
363	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
364	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
365	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
366	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
367	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
368	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
369	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
370	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
371	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
372	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
373	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
374	2871444079	Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1	Isolate	Nodule
375	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
376	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
377	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
378	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
379	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
380	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
381	2874102143	Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1	Isolate	Nodule
382	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
383	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
384	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
385	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
386	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
387	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
388	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
389	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
390	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
391	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
392	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
393	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
394	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
395	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
396	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
397	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
398	2878035449	Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1	Isolate	Nodule
399	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
400	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
401	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
402	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
403	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
404	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
405	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
406	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
407	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
408	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
409	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
410	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
411	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
412	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
413	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
414	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
415	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
416	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
417	2885334103	Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1	Isolate	Nodule
418	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
419	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
420	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
421	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
422	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
423	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
424	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
425	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
426	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
427	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
428	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
429	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
430	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
431	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
432	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
433	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
434	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
435	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
436	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
437	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
438	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
439	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
440	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
441	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
442	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
443	2906328253	Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1	Isolate	Nodule
444	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
445	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
446	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
447	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
448	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
449	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
450	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
451	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
452	2906414383	Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1	Isolate	Nodule
453	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
454	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
455	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
456	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
457	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
458	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
459	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
460	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
461	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
462	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
463	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
464	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
465	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
466	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
467	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
468	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
469	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
470	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
471	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
472	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
473	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
474	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
475	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
476	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
477	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
478	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
479	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
480	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
481	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
482	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
483	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
484	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
485	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
486	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
487	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
488	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
489	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
490	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
491	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
492	2922158528	Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1	Isolate	Nodule
493	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
494	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
495	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
496	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
497	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
498	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
499	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
500	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
501	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
502	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
503	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
504	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
505	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
506	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
507	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
508	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
509	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
510	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
511	2924726620	Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1	Isolate	Nodule
512	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
513	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
514	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
515	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
516	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
517	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
518	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
519	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
520	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
521	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
522	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
523	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
524	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
525	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
526	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
527	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
528	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
529	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
530	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
531	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
532	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
533	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
534	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
535	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
536	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
537	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
538	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
539	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
540	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
541	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
542	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
543	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
544	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
545	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
546	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
547	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
548	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
549	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
550	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
551	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
552	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
553	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
554	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
555	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
556	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
557	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
558	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
559	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
560	2937891427	Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1	Isolate	Nodule
561	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
562	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
563	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
564	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
565	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
566	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
567	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
568	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
569	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
570	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
571	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
572	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
573	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
574	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
575	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
576	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
577	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
578	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
579	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
580	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
581	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
582	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
583	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
584	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
585	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
586	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
587	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
588	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
589	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
590	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
591	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
592	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
593	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
594	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
595	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
596	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
597	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
598	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
599	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
600	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
601	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
602	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
603	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
604	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
605	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
606	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
607	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
608	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
609	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
610	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
611	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
612	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
613	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
614	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
615	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
616	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
617	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
618	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
619	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
620	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
621	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
622	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
623	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
624	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
625	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
626	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
627	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
628	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
629	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
630	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
631	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
632	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
633	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
634	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
635	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
636	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
637	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
638	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
639	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
640	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
641	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
642	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
643	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
644	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
645	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
646	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
647	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
648	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
649	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
650	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
651	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
652	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
653	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
654	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
655	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
656	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
657	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
658	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
659	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
660	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
661	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
662	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
663	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
664	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
665	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
666	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
667	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
668	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
669	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
670	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
671	2968091066	Mesorhizobium sp. AA23	Isolate	Unclassified
672	2968097103	Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1	Isolate	Nodule
673	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
674	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
675	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
676	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
677	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
678	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
679	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
680	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
681	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
682	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
683	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
684	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
685	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
686	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
687	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
688	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
689	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
690	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
691	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
692	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
693	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
694	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
695	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
696	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
697	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
698	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
699	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
700	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
701	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
702	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
703	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
704	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
705	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
706	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
707	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
708	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
709	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
710	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
711	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
712	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
713	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
714	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
715	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
716	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
717	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
718	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
719	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
720	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
721	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
722	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
723	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
724	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
725	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
726	2977858184	Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1	Isolate	Nodule
727	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
728	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
729	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
730	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
731	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
732	2977942078	Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1	Isolate	Nodule
733	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
734	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
735	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
736	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
737	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
738	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
739	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
740	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
741	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
742	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
743	2979779861	Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1	Isolate	Nodule
744	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
745	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
746	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
747	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
748	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
749	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
750	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
751	2987636660	Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1	Isolate	Nodule
752	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
753	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
754	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
755	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
756	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
757	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
758	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
759	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
760	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
761	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
762	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
763	2996341866	Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1	Isolate	Nodule
764	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
765	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
766	2996887358	Rhizobium sp. R711	Isolate	Nodule
767	2996893221	Rhizobium sp. R635	Isolate	Nodule
768	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
769	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
770	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
771	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
772	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
773	3004203850	Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1	Isolate	Nodule
774	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
775	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
776	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
777	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
778	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
779	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
780	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
781	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
782	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
783	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
784	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
785	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
786	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
787	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
788	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
789	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
790	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
791	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
792	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
793	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
794	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
795	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
796	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
797	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
798	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
799	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
800	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
801	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
802	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
803	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
804	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
805	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
806	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
807	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
808	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
809	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
810	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
811	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
812	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
813	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
814	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
815	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
816	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
817	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
818	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
819	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
820	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
821	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
822	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
823	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
824	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
825	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
826	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
827	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
828	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
829	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
830	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
831	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
832	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
833	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
834	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
835	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
836	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
837	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
838	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
839	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
840	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
841	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
842	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
843	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
844	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
845	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
846	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
847	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
848	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
849	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
850	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
851	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
852	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
853	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
854	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
855	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
856	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
857	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
858	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
859	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
860	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
861	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
862	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
863	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
864	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
865	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
866	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
867	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
868	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
869	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
870	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
871	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
872	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
873	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
874	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
875	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
876	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
877	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
878	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
879	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
880	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
881	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
882	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
883	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
884	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
885	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
886	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
887	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
888	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
889	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
890	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
891	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
892	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
893	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
894	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
895	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
896	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
897	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
898	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
899	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
900	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
901	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
902	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
903	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
904	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
905	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
906	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
907	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
908	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
909	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
910	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
911	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
912	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
913	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
914	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
915	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
916	3300041502	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT	Metatranscriptome	Unclassified
917	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
918	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
919	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
920	3300041510	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT	Metatranscriptome	Unclassified
921	3300041907	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run	Metatranscriptome	Unclassified
922	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
923	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
924	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
925	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
926	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
927	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
928	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
929	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
930	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
931	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
932	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
933	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
934	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
935	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
936	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
937	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
938	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
939	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
940	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
941	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
942	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
943	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
944	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
945	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
946	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
947	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
948	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
949	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
950	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
951	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
952	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
953	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
954	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
955	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
956	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
957	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
958	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
959	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
960	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
961	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
962	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
963	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
964	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
965	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
966	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
967	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
968	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
969	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
970	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
971	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
972	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
973	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
974	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
975	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
976	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
977	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
978	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
979	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
980	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
981	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
982	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
983	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
984	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
985	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
986	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
987	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
988	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
989	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
990	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
991	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
992	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
993	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
994	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
995	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
996	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
997	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
998	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
999	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
1000	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
1001	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
1002	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
1003	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
1004	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
1005	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
1006	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
1007	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
1008	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
1009	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
1010	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
1011	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
1012	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
1013	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
1014	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
1015	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
1016	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
1017	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
1018	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
1019	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1020	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1021	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1022	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1023	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
1024	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1025	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1026	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1027	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1028	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1029	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
1030	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
1031	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
1032	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1033	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1034	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1035	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
1036	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1037	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
1038	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
1039	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
1040	8004445564	Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1	Isolate	Nodule
1041	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1042	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
1043	8004703790	Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1	Isolate	Nodule
1044	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
1045	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1046	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
1047	8005258706	Rhizobium sp. R693	Isolate	Nodule
1048	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1049	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1050	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
1051	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1052	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1053	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1054	8005321885	Rhizobium sp. R72	Isolate	Nodule
1055	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1056	8005382845	Rhizobium sp. R634	Isolate	Nodule
1057	8005395548	Rhizobium sp. R339	Isolate	Nodule
1058	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1059	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1060	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1061	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1062	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
1063	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1064	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1065	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1066	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1067	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1068	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1069	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
1070	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1071	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1072	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
1073	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1074	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
1075	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
1076	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1077	8018176218	Rhizobium sp. N122	Isolate	Nodule
1078	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1079	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1080	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1081	8024501048	Rhizobium sp. H4	Isolate	Nodule
1082	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
1083	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
1084	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
1085	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
1086	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1087	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
1088	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
1089	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1090	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1091	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
1092	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
1093	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	37.6
Metatranscriptomes	0.51
Isolates	61.89

Biome Distribution

Category	Percentage (%)
Aerial Root	0.36
Bulb	0
Endosphere	13.45
Nodule	47.72
Rhizoplane	1.23
Rhizosphere	20.1
Stem	0
Stem Tuber	0
Unclassified	17.14

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C1045	2010549000	Bacteria	2096
2	JGI24740J21852_10000493	3300001979	Bacteria	16930
3	JGI24740J21852_10006526	3300001979	Bacteria	4821
4	JGI25155J39150_1000215	3300002704	Bacteria	23334
5	JGI25156J39149_1000491	3300002705	Bacteria	23712
6	JGI25162J39368_1000240	3300002737	Bacteria	54635
7	JGI25162J39368_1000394	3300002737	Bacteria	36901
8	JGI25154J39366_1000407	3300002738	Bacteria	23364
9	JGI25158J39367_1000050	3300002739	Bacteria	27257
10	JGI25158J39367_1000062	3300002739	Bacteria	24133
11	JGI25158J39367_1000656	3300002739	Bacteria	6776
12	JGI25158J39367_1003828	3300002739	Bacteria	2288
13	JGI25157J39369_1000310	3300002741	Bacteria	35193
14	JGI25157J39369_1000515	3300002741	Bacteria	23712
15	JGI25152J39213_1000882	3300002773	Bacteria	14768
16	JGI25152J39213_1003360	3300002773	Bacteria	5494
17	JGI25152J39213_1007648	3300002773	Bacteria	2773
18	JGI25150J39212_1000070	3300002774	Bacteria	61799
19	JGI25150J39212_1002233	3300002774	Bacteria	4917
20	JGI25159J45721_1000007	3300002987	Bacteria	176362
21	JGI25159J45721_1000029	3300002987	Bacteria	105868
22	JGI25159J45721_1000220	3300002987	Bacteria	26975
23	JGI25159J45721_1000293	3300002987	Bacteria	23430
24	JGI25151J46595_10000208	3300003187	Bacteria	71857
25	JGI25151J46595_10000479	3300003187	Bacteria	37852
26	JGI25151J46595_10003213	3300003187	Bacteria	9145
27	JGI25151J46595_10003717	3300003187	Bacteria	8292
28	JGI25406J46586_10019034	3300003203	Bacteria	2807
29	JGI25165J46597_1000192	3300003214	Bacteria	91136
30	JGI25165J46597_1003597	3300003214	Bacteria	3754
31	JGI25165J46597_1003608	3300003214	Bacteria	3742
32	JGI25153J46596_10007174	3300003215	Bacteria	5525
33	JGI25153J46596_10015117	3300003215	Bacteria	3164
34	JGI25153J46596_10034239	3300003215	Bacteria	1664
35	rootH1_10034574	3300003323	Bacteria	1436
36	rootH1_10060099	3300003323	Bacteria	2736
37	JGI25160J50197_1000010	3300003354	Bacteria	279365
38	JGI25160J50197_1000011	3300003354	Bacteria	275577
39	JGI25160J50197_1001320	3300003354	Bacteria	12521
40	JGI25161J50226_1000006	3300003374	Bacteria	279563
41	JGI25161J50226_1000055	3300003374	Bacteria	104131
42	JGI25161J50226_1000216	3300003374	Bacteria	36285
43	JGI25161J50226_1005791	3300003374	Bacteria	2331
44	Ga0055542_1001387	3300003762	Bacteria	12276
45	Ga0055542_1002854	3300003762	Bacteria	5147
46	Ga0055526_1005205	3300003771	Bacteria	7555
47	Ga0055526_1007269	3300003771	Bacteria	5801
48	Ga0055526_1010586	3300003771	Bacteria	4271
49	Ga0055524_1000879	3300003775	Bacteria	19581
50	Ga0055524_1003842	3300003775	Bacteria	7131
51	Ga0055536_1001994	3300003781	Bacteria	11712
52	Ga0055536_1002370	3300003781	Bacteria	10647
53	Ga0055528_1000222	3300003790	Bacteria	47898
54	Ga0055528_1001131	3300003790	Bacteria	17456
55	Ga0055528_1015919	3300003790	Bacteria	2687
56	Ga0055530_10027862	3300003791	Bacteria	1535
57	Ga0055540_1002477	3300003792	Bacteria	9704
58	Ga0055540_1007973	3300003792	Bacteria	3889
59	Ga0055531_10003918	3300003794	Bacteria	9271
60	Ga0055543_1000014	3300004625	Bacteria	177906
61	Ga0055543_1000032	3300004625	Bacteria	130218
62	Ga0055543_1000179	3300004625	Bacteria	52563
63	Ga0055543_1001284	3300004625	Bacteria	10327
64	Ga0065165_1000018	3300005262	Bacteria	275082
65	Ga0065165_1000251	3300005262	Bacteria	93020
66	Ga0065165_1006156	3300005262	Bacteria	6410
67	Ga0065165_1011886	3300005262	Bacteria	3585
68	Ga0070670_100021482	3300005331	Bacteria	5552
69	Ga0070671_100015004	3300005355	Bacteria	6257
70	Ga0070663_100011444	3300005455	Bacteria	5572
71	Ga0070698_100049413	3300005471	Bacteria	4293
72	Ga0070665_100023467	3300005548	Bacteria	6212
73	Ga0070665_100176084	3300005548	Bacteria	2140
74	Ga0070665_100198743	3300005548	Bacteria	2006
75	Ga0070665_100225551	3300005548	Bacteria	1874
76	Ga0070665_100396058	3300005548	Bacteria	1389
77	Ga0068854_100074668	3300005578	Bacteria	2487
78	Ga0081540_1059561	3300005983	Bacteria	1832
79	Ga0081539_10000688	3300005985	Bacteria	67723
80	Ga0075365_10000756	3300006038	Bacteria	13118
81	Ga0075365_10019843	3300006038	Bacteria	4157
82	Ga0075365_10022168	3300006038	Bacteria	3975
83	Ga0075368_10006544	3300006042	Bacteria	4076
84	Ga0075364_10000588	3300006051	Bacteria	18752
85	Ga0075362_10014572	3300006177	Bacteria	3175
86	Ga0075367_10000829	3300006178	Bacteria	12260
87	Ga0075367_10002190	3300006178	Bacteria	8807
88	Ga0075367_10026161	3300006178	Bacteria	3306
89	Ga0075367_10071189	3300006178	Bacteria	2091
90	Ga0075367_10077390	3300006178	Bacteria	2008
91	Ga0075366_10013815	3300006195	Bacteria	4603
92	Ga0075370_10010671	3300006353	Bacteria	4813
93	Ga0075370_10033108	3300006353	Bacteria	2892
94	Ga0079104_1000022	3300006946	Bacteria	223522
95	Ga0079104_1004255	3300006946	Bacteria	6220
96	Ga0079104_1004899	3300006946	Bacteria	5533
97	Ga0099826_10000117	3300006948	Bacteria	36698
98	Ga0099826_10094181	3300006948	Bacteria	1824
99	Ga0105240_10000005	3300009093	Bacteria	702630
100	Ga0105245_10188839	3300009098	Bacteria	1973
101	Ga0105241_10201507	3300009174	Bacteria	1662
102	Ga0105248_10310238	3300009177	Bacteria	1777
103	Ga0105238_10027221	3300009551	Bacteria	5826
104	Ga0123341_1000004	3300009765	Bacteria	153727
105	Ga0123341_1046535	3300009765	Bacteria	2594
106	Ga0123342_1018578	3300009766	Bacteria	5495
107	Ga0123342_1020028	3300009766	Bacteria	4976
108	Ga0105239_10088951	3300010375	Bacteria	3405
109	Ga0105239_10269779	3300010375	Bacteria	1914
110	Ga0157373_10112761	3300013100	Bacteria	1911
111	Ga0157371_10000015	3300013102	Bacteria	339838
112	Ga0157370_10000274	3300013104	Bacteria	65400
113	Ga0157370_10003029	3300013104	Bacteria	19939
114	Ga0157369_10198830	3300013105	Bacteria	2104
115	Ga0171463_1008	3300013249	Bacteria	299022
116	Ga0157374_10082150	3300013296	Bacteria	3059
117	Ga0182007_10000711	3300015262	Bacteria	18942
118	Ga0182005_1001790	3300015265	Bacteria	8238
119	Ga0183363_1171	3300015690	Bacteria	14444
120	Ga0214544_1000129	3300021320	Bacteria	108948
121	Ga0214542_1000245	3300021321	Bacteria	90699
122	Ga0214542_1030122	3300021321	Bacteria	2147
123	Ga0214543_1000010	3300021327	Bacteria	364844
124	Ga0214543_1000134	3300021327	Bacteria	102056
125	Ga0228711_1000007	3300022739	Bacteria	202413
126	Ga0228710_1000007	3300022740	Bacteria	189104
127	Ga0209435_100045	3300025206	Bacteria	96483
128	Ga0209436_100034	3300025208	Bacteria	80089
129	Ga0209436_103537	3300025208	Bacteria	4115
130	Ga0209672_104712	3300025228	Bacteria	2479
131	Ga0209437_100047	3300025233	Bacteria	405163
132	Ga0209437_100308	3300025233	Bacteria	66019
133	Ga0207425_1000024	3300025245	Bacteria	328978
134	Ga0207425_1001992	3300025245	Bacteria	7638
135	Ga0207425_1006229	3300025245	Bacteria	3287
136	Ga0209646_1000154	3300025246	Bacteria	96483
137	Ga0209026_1000002	3300025250	Bacteria	1136158
138	Ga0209026_1000177	3300025250	Bacteria	96629
139	Ga0209677_102447	3300025253	Bacteria	6976
140	Ga0209148_1000038	3300025254	Bacteria	493744
141	Ga0209148_1004788	3300025254	Bacteria	3240
142	Ga0209148_1005009	3300025254	Bacteria	3117
143	Ga0209759_1000062	3300025256	Bacteria	197996
144	Ga0209759_1000795	3300025256	Bacteria	25746
145	Ga0209129_1000069	3300025258	Bacteria	212790
146	Ga0209129_1000133	3300025258	Bacteria	126018
147	Ga0209129_1001906	3300025258	Bacteria	11001
148	Ga0209129_1002492	3300025258	Bacteria	8979
149	Ga0209129_1004911	3300025258	Bacteria	4987
150	Ga0209129_1005326	3300025258	Bacteria	4603
151	Ga0209233_1000027	3300025261	Bacteria	652089
152	Ga0209233_1000048	3300025261	Bacteria	453669
153	Ga0209233_1000069	3300025261	Bacteria	367639
154	Ga0209233_1000221	3300025261	Bacteria	104090
155	Ga0209233_1008255	3300025261	Bacteria	3234
156	Ga0209455_1000068	3300025272	Bacteria	310024
157	Ga0209673_1000013	3300025273	Bacteria	571633
158	Ga0209673_1000048	3300025273	Bacteria	287976
159	Ga0209673_1000448	3300025273	Bacteria	70096
160	Ga0209673_1002108	3300025273	Bacteria	14922
161	Ga0209673_1003476	3300025273	Bacteria	9255
162	Ga0209673_1007158	3300025273	Bacteria	5211
163	Ga0209673_1021452	3300025273	Bacteria	2258
164	Ga0209130_1000004	3300025284	Bacteria	633436
165	Ga0209130_1000021	3300025284	Bacteria	374278
166	Ga0209130_1000029	3300025284	Bacteria	323399
167	Ga0209676_1001711	3300025292	Bacteria	18937
168	Ga0209676_1004345	3300025292	Bacteria	7945
169	Ga0209025_1000033	3300025294	Bacteria	414511
170	Ga0209025_1000050	3300025294	Bacteria	331531
171	Ga0209025_1000572	3300025294	Bacteria	66863
172	Ga0209025_1000803	3300025294	Bacteria	50798
173	Ga0209025_1007047	3300025294	Bacteria	8513
174	Ga0209025_1017497	3300025294	Bacteria	4132
175	Ga0209564_1000275	3300025295	Bacteria	107884
176	Ga0209564_1000375	3300025295	Bacteria	82204
177	Ga0209564_1000570	3300025295	Bacteria	58555
178	Ga0209564_1000631	3300025295	Bacteria	53697
179	Ga0209564_1009645	3300025295	Bacteria	4563
180	Ga0209758_1000342	3300025297	Bacteria	86095
181	Ga0209758_1000421	3300025297	Bacteria	71884
182	Ga0209758_1000468	3300025297	Bacteria	66625
183	Ga0209758_1000942	3300025297	Bacteria	39264
184	Ga0209758_1003958	3300025297	Bacteria	12853
185	Ga0209758_1038163	3300025297	Bacteria	1846
186	Ga0209050_1001363	3300025298	Bacteria	26748
187	Ga0209050_1004988	3300025298	Bacteria	8635
188	Ga0209050_1005655	3300025298	Bacteria	7740
189	Ga0209256_1000644	3300025299	Bacteria	47455
190	Ga0209256_1000649	3300025299	Bacteria	47340
191	Ga0209256_1002453	3300025299	Bacteria	15124
192	Ga0209256_1009707	3300025299	Bacteria	4163
193	Ga0209256_1012706	3300025299	Bacteria	3190
194	Ga0207426_1000003	3300025302	Bacteria	1063212
195	Ga0207426_1000010	3300025302	Bacteria	796003
196	Ga0207426_1000039	3300025302	Bacteria	439937
197	Ga0207426_1000074	3300025302	Bacteria	323399
198	Ga0207426_1001225	3300025302	Bacteria	22624
199	Ga0209051_1000445	3300025303	Bacteria	55846
200	Ga0209051_1001553	3300025303	Bacteria	19008
201	Ga0209051_1004342	3300025303	Bacteria	8790
202	Ga0209051_1004443	3300025303	Bacteria	8636
203	Ga0209051_1019737	3300025303	Bacteria	2929
204	Ga0209051_1020359	3300025303	Bacteria	2859
205	Ga0209257_1001375	3300025304	Bacteria	29208
206	Ga0209257_1002758	3300025304	Bacteria	16612
207	Ga0207647_10064456	3300025904	Bacteria	2226
208	Ga0207684_10160933	3300025910	Bacteria	1933
209	Ga0207695_10000011	3300025913	Bacteria	910221
210	Ga0207671_10000314	3300025914	Bacteria	71414
211	Ga0207671_10185665	3300025914	Bacteria	1620
212	Ga0207694_10146215	3300025924	Bacteria	1903
213	Ga0207650_10030117	3300025925	Bacteria	3907
214	Ga0207687_10118999	3300025927	Bacteria	1972
215	Ga0207711_10219440	3300025941	Bacteria	1739
216	Ga0207667_10334154	3300025949	Bacteria	1547
217	Ga0207668_10184935	3300025972	Bacteria	1647
218	Ga0207640_10068433	3300025981	Bacteria	2380
219	Ga0207678_10328065	3300026067	Bacteria	1317
220	Ga0207698_10048248	3300026142	Bacteria	3231
221	Ga0207698_10054146	3300026142	Bacteria	3085
222	Ga0209281_1000036	3300027111	Bacteria	369415
223	Ga0209281_1000047	3300027111	Bacteria	326514
224	Ga0209281_1000128	3300027111	Bacteria	199265
225	Ga0209281_1000851	3300027111	Bacteria	26952
226	Ga0209371_1000058	3300027312	Bacteria	237920
227	Ga0209371_1001102	3300027312	Bacteria	20054
228	Ga0209371_1004687	3300027312	Bacteria	5806
229	Ga0209282_1000034	3300027666	Bacteria	140100
230	Ga0209813_10009710	3300027866	Bacteria	2471
231	Ga0209813_10025642	3300027866	Bacteria	1698
232	Ga0268266_10149112	3300028379	Bacteria	2106
233	Ga0268266_10198976	3300028379	Bacteria	1833
234	Ga0307515_10000198	3300028794	Bacteria	147738
235	Ga0307515_10001876	3300028794	Bacteria	46792
236	Ga0307515_10014201	3300028794	Bacteria	14800
237	Ga0307515_10088378	3300028794	Bacteria	3918
238	Ga0268256_1000056	3300030500	Bacteria	231684
239	Ga0268256_1001773	3300030500	Bacteria	12177
240	Ga0268256_1005673	3300030500	Bacteria	4835
241	Ga0307513_10108683	3300031456	Bacteria	2773
242	Ga0307513_10188010	3300031456	Bacteria	1920
243	Ga0307408_100021876	3300031548	Bacteria	4336
244	Ga0307408_100041668	3300031548	Bacteria	3256
245	Ga0307516_10170152	3300031730	Bacteria	1920
246	Ga0307406_10022052	3300031901	Bacteria	3775
247	Ga0307406_10063537	3300031901	Bacteria	2392
248	Ga0307412_10087316	3300031911	Bacteria	2173
249	Ga0315914_1000010	3300031967	Bacteria	171642
250	Ga0315913_1000005	3300033430	Bacteria	171651
251	Ga0315915_1000012	3300033464	Bacteria	199284
252	Ga0373927_0000343	3300035695	Bacteria	36640
253	Ga0373925_0014749	3300037068	Bacteria	5646
254	Ga0395899_0000059	3300037312	Bacteria	213004
255	Ga0395899_0095945	3300037312	Bacteria	2145
256	Ga0395900_0000017	3300037418	Bacteria	369602
257	Ga0395900_0030214	3300037418	Bacteria	5562
258	Ga0395900_0127135	3300037418	Bacteria	2614
259	Ga0395900_0155881	3300037418	Bacteria	2332
260	Ga0395898_0000030	3300037466	Bacteria	369577
261	Ga0395898_0014421	3300037466	Bacteria	8118
262	Ga0395905_0000056	3300037471	Bacteria	209230
263	Ga0395905_0000417	3300037471	Bacteria	59694
264	Ga0395905_0000510	3300037471	Bacteria	53278
265	Ga0395901_0000015	3300038443	Bacteria	373388
266	Ga0395901_0244841	3300038443	Bacteria	1869
267	Ga0395901_0329258	3300038443	Bacteria	1579
268	Ga0439436_0009875	3300041404	Bacteria	2920
269	Ga0439466_0035596	3300041411	Bacteria	1684
270	Ga0439465_0013135	3300041413	Bacteria	2585
271	Ga0439465_0022949	3300041413	Bacteria	1962
272	Ga0451835_0256069	3300041492	Bacteria	1631
273	Ga0451835_1189071	3300041492	Bacteria	2563
274	Ga0451845_0146031	3300041501	Bacteria	2241
275	Ga0451846_30130	3300041502	Bacteria	1869
276	Ga0451847_0621551	3300041503	Bacteria	2905
277	Ga0451849_0041359	3300041505	Bacteria	2528
278	Ga0451851_0923464	3300041507	Bacteria	4564
279	Ga0451854_07196	3300041510	Bacteria	4406
280	Ga0452268_06786	3300041907	Bacteria	5031
281	Ga0439449_0007360	3300042007	Bacteria	4182
282	Ga0439462_0025619	3300042015	Bacteria	1553
283	Ga0439434_0018439	3300042435	Bacteria	2089
284	Ga0466963_0051784	3300044694	Bacteria	2722
285	Ga0466970_0015775	3300044765	Bacteria	3889
286	Ga0466959_0076927	3300045049	Bacteria	2409
287	Ga0466958_0042182	3300045836	Bacteria	2747
288	Ga0495629_0160218	3300046459	Bacteria	1563
289	Ga0495638_0002485	3300046460	Bacteria	15005
290	Ga0495650_0052803	3300046471	Bacteria	1667
291	Ga0495605_0023979	3300046474	Bacteria	3199
292	Ga0495583_0054407	3300046506	Bacteria	1812
293	Ga0495606_0018841	3300046507	Bacteria	5161
294	Ga0495606_0029509	3300046507	Bacteria	3849
295	Ga0495610_0002799	3300046512	Bacteria	14263
296	Ga0495620_0029144	3300046515	Bacteria	2558
297	Ga0495628_0166695	3300046516	Bacteria	1672
298	Ga0495631_0022158	3300046518	Bacteria	2954
299	Ga0495632_0027307	3300046519	Bacteria	2991
300	Ga0495632_0027693	3300046519	Bacteria	2965
301	Ga0495648_0091838	3300046524	Bacteria	1697
302	Ga0495654_0003447	3300046530	Bacteria	9678
303	Ga0495609_0051549	3300046538	Bacteria	1832
304	Ga0495633_0066170	3300046558	Bacteria	1688
305	Ga0495668_0032833	3300046616	Bacteria	2918
306	Ga0495668_0095726	3300046616	Bacteria	1625
307	Ga0495625_0047434	3300046660	Bacteria	3097
308	Ga0495625_0120788	3300046660	Bacteria	1783
309	Ga0495635_0126913	3300046663	Bacteria	1740
310	Ga0495588_0063883	3300046674	Bacteria	1909
311	Ga0495670_0073833	3300046691	Bacteria	1729
312	Ga0495649_0064943	3300046694	Bacteria	1959
313	Ga0495600_0070526	3300046809	Bacteria	2283
314	Ga0495660_0077642	3300046810	Bacteria	1747
315	Ga0495636_0044016	3300047318	Bacteria	1858
316	Ga0495672_0029596	3300047320	Bacteria	3447
317	Ga0495681_0025409	3300047470	Bacteria	3099
318	Ga0495686_0008883	3300047472	Bacteria	7307
319	Ga0495686_0013897	3300047472	Bacteria	5571
320	Ga0496101_0093409	3300048904	Bacteria	2241
321	Ga0496102_0099204	3300048905	Bacteria	2703
322	Ga0496111_0015344	3300048914	Bacteria	5255
323	Ga0496112_0211109	3300048915	Bacteria	1898
324	Ga0496114_0096134	3300048917	Bacteria	2522
325	Ga0496116_0000061	3300048919	Bacteria	271860
326	Ga0496116_0004401	3300048919	Bacteria	13471
327	Ga0496116_0045167	3300048919	Bacteria	2985
328	Ga0496116_0089358	3300048919	Bacteria	1879
329	Ga0496116_0093161	3300048919	Bacteria	1825
330	Ga0496117_0000002	3300048920	Bacteria	2483758
331	Ga0496117_0001959	3300048920	Bacteria	27377
332	Ga0496117_0006730	3300048920	Bacteria	11478
333	Ga0496118_0016547	3300048921	Bacteria	6761
334	Ga0496118_0019839	3300048921	Bacteria	5992
335	Ga0496118_0099592	3300048921	Bacteria	1969
336	Ga0496119_0012124	3300048922	Bacteria	7038
337	Ga0496119_0040352	3300048922	Bacteria	2986
338	Ga0496119_0045823	3300048922	Bacteria	2737
339	Ga0496119_0086031	3300048922	Bacteria	1798
340	Ga0496119_0091589	3300048922	Bacteria	1726
341	Ga0496119_0095409	3300048922	Bacteria	1680
342	Ga0496120_0000951	3300048923	Bacteria	39539
343	Ga0496120_0011646	3300048923	Bacteria	6035
344	Ga0496120_0019985	3300048923	Bacteria	4269
345	Ga0496120_0030232	3300048923	Bacteria	3296
346	Ga0496120_0072803	3300048923	Bacteria	1882
347	Ga0496120_0104185	3300048923	Bacteria	1493
348	Ga0496120_0109420	3300048923	Bacteria	1446
349	Ga0496121_0000003	3300048924	Bacteria	1191431
350	Ga0496121_0002428	3300048924	Bacteria	28484
351	Ga0496121_0004370	3300048924	Bacteria	19103
352	Ga0496121_0007053	3300048924	Bacteria	13646
353	Ga0496121_0040901	3300048924	Bacteria	4060
354	Ga0496121_0042602	3300048924	Bacteria	3944
355	Ga0496121_0137797	3300048924	Bacteria	1815
356	Ga0496121_0155172	3300048924	Bacteria	1680
357	Ga0496122_0000001	3300048925	Bacteria	1827766
358	Ga0496122_0000025	3300048925	Bacteria	362915
359	Ga0496122_0000399	3300048925	Bacteria	92476
360	Ga0496122_0021330	3300048925	Bacteria	5803
361	Ga0496122_0111562	3300048925	Bacteria	1793
362	Ga0496122_0120091	3300048925	Bacteria	1697
363	Ga0496122_0133480	3300048925	Bacteria	1571
364	Ga0496123_0000001	3300048926	Bacteria	1831497
365	Ga0496123_0000032	3300048926	Bacteria	285282
366	Ga0496123_0003753	3300048926	Bacteria	16655
367	Ga0496123_0005051	3300048926	Bacteria	13491
368	Ga0496123_0029510	3300048926	Bacteria	4035
369	Ga0496123_0044610	3300048926	Bacteria	3030
370	Ga0496123_0069764	3300048926	Bacteria	2204
371	Ga0496123_0084650	3300048926	Bacteria	1911
372	Ga0496123_0099584	3300048926	Bacteria	1696
373	Ga0496123_0121238	3300048926	Bacteria	1470
374	Ga0496124_0001375	3300048927	Bacteria	36436
375	Ga0496124_0004615	3300048927	Bacteria	15952
376	Ga0496124_0018921	3300048927	Bacteria	6430
377	Ga0496124_0019978	3300048927	Bacteria	6209
378	Ga0496124_0024377	3300048927	Bacteria	5503
379	Ga0496124_0069460	3300048927	Bacteria	2925
380	Ga0496124_0076807	3300048927	Bacteria	2756
381	Ga0496124_0106276	3300048927	Bacteria	2266
382	Ga0496124_0107530	3300048927	Bacteria	2250
383	Ga0496124_0118368	3300048927	Bacteria	2120
384	Ga0496124_0152034	3300048927	Bacteria	1814
385	Ga0496124_0223896	3300048927	Bacteria	1412
386	Ga0496125_0000155	3300048928	Bacteria	151541
387	Ga0496125_0002230	3300048928	Bacteria	25774
388	Ga0496125_0147980	3300048928	Bacteria	1619
389	Ga0496125_0182353	3300048928	Bacteria	1397
390	Ga0496126_0000081	3300048929	Bacteria	218818
391	Ga0496126_0001055	3300048929	Bacteria	46595
392	Ga0496126_0025790	3300048929	Bacteria	5647
393	Ga0496126_0166709	3300048929	Bacteria	1879
394	Ga0501031_0000018	3300049568	Bacteria	106734
395	Ga0501031_0046757	3300049568	Bacteria	2822
396	Ga0501032_0000031	3300049569	Bacteria	130204
397	Ga0501032_0000201	3300049569	Bacteria	49742
398	Ga0501032_0126973	3300049569	Bacteria	1684
399	Ga0501033_0000126	3300049570	Bacteria	74250
400	Ga0501033_0000328	3300049570	Bacteria	45346
401	Ga0501033_0005198	3300049570	Bacteria	10340
402	Ga0501033_0006625	3300049570	Bacteria	9057
403	Ga0501033_0009424	3300049570	Bacteria	7517
404	Ga0501033_0018584	3300049570	Bacteria	5254
405	Ga0501033_0019815	3300049570	Bacteria	5084
406	Ga0501033_0052548	3300049570	Bacteria	3020
407	Ga0501034_0000005	3300049571	Bacteria	367512
408	Ga0501034_0000064	3300049571	Bacteria	189461
409	Ga0501034_0037998	3300049571	Bacteria	4876
410	Ga0501034_0054192	3300049571	Bacteria	4037
411	Ga0501034_0152540	3300049571	Bacteria	2286
412	Ga0501034_0173546	3300049571	Bacteria	2122
413	Ga0501034_0220655	3300049571	Bacteria	1848
414	Ga0501034_0255918	3300049571	Bacteria	1694
415	Ga0501036_0000005	3300049572	Bacteria	246420
416	Ga0501036_0005749	3300049572	Bacteria	10056
417	Ga0501036_0106937	3300049572	Bacteria	2366
418	Ga0501036_0196293	3300049572	Bacteria	1698
419	Ga0501037_0000045	3300049573	Bacteria	117148
420	Ga0501037_0005524	3300049573	Bacteria	9221
421	Ga0501037_0083410	3300049573	Bacteria	2315
422	Ga0501038_0000001	3300049574	Bacteria	375481
423	Ga0501038_0000205	3300049574	Bacteria	50558
424	Ga0501038_0093869	3300049574	Bacteria	2509
425	Ga0501038_0118340	3300049574	Bacteria	2188
426	Ga0501039_0000007	3300049575	Bacteria	277831
427	Ga0501039_0002792	3300049575	Bacteria	13046
428	Ga0501039_0259425	3300049575	Bacteria	1366
429	Ga0501040_0088602	3300049576	Bacteria	2149
430	Ga0501043_0000015	3300049579	Bacteria	175932
431	Ga0501043_0000107	3300049579	Bacteria	77469
432	Ga0501043_0079453	3300049579	Bacteria	2577
433	Ga0501043_0171229	3300049579	Bacteria	1694
434	Ga0501046_0109985	3300049580	Bacteria	2106
435	Ga0501047_0020996	3300049581	Bacteria	6273
436	Ga0501047_0148366	3300049581	Bacteria	2222
437	Ga0501047_0149101	3300049581	Bacteria	2215
438	Ga0501069_0000039	3300049585	Bacteria	82361
439	Ga0501069_0006899	3300049585	Bacteria	5935
440	Ga0501069_0072700	3300049585	Bacteria	1928
441	Ga0501070_0000132	3300049586	Bacteria	67092
442	Ga0501070_0000299	3300049586	Bacteria	46014
443	Ga0501070_0002117	3300049586	Bacteria	17410
444	Ga0501070_0017763	3300049586	Bacteria	5972
445	Ga0501070_0075084	3300049586	Bacteria	2798
446	Ga0501070_0176744	3300049586	Bacteria	1757
447	Ga0501070_0239182	3300049586	Bacteria	1486
448	Ga0501072_0101090	3300049588	Bacteria	2292
449	Ga0501073_0091475	3300049589	Bacteria	2115
450	Ga0501073_0094710	3300049589	Bacteria	2074
451	Ga0501074_0012781	3300049590	Bacteria	6104
452	Ga0501074_0029210	3300049590	Bacteria	3993
453	Ga0501079_0195359	3300049741	Bacteria	1580
454	Ga0501079_0201946	3300049741	Bacteria	1553
455	Ga0501080_0001676	3300049742	Bacteria	18865
456	Ga0501080_0003023	3300049742	Bacteria	14830
457	Ga0501080_0054458	3300049742	Bacteria	3725
458	Ga0501083_0011832	3300049744	Bacteria	6114
459	Ga0501083_0037699	3300049744	Bacteria	3290
460	Ga0501280_006361	3300049776	Bacteria	1666
461	Ga0501035_0000008	3300049822	Bacteria	313425
462	Ga0501035_0000055	3300049822	Bacteria	139471
463	Ga0501035_0000436	3300049822	Bacteria	46832
464	Ga0501035_0000807	3300049822	Bacteria	33393
465	Ga0501035_0011205	3300049822	Bacteria	8304
466	Ga0501035_0013030	3300049822	Bacteria	7674
467	Ga0501035_0022239	3300049822	Bacteria	5823
468	Ga0501035_0076459	3300049822	Bacteria	2961
469	Ga0501035_0103199	3300049822	Bacteria	2501
470	Ga0501035_0198987	3300049822	Bacteria	1719
471	Ga0501035_0214580	3300049822	Bacteria	1645
472	Ga0501044_0000001	3300049823	Bacteria	418087
473	Ga0501044_0000071	3300049823	Bacteria	124531
474	Ga0501044_0015843	3300049823	Bacteria	8112
475	Ga0501044_0077649	3300049823	Bacteria	3367
476	Ga0501044_0094218	3300049823	Bacteria	3019
477	Ga0501044_0117822	3300049823	Bacteria	2659
478	Ga0501044_0125074	3300049823	Bacteria	2569
479	Ga0501044_0134921	3300049823	Bacteria	2460
480	Ga0501044_0198510	3300049823	Bacteria	1965
481	Ga0501044_0259893	3300049823	Bacteria	1675
482	Ga0501044_0344265	3300049823	Bacteria	1411
483	nmdc:mga03683_23638_c1	3300050489	Bacteria	2396
484	nmdc:mga00v17_32449_c1	3300050491	Bacteria	3087
485	nmdc:mga00v17_40_c1	3300050491	Bacteria	80338
486	nmdc:mga0k408_3552_c1	3300050493	Bacteria	8244
487	nmdc:mga06z11_33750_c1	3300050494	Bacteria	2506
488	nmdc:mga06z11_50789_c1	3300050494	Bacteria	2121
489	nmdc:mga06z11_8900_c1	3300050494	Bacteria	4209
490	nmdc:mga04h51_25073_c1	3300050495	Bacteria	1832
491	nmdc:mga04h51_6935_c1	3300050495	Bacteria	2968
492	nmdc:mga0sz30_265_c1	3300050516	Bacteria	20071
493	Ga0500610_0019178	3300053079	Bacteria	3321
494	Ga0500569_004528	3300053109	Bacteria	2926
495	Ga0500594_0020946	3300053118	Bacteria	1636
496	Ga0500595_042801	3300053119	Bacteria	1446
497	Ga0500608_050812	3300053122	Bacteria	1992
498	Ga0500618_000190	3300053125	Bacteria	50341
499	Ga0500618_002477	3300053125	Bacteria	6938
500	Ga0500618_007115	3300053125	Bacteria	3220
501	Ga0500618_020276	3300053125	Bacteria	1629
502	Ga0500658_0000262	3300053134	Bacteria	24241
503	Ga0500559_0026912	3300053136	Bacteria	2452
504	Ga0500559_0043255	3300053136	Bacteria	1968
505	Ga0500561_0013766	3300053137	Bacteria	1760
506	Ga0500568_0000118	3300053139	Bacteria	70929
507	Ga0500568_0033924	3300053139	Bacteria	2090
508	Ga0500573_0010605	3300053140	Bacteria	5143
509	Ga0500590_062869	3300053148	Bacteria	1861
510	Ga0500616_0000805	3300053153	Bacteria	35836
511	Ga0500616_0001206	3300053153	Bacteria	26198
512	Ga0500616_0006291	3300053153	Bacteria	7802
513	Ga0500616_0017735	3300053153	Bacteria	4036
514	Ga0500622_0000830	3300053156	Bacteria	26470
515	Ga0500622_0015568	3300053156	Bacteria	4072
516	Ga0500622_0047851	3300053156	Bacteria	2207
517	Ga0500627_0072548	3300053158	Bacteria	1526
518	Ga0500633_0021152	3300053160	Bacteria	1974
519	Ga0500634_0009966	3300053161	Bacteria	4837
520	Ga0500636_0000115	3300053177	Bacteria	41660
521	Ga0500636_0114380	3300053177	Bacteria	1520
522	Ga0587088_001884	3300059508	Bacteria	2276
523	Ga0587090_000175	3300059510	Bacteria	4472
524	Ga0587067_004174	3300059640	Bacteria	1862
525	Ga0587072_000265	3300059643	Bacteria	4850
526	Ga0501082_0046340	3300060353	Bacteria	3748
527	Ga0501082_0153192	3300060353	Bacteria	2003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2979742915	2979750903	346
2	iso_pu_bacteria	2871451962	2871456845	349
3	iso_pu_bacteria	2938014810	2938020400	351
4	iso_pu_bacteria	2958158011	2958161140	358
5	3300035695	Ga0373927_0000343	Ga0373927_0000343_16617_17885	359
6	3300037068	Ga0373925_0014749	Ga0373925_0014749_4237_5505	359
7	iso_pu_bacteria	2885334103	2885340282	361
8	iso_pu_bacteria	2958108152	2958110533	365
9	iso_pu_bacteria	2878781027	2878781210	370
10	iso_pu_bacteria	2906401398	2906404579	370
11	iso_pu_bacteria	3004239961	3004246193	377
12	3300005983	Ga0081540_1059561	Ga0081540_10595612	382
13	3300037471	Ga0395905_0000417	Ga0395905_0000417_4548_5822	382
14	iso_pu_bacteria	2871459585	2871464141	383
15	3300048922	Ga0496119_0095409	Ga0496119_0095409_172_1401	387
16	3300005548	Ga0070665_100176084	Ga0070665_1001760842	389
17	3300009098	Ga0105245_10188839	Ga0105245_101888392	389
18	3300025927	Ga0207687_10118999	Ga0207687_101189992	389
19	3300046516	Ga0495628_0166695	Ga0495628_0166695_127_1401	391
20	3300046663	Ga0495635_0126913	Ga0495635_0126913_152_1426	391
21	iso_pu_bacteria	2937868953	2937869174	394
22	3300048929	Ga0496126_0000081	Ga0496126_0000081_24065_25342	396
23	iso_pu_bacteria	2922130491	2922136812	397
24	3300048919	Ga0496116_0000061	Ga0496116_0000061_11255_12532	398
25	3300048925	Ga0496122_0133480	Ga0496122_0133480_147_1424	398
26	iso_pu_bacteria	2837678835	2837680096	398
27	3300003354	JGI25160J50197_1001320	JGI25160J50197_10013208	400
28	3300003374	JGI25161J50226_1005791	JGI25161J50226_10057912	400
29	3300004625	Ga0055543_1001284	Ga0055543_10012844	400
30	3300006038	Ga0075365_10019843	Ga0075365_100198434	400
31	3300025302	Ga0207426_1000039	Ga0207426_100003926	400
32	3300046507	Ga0495606_0018841	Ga0495606_0018841_3569_4837	400
33	iso_pu_bacteria	2894817345	2894818349	400
34	3300025273	Ga0209673_1000448	Ga0209673_100044866	401
35	iso_pu_bacteria	8045864390	8045865262	401
36	3300003187	JGI25151J46595_10000479	JGI25151J46595_1000047936	403
37	3300003187	JGI25151J46595_10003717	JGI25151J46595_100037178	403
38	3300003215	JGI25153J46596_10015117	JGI25153J46596_100151172	403
39	3300006353	Ga0075370_10033108	Ga0075370_100331082	403
40	3300025245	Ga0207425_1001992	Ga0207425_10019925	403
41	3300025258	Ga0209129_1001906	Ga0209129_10019069	403
42	3300025294	Ga0209025_1000572	Ga0209025_100057226	403
43	3300025297	Ga0209758_1000342	Ga0209758_100034265	403
44	3300025303	Ga0209051_1019737	Ga0209051_10197372	403
45	3300046459	Ga0495629_0160218	Ga0495629_0160218_156_1481	403
46	3300053148	Ga0500590_062869	Ga0500590_062869_234_1508	403
47	3300027312	Ga0209371_1004687	Ga0209371_10046872	404
48	3300030500	Ga0268256_1005673	Ga0268256_10056732	404
49	3300048922	Ga0496119_0012124	Ga0496119_0012124_1723_2991	404
50	3300048926	Ga0496123_0069764	Ga0496123_0069764_72_1340	404
51	iso_pu_bacteria	2977957713	2977959214	407
52	3300048927	Ga0496124_0076807	Ga0496124_0076807_340_1581	409
53	3300048922	Ga0496119_0040352	Ga0496119_0040352_464_1738	410
54	3300049568	Ga0501031_0046757	Ga0501031_0046757_820_2088	410
55	3300049569	Ga0501032_0000031	Ga0501032_0000031_18823_20091	410
56	3300049570	Ga0501033_0000126	Ga0501033_0000126_6852_8120	410
57	3300049571	Ga0501034_0000064	Ga0501034_0000064_169371_170639	410
58	3300049572	Ga0501036_0005749	Ga0501036_0005749_7085_8353	410
59	3300049573	Ga0501037_0005524	Ga0501037_0005524_940_2208	410
60	3300049574	Ga0501038_0000205	Ga0501038_0000205_15128_16396	410
61	3300049575	Ga0501039_0002792	Ga0501039_0002792_7029_8297	410
62	3300049579	Ga0501043_0000015	Ga0501043_0000015_38544_39812	410
63	3300049580	Ga0501046_0109985	Ga0501046_0109985_48_1316	410
64	3300049822	Ga0501035_0000436	Ga0501035_0000436_7044_8312	410
65	3300049823	Ga0501044_0198510	Ga0501044_0198510_175_1443	410
66	3300025914	Ga0207671_10185665	Ga0207671_101856651	411
67	3300038443	Ga0395901_0329258	Ga0395901_0329258_10_1305	411
68	3300003771	Ga0055526_1007269	Ga0055526_10072692	412
69	3300003775	Ga0055524_1003842	Ga0055524_10038424	412
70	3300006177	Ga0075362_10014572	Ga0075362_100145722	412
71	3300006178	Ga0075367_10002190	Ga0075367_100021908	412
72	3300006195	Ga0075366_10013815	Ga0075366_100138153	412
73	3300025295	Ga0209564_1000375	Ga0209564_100037522	412
74	3300049776	Ga0501280_006361	Ga0501280_006361_73_1350	412
75	3300050489	nmdc:mga03683_23638_c1	nmdc:mga03683_23638_c1_952_2226	412
76	3300050493	nmdc:mga0k408_3552_c1	nmdc:mga0k408_3552_c1_440_1714	412
77	3300050494	nmdc:mga06z11_50789_c1	nmdc:mga06z11_50789_c1_293_1567	412
78	iso_pu_bacteria	2551306087	2551704632	412
79	3300048923	Ga0496120_0011646	Ga0496120_0011646_1714_2985	413
80	3300049571	Ga0501034_0152540	Ga0501034_0152540_742_2010	414
81	3300003762	Ga0055542_1001387	Ga0055542_10013875	416
82	3300003762	Ga0055542_1002854	Ga0055542_10028543	416
83	3300005471	Ga0070698_100049413	Ga0070698_1000494135	416
84	3300025254	Ga0209148_1000038	Ga0209148_1000038333	416
85	3300025272	Ga0209455_1000068	Ga0209455_100006893	416
86	iso_pu_bacteria	2643221623	2644130093	416
87	iso_pu_bacteria	2738543024	2739308868	416
88	iso_pu_bacteria	2984509177	2984511767	416
89	iso_pu_bacteria	2984518228	2984521873	416
90	iso_pu_bacteria	2984537506	2984541171	416
91	iso_pu_bacteria	8002285264	8002285424	416
92	iso_pu_bacteria	2503198000	2503202881	417
93	iso_pu_bacteria	2508501123	2509115393	417
94	iso_pu_bacteria	2508501127	2509143732	417
95	iso_pu_bacteria	2509276018	2509372287	417
96	iso_pu_bacteria	2510065059	2510317811	417
97	iso_pu_bacteria	2512875016	2512930345	417
98	iso_pu_bacteria	2512875024	2512958062	417
99	iso_pu_bacteria	2513237090	2513610041	417
100	iso_pu_bacteria	2513237164	2514032799	417
101	iso_pu_bacteria	2513237305	2514422590	417
102	iso_pu_bacteria	2513237351	2514588759	417
103	iso_pu_bacteria	2599185301	2599938198	417
104	iso_pu_bacteria	2643221550	2643770545	417
105	iso_pu_bacteria	2643221551	2643774976	417
106	iso_pu_bacteria	2643221555	2643793420	417
107	iso_pu_bacteria	2643221564	2643840649	417
108	iso_pu_bacteria	2643221595	2643989642	417
109	iso_pu_bacteria	2643221627	2644157734	417
110	iso_pu_bacteria	2687453392	2688599741	417
111	iso_pu_bacteria	2693429783	2694630587	417
112	iso_pu_bacteria	2693429784	2694639357	417
113	iso_pu_bacteria	2756170246	2756676067	417
114	iso_pu_bacteria	2791355123	2792748731	417
115	iso_pu_bacteria	2841734538	2841740686	417
116	iso_pu_bacteria	2844002411	2844007034	417
117	iso_pu_bacteria	2844009547	2844015029	417
118	iso_pu_bacteria	2847670302	2847676188	417
119	iso_pu_bacteria	2847686936	2847692842	417
120	iso_pu_bacteria	2856314179	2856315974	417
121	iso_pu_bacteria	2856320880	2856324788	417
122	iso_pu_bacteria	2856328259	2856333018	417
123	iso_pu_bacteria	2856334872	2856339070	417
124	iso_pu_bacteria	2856342000	2856346469	417
125	iso_pu_bacteria	2856349417	2856356252	417
126	iso_pu_bacteria	2856364286	2856368707	417
127	iso_pu_bacteria	2857349434	2857350411	417
128	iso_pu_bacteria	2869162929	2869167231	417
129	iso_pu_bacteria	2869169390	2869176973	417
130	iso_pu_bacteria	2869234852	2869237407	417
131	iso_pu_bacteria	2869249662	2869251426	417
132	iso_pu_bacteria	2869256925	2869257362	417
133	iso_pu_bacteria	2869264136	2869266938	417
134	iso_pu_bacteria	2869271264	2869272374	417
135	iso_pu_bacteria	2869278585	2869281221	417
136	iso_pu_bacteria	2869285874	2869291202	417
137	iso_pu_bacteria	2871429161	2871433482	417
138	iso_pu_bacteria	2871435913	2871440039	417
139	iso_pu_bacteria	2871444079	2871444492	417
140	iso_pu_bacteria	2871474448	2871476089	417
141	iso_pu_bacteria	2871481445	2871487433	417
142	iso_pu_bacteria	2871488783	2871495898	417
143	iso_pu_bacteria	2871495908	2871503112	417
144	iso_pu_bacteria	2874102143	2874105964	417
145	iso_pu_bacteria	2874109183	2874114699	417
146	iso_pu_bacteria	2874116593	2874119346	417
147	iso_pu_bacteria	2874123672	2874126103	417
148	iso_pu_bacteria	2874131515	2874134268	417
149	iso_pu_bacteria	2874139085	2874141175	417
150	iso_pu_bacteria	2874146452	2874153083	417
151	iso_pu_bacteria	2874155637	2874160348	417
152	iso_pu_bacteria	2874162495	2874165251	417
153	iso_pu_bacteria	2874168670	2874170846	417
154	iso_pu_bacteria	2876363079	2876368313	417
155	iso_pu_bacteria	2876369609	2876371533	417
156	iso_pu_bacteria	2876386047	2876392737	417
157	iso_pu_bacteria	2876392853	2876394854	417
158	iso_pu_bacteria	2876399893	2876400904	417
159	iso_pu_bacteria	2876413966	2876419374	417
160	iso_pu_bacteria	2876420981	2876425702	417
161	iso_pu_bacteria	2878035449	2878040242	417
162	iso_pu_bacteria	2878738818	2878742896	417
163	iso_pu_bacteria	2878745973	2878751093	417
164	iso_pu_bacteria	2878753008	2878753304	417
165	iso_pu_bacteria	2878760144	2878767001	417
166	iso_pu_bacteria	2878767105	2878774199	417
167	iso_pu_bacteria	2878774303	2878776204	417
168	iso_pu_bacteria	2881147464	2881152211	417
169	iso_pu_bacteria	2881155292	2881156480	417
170	iso_pu_bacteria	2881161766	2881168184	417
171	iso_pu_bacteria	2881845957	2881847297	417
172	iso_pu_bacteria	2881861095	2881864339	417
173	iso_pu_bacteria	2882632389	2882633305	417
174	iso_pu_bacteria	2882912400	2882915084	417
175	iso_pu_bacteria	2885305155	2885310063	417
176	iso_pu_bacteria	2885312484	2885316798	417
177	iso_pu_bacteria	2885318864	2885326073	417
178	iso_pu_bacteria	2885326080	2885329552	417
179	iso_pu_bacteria	2885350715	2885352466	417
180	iso_pu_bacteria	2888337043	2888340920	417
181	iso_pu_bacteria	2888343758	2888348122	417
182	iso_pu_bacteria	2888350351	2888356424	417
183	iso_pu_bacteria	2889010040	2889011336	417
184	iso_pu_bacteria	2889016732	2889016934	417
185	iso_pu_bacteria	2889790730	2889793686	417
186	iso_pu_bacteria	2889914905	2889919511	417
187	iso_pu_bacteria	2903448605	2903452331	417
188	iso_pu_bacteria	2903492973	2903495158	417
189	iso_pu_bacteria	2903492973	2903503149	417
190	iso_pu_bacteria	2903521522	2903527309	417
191	iso_pu_bacteria	2903528002	2903531455	417
192	iso_pu_bacteria	2903540706	2903548301	417
193	iso_pu_bacteria	2904659560	2904661485	417
194	iso_pu_bacteria	2906308376	2906313034	417
195	iso_pu_bacteria	2906321335	2906325745	417
196	iso_pu_bacteria	2906328253	2906328913	417
197	iso_pu_bacteria	2906354277	2906356025	417
198	iso_pu_bacteria	2906363423	2906368307	417
199	iso_pu_bacteria	2906370794	2906374918	417
200	iso_pu_bacteria	2906386501	2906391581	417
201	iso_pu_bacteria	2906393657	2906397342	417
202	iso_pu_bacteria	2906408224	2906410873	417
203	iso_pu_bacteria	2906414383	2906416111	417
204	iso_pu_bacteria	2906427513	2906432425	417
205	iso_pu_bacteria	2922151315	2922157916	417
206	iso_pu_bacteria	2922158528	2922165544	417
207	iso_pu_bacteria	2922172374	2922177287	417
208	iso_pu_bacteria	2922185730	2922191462	417
209	iso_pu_bacteria	2924710171	2924715358	417
210	iso_pu_bacteria	2924726620	2924732341	417
211	iso_pu_bacteria	2924733363	2924734982	417
212	iso_pu_bacteria	2924741084	2924741911	417
213	iso_pu_bacteria	2924748358	2924754265	417
214	iso_pu_bacteria	2924754689	2924757758	417
215	iso_pu_bacteria	2924762789	2924765174	417
216	iso_pu_bacteria	2924776078	2924780696	417
217	iso_pu_bacteria	2924784321	2924789786	417
218	iso_pu_bacteria	2937813078	2937820814	417
219	iso_pu_bacteria	2937836603	2937836860	417
220	iso_pu_bacteria	2937843397	2937845691	417
221	iso_pu_bacteria	2937848649	2937854331	417
222	iso_pu_bacteria	2937861824	2937864476	417
223	iso_pu_bacteria	2937877337	2937879800	417
224	iso_pu_bacteria	2937891427	2937893951	417
225	iso_pu_bacteria	2937972304	2937974690	417
226	iso_pu_bacteria	2937994558	2938002125	417
227	iso_pu_bacteria	2958034702	2958037183	417
228	iso_pu_bacteria	2958041894	2958046895	417
229	iso_pu_bacteria	2958041894	2958057805	417
230	iso_pu_bacteria	2958064165	2958067410	417
231	iso_pu_bacteria	2958071322	2958076957	417
232	iso_pu_bacteria	2958084443	2958086978	417
233	iso_pu_bacteria	2958092219	2958098108	417
234	iso_pu_bacteria	2958100919	2958106156	417
235	iso_pu_bacteria	2958115193	2958122149	417
236	iso_pu_bacteria	2958122699	2958126553	417
237	iso_pu_bacteria	2958130278	2958135603	417
238	iso_pu_bacteria	2958137437	2958142231	417
239	iso_pu_bacteria	2958165035	2958172179	417
240	iso_pu_bacteria	2958172287	2958174747	417
241	iso_pu_bacteria	2958179912	2958185094	417
242	iso_pu_bacteria	2961077736	2961083361	417
243	iso_pu_bacteria	2961114664	2961116637	417
244	iso_pu_bacteria	2961127735	2961131899	417
245	iso_pu_bacteria	2961136820	2961138865	417
246	iso_pu_bacteria	2961163497	2961170627	417
247	iso_pu_bacteria	2961170736	2961177748	417
248	iso_pu_bacteria	2961183825	2961184516	417
249	iso_pu_bacteria	2963644680	2963648886	417
250	iso_pu_bacteria	2965018300	2965025374	417
251	iso_pu_bacteria	2965025482	2965027984	417
252	iso_pu_bacteria	2965040258	2965041077	417
253	iso_pu_bacteria	2965047637	2965050089	417
254	iso_pu_bacteria	2965062239	2965065506	417
255	iso_pu_bacteria	2965089291	2965090403	417
256	iso_pu_bacteria	2965119406	2965121509	417
257	iso_pu_bacteria	2967996073	2968003015	417
258	iso_pu_bacteria	2968003550	2968003840	417
259	iso_pu_bacteria	2968016561	2968019999	417
260	iso_pu_bacteria	2968083720	2968084111	417
261	iso_pu_bacteria	2968091066	2968095958	417
262	iso_pu_bacteria	2968097103	2968099727	417
263	iso_pu_bacteria	2968110612	2968112544	417
264	iso_pu_bacteria	2968117919	2968121319	417
265	iso_pu_bacteria	2968128360	2968130849	417
266	iso_pu_bacteria	2968138860	2968142228	417
267	iso_pu_bacteria	2968171901	2968179013	417
268	iso_pu_bacteria	2970469710	2970473320	417
269	iso_pu_bacteria	2970489779	2970495442	417
270	iso_pu_bacteria	2970503327	2970510424	417
271	iso_pu_bacteria	2970510686	2970514125	417
272	iso_pu_bacteria	2970547951	2970552113	417
273	iso_pu_bacteria	2970554993	2970561857	417
274	iso_pu_bacteria	2970593180	2970595825	417
275	iso_pu_bacteria	2970619444	2970620362	417
276	iso_pu_bacteria	2977821940	2977822756	417
277	iso_pu_bacteria	2977828996	2977833223	417
278	iso_pu_bacteria	2977843712	2977849112	417
279	iso_pu_bacteria	2977851361	2977851367	417
280	iso_pu_bacteria	2977858184	2977864461	417
281	iso_pu_bacteria	2977864932	2977872396	417
282	iso_pu_bacteria	2977872689	2977874469	417
283	iso_pu_bacteria	2977907340	2977909719	417
284	iso_pu_bacteria	2977922695	2977926741	417
285	iso_pu_bacteria	2977935797	2977936272	417
286	iso_pu_bacteria	2977942078	2977948121	417
287	iso_pu_bacteria	2977971508	2977979636	417
288	iso_pu_bacteria	2977986579	2977992438	417
289	iso_pu_bacteria	2979710463	2979712217	417
290	iso_pu_bacteria	2979772303	2979777367	417
291	iso_pu_bacteria	2979779861	2979781439	417
292	iso_pu_bacteria	2979793036	2979794398	417
293	iso_pu_bacteria	2979808191	2979815298	417
294	iso_pu_bacteria	2987636660	2987637597	417
295	iso_pu_bacteria	2987645492	2987650677	417
296	iso_pu_bacteria	2987652177	2987653283	417
297	iso_pu_bacteria	2987659509	2987666866	417
298	iso_pu_bacteria	2987666974	2987667783	417
299	iso_pu_bacteria	2987673487	2987675636	417
300	iso_pu_bacteria	2995392953	2995395060	417
301	iso_pu_bacteria	2996310559	2996310751	417
302	iso_pu_bacteria	2996336353	2996340693	417
303	iso_pu_bacteria	2996341866	2996348447	417
304	iso_pu_bacteria	2996348954	2996351489	417
305	iso_pu_bacteria	2996386984	2996389381	417
306	iso_pu_bacteria	3000135777	3000138863	417
307	iso_pu_bacteria	3004167301	3004170451	417
308	iso_pu_bacteria	3004188549	3004195870	417
309	iso_pu_bacteria	3004203850	3004206081	417
310	iso_pu_bacteria	3004211236	3004215044	417
311	iso_pu_bacteria	3004218560	3004222365	417
312	iso_pu_bacteria	3004232784	3004236833	417
313	iso_pu_bacteria	3004248173	3004250035	417
314	iso_pu_bacteria	3004268573	3004274407	417
315	iso_pu_bacteria	3004275668	3004278189	417
316	iso_pu_bacteria	3004334049	3004339927	417
317	iso_pu_bacteria	649633066	649874246	417
318	iso_pu_bacteria	8004300914	8004302583	417
319	iso_pu_bacteria	8004312739	8004315346	417
320	iso_pu_bacteria	8004361976	8004364182	417
321	iso_pu_bacteria	8004374579	8004374876	417
322	iso_pu_bacteria	8004387939	8004394242	417
323	iso_pu_bacteria	8004445564	8004446074	417
324	iso_pu_bacteria	8004633249	8004638215	417
325	iso_pu_bacteria	8004640170	8004642036	417
326	iso_pu_bacteria	8004703790	8004713583	417
327	iso_pu_bacteria	8004714634	8004719292	417
328	iso_pu_bacteria	8004727605	8004729667	417
329	iso_pu_bacteria	8055617313	8055622237	417
330	3300025910	Ga0207684_10160933	Ga0207684_101609332	418
331	iso_pu_bacteria	2537561587	2537875898	418
332	iso_pu_bacteria	2554235003	2554247985	418
333	iso_pu_bacteria	2558860242	2559295103	418
334	iso_pu_bacteria	2599185210	2599601415	418
335	iso_pu_bacteria	2600254933	2600374580	418
336	iso_pu_bacteria	2643221568	2643854516	418
337	iso_pu_bacteria	2643221582	2643919514	418
338	iso_pu_bacteria	2643221693	2644520253	418
339	iso_pu_bacteria	2751185800	2753359239	418
340	iso_pu_bacteria	2757320392	2757570896	418
341	iso_pu_bacteria	2808606387	2808985183	418
342	iso_pu_bacteria	2818991439	2819559615	418
343	iso_pu_bacteria	2838675328	2838676043	418
344	iso_pu_bacteria	2838714209	2838714925	418
345	iso_pu_bacteria	2838719591	2838721274	418
346	iso_pu_bacteria	2838724970	2838725685	418
347	iso_pu_bacteria	2841846520	2841848240	418
348	iso_pu_bacteria	2841859092	2841859215	418
349	iso_pu_bacteria	2842124991	2842125730	418
350	iso_pu_bacteria	2842130223	2842130938	418
351	iso_pu_bacteria	2842152218	2842153892	418
352	iso_pu_bacteria	2842170452	2842171169	418
353	iso_pu_bacteria	2842175837	2842177512	418
354	iso_pu_bacteria	2842187318	2842188034	418
355	iso_pu_bacteria	2842211629	2842212345	418
356	iso_pu_bacteria	2842224351	2842226036	418
357	iso_pu_bacteria	2842515876	2842515999	418
358	iso_pu_bacteria	2891048133	2891051803	418
359	iso_pu_bacteria	2899792073	2899794001	418
360	iso_pu_bacteria	2899845264	2899846392	418
361	iso_pu_bacteria	2915650412	2915651760	418
362	iso_pu_bacteria	2919114240	2919115015	418
363	iso_pu_bacteria	2919166419	2919168854	418
364	iso_pu_bacteria	2926754445	2926755980	418
365	iso_pu_bacteria	2926760298	2926763077	418
366	iso_pu_bacteria	2933006813	2933008538	418
367	iso_pu_bacteria	2933594066	2933596870	418
368	iso_pu_bacteria	2978969890	2978971541	418
369	iso_pu_bacteria	2979089926	2979094429	418
370	iso_pu_bacteria	2979095461	2979098188	418
371	iso_pu_bacteria	2979100975	2979103669	418
372	iso_pu_bacteria	2984587000	2984588686	418
373	iso_pu_bacteria	2984601300	2984603451	418
374	iso_pu_bacteria	650716007	650740306	418
375	iso_pu_bacteria	8003570095	8003571357	418
376	iso_pu_bacteria	8054460903	8054462892	418
377	3300010375	Ga0105239_10269779	Ga0105239_102697792	419
378	3300048922	Ga0496119_0086031	Ga0496119_0086031_58_1320	419
379	iso_pu_bacteria	2508501122	2509107605	419
380	iso_pu_bacteria	2509276019	2509375937	419
381	iso_pu_bacteria	2509276021	2509386759	419
382	iso_pu_bacteria	2509276033	2509443170	419
383	iso_pu_bacteria	2510065019	2510133236	419
384	iso_pu_bacteria	2510065057	2510306403	419
385	iso_pu_bacteria	2510461076	2510894602	419
386	iso_pu_bacteria	2510917022	2511135041	419
387	iso_pu_bacteria	2510917026	2511168725	419
388	iso_pu_bacteria	2510917028	2511182343	419
389	iso_pu_bacteria	2510917030	2511200013	419
390	iso_pu_bacteria	2511231027	2511388347	419
391	iso_pu_bacteria	2511231052	2511501699	419
392	iso_pu_bacteria	2512047086	2512533149	419
393	iso_pu_bacteria	2512875026	2512971346	419
394	iso_pu_bacteria	2513237084	2513572294	419
395	iso_pu_bacteria	2513237085	2513579650	419
396	iso_pu_bacteria	2513237086	2513585339	419
397	iso_pu_bacteria	2513237088	2513594514	419
398	iso_pu_bacteria	2513237089	2513604056	419
399	iso_pu_bacteria	2513237091	2513619744	419
400	iso_pu_bacteria	2513237093	2513634417	419
401	iso_pu_bacteria	2513237103	2513708809	419
402	iso_pu_bacteria	2513237138	2513864572	419
403	iso_pu_bacteria	2513237140	2513883679	419
404	iso_pu_bacteria	2513237143	2513905383	419
405	iso_pu_bacteria	2513237144	2513913098	419
406	iso_pu_bacteria	2513237146	2513926317	419
407	iso_pu_bacteria	2513237156	2513987396	419
408	iso_pu_bacteria	2513237159	2513997279	419
409	iso_pu_bacteria	2513237160	2514006282	419
410	iso_pu_bacteria	2513237162	2514021551	419
411	iso_pu_bacteria	2515075009	2515112192	419
412	iso_pu_bacteria	2515154107	2515608570	419
413	iso_pu_bacteria	2515154113	2515637255	419
414	iso_pu_bacteria	2515154114	2515639696	419
415	iso_pu_bacteria	2515154116	2515657340	419
416	iso_pu_bacteria	2515154134	2515738655	419
417	iso_pu_bacteria	2516143018	2516209467	419
418	iso_pu_bacteria	2516653046	2516892999	419
419	iso_pu_bacteria	2516653077	2517035924	419
420	iso_pu_bacteria	2516653085	2517076320	419
421	iso_pu_bacteria	2517093000	2517095076	419
422	iso_pu_bacteria	2517287029	2517406708	419
423	iso_pu_bacteria	2517487022	2517569771	419
424	iso_pu_bacteria	2519899620	2520379334	419
425	iso_pu_bacteria	2524023207	2524453037	419
426	iso_pu_bacteria	2524023209	2524460351	419
427	iso_pu_bacteria	2529292951	2530645451	419
428	iso_pu_bacteria	2534681796	2535516427	419
429	iso_pu_bacteria	2551306084	2551677748	419
430	iso_pu_bacteria	2551306085	2551686357	419
431	iso_pu_bacteria	2551306086	2551690831	419
432	iso_pu_bacteria	2551306089	2551715376	419
433	iso_pu_bacteria	2551306090	2551720195	419
434	iso_pu_bacteria	2551306091	2551725864	419
435	iso_pu_bacteria	2551306093	2551744561	419
436	iso_pu_bacteria	2558860100	2558868212	419
437	iso_pu_bacteria	2558860983	2561466448	419
438	iso_pu_bacteria	2582581283	2585165914	419
439	iso_pu_bacteria	2582581294	2585200093	419
440	iso_pu_bacteria	2582581298	2585224273	419
441	iso_pu_bacteria	2582581299	2585232825	419
442	iso_pu_bacteria	2582581304	2585254684	419
443	iso_pu_bacteria	2582581306	2585267934	419
444	iso_pu_bacteria	2582581307	2585270780	419
445	iso_pu_bacteria	2582581308	2585277132	419
446	iso_pu_bacteria	2582581315	2585323859	419
447	iso_pu_bacteria	2582581316	2585331837	419
448	iso_pu_bacteria	2582581865	2585386962	419
449	iso_pu_bacteria	2582581866	2585396866	419
450	iso_pu_bacteria	2582581867	2585401940	419
451	iso_pu_bacteria	2585427526	2585527563	419
452	iso_pu_bacteria	2585427527	2585534132	419
453	iso_pu_bacteria	2585427528	2585537459	419
454	iso_pu_bacteria	2585427529	2585546394	419
455	iso_pu_bacteria	2585427530	2585552016	419
456	iso_pu_bacteria	2585427531	2585558503	419
457	iso_pu_bacteria	2585427590	2585821725	419
458	iso_pu_bacteria	2585427593	2585835415	419
459	iso_pu_bacteria	2585427594	2585846671	419
460	iso_pu_bacteria	2585427608	2585897870	419
461	iso_pu_bacteria	2585427609	2585904527	419
462	iso_pu_bacteria	2585427633	2585995826	419
463	iso_pu_bacteria	2585427634	2586000389	419
464	iso_pu_bacteria	2585428125	2587980357	419
465	iso_pu_bacteria	2599185156	2599331396	419
466	iso_pu_bacteria	2599185170	2599417795	419
467	iso_pu_bacteria	2599185236	2599721455	419
468	iso_pu_bacteria	2599185352	2600193306	419
469	iso_pu_bacteria	2615840624	2616292545	419
470	iso_pu_bacteria	2615840626	2616308509	419
471	iso_pu_bacteria	2615840698	2616557188	419
472	iso_pu_bacteria	2617270742	2617385674	419
473	iso_pu_bacteria	2643221557	2643803800	419
474	iso_pu_bacteria	2643221558	2643811782	419
475	iso_pu_bacteria	2643221599	2644003699	419
476	iso_pu_bacteria	2643221607	2644049257	419
477	iso_pu_bacteria	2643221610	2644067770	419
478	iso_pu_bacteria	2643221618	2644107917	419
479	iso_pu_bacteria	2643221626	2644148410	419
480	iso_pu_bacteria	2643221634	2644192843	419
481	iso_pu_bacteria	2643221636	2644204398	419
482	iso_pu_bacteria	2643221637	2644210473	419
483	iso_pu_bacteria	2643221643	2644239512	419
484	iso_pu_bacteria	2643221655	2644309311	419
485	iso_pu_bacteria	2643221659	2644333138	419
486	iso_pu_bacteria	2643221668	2644377773	419
487	iso_pu_bacteria	2643221675	2644418824	419
488	iso_pu_bacteria	2643221680	2644452190	419
489	iso_pu_bacteria	2643221686	2644482291	419
490	iso_pu_bacteria	2643221688	2644494560	419
491	iso_pu_bacteria	2643221689	2644501928	419
492	iso_pu_bacteria	2643221698	2644545690	419
493	iso_pu_bacteria	2643221712	2644615253	419
494	iso_pu_bacteria	2643221718	2644654025	419
495	iso_pu_bacteria	2643221723	2644673558	419
496	iso_pu_bacteria	2643221726	2644690953	419
497	iso_pu_bacteria	2657244999	2657683879	419
498	iso_pu_bacteria	2667528174	2671111787	419
499	iso_pu_bacteria	2690316117	2692316078	419
500	iso_pu_bacteria	2718217882	2719181096	419
501	iso_pu_bacteria	2718217927	2719385710	419
502	iso_pu_bacteria	2718217997	2719665529	419
503	iso_pu_bacteria	2718218009	2719731845	419
504	iso_pu_bacteria	2718218199	2720491949	419
505	iso_pu_bacteria	2718218232	2720613216	419
506	iso_pu_bacteria	2718218233	2720620091	419
507	iso_pu_bacteria	2718218235	2720631516	419
508	iso_pu_bacteria	2718218269	2720775244	419
509	iso_pu_bacteria	2718218363	2721147190	419
510	iso_pu_bacteria	2718218365	2721158722	419
511	iso_pu_bacteria	2718218366	2721164108	419
512	iso_pu_bacteria	2718218423	2721399490	419
513	iso_pu_bacteria	2721755514	2722840278	419
514	iso_pu_bacteria	2721755556	2723026861	419
515	iso_pu_bacteria	2721755684	2723560478	419
516	iso_pu_bacteria	2721755685	2723567063	419
517	iso_pu_bacteria	2721755809	2724038303	419
518	iso_pu_bacteria	2721755810	2724044601	419
519	iso_pu_bacteria	2721755819	2724089851	419
520	iso_pu_bacteria	2721755822	2724104328	419
521	iso_pu_bacteria	2721755823	2724110123	419
522	iso_pu_bacteria	2724679232	2725951296	419
523	iso_pu_bacteria	2728369352	2730107797	419
524	iso_pu_bacteria	2728369365	2730164333	419
525	iso_pu_bacteria	2728369397	2730298354	419
526	iso_pu_bacteria	2738541293	2738801990	419
527	iso_pu_bacteria	2738541333	2739036426	419
528	iso_pu_bacteria	2751185821	2753458279	419
529	iso_pu_bacteria	2765235802	2765465484	419
530	iso_pu_bacteria	2765235942	2766063091	419
531	iso_pu_bacteria	2767802442	2770199424	419
532	iso_pu_bacteria	2775506902	2776271617	419
533	iso_pu_bacteria	2775506904	2776279870	419
534	iso_pu_bacteria	2775507266	2778173946	419
535	iso_pu_bacteria	2791355082	2792582036	419
536	iso_pu_bacteria	2791355091	2792619935	419
537	iso_pu_bacteria	2791355092	2792626646	419
538	iso_pu_bacteria	2791355094	2792639585	419
539	iso_pu_bacteria	2791355253	2793279769	419
540	iso_pu_bacteria	2791355256	2793294594	419
541	iso_pu_bacteria	2791355259	2793312166	419
542	iso_pu_bacteria	2791355260	2793322104	419
543	iso_pu_bacteria	2791355261	2793326590	419
544	iso_pu_bacteria	2791355262	2793335810	419
545	iso_pu_bacteria	2791355263	2793341444	419
546	iso_pu_bacteria	2791355264	2793349163	419
547	iso_pu_bacteria	2791355265	2793356713	419
548	iso_pu_bacteria	2791355266	2793361246	419
549	iso_pu_bacteria	2791355267	2793369334	419
550	iso_pu_bacteria	2802428858	2802719046	419
551	iso_pu_bacteria	2802428859	2802727277	419
552	iso_pu_bacteria	2802428860	2802732059	419
553	iso_pu_bacteria	2802428861	2802738989	419
554	iso_pu_bacteria	2802428862	2802744888	419
555	iso_pu_bacteria	2802428863	2802752164	419
556	iso_pu_bacteria	2802429268	2804752141	419
557	iso_pu_bacteria	2802429605	2805925630	419
558	iso_pu_bacteria	2802429606	2805933650	419
559	iso_pu_bacteria	2802429633	2806045976	419
560	iso_pu_bacteria	2802429634	2806054356	419
561	iso_pu_bacteria	2802429635	2806060361	419
562	iso_pu_bacteria	2802429636	2806065183	419
563	iso_pu_bacteria	2802429637	2806072450	419
564	iso_pu_bacteria	2818991448	2819612913	419
565	iso_pu_bacteria	2818991453	2819637980	419
566	iso_pu_bacteria	2818991461	2819687246	419
567	iso_pu_bacteria	2821123053	2821127960	419
568	iso_pu_bacteria	2838016132	2838020991	419
569	iso_pu_bacteria	2838022645	2838029026	419
570	iso_pu_bacteria	2838029111	2838030166	419
571	iso_pu_bacteria	2838035591	2838037988	419
572	iso_pu_bacteria	2838042994	2838043348	419
573	iso_pu_bacteria	2838048938	2838052503	419
574	iso_pu_bacteria	2838061910	2838066028	419
575	iso_pu_bacteria	2838068647	2838073508	419
576	iso_pu_bacteria	2838074704	2838078804	419
577	iso_pu_bacteria	2838661181	2838667301	419
578	iso_pu_bacteria	2838668709	2838672106	419
579	iso_pu_bacteria	2838680041	2838682305	419
580	iso_pu_bacteria	2838686498	2838689414	419
581	iso_pu_bacteria	2838694306	2838696876	419
582	iso_pu_bacteria	2838701080	2838704614	419
583	iso_pu_bacteria	2838707686	2838709883	419
584	iso_pu_bacteria	2838729681	2838730747	419
585	iso_pu_bacteria	2838736955	2838738372	419
586	iso_pu_bacteria	2838742623	2838743688	419
587	iso_pu_bacteria	2839993093	2839995658	419
588	iso_pu_bacteria	2840764183	2840767975	419
589	iso_pu_bacteria	2841840854	2841841259	419
590	iso_pu_bacteria	2841851746	2841857764	419
591	iso_pu_bacteria	2841864319	2841864639	419
592	iso_pu_bacteria	2842077413	2842078057	419
593	iso_pu_bacteria	2842110456	2842110580	419
594	iso_pu_bacteria	2842118031	2842119434	419
595	iso_pu_bacteria	2842140634	2842141037	419
596	iso_pu_bacteria	2842146304	2842148646	419
597	iso_pu_bacteria	2842156927	2842157499	419
598	iso_pu_bacteria	2842163707	2842164691	419
599	iso_pu_bacteria	2842180545	2842180916	419
600	iso_pu_bacteria	2842192696	2842194587	419
601	iso_pu_bacteria	2842198810	2842205199	419
602	iso_pu_bacteria	2842205361	2842206114	419
603	iso_pu_bacteria	2842217011	2842217146	419
604	iso_pu_bacteria	2842229732	2842231025	419
605	iso_pu_bacteria	2842237096	2842239296	419
606	iso_pu_bacteria	2842243621	2842244867	419
607	iso_pu_bacteria	2842250916	2842254294	419
608	iso_pu_bacteria	2842257432	2842258680	419
609	iso_pu_bacteria	2842264693	2842268196	419
610	iso_pu_bacteria	2842271015	2842273434	419
611	iso_pu_bacteria	2842278818	2842279571	419
612	iso_pu_bacteria	2842285085	2842286212	419
613	iso_pu_bacteria	2842291075	2842291720	419
614	iso_pu_bacteria	2842298080	2842302116	419
615	iso_pu_bacteria	2842304105	2842304211	419
616	iso_pu_bacteria	2842311132	2842313834	419
617	iso_pu_bacteria	2842317721	2842317985	419
618	iso_pu_bacteria	2842341865	2842345918	419
619	iso_pu_bacteria	2842357229	2842357417	419
620	iso_pu_bacteria	2842363717	2842364454	419
621	iso_pu_bacteria	2842370503	2842372871	419
622	iso_pu_bacteria	2842377471	2842378116	419
623	iso_pu_bacteria	2842384541	2842385943	419
624	iso_pu_bacteria	2842395702	2842397585	419
625	iso_pu_bacteria	2842402390	2842403579	419
626	iso_pu_bacteria	2842409023	2842409048	419
627	iso_pu_bacteria	2842415677	2842415702	419
628	iso_pu_bacteria	2842422224	2842427986	419
629	iso_pu_bacteria	2842428310	2842431569	419
630	iso_pu_bacteria	2842434925	2842438471	419
631	iso_pu_bacteria	2842441272	2842445101	419
632	iso_pu_bacteria	2842447887	2842452419	419
633	iso_pu_bacteria	2842462802	2842465941	419
634	iso_pu_bacteria	2842469257	2842473086	419
635	iso_pu_bacteria	2842475841	2842476549	419
636	iso_pu_bacteria	2842482326	2842484908	419
637	iso_pu_bacteria	2842489311	2842489948	419
638	iso_pu_bacteria	2842495871	2842496255	419
639	iso_pu_bacteria	2842502639	2842503694	419
640	iso_pu_bacteria	2842509118	2842515217	419
641	iso_pu_bacteria	2842521101	2842522477	419
642	iso_pu_bacteria	2842871566	2842872952	419
643	iso_pu_bacteria	2842922631	2842923793	419
644	iso_pu_bacteria	2844163670	2844167351	419
645	iso_pu_bacteria	2844454524	2844459245	419
646	iso_pu_bacteria	2847417321	2847418856	419
647	iso_pu_bacteria	2848992105	2848993832	419
648	iso_pu_bacteria	2850079185	2850081948	419
649	iso_pu_bacteria	2852387548	2852389822	419
650	iso_pu_bacteria	2854896431	2854899482	419
651	iso_pu_bacteria	2854916844	2854918304	419
652	iso_pu_bacteria	2855825444	2855825795	419
653	iso_pu_bacteria	2855839649	2855841153	419
654	iso_pu_bacteria	2855872281	2855876530	419
655	iso_pu_bacteria	2857516855	2857518636	419
656	iso_pu_bacteria	2857531043	2857535002	419
657	iso_pu_bacteria	2858800743	2858801794	419
658	iso_pu_bacteria	2891373044	2891374405	419
659	iso_pu_bacteria	2896384573	2896390675	419
660	iso_pu_bacteria	2904578770	2904581622	419
661	iso_pu_bacteria	2913295892	2913301046	419
662	iso_pu_bacteria	2915980308	2915981528	419
663	iso_pu_bacteria	2915986958	2915993320	419
664	iso_pu_bacteria	2915993759	2916000197	419
665	iso_pu_bacteria	2916000859	2916006298	419
666	iso_pu_bacteria	2916007675	2916009603	419
667	iso_pu_bacteria	2916014648	2916018052	419
668	iso_pu_bacteria	2916021584	2916027152	419
669	iso_pu_bacteria	2916028427	2916033392	419
670	iso_pu_bacteria	2916035215	2916038017	419
671	iso_pu_bacteria	2916041962	2916046928	419
672	iso_pu_bacteria	2916048683	2916050969	419
673	iso_pu_bacteria	2916055098	2916055457	419
674	iso_pu_bacteria	2916061851	2916066077	419
675	iso_pu_bacteria	2916068649	2916074554	419
676	iso_pu_bacteria	2916076590	2916079001	419
677	iso_pu_bacteria	2919100787	2919106996	419
678	iso_pu_bacteria	2919119836	2919122858	419
679	iso_pu_bacteria	2919171160	2919175169	419
680	iso_pu_bacteria	2919408235	2919411760	419
681	iso_pu_bacteria	2920760137	2920766278	419
682	iso_pu_bacteria	2920822456	2920824506	419
683	iso_pu_bacteria	2921201388	2921208098	419
684	iso_pu_bacteria	2921208531	2921208764	419
685	iso_pu_bacteria	2921237296	2921240236	419
686	iso_pu_bacteria	2921244191	2921247184	419
687	iso_pu_bacteria	2921250672	2921255056	419
688	iso_pu_bacteria	2921257292	2921261289	419
689	iso_pu_bacteria	2921263974	2921267589	419
690	iso_pu_bacteria	2921282425	2921288854	419
691	iso_pu_bacteria	2921289301	2921293576	419
692	iso_pu_bacteria	2921296804	2921297798	419
693	iso_pu_bacteria	2923556063	2923557858	419
694	iso_pu_bacteria	2924144063	2924146349	419
695	iso_pu_bacteria	2924150972	2924154683	419
696	iso_pu_bacteria	2924158325	2924159764	419
697	iso_pu_bacteria	2924165586	2924168809	419
698	iso_pu_bacteria	2924172951	2924177387	419
699	iso_pu_bacteria	2924179722	2924185439	419
700	iso_pu_bacteria	2924186466	2924189759	419
701	iso_pu_bacteria	2924193448	2924196355	419
702	iso_pu_bacteria	2924200457	2924205690	419
703	iso_pu_bacteria	2924207177	2924211358	419
704	iso_pu_bacteria	2924214083	2924215328	419
705	iso_pu_bacteria	2924221636	2924223164	419
706	iso_pu_bacteria	2924228884	2924233857	419
707	iso_pu_bacteria	2928521798	2928524399	419
708	iso_pu_bacteria	2929138655	2929140504	419
709	iso_pu_bacteria	2933016740	2933021112	419
710	iso_pu_bacteria	2933570622	2933571488	419
711	iso_pu_bacteria	2933586486	2933586608	419
712	iso_pu_bacteria	2933599457	2933604010	419
713	iso_pu_bacteria	2935894831	2935897268	419
714	iso_pu_bacteria	2935901341	2935904660	419
715	iso_pu_bacteria	2936367885	2936372801	419
716	iso_pu_bacteria	2936375103	2936376675	419
717	iso_pu_bacteria	2936381700	2936385057	419
718	iso_pu_bacteria	2936996657	2937002573	419
719	iso_pu_bacteria	2937002841	2937006120	419
720	iso_pu_bacteria	2937009748	2937010139	419
721	iso_pu_bacteria	2937016420	2937022958	419
722	iso_pu_bacteria	2937023124	2937025908	419
723	iso_pu_bacteria	2937029754	2937032633	419
724	iso_pu_bacteria	2937036028	2937038730	419
725	iso_pu_bacteria	2937042894	2937048098	419
726	iso_pu_bacteria	2937049772	2937054793	419
727	iso_pu_bacteria	2937056579	2937057147	419
728	iso_pu_bacteria	2937063883	2937066338	419
729	iso_pu_bacteria	2937071275	2937073701	419
730	iso_pu_bacteria	2937078374	2937079199	419
731	iso_pu_bacteria	2937091812	2937096502	419
732	iso_pu_bacteria	2937098957	2937099222	419
733	iso_pu_bacteria	2937106411	2937107002	419
734	iso_pu_bacteria	2937113482	2937116274	419
735	iso_pu_bacteria	2937119839	2937120391	419
736	iso_pu_bacteria	2937126314	2937127445	419
737	iso_pu_bacteria	2941499720	2941503763	419
738	iso_pu_bacteria	2954011201	2954015323	419
739	iso_pu_bacteria	2957375807	2957381595	419
740	iso_pu_bacteria	2957382221	2957387374	419
741	iso_pu_bacteria	2957388812	2957391851	419
742	iso_pu_bacteria	2957395598	2957400379	419
743	iso_pu_bacteria	2957402308	2957403299	419
744	iso_pu_bacteria	2957408893	2957410349	419
745	iso_pu_bacteria	2957415311	2957421766	419
746	iso_pu_bacteria	2957430029	2957434854	419
747	iso_pu_bacteria	2957437181	2957442483	419
748	iso_pu_bacteria	2957443900	2957447463	419
749	iso_pu_bacteria	2957450854	2957456950	419
750	iso_pu_bacteria	2957457609	2957464459	419
751	iso_pu_bacteria	2957464669	2957467888	419
752	iso_pu_bacteria	2957471148	2957477313	419
753	iso_pu_bacteria	2957478035	2957481493	419
754	iso_pu_bacteria	2957484790	2957488981	419
755	iso_pu_bacteria	2957491536	2957491914	419
756	iso_pu_bacteria	2957498199	2957499164	419
757	iso_pu_bacteria	2957505466	2957509420	419
758	iso_pu_bacteria	2960584000	2960590129	419
759	iso_pu_bacteria	2960591022	2960597197	419
760	iso_pu_bacteria	2960597568	2960598176	419
761	iso_pu_bacteria	2960603979	2960609913	419
762	iso_pu_bacteria	2960610863	2960614172	419
763	iso_pu_bacteria	2960617483	2960618939	419
764	iso_pu_bacteria	2960624210	2960625548	419
765	iso_pu_bacteria	2960631154	2960631777	419
766	iso_pu_bacteria	2960637947	2960642131	419
767	iso_pu_bacteria	2960645483	2960651928	419
768	iso_pu_bacteria	2960652885	2960656614	419
769	iso_pu_bacteria	2960660292	2960664043	419
770	iso_pu_bacteria	2960667422	2960672854	419
771	iso_pu_bacteria	2960674078	2960678933	419
772	iso_pu_bacteria	2960680706	2960687149	419
773	iso_pu_bacteria	2960687367	2960691406	419
774	iso_pu_bacteria	2960693952	2960699122	419
775	iso_pu_bacteria	2964607997	2964612252	419
776	iso_pu_bacteria	2964615318	2964620547	419
777	iso_pu_bacteria	2964621998	2964627348	419
778	iso_pu_bacteria	2964628898	2964632255	419
779	iso_pu_bacteria	2964636051	2964638950	419
780	iso_pu_bacteria	2964643177	2964648771	419
781	iso_pu_bacteria	2964649959	2964652244	419
782	iso_pu_bacteria	2964656573	2964659377	419
783	iso_pu_bacteria	2964663802	2964668430	419
784	iso_pu_bacteria	2964678106	2964683259	419
785	iso_pu_bacteria	2964685014	2964685973	419
786	iso_pu_bacteria	2964691889	2964695453	419
787	iso_pu_bacteria	2964698721	2964701789	419
788	iso_pu_bacteria	2964705432	2964709166	419
789	iso_pu_bacteria	2964712639	2964715348	419
790	iso_pu_bacteria	2964719344	2964720431	419
791	iso_pu_bacteria	2967664464	2967666305	419
792	iso_pu_bacteria	2967671571	2967677470	419
793	iso_pu_bacteria	2967678726	2967684216	419
794	iso_pu_bacteria	2967686174	2967687487	419
795	iso_pu_bacteria	2967693043	2967699685	419
796	iso_pu_bacteria	2967699805	2967700116	419
797	iso_pu_bacteria	2967706974	2967712530	419
798	iso_pu_bacteria	2967714385	2967715317	419
799	iso_pu_bacteria	2967721400	2967726956	419
800	iso_pu_bacteria	2967728569	2967729239	419
801	iso_pu_bacteria	2967735183	2967741460	419
802	iso_pu_bacteria	2967742019	2967743356	419
803	iso_pu_bacteria	2967748971	2967753884	419
804	iso_pu_bacteria	2967755722	2967757144	419
805	iso_pu_bacteria	2967762386	2967767987	419
806	iso_pu_bacteria	2967769361	2967771491	419
807	iso_pu_bacteria	2967775926	2967777042	419
808	iso_pu_bacteria	2970019648	2970022477	419
809	iso_pu_bacteria	2970026789	2970029837	419
810	iso_pu_bacteria	2970033650	2970038611	419
811	iso_pu_bacteria	2970040964	2970041641	419
812	iso_pu_bacteria	2970054988	2970058242	419
813	iso_pu_bacteria	2970061556	2970068488	419
814	iso_pu_bacteria	2970068827	2970073735	419
815	iso_pu_bacteria	2970076120	2970078442	419
816	iso_pu_bacteria	2970082768	2970088273	419
817	iso_pu_bacteria	2970088815	2970092495	419
818	iso_pu_bacteria	2970095765	2970098741	419
819	iso_pu_bacteria	2970102677	2970105125	419
820	iso_pu_bacteria	2970109326	2970110491	419
821	iso_pu_bacteria	2970116247	2970117750	419
822	iso_pu_bacteria	2970122695	2970125774	419
823	iso_pu_bacteria	2970129317	2970130452	419
824	iso_pu_bacteria	2970136068	2970141974	419
825	iso_pu_bacteria	2970143518	2970146893	419
826	iso_pu_bacteria	2970149975	2970150430	419
827	iso_pu_bacteria	2970156795	2970162087	419
828	iso_pu_bacteria	2970164137	2970166458	419
829	iso_pu_bacteria	2970170962	2970172317	419
830	iso_pu_bacteria	2970177841	2970182408	419
831	iso_pu_bacteria	2970184632	2970190536	419
832	iso_pu_bacteria	2970191845	2970192742	419
833	iso_pu_bacteria	2977516862	2977517187	419
834	iso_pu_bacteria	2977523885	2977527899	419
835	iso_pu_bacteria	2977530762	2977532870	419
836	iso_pu_bacteria	2977537788	2977542710	419
837	iso_pu_bacteria	2977544691	2977548463	419
838	iso_pu_bacteria	2977551784	2977552715	419
839	iso_pu_bacteria	2977558990	2977565634	419
840	iso_pu_bacteria	2977565890	2977569552	419
841	iso_pu_bacteria	2977572785	2977574946	419
842	iso_pu_bacteria	2977579622	2977586204	419
843	iso_pu_bacteria	2989349275	2989353297	419
844	iso_pu_bacteria	2989771324	2989773610	419
845	iso_pu_bacteria	2996887358	2996891629	419
846	iso_pu_bacteria	2996893221	2996898228	419
847	iso_pu_bacteria	3003930520	3003933600	419
848	iso_pu_bacteria	3005409236	3005415220	419
849	iso_pu_bacteria	3005416602	3005420176	419
850	iso_pu_bacteria	3005445848	3005447437	419
851	iso_pu_bacteria	3005452660	3005454147	419
852	iso_pu_bacteria	643692032	643825746	419
853	iso_pu_bacteria	648276728	648737370	419
854	iso_pu_bacteria	8003992118	8003993649	419
855	iso_pu_bacteria	8003999396	8004001135	419
856	iso_pu_bacteria	8005258706	8005262959	419
857	iso_pu_bacteria	8005275841	8005280487	419
858	iso_pu_bacteria	8005282627	8005283105	419
859	iso_pu_bacteria	8005289223	8005290334	419
860	iso_pu_bacteria	8005301065	8005302473	419
861	iso_pu_bacteria	8005307578	8005314451	419
862	iso_pu_bacteria	8005314921	8005317127	419
863	iso_pu_bacteria	8005321885	8005326156	419
864	iso_pu_bacteria	8005376324	8005379117	419
865	iso_pu_bacteria	8005382845	8005388249	419
866	iso_pu_bacteria	8005395548	8005397225	419
867	iso_pu_bacteria	8005430974	8005432054	419
868	iso_pu_bacteria	8005460587	8005462854	419
869	iso_pu_bacteria	8005497431	8005500253	419
870	iso_pu_bacteria	8005542996	8005545075	419
871	iso_pu_bacteria	8005556819	8005557802	419
872	iso_pu_bacteria	8005563573	8005568975	419
873	iso_pu_bacteria	8005570704	8005574787	419
874	iso_pu_bacteria	8005619151	8005621627	419
875	iso_pu_bacteria	8005626139	8005626448	419
876	iso_pu_bacteria	8005645114	8005648809	419
877	iso_pu_bacteria	8005668836	8005671669	419
878	iso_pu_bacteria	8005682033	8005683262	419
879	iso_pu_bacteria	8005688590	8005694486	419
880	iso_pu_bacteria	8005695170	8005700107	419
881	iso_pu_bacteria	8018127388	8018129827	419
882	iso_pu_bacteria	8018150411	8018155394	419
883	iso_pu_bacteria	8018163183	8018166887	419
884	iso_pu_bacteria	8018176218	8018179920	419
885	iso_pu_bacteria	8023680758	8023685473	419
886	iso_pu_bacteria	8024479707	8024482214	419
887	iso_pu_bacteria	8024486573	8024492329	419
888	iso_pu_bacteria	8024501048	8024506675	419
889	iso_pu_bacteria	8046767195	8046773865	419
890	iso_pu_bacteria	8049293176	8049294689	419
891	iso_pu_bacteria	8054558443	8054558968	419
892	iso_pu_bacteria	8056375014	8056376546	419
893	iso_pu_bacteria	8056382006	8056388176	419
894	iso_pu_bacteria	8056875544	8056877724	419
895	iso_pu_bacteria	8057575449	8057576759	419
896	iso_pu_bacteria	8057874678	8057875151	419
897	3300005548	Ga0070665_100225551	Ga0070665_1002255512	420
898	3300028379	Ga0268266_10149112	Ga0268266_101491121	420
899	3300049571	Ga0501034_0173546	Ga0501034_0173546_505_1773	420
900	3300049575	Ga0501039_0259425	Ga0501039_0259425_48_1316	420
901	iso_pu_bacteria	2510461069	2510843160	420
902	iso_pu_bacteria	2643221653	2644300249	420
903	iso_pu_bacteria	2643221719	2644658475	420
904	iso_pu_bacteria	2738541317	2738946142	420
905	iso_pu_bacteria	2775507049	2776913618	420
906	iso_pu_bacteria	2818991272	2819242133	420
907	iso_pu_bacteria	2894652903	2894656526	420
908	iso_pu_bacteria	2899803654	2899807585	420
909	iso_pu_bacteria	2913308742	2913311273	420
910	iso_pu_bacteria	2989776772	2989778588	420
911	iso_pu_bacteria	8005246636	8005250910	420
912	iso_pu_bacteria	8005484373	8005485074	420
913	iso_pu_bacteria	8005658619	8005659533	420
914	iso_pu_bacteria	8055431914	8055435087	420
915	3300001979	JGI24740J21852_10006526	JGI24740J21852_100065265	421
916	3300002741	JGI25157J39369_1000310	JGI25157J39369_100031025	421
917	3300003203	JGI25406J46586_10019034	JGI25406J46586_100190344	421
918	3300003214	JGI25165J46597_1000192	JGI25165J46597_100019253	421
919	3300005262	Ga0065165_1006156	Ga0065165_10061562	421
920	3300005455	Ga0070663_100011444	Ga0070663_1000114443	421
921	3300005548	Ga0070665_100198743	Ga0070665_1001987432	421
922	3300005548	Ga0070665_100396058	Ga0070665_1003960581	421
923	3300005578	Ga0068854_100074668	Ga0068854_1000746682	421
924	3300005985	Ga0081539_10000688	Ga0081539_1000068810	421
925	3300006038	Ga0075365_10022168	Ga0075365_100221683	421
926	3300006178	Ga0075367_10026161	Ga0075367_100261613	421
927	3300006178	Ga0075367_10071189	Ga0075367_100711892	421
928	3300009174	Ga0105241_10201507	Ga0105241_102015071	421
929	3300009177	Ga0105248_10310238	Ga0105248_103102382	421
930	3300009551	Ga0105238_10027221	Ga0105238_100272212	421
931	3300010375	Ga0105239_10088951	Ga0105239_100889512	421
932	3300013296	Ga0157374_10082150	Ga0157374_100821502	421
933	3300025250	Ga0209026_1000002	Ga0209026_1000002182	421
934	3300025254	Ga0209148_1004788	Ga0209148_10047882	421
935	3300025256	Ga0209759_1000062	Ga0209759_1000062135	421
936	3300025261	Ga0209233_1000027	Ga0209233_1000027187	421
937	3300025261	Ga0209233_1008255	Ga0209233_10082553	421
938	3300025904	Ga0207647_10064456	Ga0207647_100644562	421
939	3300025924	Ga0207694_10146215	Ga0207694_101462151	421
940	3300025941	Ga0207711_10219440	Ga0207711_102194402	421
941	3300025949	Ga0207667_10334154	Ga0207667_103341542	421
942	3300025972	Ga0207668_10184935	Ga0207668_101849351	421
943	3300025981	Ga0207640_10068433	Ga0207640_100684332	421
944	3300026067	Ga0207678_10328065	Ga0207678_103280651	421
945	3300026142	Ga0207698_10048248	Ga0207698_100482483	421
946	3300026142	Ga0207698_10054146	Ga0207698_100541463	421
947	3300027866	Ga0209813_10025642	Ga0209813_100256422	421
948	3300028379	Ga0268266_10198976	Ga0268266_101989761	421
949	3300037312	Ga0395899_0000059	Ga0395899_0000059_100995_102263	421
950	3300037312	Ga0395899_0095945	Ga0395899_0095945_40_1311	421
951	3300037418	Ga0395900_0000017	Ga0395900_0000017_100995_102263	421
952	3300037418	Ga0395900_0030214	Ga0395900_0030214_1104_2396	421
953	3300037418	Ga0395900_0127135	Ga0395900_0127135_645_1916	421
954	3300037418	Ga0395900_0155881	Ga0395900_0155881_95_1360	421
955	3300037466	Ga0395898_0000030	Ga0395898_0000030_100970_102238	421
956	3300037466	Ga0395898_0014421	Ga0395898_0014421_4786_6051	421
957	3300037471	Ga0395905_0000056	Ga0395905_0000056_106968_108236	421
958	3300038443	Ga0395901_0000015	Ga0395901_0000015_267340_268608	421
959	3300038443	Ga0395901_0244841	Ga0395901_0244841_214_1509	421
960	3300041413	Ga0439465_0022949	Ga0439465_0022949_600_1868	421
961	3300046471	Ga0495650_0052803	Ga0495650_0052803_134_1402	421
962	3300048915	Ga0496112_0211109	Ga0496112_0211109_334_1626	421
963	3300048923	Ga0496120_0030232	Ga0496120_0030232_110_1402	421
964	3300048929	Ga0496126_0001055	Ga0496126_0001055_45082_46350	421
965	3300049568	Ga0501031_0000018	Ga0501031_0000018_82031_83296	421
966	3300049569	Ga0501032_0000201	Ga0501032_0000201_23360_24625	421
967	3300049570	Ga0501033_0000328	Ga0501033_0000328_20529_21794	421
968	3300049570	Ga0501033_0019815	Ga0501033_0019815_261_1526	421
969	3300049570	Ga0501033_0052548	Ga0501033_0052548_564_1829	421
970	3300049571	Ga0501034_0000005	Ga0501034_0000005_342691_343956	421
971	3300049571	Ga0501034_0037998	Ga0501034_0037998_2080_3348	421
972	3300049571	Ga0501034_0054192	Ga0501034_0054192_2060_3328	421
973	3300049571	Ga0501034_0255918	Ga0501034_0255918_66_1331	421
974	3300049572	Ga0501036_0000005	Ga0501036_0000005_221559_222824	421
975	3300049573	Ga0501037_0000045	Ga0501037_0000045_92438_93703	421
976	3300049574	Ga0501038_0000001	Ga0501038_0000001_342691_343956	421
977	3300049575	Ga0501039_0000007	Ga0501039_0000007_153219_154484	421
978	3300049576	Ga0501040_0088602	Ga0501040_0088602_757_2022	421
979	3300049579	Ga0501043_0079453	Ga0501043_0079453_126_1391	421
980	3300049581	Ga0501047_0149101	Ga0501047_0149101_854_2119	421
981	3300049586	Ga0501070_0176744	Ga0501070_0176744_129_1394	421
982	3300049588	Ga0501072_0101090	Ga0501072_0101090_165_1430	421
983	3300049741	Ga0501079_0201946	Ga0501079_0201946_233_1498	421
984	3300049822	Ga0501035_0000008	Ga0501035_0000008_288570_289835	421
985	3300049822	Ga0501035_0076459	Ga0501035_0076459_904_2169	421
986	3300049823	Ga0501044_0000001	Ga0501044_0000001_74132_75397	421
987	3300049823	Ga0501044_0077649	Ga0501044_0077649_695_1960	421
988	3300050494	nmdc:mga06z11_33750_c1	nmdc:mga06z11_33750_c1_106_1398	421
989	3300050494	nmdc:mga06z11_8900_c1	nmdc:mga06z11_8900_c1_1748_3016	421
990	3300050495	nmdc:mga04h51_25073_c1	nmdc:mga04h51_25073_c1_268_1536	421
991	3300053079	Ga0500610_0019178	Ga0500610_0019178_1909_3195	421
992	3300053119	Ga0500595_042801	Ga0500595_042801_13_1281	421
993	3300053139	Ga0500568_0000118	Ga0500568_0000118_52929_54197	421
994	3300053158	Ga0500627_0072548	Ga0500627_0072548_93_1379	421
995	iso_pu_bacteria	2509276022	2509397372	421
996	iso_pu_bacteria	2534681786	2535484661	421
997	iso_pu_bacteria	2588253730	2588515958	421
998	iso_pu_bacteria	2597489875	2597814514	421
999	iso_pu_bacteria	2721755686	2723576505	421
1000	iso_pu_bacteria	2758568016	2758641487	421
1001	iso_pu_bacteria	2854911287	2854911857	421
1002	iso_pu_bacteria	2906378014	2906382229	421
1003	iso_pu_bacteria	2922178524	2922183153	421
1004	iso_pu_bacteria	2965102966	2965108404	421
1005	iso_pu_bacteria	2970524798	2970532025	421
1006	iso_pu_bacteria	637000159	637073340	421
1007	iso_pu_bacteria	8004395343	8004399853	421
1008	3300003187	JGI25151J46595_10003213	JGI25151J46595_100032136	422
1009	3300003781	Ga0055536_1001994	Ga0055536_10019946	422
1010	3300006042	Ga0075368_10006544	Ga0075368_100065444	422
1011	3300006178	Ga0075367_10077390	Ga0075367_100773902	422
1012	3300006948	Ga0099826_10000117	Ga0099826_1000011711	422
1013	3300006948	Ga0099826_10094181	Ga0099826_100941812	422
1014	3300013100	Ga0157373_10112761	Ga0157373_101127612	422
1015	3300013102	Ga0157371_10000015	Ga0157371_10000015341	422
1016	3300013104	Ga0157370_10003029	Ga0157370_100030296	422
1017	3300013105	Ga0157369_10198830	Ga0157369_101988301	422
1018	3300025292	Ga0209676_1004345	Ga0209676_10043452	422
1019	3300025294	Ga0209025_1000803	Ga0209025_100080311	422
1020	3300025297	Ga0209758_1000942	Ga0209758_100094237	422
1021	3300025298	Ga0209050_1005655	Ga0209050_10056552	422
1022	3300025303	Ga0209051_1001553	Ga0209051_10015536	422
1023	3300027312	Ga0209371_1000058	Ga0209371_1000058157	422
1024	3300027312	Ga0209371_1001102	Ga0209371_10011029	422
1025	3300027866	Ga0209813_10009710	Ga0209813_100097103	422
1026	3300028794	Ga0307515_10001876	Ga0307515_1000187612	422
1027	3300030500	Ga0268256_1000056	Ga0268256_1000056147	422
1028	3300030500	Ga0268256_1001773	Ga0268256_100177316	422
1029	3300031456	Ga0307513_10188010	Ga0307513_101880102	422
1030	3300031730	Ga0307516_10170152	Ga0307516_101701522	422
1031	3300031911	Ga0307412_10087316	Ga0307412_100873162	422
1032	3300037471	Ga0395905_0000510	Ga0395905_0000510_7371_8645	422
1033	3300046674	Ga0495588_0063883	Ga0495588_0063883_381_1658	422
1034	3300047470	Ga0495681_0025409	Ga0495681_0025409_470_1747	422
1035	3300047472	Ga0495686_0008883	Ga0495686_0008883_1427_2698	422
1036	3300048919	Ga0496116_0089358	Ga0496116_0089358_503_1780	422
1037	3300048920	Ga0496117_0000002	Ga0496117_0000002_732308_733585	422
1038	3300048921	Ga0496118_0019839	Ga0496118_0019839_74_1351	422
1039	3300048922	Ga0496119_0045823	Ga0496119_0045823_512_1789	422
1040	3300048922	Ga0496119_0091589	Ga0496119_0091589_133_1410	422
1041	3300048923	Ga0496120_0000951	Ga0496120_0000951_28000_29277	422
1042	3300048923	Ga0496120_0104185	Ga0496120_0104185_43_1320	422
1043	3300048925	Ga0496122_0000001	Ga0496122_0000001_98867_100144	422
1044	3300048925	Ga0496122_0111562	Ga0496122_0111562_71_1339	422
1045	3300048926	Ga0496123_0000001	Ga0496123_0000001_102598_103875	422
1046	3300048927	Ga0496124_0001375	Ga0496124_0001375_6767_8038	422
1047	3300048927	Ga0496124_0019978	Ga0496124_0019978_376_1653	422
1048	3300049569	Ga0501032_0126973	Ga0501032_0126973_88_1356	422
1049	3300049570	Ga0501033_0005198	Ga0501033_0005198_292_1560	422
1050	3300049570	Ga0501033_0006625	Ga0501033_0006625_5866_7140	422
1051	3300049570	Ga0501033_0009424	Ga0501033_0009424_790_2058	422
1052	3300049570	Ga0501033_0018584	Ga0501033_0018584_2912_4180	422
1053	3300049572	Ga0501036_0106937	Ga0501036_0106937_313_1581	422
1054	3300049573	Ga0501037_0083410	Ga0501037_0083410_246_1514	422
1055	3300049574	Ga0501038_0118340	Ga0501038_0118340_320_1588	422
1056	3300049579	Ga0501043_0000107	Ga0501043_0000107_62070_63338	422
1057	3300049581	Ga0501047_0020996	Ga0501047_0020996_3900_5168	422
1058	3300049581	Ga0501047_0148366	Ga0501047_0148366_48_1316	422
1059	3300049585	Ga0501069_0000039	Ga0501069_0000039_46519_47787	422
1060	3300049585	Ga0501069_0006899	Ga0501069_0006899_314_1582	422
1061	3300049585	Ga0501069_0072700	Ga0501069_0072700_375_1643	422
1062	3300049586	Ga0501070_0000132	Ga0501070_0000132_13161_14429	422
1063	3300049586	Ga0501070_0000299	Ga0501070_0000299_43942_45210	422
1064	3300049586	Ga0501070_0002117	Ga0501070_0002117_8482_9750	422
1065	3300049586	Ga0501070_0017763	Ga0501070_0017763_1301_2569	422
1066	3300049586	Ga0501070_0075084	Ga0501070_0075084_1239_2507	422
1067	3300049586	Ga0501070_0239182	Ga0501070_0239182_10_1278	422
1068	3300049589	Ga0501073_0091475	Ga0501073_0091475_559_1827	422
1069	3300049589	Ga0501073_0094710	Ga0501073_0094710_642_1910	422
1070	3300049590	Ga0501074_0012781	Ga0501074_0012781_638_1906	422
1071	3300049590	Ga0501074_0029210	Ga0501074_0029210_147_1415	422
1072	3300049741	Ga0501079_0195359	Ga0501079_0195359_191_1459	422
1073	3300049742	Ga0501080_0001676	Ga0501080_0001676_17190_18458	422
1074	3300049742	Ga0501080_0003023	Ga0501080_0003023_3918_5186	422
1075	3300049742	Ga0501080_0054458	Ga0501080_0054458_205_1473	422
1076	3300049744	Ga0501083_0011832	Ga0501083_0011832_4712_5980	422
1077	3300049822	Ga0501035_0000055	Ga0501035_0000055_109082_110350	422
1078	3300049822	Ga0501035_0000807	Ga0501035_0000807_15597_16865	422
1079	3300049822	Ga0501035_0011205	Ga0501035_0011205_5830_7104	422
1080	3300049822	Ga0501035_0013030	Ga0501035_0013030_176_1444	422
1081	3300049822	Ga0501035_0022239	Ga0501035_0022239_3806_5074	422
1082	3300049822	Ga0501035_0103199	Ga0501035_0103199_323_1591	422
1083	3300049822	Ga0501035_0214580	Ga0501035_0214580_320_1588	422
1084	3300049823	Ga0501044_0000071	Ga0501044_0000071_26325_27593	422
1085	3300049823	Ga0501044_0015843	Ga0501044_0015843_4980_6248	422
1086	3300049823	Ga0501044_0094218	Ga0501044_0094218_1046_2314	422
1087	3300049823	Ga0501044_0134921	Ga0501044_0134921_836_2104	422
1088	3300049823	Ga0501044_0344265	Ga0501044_0344265_59_1327	422
1089	3300050491	nmdc:mga00v17_40_c1	nmdc:mga00v17_40_c1_61740_63017	422
1090	3300050495	nmdc:mga04h51_6935_c1	nmdc:mga04h51_6935_c1_532_1809	422
1091	3300050516	nmdc:mga0sz30_265_c1	nmdc:mga0sz30_265_c1_11555_12832	422
1092	3300053122	Ga0500608_050812	Ga0500608_050812_402_1673	422
1093	3300053125	Ga0500618_007115	Ga0500618_007115_1634_2905	422
1094	3300053136	Ga0500559_0026912	Ga0500559_0026912_501_1775	422
1095	3300053136	Ga0500559_0043255	Ga0500559_0043255_321_1592	422
1096	3300053137	Ga0500561_0013766	Ga0500561_0013766_234_1511	422
1097	3300053153	Ga0500616_0000805	Ga0500616_0000805_367_1641	422
1098	3300053156	Ga0500622_0000830	Ga0500622_0000830_1972_3243	422
1099	3300053177	Ga0500636_0000115	Ga0500636_0000115_1448_2719	422
1100	3300053177	Ga0500636_0114380	Ga0500636_0114380_86_1363	422
1101	3300059508	Ga0587088_001884	Ga0587088_001884_479_1756	422
1102	3300059510	Ga0587090_000175	Ga0587090_000175_802_2079	422
1103	3300059640	Ga0587067_004174	Ga0587067_004174_291_1568	422
1104	3300059643	Ga0587072_000265	Ga0587072_000265_1512_2789	422
1105	3300060353	Ga0501082_0046340	Ga0501082_0046340_1660_2928	422
1106	iso_pu_bacteria	2600255279	2601612041	422
1107	iso_pu_bacteria	2600255308	2601749175	422
1108	3300001979	JGI24740J21852_10000493	JGI24740J21852_100004934	423
1109	3300002704	JGI25155J39150_1000215	JGI25155J39150_10002157	423
1110	3300002705	JGI25156J39149_1000491	JGI25156J39149_10004917	423
1111	3300002737	JGI25162J39368_1000240	JGI25162J39368_10002401	423
1112	3300002737	JGI25162J39368_1000394	JGI25162J39368_10003941	423
1113	3300002738	JGI25154J39366_1000407	JGI25154J39366_10004077	423
1114	3300002739	JGI25158J39367_1000050	JGI25158J39367_10000505	423
1115	3300002739	JGI25158J39367_1000062	JGI25158J39367_100006213	423
1116	3300002739	JGI25158J39367_1000656	JGI25158J39367_10006562	423
1117	3300002739	JGI25158J39367_1003828	JGI25158J39367_10038282	423
1118	3300002741	JGI25157J39369_1000515	JGI25157J39369_10005157	423
1119	3300002773	JGI25152J39213_1000882	JGI25152J39213_10008828	423
1120	3300002773	JGI25152J39213_1003360	JGI25152J39213_10033605	423
1121	3300002773	JGI25152J39213_1007648	JGI25152J39213_10076483	423
1122	3300002774	JGI25150J39212_1000070	JGI25150J39212_100007053	423
1123	3300002774	JGI25150J39212_1002233	JGI25150J39212_10022332	423
1124	3300002987	JGI25159J45721_1000007	JGI25159J45721_1000007142	423
1125	3300002987	JGI25159J45721_1000029	JGI25159J45721_100002972	423
1126	3300002987	JGI25159J45721_1000220	JGI25159J45721_10002204	423
1127	3300002987	JGI25159J45721_1000293	JGI25159J45721_10002933	423
1128	3300003187	JGI25151J46595_10000208	JGI25151J46595_1000020858	423
1129	3300003214	JGI25165J46597_1003597	JGI25165J46597_10035973	423
1130	3300003214	JGI25165J46597_1003608	JGI25165J46597_10036081	423
1131	3300003215	JGI25153J46596_10007174	JGI25153J46596_100071742	423
1132	3300003215	JGI25153J46596_10034239	JGI25153J46596_100342391	423
1133	3300003323	rootH1_10034574	rootH1_100345741	423
1134	3300003323	rootH1_10060099	rootH1_100600992	423
1135	3300003354	JGI25160J50197_1000010	JGI25160J50197_1000010173	423
1136	3300003354	JGI25160J50197_1000011	JGI25160J50197_1000011187	423
1137	3300003374	JGI25161J50226_1000006	JGI25161J50226_1000006173	423
1138	3300003374	JGI25161J50226_1000055	JGI25161J50226_100005536	423
1139	3300003374	JGI25161J50226_1000216	JGI25161J50226_100021622	423
1140	3300003771	Ga0055526_1005205	Ga0055526_10052051	423
1141	3300003771	Ga0055526_1010586	Ga0055526_10105862	423
1142	3300003775	Ga0055524_1000879	Ga0055524_100087914	423
1143	3300003781	Ga0055536_1002370	Ga0055536_10023703	423
1144	3300003790	Ga0055528_1000222	Ga0055528_10002229	423
1145	3300003790	Ga0055528_1001131	Ga0055528_100113111	423
1146	3300003790	Ga0055528_1015919	Ga0055528_10159192	423
1147	3300003791	Ga0055530_10027862	Ga0055530_100278621	423
1148	3300003792	Ga0055540_1002477	Ga0055540_10024775	423
1149	3300003792	Ga0055540_1007973	Ga0055540_10079732	423
1150	3300003794	Ga0055531_10003918	Ga0055531_100039182	423
1151	3300004625	Ga0055543_1000014	Ga0055543_100001479	423
1152	3300004625	Ga0055543_1000032	Ga0055543_100003290	423
1153	3300004625	Ga0055543_1000179	Ga0055543_100017948	423
1154	3300005262	Ga0065165_1000018	Ga0065165_1000018187	423
1155	3300005262	Ga0065165_1000251	Ga0065165_100025183	423
1156	3300005262	Ga0065165_1011886	Ga0065165_10118862	423
1157	3300005331	Ga0070670_100021482	Ga0070670_1000214824	423
1158	3300005355	Ga0070671_100015004	Ga0070671_1000150047	423
1159	3300005548	Ga0070665_100023467	Ga0070665_1000234673	423
1160	3300006038	Ga0075365_10000756	Ga0075365_1000075611	423
1161	3300006051	Ga0075364_10000588	Ga0075364_100005884	423
1162	3300006178	Ga0075367_10000829	Ga0075367_100008297	423
1163	3300006353	Ga0075370_10010671	Ga0075370_100106715	423
1164	3300006946	Ga0079104_1000022	Ga0079104_1000022100	423
1165	3300006946	Ga0079104_1004255	Ga0079104_10042553	423
1166	3300006946	Ga0079104_1004899	Ga0079104_10048993	423
1167	3300009093	Ga0105240_10000005	Ga0105240_10000005524	423
1168	3300009765	Ga0123341_1000004	Ga0123341_100000417	423
1169	3300009765	Ga0123341_1046535	Ga0123341_10465352	423
1170	3300009766	Ga0123342_1018578	Ga0123342_10185783	423
1171	3300009766	Ga0123342_1020028	Ga0123342_10200283	423
1172	3300013104	Ga0157370_10000274	Ga0157370_1000027431	423
1173	3300013249	Ga0171463_1008	Ga0171463_1008144	423
1174	3300015262	Ga0182007_10000711	Ga0182007_1000071118	423
1175	3300015265	Ga0182005_1001790	Ga0182005_10017905	423
1176	3300015690	Ga0183363_1171	Ga0183363_11716	423
1177	3300021320	Ga0214544_1000129	Ga0214544_100012920	423
1178	3300021321	Ga0214542_1000245	Ga0214542_100024525	423
1179	3300021321	Ga0214542_1030122	Ga0214542_10301222	423
1180	3300021327	Ga0214543_1000010	Ga0214543_100001083	423
1181	3300021327	Ga0214543_1000134	Ga0214543_100013457	423
1182	3300022739	Ga0228711_1000007	Ga0228711_1000007132	423
1183	3300022740	Ga0228710_1000007	Ga0228710_1000007119	423
1184	3300025206	Ga0209435_100045	Ga0209435_1000457	423
1185	3300025208	Ga0209436_100034	Ga0209436_10003480	423
1186	3300025208	Ga0209436_103537	Ga0209436_1035373	423
1187	3300025228	Ga0209672_104712	Ga0209672_1047122	423
1188	3300025233	Ga0209437_100047	Ga0209437_100047297	423
1189	3300025233	Ga0209437_100308	Ga0209437_10030863	423
1190	3300025245	Ga0207425_1000024	Ga0207425_100002414	423
1191	3300025245	Ga0207425_1006229	Ga0207425_10062292	423
1192	3300025246	Ga0209646_1000154	Ga0209646_10001547	423
1193	3300025250	Ga0209026_1000177	Ga0209026_10001777	423
1194	3300025253	Ga0209677_102447	Ga0209677_1024476	423
1195	3300025254	Ga0209148_1005009	Ga0209148_10050093	423
1196	3300025256	Ga0209759_1000795	Ga0209759_10007957	423
1197	3300025258	Ga0209129_1000069	Ga0209129_1000069204	423
1198	3300025258	Ga0209129_1000133	Ga0209129_1000133100	423
1199	3300025258	Ga0209129_1002492	Ga0209129_10024926	423
1200	3300025258	Ga0209129_1004911	Ga0209129_10049114	423
1201	3300025258	Ga0209129_1005326	Ga0209129_10053265	423
1202	3300025261	Ga0209233_1000048	Ga0209233_1000048105	423
1203	3300025261	Ga0209233_1000069	Ga0209233_1000069332	423
1204	3300025261	Ga0209233_1000221	Ga0209233_100022150	423
1205	3300025273	Ga0209673_1000013	Ga0209673_1000013517	423
1206	3300025273	Ga0209673_1000048	Ga0209673_1000048108	423
1207	3300025273	Ga0209673_1002108	Ga0209673_10021089	423
1208	3300025273	Ga0209673_1003476	Ga0209673_10034767	423
1209	3300025273	Ga0209673_1007158	Ga0209673_10071583	423
1210	3300025273	Ga0209673_1021452	Ga0209673_10214522	423
1211	3300025284	Ga0209130_1000004	Ga0209130_1000004114	423
1212	3300025284	Ga0209130_1000021	Ga0209130_100002195	423
1213	3300025284	Ga0209130_1000029	Ga0209130_100002968	423
1214	3300025292	Ga0209676_1001711	Ga0209676_100171110	423
1215	3300025294	Ga0209025_1000033	Ga0209025_1000033129	423
1216	3300025294	Ga0209025_1000050	Ga0209025_1000050313	423
1217	3300025294	Ga0209025_1007047	Ga0209025_100704710	423
1218	3300025294	Ga0209025_1017497	Ga0209025_10174973	423
1219	3300025295	Ga0209564_1000275	Ga0209564_100027530	423
1220	3300025295	Ga0209564_1000570	Ga0209564_100057053	423
1221	3300025295	Ga0209564_1000631	Ga0209564_100063130	423
1222	3300025295	Ga0209564_1009645	Ga0209564_10096455	423
1223	3300025297	Ga0209758_1000421	Ga0209758_100042158	423
1224	3300025297	Ga0209758_1000468	Ga0209758_100046840	423
1225	3300025297	Ga0209758_1003958	Ga0209758_10039584	423
1226	3300025297	Ga0209758_1038163	Ga0209758_10381632	423
1227	3300025298	Ga0209050_1001363	Ga0209050_100136312	423
1228	3300025298	Ga0209050_1004988	Ga0209050_10049886	423
1229	3300025299	Ga0209256_1000644	Ga0209256_100064431	423
1230	3300025299	Ga0209256_1000649	Ga0209256_100064927	423
1231	3300025299	Ga0209256_1002453	Ga0209256_100245312	423
1232	3300025299	Ga0209256_1009707	Ga0209256_10097072	423
1233	3300025299	Ga0209256_1012706	Ga0209256_10127063	423
1234	3300025302	Ga0207426_1000003	Ga0207426_1000003614	423
1235	3300025302	Ga0207426_1000010	Ga0207426_1000010263	423
1236	3300025302	Ga0207426_1000074	Ga0207426_1000074229	423
1237	3300025302	Ga0207426_1001225	Ga0207426_10012252	423
1238	3300025303	Ga0209051_1000445	Ga0209051_10004457	423
1239	3300025303	Ga0209051_1004342	Ga0209051_10043427	423
1240	3300025303	Ga0209051_1004443	Ga0209051_10044438	423
1241	3300025303	Ga0209051_1020359	Ga0209051_10203591	423
1242	3300025304	Ga0209257_1001375	Ga0209257_100137533	423
1243	3300025304	Ga0209257_1002758	Ga0209257_10027587	423
1244	3300025913	Ga0207695_10000011	Ga0207695_10000011394	423
1245	3300025914	Ga0207671_10000314	Ga0207671_1000031453	423
1246	3300025925	Ga0207650_10030117	Ga0207650_100301172	423
1247	3300027111	Ga0209281_1000036	Ga0209281_1000036378	423
1248	3300027111	Ga0209281_1000047	Ga0209281_1000047320	423
1249	3300027111	Ga0209281_1000128	Ga0209281_100012872	423
1250	3300027111	Ga0209281_1000851	Ga0209281_100085128	423
1251	3300027666	Ga0209282_1000034	Ga0209282_10000346	423
1252	3300028794	Ga0307515_10000198	Ga0307515_1000019817	423
1253	3300028794	Ga0307515_10014201	Ga0307515_100142016	423
1254	3300028794	Ga0307515_10088378	Ga0307515_100883783	423
1255	3300031456	Ga0307513_10108683	Ga0307513_101086833	423
1256	3300031548	Ga0307408_100021876	Ga0307408_1000218762	423
1257	3300031548	Ga0307408_100041668	Ga0307408_1000416682	423
1258	3300031901	Ga0307406_10022052	Ga0307406_100220524	423
1259	3300031901	Ga0307406_10063537	Ga0307406_100635372	423
1260	3300031967	Ga0315914_1000010	Ga0315914_100001044	423
1261	3300033430	Ga0315913_1000005	Ga0315913_100000544	423
1262	3300033464	Ga0315915_1000012	Ga0315915_1000012119	423
1263	3300041404	Ga0439436_0009875	Ga0439436_0009875_330_1604	423
1264	3300041411	Ga0439466_0035596	Ga0439466_0035596_245_1519	423
1265	3300041413	Ga0439465_0013135	Ga0439465_0013135_1079_2353	423
1266	3300041492	Ga0451835_0256069	Ga0451835_0256069_24_1298	423
1267	3300041492	Ga0451835_1189071	Ga0451835_1189071_110_1384	423
1268	3300041501	Ga0451845_0146031	Ga0451845_0146031_471_1745	423
1269	3300041502	Ga0451846_30130	Ga0451846_30130_471_1745	423
1270	3300041503	Ga0451847_0621551	Ga0451847_0621551_1589_2863	423
1271	3300041505	Ga0451849_0041359	Ga0451849_0041359_1180_2460	423
1272	3300041507	Ga0451851_0923464	Ga0451851_0923464_1135_2409	423
1273	3300041510	Ga0451854_07196	Ga0451854_07196_857_2131	423
1274	3300041907	Ga0452268_06786	Ga0452268_06786_393_1667	423
1275	3300042007	Ga0439449_0007360	Ga0439449_0007360_2626_3903	423
1276	3300042015	Ga0439462_0025619	Ga0439462_0025619_257_1531	423
1277	3300042435	Ga0439434_0018439	Ga0439434_0018439_133_1407	423
1278	3300044694	Ga0466963_0051784	Ga0466963_0051784_224_1498	423
1279	3300044765	Ga0466970_0015775	Ga0466970_0015775_1235_2509	423
1280	3300045049	Ga0466959_0076927	Ga0466959_0076927_993_2267	423
1281	3300045836	Ga0466958_0042182	Ga0466958_0042182_202_1476	423
1282	3300046460	Ga0495638_0002485	Ga0495638_0002485_1237_2511	423
1283	3300046474	Ga0495605_0023979	Ga0495605_0023979_1333_2607	423
1284	3300046506	Ga0495583_0054407	Ga0495583_0054407_480_1754	423
1285	3300046507	Ga0495606_0029509	Ga0495606_0029509_2279_3553	423
1286	3300046512	Ga0495610_0002799	Ga0495610_0002799_1356_2630	423
1287	3300046515	Ga0495620_0029144	Ga0495620_0029144_260_1534	423
1288	3300046518	Ga0495631_0022158	Ga0495631_0022158_1337_2611	423
1289	3300046519	Ga0495632_0027307	Ga0495632_0027307_1475_2749	423
1290	3300046519	Ga0495632_0027693	Ga0495632_0027693_1368_2642	423
1291	3300046524	Ga0495648_0091838	Ga0495648_0091838_398_1672	423
1292	3300046530	Ga0495654_0003447	Ga0495654_0003447_3974_5257	423
1293	3300046538	Ga0495609_0051549	Ga0495609_0051549_347_1621	423
1294	3300046558	Ga0495633_0066170	Ga0495633_0066170_54_1328	423
1295	3300046616	Ga0495668_0032833	Ga0495668_0032833_1245_2519	423
1296	3300046616	Ga0495668_0095726	Ga0495668_0095726_49_1323	423
1297	3300046660	Ga0495625_0047434	Ga0495625_0047434_1168_2442	423
1298	3300046660	Ga0495625_0120788	Ga0495625_0120788_18_1301	423
1299	3300046691	Ga0495670_0073833	Ga0495670_0073833_316_1590	423
1300	3300046694	Ga0495649_0064943	Ga0495649_0064943_401_1675	423
1301	3300046809	Ga0495600_0070526	Ga0495600_0070526_137_1462	423
1302	3300046810	Ga0495660_0077642	Ga0495660_0077642_160_1434	423
1303	3300047318	Ga0495636_0044016	Ga0495636_0044016_241_1515	423
1304	3300047320	Ga0495672_0029596	Ga0495672_0029596_584_1858	423
1305	3300047472	Ga0495686_0013897	Ga0495686_0013897_2032_3306	423
1306	3300048904	Ga0496101_0093409	Ga0496101_0093409_24_1298	423
1307	3300048905	Ga0496102_0099204	Ga0496102_0099204_1269_2543	423
1308	3300048914	Ga0496111_0015344	Ga0496111_0015344_2635_3918	423
1309	3300048917	Ga0496114_0096134	Ga0496114_0096134_480_1757	423
1310	3300048919	Ga0496116_0004401	Ga0496116_0004401_12162_13436	423
1311	3300048919	Ga0496116_0045167	Ga0496116_0045167_64_1338	423
1312	3300048919	Ga0496116_0093161	Ga0496116_0093161_305_1579	423
1313	3300048920	Ga0496117_0001959	Ga0496117_0001959_107_1381	423
1314	3300048920	Ga0496117_0006730	Ga0496117_0006730_985_2259	423
1315	3300048921	Ga0496118_0016547	Ga0496118_0016547_3753_5027	423
1316	3300048921	Ga0496118_0099592	Ga0496118_0099592_392_1666	423
1317	3300048923	Ga0496120_0019985	Ga0496120_0019985_1473_2747	423
1318	3300048923	Ga0496120_0072803	Ga0496120_0072803_308_1582	423
1319	3300048923	Ga0496120_0109420	Ga0496120_0109420_99_1373	423
1320	3300048924	Ga0496121_0000003	Ga0496121_0000003_30079_31353	423
1321	3300048924	Ga0496121_0002428	Ga0496121_0002428_22846_24120	423
1322	3300048924	Ga0496121_0004370	Ga0496121_0004370_8782_10107	423
1323	3300048924	Ga0496121_0007053	Ga0496121_0007053_12162_13436	423
1324	3300048924	Ga0496121_0040901	Ga0496121_0040901_269_1552	423
1325	3300048924	Ga0496121_0042602	Ga0496121_0042602_2517_3791	423
1326	3300048924	Ga0496121_0137797	Ga0496121_0137797_503_1777	423
1327	3300048924	Ga0496121_0155172	Ga0496121_0155172_50_1324	423
1328	3300048925	Ga0496122_0000025	Ga0496122_0000025_149013_150299	423
1329	3300048925	Ga0496122_0000399	Ga0496122_0000399_25751_27025	423
1330	3300048925	Ga0496122_0021330	Ga0496122_0021330_36_1310	423
1331	3300048925	Ga0496122_0120091	Ga0496122_0120091_172_1455	423
1332	3300048926	Ga0496123_0000032	Ga0496123_0000032_213914_215200	423
1333	3300048926	Ga0496123_0003753	Ga0496123_0003753_4157_5431	423
1334	3300048926	Ga0496123_0005051	Ga0496123_0005051_2517_3791	423
1335	3300048926	Ga0496123_0029510	Ga0496123_0029510_150_1433	423
1336	3300048926	Ga0496123_0044610	Ga0496123_0044610_215_1489	423
1337	3300048926	Ga0496123_0084650	Ga0496123_0084650_543_1817	423
1338	3300048926	Ga0496123_0099584	Ga0496123_0099584_380_1654	423
1339	3300048926	Ga0496123_0121238	Ga0496123_0121238_166_1440	423
1340	3300048927	Ga0496124_0004615	Ga0496124_0004615_12162_13436	423
1341	3300048927	Ga0496124_0018921	Ga0496124_0018921_3267_4553	423
1342	3300048927	Ga0496124_0024377	Ga0496124_0024377_145_1419	423
1343	3300048927	Ga0496124_0069460	Ga0496124_0069460_1401_2684	423
1344	3300048927	Ga0496124_0106276	Ga0496124_0106276_342_1616	423
1345	3300048927	Ga0496124_0107530	Ga0496124_0107530_542_1816	423
1346	3300048927	Ga0496124_0118368	Ga0496124_0118368_600_1874	423
1347	3300048927	Ga0496124_0152034	Ga0496124_0152034_158_1432	423
1348	3300048927	Ga0496124_0223896	Ga0496124_0223896_35_1309	423
1349	3300048928	Ga0496125_0000155	Ga0496125_0000155_104086_105360	423
1350	3300048928	Ga0496125_0002230	Ga0496125_0002230_23062_24336	423
1351	3300048928	Ga0496125_0147980	Ga0496125_0147980_334_1608	423
1352	3300048928	Ga0496125_0182353	Ga0496125_0182353_20_1345	423
1353	3300048929	Ga0496126_0025790	Ga0496126_0025790_1000_2331	423
1354	3300048929	Ga0496126_0166709	Ga0496126_0166709_388_1662	423
1355	3300049571	Ga0501034_0220655	Ga0501034_0220655_275_1549	423
1356	3300049572	Ga0501036_0196293	Ga0501036_0196293_300_1574	423
1357	3300049574	Ga0501038_0093869	Ga0501038_0093869_915_2189	423
1358	3300049579	Ga0501043_0171229	Ga0501043_0171229_394_1668	423
1359	3300049744	Ga0501083_0037699	Ga0501083_0037699_1743_3017	423
1360	3300049822	Ga0501035_0198987	Ga0501035_0198987_140_1414	423
1361	3300049823	Ga0501044_0117822	Ga0501044_0117822_1266_2540	423
1362	3300049823	Ga0501044_0125074	Ga0501044_0125074_293_1567	423
1363	3300050491	nmdc:mga00v17_32449_c1	nmdc:mga00v17_32449_c1_548_1822	423
1364	3300053109	Ga0500569_004528	Ga0500569_004528_371_1645	423
1365	3300053118	Ga0500594_0020946	Ga0500594_0020946_332_1606	423
1366	3300053125	Ga0500618_000190	Ga0500618_000190_4214_5497	423
1367	3300053125	Ga0500618_002477	Ga0500618_002477_1378_2652	423
1368	3300053125	Ga0500618_020276	Ga0500618_020276_51_1325	423
1369	3300053134	Ga0500658_0000262	Ga0500658_0000262_20200_21474	423
1370	3300053139	Ga0500568_0033924	Ga0500568_0033924_413_1687	423
1371	3300053140	Ga0500573_0010605	Ga0500573_0010605_3481_4755	423
1372	3300053153	Ga0500616_0001206	Ga0500616_0001206_23986_25260	423
1373	3300053153	Ga0500616_0006291	Ga0500616_0006291_1449_2723	423
1374	3300053153	Ga0500616_0017735	Ga0500616_0017735_1988_3259	423
1375	3300053156	Ga0500622_0015568	Ga0500622_0015568_167_1441	423
1376	3300053156	Ga0500622_0047851	Ga0500622_0047851_347_1621	423
1377	3300053160	Ga0500633_0021152	Ga0500633_0021152_509_1783	423
1378	3300053161	Ga0500634_0009966	Ga0500634_0009966_674_1954	423
1379	3300060353	Ga0501082_0153192	Ga0501082_0153192_481_1755	423
1380	iso_pu_bacteria	3002141150	3002144001	423
1381	iso_pu_bacteria	639633055	639648456	423
1382	2010549000	RicEn_C1045	RicEn_19310	424
1383	3300049823	Ga0501044_0259893	Ga0501044_0259893_142_1419	424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

189

414

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4dn7-assembly1.cif.gz_B	crystal structure of putative abc transporter, atp-binding protein from methanosarcina mazei go1	0.8981	88	422
5awf-assembly1.cif.gz_B	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.8978	10	419
5awg-assembly2.cif.gz_F	crystal structure of hg-bound sufb-sufc-sufd complex from escherichia coli	0.8916	78	418
5awf-assembly1.cif.gz_B	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.8874	10	419
5awg-assembly2.cif.gz_F	crystal structure of hg-bound sufb-sufc-sufd complex from escherichia coli	0.8501	78	418

ID	Description	Score	Start	End	Superfamily
af_A0A0K3ATU3_79_235_1.10.490.10	Mainly Alpha;Orthogonal Bundle;Globin-like;Globins	0.5091	372	421	1.10.490.10
1ezaA02	Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;PtsI, HPr-binding domain	0.4366	371	422	1.10.274.10
af_Q4CKJ8_12_259_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3692	149	353	2.160.20.10
af_Q4CLR5_6_301_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3365	147	369	2.160.20.10
af_A0A0P0X3K6_335_546_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3298	149	367	2.160.20.10

ID	Description	Score	Start	End	GO Terms
AF-A0A523JXS2-F1-model_v4	SufD family Fe-S cluster assembly protein	0.9913	232	423	GO:0016226
AF-A0A7W1FZW9-F1-model_v4	SufD family Fe-S cluster assembly protein	0.9894	249	420	GO:0016226
AF-A0A3D2ND49-F1-model_v4	deleted	0.9883	276	423
AF-A0A7Z9PTL7-F1-model_v4	Fe-S cluster assembly protein SufD	0.988	266	422	GO:0016226
AF-R5RYW3-F1-model_v4	deleted	0.9875	204	423

Feature Viewer

pLDDT	pTM	Quality
94.1	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F493534

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

189

414

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map