F493536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1383 | 752 | 1083 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300014745|Ga0157377_10826117|Ga0157377_108261172 |
| Length | 145 |
| Sequence | MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRAITREMKRAGRVWIRIFPDVPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDGVNDETAREALRLGAGKLPIKTKVVTRTDAGLTMEVVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 8 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 9 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 10 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 11 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 12 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 13 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 14 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 15 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 16 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 17 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 18 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 19 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 20 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 21 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 22 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 23 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 24 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 25 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 26 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 27 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 28 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 29 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 30 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 31 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 32 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 33 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 34 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 35 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 36 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 37 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 38 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 39 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 40 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 41 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 42 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 43 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 44 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 45 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 46 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 47 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 48 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 49 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 50 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 51 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 52 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 53 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 54 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 55 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 56 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 57 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 58 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 59 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 60 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 61 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 62 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 63 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 64 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 65 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 66 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 67 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 68 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 69 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 70 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 71 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 72 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 73 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 74 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 75 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 76 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 77 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 78 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 79 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 80 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 81 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 82 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 83 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 84 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 85 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 86 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 87 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 88 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 89 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 90 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 91 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 92 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 93 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 94 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 95 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 96 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 97 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 98 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 99 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 100 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 101 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 102 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 103 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 104 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 105 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 106 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 107 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 108 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 109 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 110 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 111 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 112 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 113 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 114 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 115 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 116 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 117 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 118 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 119 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 120 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 121 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 122 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 123 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 124 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 125 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 126 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 127 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 128 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 129 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 130 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 131 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 132 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 133 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 134 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 135 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 136 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 137 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 138 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 139 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 140 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 141 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 142 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 143 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 144 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 145 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 146 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 147 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 148 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 149 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 150 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 151 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 152 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 153 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 154 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 155 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 156 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 157 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 158 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 159 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 160 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 161 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 162 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 163 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 164 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 165 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 166 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 167 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 168 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 169 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 170 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 171 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 172 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 173 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 174 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 175 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 176 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 177 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 178 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 179 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 180 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 181 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 182 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 183 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 184 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 185 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 186 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 187 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 188 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 189 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 190 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 191 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 192 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 193 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 194 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 195 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 196 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 197 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 198 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 199 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 200 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 201 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 202 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 203 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 204 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 205 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 206 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 207 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 208 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 209 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 210 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 211 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 212 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 213 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 214 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 215 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 216 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 217 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 218 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 219 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 220 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 221 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 222 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 223 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 224 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 225 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 226 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 227 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 228 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 229 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 230 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 231 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 232 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 233 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 234 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 235 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 236 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 237 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 238 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 239 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 240 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 241 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 242 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 243 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 244 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 245 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 246 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 247 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 248 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 249 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 250 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 251 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 252 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 253 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 254 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 255 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 256 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 257 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 258 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 259 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 260 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 261 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 262 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 263 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 264 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 265 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 266 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 267 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 268 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 269 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 270 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 271 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 272 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 273 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 274 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 275 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 276 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 277 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 278 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 279 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 280 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 281 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 282 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 283 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 284 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 285 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 286 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 287 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 288 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 289 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 290 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 291 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 294 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 296 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 297 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 299 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 300 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 301 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 306 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 309 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 311 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 312 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 317 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 318 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 319 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 320 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 321 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 322 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 323 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 324 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 326 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 327 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 328 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 330 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 331 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 332 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 333 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 334 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 335 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 336 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 337 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 339 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 340 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 341 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 342 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 343 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 344 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 345 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 346 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 348 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 349 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 350 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 351 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 352 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 355 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 356 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 358 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 361 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 362 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 363 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 364 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 365 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 366 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 367 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 368 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 369 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 370 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 371 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 372 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 373 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 374 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 375 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 376 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 379 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 381 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 382 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 383 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 384 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 385 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 386 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 387 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 388 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 389 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 390 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 391 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 393 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 394 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 396 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 397 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 455 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 456 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 457 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 458 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 459 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 460 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 461 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 462 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 463 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 464 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 465 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 466 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 467 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 468 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 469 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 470 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 471 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 472 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 473 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 474 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 475 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 476 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 477 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 478 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 479 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 480 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 481 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 482 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 483 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 484 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 485 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 486 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 487 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 488 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 489 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 490 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 491 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 492 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 493 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 494 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 495 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 496 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 497 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 498 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 499 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 500 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 501 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 502 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 503 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 504 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 505 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 506 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 507 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 508 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 509 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 510 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 511 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 512 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 513 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 514 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 515 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 516 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 517 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 518 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 519 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 520 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 521 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 522 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 523 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 524 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 525 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 526 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 527 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 528 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 529 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 530 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 531 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 532 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 533 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 534 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 535 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 536 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 537 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 538 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 539 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 540 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 541 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 542 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 543 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 544 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 545 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 546 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 547 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 548 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 549 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 597 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 598 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 599 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 600 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 601 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 602 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 604 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 605 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 606 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 607 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 608 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 609 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 610 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 611 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 612 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 613 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 614 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 615 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 616 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 617 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 618 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 619 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 620 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 621 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 623 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 630 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 634 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 636 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 637 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 638 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 639 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 641 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 642 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 660 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 661 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 662 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 663 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 664 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 665 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 666 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 668 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 669 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 670 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 671 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 673 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 676 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 677 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 678 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 679 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 680 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 681 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 682 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 683 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 684 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 685 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 686 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 687 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 688 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 689 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 690 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 691 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 692 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 693 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 694 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 695 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 696 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 697 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 698 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 699 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 700 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 701 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 702 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 703 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 704 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 705 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 706 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 709 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 710 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 711 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 712 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 713 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 714 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 715 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 716 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 717 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 718 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 719 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 720 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 721 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 722 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 723 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 724 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 725 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 726 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 727 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 728 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 730 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 731 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 732 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 734 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 735 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 736 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 737 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 738 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 739 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 740 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 741 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 742 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 743 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 744 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 745 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 746 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 747 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 748 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 749 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 750 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 751 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 752 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.05 |
| Metatranscriptomes | 3.25 |
| Isolates | 21.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.59 |
| Nodule | 17.64 |
| Rhizoplane | 1.81 |
| Rhizosphere | 65.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011508 | 3300001979 | Bacteria | 3365 |
| 2 | JGI24739J22299_10011564 | 3300001989 | Bacteria | 3258 |
| 3 | JGI24739J22299_10023219 | 3300001989 | Bacteria | 2194 |
| 4 | JGI24737J22298_10065756 | 3300001990 | Bacteria | 1086 |
| 5 | JGI25156J39149_1004694 | 3300002705 | Bacteria | 4104 |
| 6 | JGI25157J39369_1002241 | 3300002741 | Bacteria | 5220 |
| 7 | JGI25406J46586_10001918 | 3300003203 | Bacteria | 9806 |
| 8 | JGI25165J46597_1001303 | 3300003214 | Bacteria | 14268 |
| 9 | Ga0055542_1002774 | 3300003762 | Bacteria | 5300 |
| 10 | Ga0055529_1005671 | 3300003763 | Bacteria | 1787 |
| 11 | Ga0070658_10183900 | 3300005327 | Bacteria | 1759 |
| 12 | Ga0070676_10143888 | 3300005328 | Bacteria | 1520 |
| 13 | Ga0068869_100096159 | 3300005334 | Bacteria | 2235 |
| 14 | Ga0068869_101231623 | 3300005334 | Bacteria | 658 |
| 15 | Ga0070666_10089881 | 3300005335 | Bacteria | 2108 |
| 16 | Ga0070682_100255530 | 3300005337 | Bacteria | 1265 |
| 17 | Ga0070682_101760505 | 3300005337 | Bacteria | 540 |
| 18 | Ga0068868_100073957 | 3300005338 | Bacteria | 2721 |
| 19 | Ga0068868_101574763 | 3300005338 | Bacteria | 617 |
| 20 | Ga0070660_100981005 | 3300005339 | Bacteria | 714 |
| 21 | Ga0070689_100111476 | 3300005340 | Bacteria | 2176 |
| 22 | Ga0070687_100094508 | 3300005343 | Bacteria | 1660 |
| 23 | Ga0070661_100021028 | 3300005344 | Bacteria | 4658 |
| 24 | Ga0070661_100049078 | 3300005344 | Bacteria | 3090 |
| 25 | Ga0070675_100203748 | 3300005354 | Bacteria | 1717 |
| 26 | Ga0070675_100559861 | 3300005354 | Bacteria | 1034 |
| 27 | Ga0070675_100763812 | 3300005354 | Bacteria | 882 |
| 28 | Ga0070671_100280251 | 3300005355 | Bacteria | 1418 |
| 29 | Ga0070674_100294493 | 3300005356 | Bacteria | 1291 |
| 30 | Ga0070673_100326000 | 3300005364 | Bacteria | 1357 |
| 31 | Ga0070688_100209230 | 3300005365 | Bacteria | 1369 |
| 32 | Ga0070688_100394795 | 3300005365 | Bacteria | 1023 |
| 33 | Ga0070659_100338681 | 3300005366 | Bacteria | 1260 |
| 34 | Ga0070659_100689668 | 3300005366 | Bacteria | 882 |
| 35 | Ga0070667_100277362 | 3300005367 | Bacteria | 1505 |
| 36 | Ga0070709_10020478 | 3300005434 | Bacteria | 3837 |
| 37 | Ga0070709_10053418 | 3300005434 | Bacteria | 2544 |
| 38 | Ga0070714_100333680 | 3300005435 | Bacteria | 1421 |
| 39 | Ga0070714_100851782 | 3300005435 | Bacteria | 884 |
| 40 | Ga0070714_101275745 | 3300005435 | Bacteria | 717 |
| 41 | Ga0070713_100054584 | 3300005436 | Bacteria | 3316 |
| 42 | Ga0070713_101421033 | 3300005436 | Bacteria | 673 |
| 43 | Ga0070710_10072682 | 3300005437 | Bacteria | 1986 |
| 44 | Ga0070705_100594703 | 3300005440 | Bacteria | 855 |
| 45 | Ga0070663_100031905 | 3300005455 | Bacteria | 3626 |
| 46 | Ga0070663_100105054 | 3300005455 | Bacteria | 2113 |
| 47 | Ga0070663_100151353 | 3300005455 | Bacteria | 1779 |
| 48 | Ga0070663_101334560 | 3300005455 | Bacteria | 634 |
| 49 | Ga0070678_101419075 | 3300005456 | Bacteria | 649 |
| 50 | Ga0070678_101904622 | 3300005456 | Bacteria | 561 |
| 51 | Ga0070662_100137792 | 3300005457 | Bacteria | 1888 |
| 52 | Ga0070681_10742830 | 3300005458 | Bacteria | 898 |
| 53 | Ga0070698_100134303 | 3300005471 | Bacteria | 2429 |
| 54 | Ga0070679_100469604 | 3300005530 | Bacteria | 1202 |
| 55 | Ga0070684_101259428 | 3300005535 | Bacteria | 696 |
| 56 | Ga0070684_101272144 | 3300005535 | Bacteria | 692 |
| 57 | Ga0070697_100657013 | 3300005536 | Bacteria | 923 |
| 58 | Ga0068853_100000888 | 3300005539 | Bacteria | 20812 |
| 59 | Ga0068853_100114801 | 3300005539 | Bacteria | 2396 |
| 60 | Ga0068853_100269462 | 3300005539 | Bacteria | 1567 |
| 61 | Ga0068853_100445767 | 3300005539 | Bacteria | 1217 |
| 62 | Ga0070665_100006166 | 3300005548 | Bacteria | 12264 |
| 63 | Ga0070665_100319540 | 3300005548 | Bacteria | 1557 |
| 64 | Ga0068855_100047378 | 3300005563 | Bacteria | 5078 |
| 65 | Ga0068855_100132159 | 3300005563 | Bacteria | 2849 |
| 66 | Ga0068855_100326596 | 3300005563 | Bacteria | 1694 |
| 67 | Ga0068855_100420269 | 3300005563 | Bacteria | 1462 |
| 68 | Ga0068855_101424104 | 3300005563 | Bacteria | 714 |
| 69 | Ga0070664_100552558 | 3300005564 | Bacteria | 1065 |
| 70 | Ga0068857_100458367 | 3300005577 | Bacteria | 1193 |
| 71 | Ga0068857_100559042 | 3300005577 | Bacteria | 1078 |
| 72 | Ga0068857_100904146 | 3300005577 | Bacteria | 847 |
| 73 | Ga0068854_100225910 | 3300005578 | Bacteria | 1483 |
| 74 | Ga0068854_100354078 | 3300005578 | Bacteria | 1202 |
| 75 | Ga0068856_100081776 | 3300005614 | Bacteria | 3205 |
| 76 | Ga0068856_100114919 | 3300005614 | Bacteria | 2690 |
| 77 | Ga0068856_100352912 | 3300005614 | Bacteria | 1489 |
| 78 | Ga0068856_100369844 | 3300005614 | Bacteria | 1452 |
| 79 | Ga0068856_101663352 | 3300005614 | Bacteria | 651 |
| 80 | Ga0070702_100576219 | 3300005615 | Bacteria | 840 |
| 81 | Ga0068852_100009612 | 3300005616 | Bacteria | 7185 |
| 82 | Ga0068852_100016813 | 3300005616 | Bacteria | 5719 |
| 83 | Ga0068852_100026746 | 3300005616 | Bacteria | 4695 |
| 84 | Ga0068852_100285464 | 3300005616 | Bacteria | 1592 |
| 85 | Ga0068852_101715648 | 3300005616 | Bacteria | 650 |
| 86 | Ga0068852_101918274 | 3300005616 | Bacteria | 614 |
| 87 | Ga0068852_102361678 | 3300005616 | Bacteria | 552 |
| 88 | Ga0068861_100051723 | 3300005719 | Bacteria | 3120 |
| 89 | Ga0068861_100790679 | 3300005719 | Bacteria | 890 |
| 90 | Ga0068851_10011945 | 3300005834 | Bacteria | 4083 |
| 91 | Ga0068851_10129488 | 3300005834 | Bacteria | 1363 |
| 92 | Ga0068851_10967984 | 3300005834 | Bacteria | 536 |
| 93 | Ga0068858_100277785 | 3300005842 | Bacteria | 1594 |
| 94 | Ga0068858_100376245 | 3300005842 | Bacteria | 1362 |
| 95 | Ga0068862_100150751 | 3300005844 | Bacteria | 2069 |
| 96 | Ga0068862_100593448 | 3300005844 | Bacteria | 1062 |
| 97 | Ga0081455_10012098 | 3300005937 | Bacteria | 8627 |
| 98 | Ga0081455_10046763 | 3300005937 | Bacteria | 3752 |
| 99 | Ga0081455_10127650 | 3300005937 | Bacteria | 1993 |
| 100 | Ga0081540_1002663 | 3300005983 | Bacteria | 14523 |
| 101 | Ga0081540_1016488 | 3300005983 | Bacteria | 4620 |
| 102 | Ga0081540_1089513 | 3300005983 | Bacteria | 1358 |
| 103 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 104 | Ga0081539_10004419 | 3300005985 | Bacteria | 15563 |
| 105 | Ga0081539_10019248 | 3300005985 | Bacteria | 4683 |
| 106 | Ga0070717_10577894 | 3300006028 | Bacteria | 1019 |
| 107 | Ga0070717_10859221 | 3300006028 | Bacteria | 826 |
| 108 | Ga0075365_10069048 | 3300006038 | Bacteria | 2375 |
| 109 | Ga0075365_10170405 | 3300006038 | Bacteria | 1519 |
| 110 | Ga0075365_10422342 | 3300006038 | Bacteria | 941 |
| 111 | Ga0075365_10741750 | 3300006038 | Bacteria | 693 |
| 112 | Ga0075365_11168730 | 3300006038 | Bacteria | 541 |
| 113 | Ga0075368_10166398 | 3300006042 | Bacteria | 925 |
| 114 | Ga0075368_10203166 | 3300006042 | Bacteria | 839 |
| 115 | Ga0075368_10364533 | 3300006042 | Bacteria | 630 |
| 116 | Ga0075368_10408645 | 3300006042 | Bacteria | 597 |
| 117 | Ga0075363_100004858 | 3300006048 | Bacteria | 5938 |
| 118 | Ga0075363_100422880 | 3300006048 | Bacteria | 785 |
| 119 | Ga0075363_100565768 | 3300006048 | Bacteria | 679 |
| 120 | Ga0070716_100118595 | 3300006173 | Bacteria | 1652 |
| 121 | Ga0070712_100020783 | 3300006175 | Bacteria | 4300 |
| 122 | Ga0070712_100507373 | 3300006175 | Bacteria | 1012 |
| 123 | Ga0070712_101750514 | 3300006175 | Bacteria | 544 |
| 124 | Ga0075362_10004861 | 3300006177 | Bacteria | 4855 |
| 125 | Ga0075362_10014057 | 3300006177 | Bacteria | 3222 |
| 126 | Ga0075362_10310555 | 3300006177 | Bacteria | 784 |
| 127 | Ga0075367_10148470 | 3300006178 | Bacteria | 1454 |
| 128 | Ga0075367_10183139 | 3300006178 | Bacteria | 1306 |
| 129 | Ga0075367_10421671 | 3300006178 | Bacteria | 845 |
| 130 | Ga0075367_10421684 | 3300006178 | Bacteria | 845 |
| 131 | Ga0075367_10875772 | 3300006178 | Bacteria | 572 |
| 132 | Ga0075369_10108834 | 3300006186 | Bacteria | 1248 |
| 133 | Ga0075369_10139127 | 3300006186 | Bacteria | 1106 |
| 134 | Ga0075369_10178884 | 3300006186 | Bacteria | 976 |
| 135 | Ga0097621_100769182 | 3300006237 | Bacteria | 890 |
| 136 | Ga0097621_100818497 | 3300006237 | Bacteria | 864 |
| 137 | Ga0075370_10003104 | 3300006353 | Bacteria | 7840 |
| 138 | Ga0075370_10176245 | 3300006353 | Bacteria | 1257 |
| 139 | Ga0068871_100580240 | 3300006358 | Bacteria | 1018 |
| 140 | Ga0075430_100000605 | 3300006846 | Bacteria | 27377 |
| 141 | Ga0075434_101003988 | 3300006871 | Bacteria | 848 |
| 142 | Ga0068865_100104366 | 3300006881 | Bacteria | 2080 |
| 143 | Ga0097620_100592678 | 3300006931 | Bacteria | 1202 |
| 144 | Ga0105240_10004696 | 3300009093 | Bacteria | 20647 |
| 145 | Ga0105240_10568612 | 3300009093 | Bacteria | 1252 |
| 146 | Ga0105240_10747556 | 3300009093 | Bacteria | 1063 |
| 147 | Ga0105240_11183468 | 3300009093 | Bacteria | 810 |
| 148 | Ga0105245_10469358 | 3300009098 | Bacteria | 1270 |
| 149 | Ga0105245_10731578 | 3300009098 | Bacteria | 1024 |
| 150 | Ga0105245_10845108 | 3300009098 | Bacteria | 955 |
| 151 | Ga0105245_11455164 | 3300009098 | Bacteria | 736 |
| 152 | Ga0105247_10106510 | 3300009101 | Bacteria | 1799 |
| 153 | Ga0105247_10190156 | 3300009101 | Bacteria | 1374 |
| 154 | Ga0114129_12169584 | 3300009147 | Bacteria | 669 |
| 155 | Ga0114129_12766950 | 3300009147 | Bacteria | 584 |
| 156 | Ga0105243_10119606 | 3300009148 | Bacteria | 2218 |
| 157 | Ga0105243_11676020 | 3300009148 | Bacteria | 664 |
| 158 | Ga0105241_10040943 | 3300009174 | Bacteria | 3499 |
| 159 | Ga0105241_10196158 | 3300009174 | Bacteria | 1683 |
| 160 | Ga0105241_10256290 | 3300009174 | Bacteria | 1485 |
| 161 | Ga0105241_10295719 | 3300009174 | Bacteria | 1388 |
| 162 | Ga0105241_11044501 | 3300009174 | Bacteria | 766 |
| 163 | Ga0105242_10064140 | 3300009176 | Bacteria | 3027 |
| 164 | Ga0105237_10332155 | 3300009545 | Bacteria | 1524 |
| 165 | Ga0105237_10586873 | 3300009545 | Bacteria | 1121 |
| 166 | Ga0105237_10640967 | 3300009545 | Bacteria | 1069 |
| 167 | Ga0105237_10944359 | 3300009545 | Bacteria | 869 |
| 168 | Ga0105238_10012597 | 3300009551 | Bacteria | 8537 |
| 169 | Ga0105238_10060184 | 3300009551 | Bacteria | 3803 |
| 170 | Ga0105238_10290940 | 3300009551 | Bacteria | 1616 |
| 171 | Ga0105238_10709028 | 3300009551 | Bacteria | 1018 |
| 172 | Ga0105249_10525741 | 3300009553 | Bacteria | 1231 |
| 173 | Ga0105239_10039505 | 3300010375 | Bacteria | 5170 |
| 174 | Ga0105239_10104618 | 3300010375 | Bacteria | 3134 |
| 175 | Ga0105239_10256544 | 3300010375 | Bacteria | 1965 |
| 176 | Ga0105239_11270276 | 3300010375 | Bacteria | 849 |
| 177 | Ga0105239_11393482 | 3300010375 | Bacteria | 809 |
| 178 | Ga0105246_10114713 | 3300011119 | Bacteria | 1985 |
| 179 | Ga0105246_10897680 | 3300011119 | Bacteria | 794 |
| 180 | Ga0157341_1047504 | 3300012494 | Bacteria | 515 |
| 181 | Ga0157316_1041297 | 3300012510 | Bacteria | 602 |
| 182 | Ga0157373_10346246 | 3300013100 | Bacteria | 1060 |
| 183 | Ga0157371_10043166 | 3300013102 | Bacteria | 3213 |
| 184 | Ga0157371_10340940 | 3300013102 | Bacteria | 1090 |
| 185 | Ga0157370_10033885 | 3300013104 | Bacteria | 4977 |
| 186 | Ga0157370_10353884 | 3300013104 | Bacteria | 1353 |
| 187 | Ga0157370_10710963 | 3300013104 | Bacteria | 917 |
| 188 | Ga0157370_11317979 | 3300013104 | Bacteria | 650 |
| 189 | Ga0157370_11550645 | 3300013104 | Bacteria | 595 |
| 190 | Ga0157369_10038065 | 3300013105 | Bacteria | 5262 |
| 191 | Ga0157369_10115778 | 3300013105 | Bacteria | 2847 |
| 192 | Ga0157369_10687854 | 3300013105 | Bacteria | 1054 |
| 193 | Ga0157369_10855454 | 3300013105 | Bacteria | 933 |
| 194 | Ga0157374_11004771 | 3300013296 | Bacteria | 853 |
| 195 | Ga0157374_11251300 | 3300013296 | Bacteria | 764 |
| 196 | Ga0157374_12366819 | 3300013296 | Bacteria | 558 |
| 197 | Ga0157378_10244775 | 3300013297 | Bacteria | 1715 |
| 198 | Ga0157378_10273543 | 3300013297 | Bacteria | 1625 |
| 199 | Ga0163162_10155250 | 3300013306 | Bacteria | 2408 |
| 200 | Ga0163162_10641078 | 3300013306 | Bacteria | 1186 |
| 201 | Ga0163162_11776650 | 3300013306 | Bacteria | 705 |
| 202 | Ga0157372_10064075 | 3300013307 | Bacteria | 4123 |
| 203 | Ga0157372_10290744 | 3300013307 | Bacteria | 1900 |
| 204 | Ga0157372_12852140 | 3300013307 | Bacteria | 554 |
| 205 | Ga0157375_10172923 | 3300013308 | Bacteria | 2308 |
| 206 | Ga0163163_10072147 | 3300014325 | Bacteria | 3442 |
| 207 | Ga0163163_11564471 | 3300014325 | Bacteria | 720 |
| 208 | Ga0157380_10499816 | 3300014326 | Bacteria | 1181 |
| 209 | Ga0157380_12037108 | 3300014326 | Bacteria | 636 |
| 210 | Ga0157380_12510298 | 3300014326 | Bacteria | 581 |
| 211 | Ga0157380_12758068 | 3300014326 | Bacteria | 558 |
| 212 | Ga0157380_12766867 | 3300014326 | Bacteria | 557 |
| 213 | Ga0182008_10119741 | 3300014497 | Bacteria | 1308 |
| 214 | Ga0182008_10149116 | 3300014497 | Bacteria | 1173 |
| 215 | Ga0157377_10331116 | 3300014745 | Bacteria | 1015 |
| 216 | Ga0157377_10826117 | 3300014745 | Bacteria | 686 |
| 217 | Ga0157379_10010518 | 3300014968 | Bacteria | 8065 |
| 218 | Ga0182006_1031634 | 3300015261 | Bacteria | 2130 |
| 219 | Ga0182006_1126984 | 3300015261 | Bacteria | 881 |
| 220 | Ga0182005_1002173 | 3300015265 | Bacteria | 7236 |
| 221 | Ga0182005_1041026 | 3300015265 | Bacteria | 1258 |
| 222 | Ga0163161_10407732 | 3300017792 | Bacteria | 1091 |
| 223 | Ga0163161_11253125 | 3300017792 | Bacteria | 643 |
| 224 | Ga0213873_10008313 | 3300021358 | Bacteria | 2115 |
| 225 | Ga0213873_10011514 | 3300021358 | Bacteria | 1895 |
| 226 | Ga0213874_10003891 | 3300021377 | Bacteria | 3358 |
| 227 | Ga0213874_10018746 | 3300021377 | Bacteria | 1874 |
| 228 | Ga0213876_10003189 | 3300021384 | Bacteria | 9433 |
| 229 | Ga0213876_10235011 | 3300021384 | Bacteria | 974 |
| 230 | Ga0213875_10080749 | 3300021388 | Bacteria | 1517 |
| 231 | Ga0213871_10098758 | 3300021441 | Bacteria | 852 |
| 232 | Ga0213871_10286220 | 3300021441 | Bacteria | 530 |
| 233 | Ga0224712_10023834 | 3300022467 | Bacteria | 2130 |
| 234 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 235 | Ga0209677_100816 | 3300025253 | Bacteria | 15575 |
| 236 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 237 | Ga0209759_1000119 | 3300025256 | Bacteria | 141051 |
| 238 | Ga0209233_1000188 | 3300025261 | Bacteria | 132904 |
| 239 | Ga0209233_1029680 | 3300025261 | Bacteria | 1297 |
| 240 | Ga0209455_1000204 | 3300025272 | Bacteria | 85420 |
| 241 | Ga0209455_1005018 | 3300025272 | Bacteria | 4193 |
| 242 | Ga0209025_1041276 | 3300025294 | Bacteria | 1979 |
| 243 | Ga0209025_1098796 | 3300025294 | Bacteria | 931 |
| 244 | Ga0209025_1112992 | 3300025294 | Bacteria | 829 |
| 245 | Ga0209758_1006057 | 3300025297 | Bacteria | 8913 |
| 246 | Ga0207697_10030257 | 3300025315 | Bacteria | 2216 |
| 247 | Ga0207656_10000708 | 3300025321 | Bacteria | 10913 |
| 248 | Ga0207656_10029364 | 3300025321 | Bacteria | 2264 |
| 249 | Ga0207682_10058611 | 3300025893 | Bacteria | 1607 |
| 250 | Ga0207692_10144556 | 3300025898 | Bacteria | 1356 |
| 251 | Ga0207710_10686447 | 3300025900 | Bacteria | 537 |
| 252 | Ga0207688_10024957 | 3300025901 | Bacteria | 3280 |
| 253 | Ga0207688_10118156 | 3300025901 | Bacteria | 1545 |
| 254 | Ga0207647_10069351 | 3300025904 | Bacteria | 2131 |
| 255 | Ga0207647_10170361 | 3300025904 | Bacteria | 1268 |
| 256 | Ga0207699_10183916 | 3300025906 | Bacteria | 1406 |
| 257 | Ga0207699_10645453 | 3300025906 | Bacteria | 773 |
| 258 | Ga0207645_10006221 | 3300025907 | Bacteria | 8578 |
| 259 | Ga0207705_10011637 | 3300025909 | Bacteria | 6358 |
| 260 | Ga0207705_10187695 | 3300025909 | Bacteria | 1562 |
| 261 | Ga0207654_10043479 | 3300025911 | Bacteria | 2547 |
| 262 | Ga0207654_10462413 | 3300025911 | Bacteria | 891 |
| 263 | Ga0207654_11100659 | 3300025911 | Bacteria | 579 |
| 264 | Ga0207707_10357488 | 3300025912 | Bacteria | 1258 |
| 265 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 266 | Ga0207695_10002347 | 3300025913 | Bacteria | 28115 |
| 267 | Ga0207695_10109547 | 3300025913 | Bacteria | 2743 |
| 268 | Ga0207695_10253213 | 3300025913 | Bacteria | 1660 |
| 269 | Ga0207671_10110334 | 3300025914 | Bacteria | 2093 |
| 270 | Ga0207671_10237967 | 3300025914 | Bacteria | 1430 |
| 271 | Ga0207693_10026373 | 3300025915 | Bacteria | 4599 |
| 272 | Ga0207693_10252031 | 3300025915 | Bacteria | 1385 |
| 273 | Ga0207663_10089559 | 3300025916 | Bacteria | 2038 |
| 274 | Ga0207662_10463199 | 3300025918 | Bacteria | 868 |
| 275 | Ga0207657_10011937 | 3300025919 | Bacteria | 8597 |
| 276 | Ga0207657_10678540 | 3300025919 | Bacteria | 801 |
| 277 | Ga0207649_10003305 | 3300025920 | Bacteria | 8827 |
| 278 | Ga0207649_10467790 | 3300025920 | Bacteria | 954 |
| 279 | Ga0207649_10529592 | 3300025920 | Bacteria | 899 |
| 280 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 281 | Ga0207694_10022428 | 3300025924 | Bacteria | 4789 |
| 282 | Ga0207694_10033132 | 3300025924 | Bacteria | 3957 |
| 283 | Ga0207694_10085496 | 3300025924 | Bacteria | 2483 |
| 284 | Ga0207694_10462287 | 3300025924 | Bacteria | 1060 |
| 285 | Ga0207650_10457164 | 3300025925 | Bacteria | 1063 |
| 286 | Ga0207659_10616521 | 3300025926 | Bacteria | 926 |
| 287 | Ga0207687_10079261 | 3300025927 | Bacteria | 2368 |
| 288 | Ga0207687_10494140 | 3300025927 | Bacteria | 1020 |
| 289 | Ga0207700_10055325 | 3300025928 | Bacteria | 2982 |
| 290 | Ga0207700_11239767 | 3300025928 | Bacteria | 665 |
| 291 | Ga0207664_10260683 | 3300025929 | Bacteria | 1516 |
| 292 | Ga0207690_10137165 | 3300025932 | Bacteria | 1797 |
| 293 | Ga0207690_10370310 | 3300025932 | Bacteria | 1136 |
| 294 | Ga0207690_10517750 | 3300025932 | Bacteria | 966 |
| 295 | Ga0207690_11392386 | 3300025932 | Bacteria | 586 |
| 296 | Ga0207706_10017336 | 3300025933 | Bacteria | 6487 |
| 297 | Ga0207686_10098572 | 3300025934 | Bacteria | 1946 |
| 298 | Ga0207709_10697778 | 3300025935 | Bacteria | 812 |
| 299 | Ga0207709_10903135 | 3300025935 | Bacteria | 718 |
| 300 | Ga0207670_11834158 | 3300025936 | Bacteria | 516 |
| 301 | Ga0207669_10237964 | 3300025937 | Bacteria | 1348 |
| 302 | Ga0207669_10483614 | 3300025937 | Bacteria | 987 |
| 303 | Ga0207665_10159438 | 3300025939 | Bacteria | 1622 |
| 304 | Ga0207691_10168157 | 3300025940 | Bacteria | 1921 |
| 305 | Ga0207691_11119673 | 3300025940 | Bacteria | 654 |
| 306 | Ga0207711_10476855 | 3300025941 | Bacteria | 1162 |
| 307 | Ga0207711_11132271 | 3300025941 | Bacteria | 724 |
| 308 | Ga0207689_10358749 | 3300025942 | Bacteria | 1212 |
| 309 | Ga0207689_10379367 | 3300025942 | Bacteria | 1177 |
| 310 | Ga0207689_10435269 | 3300025942 | Bacteria | 1095 |
| 311 | Ga0207661_10550432 | 3300025944 | Bacteria | 1057 |
| 312 | Ga0207679_10707568 | 3300025945 | Bacteria | 914 |
| 313 | Ga0207667_10000388 | 3300025949 | Bacteria | 59263 |
| 314 | Ga0207667_10000877 | 3300025949 | Bacteria | 38435 |
| 315 | Ga0207667_10119839 | 3300025949 | Bacteria | 2712 |
| 316 | Ga0207667_10267115 | 3300025949 | Bacteria | 1749 |
| 317 | Ga0207712_10770224 | 3300025961 | Bacteria | 844 |
| 318 | Ga0207668_10180850 | 3300025972 | Bacteria | 1663 |
| 319 | Ga0207668_11783125 | 3300025972 | Bacteria | 555 |
| 320 | Ga0207640_10158340 | 3300025981 | Bacteria | 1672 |
| 321 | Ga0207640_10268641 | 3300025981 | Bacteria | 1333 |
| 322 | Ga0207640_11418914 | 3300025981 | Bacteria | 622 |
| 323 | Ga0207677_10234626 | 3300026023 | Bacteria | 1480 |
| 324 | Ga0207677_11678840 | 3300026023 | Bacteria | 589 |
| 325 | Ga0207703_10200256 | 3300026035 | Bacteria | 1774 |
| 326 | Ga0207639_10002448 | 3300026041 | Bacteria | 12454 |
| 327 | Ga0207639_10029726 | 3300026041 | Bacteria | 4004 |
| 328 | Ga0207639_10249047 | 3300026041 | Bacteria | 1548 |
| 329 | Ga0207639_10386268 | 3300026041 | Bacteria | 1258 |
| 330 | Ga0207639_10388172 | 3300026041 | Bacteria | 1255 |
| 331 | Ga0207639_11788024 | 3300026041 | Bacteria | 575 |
| 332 | Ga0207678_10048388 | 3300026067 | Bacteria | 3675 |
| 333 | Ga0207678_10049649 | 3300026067 | Bacteria | 3626 |
| 334 | Ga0207678_10076186 | 3300026067 | Bacteria | 2873 |
| 335 | Ga0207678_10612480 | 3300026067 | Bacteria | 955 |
| 336 | Ga0207678_11311165 | 3300026067 | Bacteria | 640 |
| 337 | Ga0207702_10014521 | 3300026078 | Bacteria | 6538 |
| 338 | Ga0207702_10153650 | 3300026078 | Bacteria | 2096 |
| 339 | Ga0207702_10473640 | 3300026078 | Bacteria | 1218 |
| 340 | Ga0207702_11107845 | 3300026078 | Bacteria | 786 |
| 341 | Ga0207702_11748803 | 3300026078 | Bacteria | 614 |
| 342 | Ga0207648_10011030 | 3300026089 | Bacteria | 8530 |
| 343 | Ga0207648_10095334 | 3300026089 | Bacteria | 2603 |
| 344 | Ga0207676_10802442 | 3300026095 | Bacteria | 918 |
| 345 | Ga0207674_10128180 | 3300026116 | Bacteria | 2502 |
| 346 | Ga0207674_10190354 | 3300026116 | Bacteria | 2001 |
| 347 | Ga0207674_10386131 | 3300026116 | Bacteria | 1354 |
| 348 | Ga0207674_10919994 | 3300026116 | Bacteria | 843 |
| 349 | Ga0207675_100040050 | 3300026118 | Bacteria | 4372 |
| 350 | Ga0207675_100090967 | 3300026118 | Bacteria | 2869 |
| 351 | Ga0207683_10016263 | 3300026121 | Bacteria | 6330 |
| 352 | Ga0207683_11118690 | 3300026121 | Bacteria | 731 |
| 353 | Ga0207698_10046854 | 3300026142 | Bacteria | 3269 |
| 354 | Ga0207698_10089559 | 3300026142 | Bacteria | 2513 |
| 355 | Ga0207698_10126898 | 3300026142 | Bacteria | 2172 |
| 356 | Ga0207698_10252997 | 3300026142 | Bacteria | 1613 |
| 357 | Ga0207698_10380105 | 3300026142 | Bacteria | 1343 |
| 358 | Ga0207698_12096819 | 3300026142 | Bacteria | 579 |
| 359 | Ga0209966_1038516 | 3300027695 | Bacteria | 990 |
| 360 | Ga0209813_10017271 | 3300027866 | Bacteria | 1979 |
| 361 | Ga0209813_10102879 | 3300027866 | Bacteria | 974 |
| 362 | Ga0268266_10020829 | 3300028379 | Bacteria | 5592 |
| 363 | Ga0268266_10036033 | 3300028379 | Bacteria | 4209 |
| 364 | Ga0268265_10401497 | 3300028380 | Bacteria | 1267 |
| 365 | Ga0265337_1002429 | 3300028556 | Bacteria | 8569 |
| 366 | Ga0265337_1008843 | 3300028556 | Bacteria | 3630 |
| 367 | Ga0265326_10001795 | 3300028558 | Bacteria | 7402 |
| 368 | Ga0265319_1001825 | 3300028563 | Bacteria | 12143 |
| 369 | Ga0265319_1040122 | 3300028563 | Bacteria | 1584 |
| 370 | Ga0265334_10000469 | 3300028573 | Bacteria | 20809 |
| 371 | Ga0265334_10052725 | 3300028573 | Bacteria | 1556 |
| 372 | Ga0265318_10000037 | 3300028577 | Bacteria | 138223 |
| 373 | Ga0265318_10008934 | 3300028577 | Bacteria | 4437 |
| 374 | Ga0265318_10041779 | 3300028577 | Bacteria | 1741 |
| 375 | Ga0265323_10001237 | 3300028653 | Bacteria | 12839 |
| 376 | Ga0265322_10051676 | 3300028654 | Bacteria | 1166 |
| 377 | Ga0265336_10000535 | 3300028666 | Bacteria | 21804 |
| 378 | Ga0307517_10185220 | 3300028786 | Bacteria | 1334 |
| 379 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 380 | Ga0265338_10340294 | 3300028800 | Bacteria | 1081 |
| 381 | Ga0265324_10001269 | 3300029957 | Bacteria | 14862 |
| 382 | Ga0265330_10125296 | 3300031235 | Bacteria | 1094 |
| 383 | Ga0265332_10115038 | 3300031238 | Bacteria | 1132 |
| 384 | Ga0265332_10176541 | 3300031238 | Bacteria | 891 |
| 385 | Ga0265328_10038497 | 3300031239 | Bacteria | 1765 |
| 386 | Ga0265328_10348579 | 3300031239 | Bacteria | 576 |
| 387 | Ga0265320_10006806 | 3300031240 | Bacteria | 7169 |
| 388 | Ga0265325_10048954 | 3300031241 | Bacteria | 2183 |
| 389 | Ga0265325_10142648 | 3300031241 | Bacteria | 1138 |
| 390 | Ga0265325_10160262 | 3300031241 | Bacteria | 1059 |
| 391 | Ga0265325_10436815 | 3300031241 | Bacteria | 571 |
| 392 | Ga0265329_10054789 | 3300031242 | Bacteria | 1266 |
| 393 | Ga0265329_10129057 | 3300031242 | Bacteria | 813 |
| 394 | Ga0265340_10065829 | 3300031247 | Bacteria | 1725 |
| 395 | Ga0265339_10012498 | 3300031249 | Bacteria | 5181 |
| 396 | Ga0265339_10038285 | 3300031249 | Bacteria | 2676 |
| 397 | Ga0265339_10045403 | 3300031249 | Bacteria | 2418 |
| 398 | Ga0265339_10074118 | 3300031249 | Bacteria | 1809 |
| 399 | Ga0265339_10255981 | 3300031249 | Bacteria | 846 |
| 400 | Ga0265331_10005639 | 3300031250 | Bacteria | 7527 |
| 401 | Ga0265331_10016180 | 3300031250 | Bacteria | 3921 |
| 402 | Ga0265331_10084260 | 3300031250 | Bacteria | 1474 |
| 403 | Ga0265331_10193919 | 3300031250 | Bacteria | 916 |
| 404 | Ga0265316_10015933 | 3300031344 | Bacteria | 6544 |
| 405 | Ga0265316_10076581 | 3300031344 | Bacteria | 2570 |
| 406 | Ga0265316_10498534 | 3300031344 | Bacteria | 870 |
| 407 | Ga0307513_10028569 | 3300031456 | Bacteria | 6373 |
| 408 | Ga0307513_10178755 | 3300031456 | Bacteria | 1988 |
| 409 | Ga0307513_10212495 | 3300031456 | Bacteria | 1764 |
| 410 | Ga0307513_10455881 | 3300031456 | Bacteria | 1002 |
| 411 | Ga0307408_100357006 | 3300031548 | Bacteria | 1242 |
| 412 | Ga0307408_100447469 | 3300031548 | Bacteria | 1120 |
| 413 | Ga0307408_101689637 | 3300031548 | Bacteria | 603 |
| 414 | Ga0265313_10003614 | 3300031595 | Bacteria | 12415 |
| 415 | Ga0265313_10022840 | 3300031595 | Bacteria | 3384 |
| 416 | Ga0265313_10031690 | 3300031595 | Bacteria | 2707 |
| 417 | Ga0265313_10031974 | 3300031595 | Bacteria | 2693 |
| 418 | Ga0265313_10052060 | 3300031595 | Bacteria | 1956 |
| 419 | Ga0265314_10008857 | 3300031711 | Bacteria | 8590 |
| 420 | Ga0265314_10028270 | 3300031711 | Bacteria | 4183 |
| 421 | Ga0265314_10084434 | 3300031711 | Bacteria | 2084 |
| 422 | Ga0265314_10615528 | 3300031711 | Bacteria | 558 |
| 423 | Ga0265342_10004137 | 3300031712 | Bacteria | 11550 |
| 424 | Ga0265342_10101676 | 3300031712 | Bacteria | 1636 |
| 425 | Ga0265342_10107995 | 3300031712 | Bacteria | 1578 |
| 426 | Ga0307516_10057860 | 3300031730 | Bacteria | 3775 |
| 427 | Ga0307405_10167684 | 3300031731 | Bacteria | 1563 |
| 428 | Ga0307405_10767112 | 3300031731 | Bacteria | 805 |
| 429 | Ga0307413_10738202 | 3300031824 | Bacteria | 822 |
| 430 | Ga0307410_10088224 | 3300031852 | Bacteria | 2196 |
| 431 | Ga0307410_10952505 | 3300031852 | Bacteria | 738 |
| 432 | Ga0307406_10443616 | 3300031901 | Bacteria | 1039 |
| 433 | Ga0307406_11160143 | 3300031901 | Bacteria | 669 |
| 434 | Ga0307407_10352119 | 3300031903 | Bacteria | 1043 |
| 435 | Ga0307407_11031382 | 3300031903 | Bacteria | 637 |
| 436 | Ga0307412_10030283 | 3300031911 | Bacteria | 3406 |
| 437 | Ga0307412_10033696 | 3300031911 | Bacteria | 3258 |
| 438 | Ga0307412_10778838 | 3300031911 | Bacteria | 828 |
| 439 | Ga0307409_100317323 | 3300031995 | Bacteria | 1457 |
| 440 | Ga0307409_100707130 | 3300031995 | Bacteria | 1007 |
| 441 | Ga0307409_100845007 | 3300031995 | Bacteria | 926 |
| 442 | Ga0307409_101618333 | 3300031995 | Bacteria | 676 |
| 443 | Ga0307416_100537909 | 3300032002 | Bacteria | 1240 |
| 444 | Ga0307416_101472812 | 3300032002 | Bacteria | 786 |
| 445 | Ga0307414_10155793 | 3300032004 | Bacteria | 1808 |
| 446 | Ga0307411_10460006 | 3300032005 | Bacteria | 1066 |
| 447 | Ga0307415_100114769 | 3300032126 | Bacteria | 2006 |
| 448 | Ga0307415_100371306 | 3300032126 | Bacteria | 1211 |
| 449 | Ga0307415_100435537 | 3300032126 | Bacteria | 1129 |
| 450 | Ga0307415_100611652 | 3300032126 | Bacteria | 971 |
| 451 | Ga0307510_10235297 | 3300033180 | Bacteria | 1331 |
| 452 | Ga0307510_10275184 | 3300033180 | Bacteria | 1157 |
| 453 | Ga0373940_0141410 | 3300035088 | Bacteria | 761 |
| 454 | Ga0373944_0029385 | 3300035089 | Bacteria | 1643 |
| 455 | Ga0373936_0113921 | 3300035113 | Bacteria | 1150 |
| 456 | Ga0373954_0041438 | 3300035118 | Bacteria | 2147 |
| 457 | Ga0373957_0119033 | 3300035120 | Bacteria | 1068 |
| 458 | Ga0373960_0240473 | 3300035121 | Bacteria | 654 |
| 459 | Ga0373946_0052650 | 3300035171 | Bacteria | 1708 |
| 460 | Ga0373946_0303804 | 3300035171 | Bacteria | 789 |
| 461 | Ga0373955_0303048 | 3300035172 | Bacteria | 963 |
| 462 | Ga0373955_0555436 | 3300035172 | Bacteria | 702 |
| 463 | Ga0373962_0085141 | 3300035242 | Bacteria | 966 |
| 464 | Ga0373924_0055558 | 3300035410 | Bacteria | 1648 |
| 465 | Ga0373935_0318189 | 3300035692 | Bacteria | 1103 |
| 466 | Ga0373927_0093236 | 3300035695 | Bacteria | 1956 |
| 467 | Ga0373933_0217946 | 3300035724 | Bacteria | 1224 |
| 468 | Ga0373933_0262839 | 3300035724 | Bacteria | 1113 |
| 469 | Ga0373947_1076269 | 3300035725 | Bacteria | 548 |
| 470 | Ga0373937_0025062 | 3300036401 | Bacteria | 5384 |
| 471 | Ga0373937_0229703 | 3300036401 | Bacteria | 1747 |
| 472 | Ga0373937_1299498 | 3300036401 | Bacteria | 675 |
| 473 | Ga0373925_0686270 | 3300037068 | Bacteria | 844 |
| 474 | Ga0373925_0873216 | 3300037068 | Bacteria | 741 |
| 475 | Ga0373925_1050951 | 3300037068 | Bacteria | 670 |
| 476 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 477 | Ga0395899_0019478 | 3300037312 | Bacteria | 5153 |
| 478 | Ga0395899_0075725 | 3300037312 | Bacteria | 2457 |
| 479 | Ga0395899_0440335 | 3300037312 | Bacteria | 855 |
| 480 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 481 | Ga0395900_0012290 | 3300037418 | Bacteria | 8757 |
| 482 | Ga0395900_0147149 | 3300037418 | Bacteria | 2408 |
| 483 | Ga0395900_0609526 | 3300037418 | Bacteria | 1031 |
| 484 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 485 | Ga0395898_0029950 | 3300037466 | Bacteria | 5449 |
| 486 | Ga0395898_0131941 | 3300037466 | Bacteria | 2392 |
| 487 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 488 | Ga0395905_0446168 | 3300037471 | Bacteria | 1191 |
| 489 | Ga0395905_1274895 | 3300037471 | Bacteria | 638 |
| 490 | Ga0436364_0076013 | 3300037853 | Bacteria | 637 |
| 491 | Ga0436364_0530881 | 3300037853 | Bacteria | 2434 |
| 492 | Ga0436364_0697961 | 3300037853 | Bacteria | 1498 |
| 493 | Ga0436364_0765756 | 3300037853 | Bacteria | 1335 |
| 494 | Ga0436364_1305283 | 3300037853 | Bacteria | 2225 |
| 495 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 496 | Ga0395901_0036689 | 3300038443 | Bacteria | 5066 |
| 497 | Ga0395901_0052439 | 3300038443 | Bacteria | 4239 |
| 498 | Ga0400485_17392 | 3300038735 | Bacteria | 1093 |
| 499 | Ga0400486_08264 | 3300038742 | Bacteria | 1833 |
| 500 | Ga0436365_0167537 | 3300039437 | Bacteria | 1043 |
| 501 | Ga0436365_0544722 | 3300039437 | Bacteria | 16758 |
| 502 | Ga0436365_0973027 | 3300039437 | Bacteria | 1422 |
| 503 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 504 | Ga0436360_0323768 | 3300039438 | Bacteria | 591 |
| 505 | Ga0436360_0429536 | 3300039438 | Bacteria | 3039 |
| 506 | Ga0436360_0564682 | 3300039438 | Bacteria | 5174 |
| 507 | Ga0436360_1144658 | 3300039438 | Bacteria | 1406 |
| 508 | Ga0436360_1325924 | 3300039438 | Bacteria | 1284 |
| 509 | Ga0436361_0237988 | 3300039447 | Bacteria | 620 |
| 510 | Ga0436363_0701091 | 3300039450 | Bacteria | 1472 |
| 511 | Ga0436363_0880899 | 3300039450 | Bacteria | 6318 |
| 512 | Ga0436363_0939204 | 3300039450 | Bacteria | 612 |
| 513 | Ga0436363_1046285 | 3300039450 | Bacteria | 10399 |
| 514 | Ga0436363_1077755 | 3300039450 | Bacteria | 662 |
| 515 | Ga0436363_1630341 | 3300039450 | Bacteria | 952 |
| 516 | Ga0436362_0687315 | 3300039453 | Bacteria | 575 |
| 517 | Ga0436362_0733157 | 3300039453 | Bacteria | 4042 |
| 518 | Ga0436362_1210898 | 3300039453 | Bacteria | 946 |
| 519 | Ga0439438_017474 | 3300041405 | Bacteria | 2064 |
| 520 | Ga0439453_0008967 | 3300041408 | Bacteria | 1620 |
| 521 | Ga0439466_0110953 | 3300041411 | Bacteria | 851 |
| 522 | Ga0439465_0032376 | 3300041413 | Bacteria | 1669 |
| 523 | Ga0439465_0119634 | 3300041413 | Bacteria | 922 |
| 524 | Ga0451789_1069382 | 3300041443 | Bacteria | 911 |
| 525 | Ga0451797_0510059 | 3300041453 | Bacteria | 758 |
| 526 | Ga0451802_1649373 | 3300041460 | Bacteria | 940 |
| 527 | Ga0451837_1213495 | 3300041494 | Bacteria | 656 |
| 528 | Ga0451837_1454596 | 3300041494 | Bacteria | 1588 |
| 529 | Ga0451849_1216811 | 3300041505 | Bacteria | 599 |
| 530 | Ga0451853_2656839 | 3300041512 | Bacteria | 531 |
| 531 | Ga0439441_077923 | 3300042001 | Bacteria | 718 |
| 532 | Ga0439442_099155 | 3300042002 | Bacteria | 630 |
| 533 | Ga0439445_0067786 | 3300042004 | Bacteria | 984 |
| 534 | Ga0439455_0018856 | 3300042012 | Bacteria | 1622 |
| 535 | Ga0439458_0020812 | 3300042157 | Bacteria | 1516 |
| 536 | Ga0439435_0004725 | 3300042436 | Bacteria | 2953 |
| 537 | Ga0466969_0085473 | 3300044656 | Bacteria | 1500 |
| 538 | Ga0466972_0010313 | 3300044658 | Bacteria | 4691 |
| 539 | Ga0466961_0068632 | 3300044693 | Bacteria | 2251 |
| 540 | Ga0466963_0292782 | 3300044694 | Bacteria | 1145 |
| 541 | Ga0466963_0895951 | 3300044694 | Bacteria | 625 |
| 542 | Ga0466964_0380189 | 3300044706 | Bacteria | 733 |
| 543 | Ga0466971_0254118 | 3300044719 | Bacteria | 838 |
| 544 | Ga0466971_0426149 | 3300044719 | Bacteria | 649 |
| 545 | Ga0466957_1155472 | 3300044842 | Bacteria | 559 |
| 546 | Ga0466960_0029748 | 3300044901 | Bacteria | 2509 |
| 547 | Ga0466960_0770748 | 3300044901 | Bacteria | 581 |
| 548 | Ga0466959_0011129 | 3300045049 | Bacteria | 6456 |
| 549 | Ga0466959_0590257 | 3300045049 | Bacteria | 748 |
| 550 | Ga0466958_0180617 | 3300045836 | Bacteria | 1339 |
| 551 | Ga0466967_0549579 | 3300045976 | Bacteria | 1137 |
| 552 | Ga0466967_0613874 | 3300045976 | Bacteria | 1074 |
| 553 | Ga0466967_1157763 | 3300045976 | Bacteria | 771 |
| 554 | Ga0495592_0098665 | 3300046454 | Bacteria | 2085 |
| 555 | Ga0495592_0439032 | 3300046454 | Bacteria | 820 |
| 556 | Ga0495603_0432529 | 3300046455 | Bacteria | 754 |
| 557 | Ga0495590_0047095 | 3300046457 | Bacteria | 1504 |
| 558 | Ga0495629_0131013 | 3300046459 | Bacteria | 1747 |
| 559 | Ga0495629_0304789 | 3300046459 | Bacteria | 1090 |
| 560 | Ga0495638_0040593 | 3300046460 | Bacteria | 2948 |
| 561 | Ga0495638_0276814 | 3300046460 | Bacteria | 913 |
| 562 | Ga0495651_0323475 | 3300046462 | Bacteria | 1027 |
| 563 | Ga0495650_0127613 | 3300046471 | Bacteria | 931 |
| 564 | Ga0495580_0059866 | 3300046472 | Bacteria | 2676 |
| 565 | Ga0495582_0319921 | 3300046473 | Bacteria | 893 |
| 566 | Ga0495639_0242902 | 3300046475 | Bacteria | 889 |
| 567 | Ga0495664_0051700 | 3300046477 | Bacteria | 2440 |
| 568 | Ga0495664_0454931 | 3300046477 | Bacteria | 766 |
| 569 | Ga0495596_0060347 | 3300046500 | Bacteria | 1478 |
| 570 | Ga0495596_0130125 | 3300046500 | Bacteria | 977 |
| 571 | Ga0495607_0477595 | 3300046501 | Bacteria | 556 |
| 572 | Ga0495607_0524058 | 3300046501 | Bacteria | 523 |
| 573 | Ga0495583_0049116 | 3300046506 | Bacteria | 1934 |
| 574 | Ga0495583_0143975 | 3300046506 | Bacteria | 991 |
| 575 | Ga0495610_0327868 | 3300046512 | Bacteria | 582 |
| 576 | Ga0495616_0047418 | 3300046513 | Bacteria | 2164 |
| 577 | Ga0495618_0307148 | 3300046514 | Bacteria | 985 |
| 578 | Ga0495620_0008766 | 3300046515 | Bacteria | 5412 |
| 579 | Ga0495628_0398834 | 3300046516 | Bacteria | 1005 |
| 580 | Ga0495637_0027395 | 3300046520 | Bacteria | 2550 |
| 581 | Ga0495643_0011617 | 3300046522 | Bacteria | 5353 |
| 582 | Ga0495652_0270727 | 3300046529 | Bacteria | 1249 |
| 583 | Ga0495587_0405187 | 3300046536 | Bacteria | 758 |
| 584 | Ga0495598_0165155 | 3300046537 | Bacteria | 781 |
| 585 | Ga0495597_0076584 | 3300046542 | Bacteria | 1434 |
| 586 | Ga0495645_0165319 | 3300046543 | Bacteria | 1527 |
| 587 | Ga0495622_0354651 | 3300046557 | Bacteria | 635 |
| 588 | Ga0495668_0252348 | 3300046616 | Bacteria | 966 |
| 589 | Ga0495611_0261712 | 3300046648 | Bacteria | 801 |
| 590 | Ga0495625_0220780 | 3300046660 | Bacteria | 1242 |
| 591 | Ga0495625_0292882 | 3300046660 | Bacteria | 1044 |
| 592 | Ga0495657_0068294 | 3300046675 | Bacteria | 2330 |
| 593 | Ga0495599_0319617 | 3300046678 | Bacteria | 935 |
| 594 | Ga0495658_0111501 | 3300046683 | Bacteria | 1645 |
| 595 | Ga0495658_0276678 | 3300046683 | Bacteria | 1059 |
| 596 | Ga0495669_0294413 | 3300046684 | Bacteria | 782 |
| 597 | Ga0495670_0102193 | 3300046691 | Bacteria | 1477 |
| 598 | Ga0495660_0007203 | 3300046810 | Bacteria | 6548 |
| 599 | Ga0495581_0065369 | 3300047315 | Bacteria | 2103 |
| 600 | Ga0495604_0233671 | 3300047317 | Bacteria | 1260 |
| 601 | Ga0495604_0604734 | 3300047317 | Bacteria | 703 |
| 602 | Ga0495672_0073202 | 3300047320 | Bacteria | 1933 |
| 603 | Ga0495672_0113829 | 3300047320 | Bacteria | 1448 |
| 604 | Ga0495672_0117241 | 3300047320 | Bacteria | 1421 |
| 605 | Ga0495680_0065932 | 3300047322 | Bacteria | 2772 |
| 606 | Ga0495687_013562 | 3300047443 | Bacteria | 4244 |
| 607 | Ga0495679_059554 | 3300047446 | Bacteria | 1123 |
| 608 | Ga0495673_0187945 | 3300047469 | Bacteria | 779 |
| 609 | Ga0495686_0013227 | 3300047472 | Bacteria | 5734 |
| 610 | Ga0495686_0184288 | 3300047472 | Bacteria | 1207 |
| 611 | Ga0495602_0752933 | 3300048088 | Bacteria | 657 |
| 612 | Ga0495615_0042760 | 3300048090 | Bacteria | 1137 |
| 613 | Ga0495626_0073504 | 3300048091 | Bacteria | 1531 |
| 614 | Ga0496100_0594067 | 3300048903 | Bacteria | 859 |
| 615 | Ga0496101_0639867 | 3300048904 | Bacteria | 840 |
| 616 | Ga0496101_0659266 | 3300048904 | Bacteria | 827 |
| 617 | Ga0496102_0426059 | 3300048905 | Bacteria | 1246 |
| 618 | Ga0496104_0250153 | 3300048907 | Bacteria | 1685 |
| 619 | Ga0496105_0915100 | 3300048908 | Bacteria | 660 |
| 620 | Ga0496106_0680519 | 3300048909 | Bacteria | 821 |
| 621 | Ga0496106_0810384 | 3300048909 | Bacteria | 742 |
| 622 | Ga0496106_1487973 | 3300048909 | Bacteria | 521 |
| 623 | Ga0496108_1093656 | 3300048911 | Bacteria | 678 |
| 624 | Ga0496109_0361483 | 3300048912 | Bacteria | 1371 |
| 625 | Ga0496109_0492074 | 3300048912 | Bacteria | 1158 |
| 626 | Ga0496110_0764248 | 3300048913 | Bacteria | 870 |
| 627 | Ga0496111_0318265 | 3300048914 | Bacteria | 1152 |
| 628 | Ga0496111_0748896 | 3300048914 | Bacteria | 709 |
| 629 | Ga0496112_0063587 | 3300048915 | Bacteria | 3640 |
| 630 | Ga0496113_0260126 | 3300048916 | Bacteria | 1386 |
| 631 | Ga0496113_0630790 | 3300048916 | Bacteria | 857 |
| 632 | Ga0496115_0181345 | 3300048918 | Bacteria | 1740 |
| 633 | Ga0496117_0123621 | 3300048920 | Bacteria | 1584 |
| 634 | Ga0496118_0038146 | 3300048921 | Bacteria | 3855 |
| 635 | Ga0496118_0070157 | 3300048921 | Bacteria | 2532 |
| 636 | Ga0496118_0142522 | 3300048921 | Bacteria | 1516 |
| 637 | Ga0496118_0234990 | 3300048921 | Bacteria | 1054 |
| 638 | Ga0496119_0000372 | 3300048922 | Bacteria | 62094 |
| 639 | Ga0496119_0064924 | 3300048922 | Bacteria | 2165 |
| 640 | Ga0496119_0081757 | 3300048922 | Bacteria | 1859 |
| 641 | Ga0496119_0122432 | 3300048922 | Bacteria | 1428 |
| 642 | Ga0496119_0181727 | 3300048922 | Bacteria | 1102 |
| 643 | Ga0496119_0204607 | 3300048922 | Bacteria | 1019 |
| 644 | Ga0496120_0045101 | 3300048923 | Bacteria | 2556 |
| 645 | Ga0496120_0065139 | 3300048923 | Bacteria | 2020 |
| 646 | Ga0496120_0293618 | 3300048923 | Bacteria | 747 |
| 647 | Ga0496121_0035490 | 3300048924 | Bacteria | 4468 |
| 648 | Ga0496121_0194855 | 3300048924 | Bacteria | 1449 |
| 649 | Ga0496121_0428716 | 3300048924 | Bacteria | 858 |
| 650 | Ga0496122_0006451 | 3300048925 | Bacteria | 13461 |
| 651 | Ga0496122_0255799 | 3300048925 | Bacteria | 976 |
| 652 | Ga0496123_0017126 | 3300048926 | Bacteria | 5847 |
| 653 | Ga0496124_0095308 | 3300048927 | Bacteria | 2419 |
| 654 | Ga0496124_0105288 | 3300048927 | Bacteria | 2279 |
| 655 | Ga0496125_0134455 | 3300048928 | Bacteria | 1733 |
| 656 | Ga0496125_0243721 | 3300048928 | Bacteria | 1139 |
| 657 | Ga0496125_0380311 | 3300048928 | Bacteria | 832 |
| 658 | Ga0496126_0055058 | 3300048929 | Bacteria | 3600 |
| 659 | Ga0496126_0164769 | 3300048929 | Bacteria | 1892 |
| 660 | Ga0496126_0282853 | 3300048929 | Bacteria | 1373 |
| 661 | Ga0496126_0347592 | 3300048929 | Bacteria | 1214 |
| 662 | Ga0501309_013314 | 3300049129 | Bacteria | 1093 |
| 663 | Ga0501305_054534 | 3300049161 | Bacteria | 677 |
| 664 | Ga0495682_0005207 | 3300049460 | Bacteria | 5432 |
| 665 | Ga0501313_010924 | 3300049529 | Bacteria | 1041 |
| 666 | Ga0501313_047583 | 3300049529 | Bacteria | 587 |
| 667 | Ga0501315_049789 | 3300049531 | Bacteria | 656 |
| 668 | Ga0501317_002279 | 3300049533 | Bacteria | 1793 |
| 669 | Ga0501318_001867 | 3300049534 | Bacteria | 1741 |
| 670 | Ga0501320_018996 | 3300049536 | Bacteria | 781 |
| 671 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 672 | Ga0501031_0003843 | 3300049568 | Bacteria | 9657 |
| 673 | Ga0501031_0010832 | 3300049568 | Bacteria | 5936 |
| 674 | Ga0501031_0016670 | 3300049568 | Bacteria | 4771 |
| 675 | Ga0501031_0341948 | 3300049568 | Bacteria | 969 |
| 676 | Ga0501031_0800168 | 3300049568 | Bacteria | 604 |
| 677 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 678 | Ga0501032_0001915 | 3300049569 | Bacteria | 16407 |
| 679 | Ga0501032_0003488 | 3300049569 | Bacteria | 12021 |
| 680 | Ga0501032_0012326 | 3300049569 | Bacteria | 6112 |
| 681 | Ga0501032_0051001 | 3300049569 | Bacteria | 2790 |
| 682 | Ga0501032_0111144 | 3300049569 | Bacteria | 1813 |
| 683 | Ga0501032_0119107 | 3300049569 | Bacteria | 1746 |
| 684 | Ga0501032_0165400 | 3300049569 | Bacteria | 1451 |
| 685 | Ga0501032_0188536 | 3300049569 | Bacteria | 1348 |
| 686 | Ga0501032_0237913 | 3300049569 | Bacteria | 1183 |
| 687 | Ga0501032_0305998 | 3300049569 | Bacteria | 1027 |
| 688 | Ga0501032_0399755 | 3300049569 | Bacteria | 882 |
| 689 | Ga0501032_0612912 | 3300049569 | Bacteria | 692 |
| 690 | Ga0501032_0737764 | 3300049569 | Bacteria | 623 |
| 691 | Ga0501033_0000121 | 3300049570 | Bacteria | 75242 |
| 692 | Ga0501033_0004963 | 3300049570 | Bacteria | 10583 |
| 693 | Ga0501033_0006462 | 3300049570 | Bacteria | 9172 |
| 694 | Ga0501033_0018118 | 3300049570 | Bacteria | 5320 |
| 695 | Ga0501033_0037361 | 3300049570 | Bacteria | 3635 |
| 696 | Ga0501033_0059135 | 3300049570 | Bacteria | 2830 |
| 697 | Ga0501033_0126195 | 3300049570 | Bacteria | 1855 |
| 698 | Ga0501033_0139684 | 3300049570 | Bacteria | 1751 |
| 699 | Ga0501033_0141883 | 3300049570 | Bacteria | 1736 |
| 700 | Ga0501033_0194748 | 3300049570 | Bacteria | 1449 |
| 701 | Ga0501033_0717400 | 3300049570 | Bacteria | 679 |
| 702 | Ga0501034_0000298 | 3300049571 | Bacteria | 88154 |
| 703 | Ga0501034_0009013 | 3300049571 | Bacteria | 10479 |
| 704 | Ga0501034_0014685 | 3300049571 | Bacteria | 8064 |
| 705 | Ga0501034_0014987 | 3300049571 | Bacteria | 7973 |
| 706 | Ga0501034_0026519 | 3300049571 | Bacteria | 5901 |
| 707 | Ga0501034_0035212 | 3300049571 | Bacteria | 5076 |
| 708 | Ga0501034_0050055 | 3300049571 | Bacteria | 4214 |
| 709 | Ga0501034_0064759 | 3300049571 | Bacteria | 3669 |
| 710 | Ga0501034_0071741 | 3300049571 | Bacteria | 3472 |
| 711 | Ga0501034_0078177 | 3300049571 | Bacteria | 3313 |
| 712 | Ga0501034_0093906 | 3300049571 | Bacteria | 2996 |
| 713 | Ga0501034_0172892 | 3300049571 | Bacteria | 2126 |
| 714 | Ga0501034_0185421 | 3300049571 | Bacteria | 2044 |
| 715 | Ga0501034_0271516 | 3300049571 | Bacteria | 1636 |
| 716 | Ga0501034_0337605 | 3300049571 | Bacteria | 1437 |
| 717 | Ga0501034_0381046 | 3300049571 | Bacteria | 1335 |
| 718 | Ga0501034_0594197 | 3300049571 | Bacteria | 1013 |
| 719 | Ga0501034_0679958 | 3300049571 | Bacteria | 929 |
| 720 | Ga0501034_0753945 | 3300049571 | Bacteria | 869 |
| 721 | Ga0501034_0760920 | 3300049571 | Bacteria | 863 |
| 722 | Ga0501036_0000724 | 3300049572 | Bacteria | 24360 |
| 723 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 724 | Ga0501036_0014004 | 3300049572 | Bacteria | 6665 |
| 725 | Ga0501036_0038561 | 3300049572 | Bacteria | 4044 |
| 726 | Ga0501036_0186938 | 3300049572 | Bacteria | 1743 |
| 727 | Ga0501036_0230566 | 3300049572 | Bacteria | 1554 |
| 728 | Ga0501036_0582833 | 3300049572 | Bacteria | 928 |
| 729 | Ga0501036_0838139 | 3300049572 | Bacteria | 756 |
| 730 | Ga0501036_0867987 | 3300049572 | Bacteria | 741 |
| 731 | Ga0501036_1004012 | 3300049572 | Bacteria | 683 |
| 732 | Ga0501036_1103135 | 3300049572 | Bacteria | 648 |
| 733 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 734 | Ga0501037_0000191 | 3300049573 | Bacteria | 56839 |
| 735 | Ga0501037_0000195 | 3300049573 | Bacteria | 55440 |
| 736 | Ga0501037_0003453 | 3300049573 | Bacteria | 11480 |
| 737 | Ga0501037_0014952 | 3300049573 | Bacteria | 5708 |
| 738 | Ga0501037_0067854 | 3300049573 | Bacteria | 2596 |
| 739 | Ga0501037_0108318 | 3300049573 | Bacteria | 2002 |
| 740 | Ga0501037_0158968 | 3300049573 | Bacteria | 1611 |
| 741 | Ga0501037_0171288 | 3300049573 | Bacteria | 1543 |
| 742 | Ga0501037_0208097 | 3300049573 | Bacteria | 1380 |
| 743 | Ga0501037_0346999 | 3300049573 | Bacteria | 1024 |
| 744 | Ga0501037_0382566 | 3300049573 | Bacteria | 967 |
| 745 | Ga0501037_0519909 | 3300049573 | Bacteria | 806 |
| 746 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 747 | Ga0501038_0001299 | 3300049574 | Bacteria | 22755 |
| 748 | Ga0501038_0001882 | 3300049574 | Bacteria | 19398 |
| 749 | Ga0501038_0005274 | 3300049574 | Bacteria | 12021 |
| 750 | Ga0501038_0029459 | 3300049574 | Bacteria | 4863 |
| 751 | Ga0501038_0039812 | 3300049574 | Bacteria | 4110 |
| 752 | Ga0501038_0131427 | 3300049574 | Bacteria | 2055 |
| 753 | Ga0501038_0132340 | 3300049574 | Bacteria | 2046 |
| 754 | Ga0501038_0132662 | 3300049574 | Bacteria | 2043 |
| 755 | Ga0501038_0169820 | 3300049574 | Bacteria | 1766 |
| 756 | Ga0501038_0216147 | 3300049574 | Bacteria | 1531 |
| 757 | Ga0501038_0242003 | 3300049574 | Bacteria | 1432 |
| 758 | Ga0501038_0309115 | 3300049574 | Bacteria | 1239 |
| 759 | Ga0501039_0000080 | 3300049575 | Bacteria | 72519 |
| 760 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 761 | Ga0501039_0054344 | 3300049575 | Bacteria | 3099 |
| 762 | Ga0501039_0195543 | 3300049575 | Bacteria | 1590 |
| 763 | Ga0501039_0240450 | 3300049575 | Bacteria | 1423 |
| 764 | Ga0501039_0271682 | 3300049575 | Bacteria | 1332 |
| 765 | Ga0501039_0525627 | 3300049575 | Bacteria | 929 |
| 766 | Ga0501040_0107203 | 3300049576 | Bacteria | 1952 |
| 767 | Ga0501041_0089200 | 3300049577 | Bacteria | 1904 |
| 768 | Ga0501041_0219781 | 3300049577 | Bacteria | 1192 |
| 769 | Ga0501042_0403503 | 3300049578 | Bacteria | 990 |
| 770 | Ga0501042_0915857 | 3300049578 | Bacteria | 639 |
| 771 | Ga0501043_0000080 | 3300049579 | Bacteria | 85372 |
| 772 | Ga0501043_0004023 | 3300049579 | Bacteria | 12021 |
| 773 | Ga0501043_0007495 | 3300049579 | Bacteria | 8664 |
| 774 | Ga0501043_0012997 | 3300049579 | Bacteria | 6508 |
| 775 | Ga0501043_0038138 | 3300049579 | Bacteria | 3779 |
| 776 | Ga0501043_0047851 | 3300049579 | Bacteria | 3362 |
| 777 | Ga0501043_0055891 | 3300049579 | Bacteria | 3100 |
| 778 | Ga0501043_0060820 | 3300049579 | Bacteria | 2965 |
| 779 | Ga0501043_0089103 | 3300049579 | Bacteria | 2425 |
| 780 | Ga0501043_0099954 | 3300049579 | Bacteria | 2280 |
| 781 | Ga0501043_0113305 | 3300049579 | Bacteria | 2130 |
| 782 | Ga0501043_0126611 | 3300049579 | Bacteria | 2003 |
| 783 | Ga0501043_0260320 | 3300049579 | Bacteria | 1334 |
| 784 | Ga0501043_0311955 | 3300049579 | Bacteria | 1200 |
| 785 | Ga0501043_0631661 | 3300049579 | Bacteria | 788 |
| 786 | Ga0501046_0103794 | 3300049580 | Bacteria | 2179 |
| 787 | Ga0501046_0144271 | 3300049580 | Bacteria | 1799 |
| 788 | Ga0501046_0242537 | 3300049580 | Bacteria | 1329 |
| 789 | Ga0501046_0312805 | 3300049580 | Bacteria | 1145 |
| 790 | Ga0501047_0009718 | 3300049581 | Bacteria | 9096 |
| 791 | Ga0501047_0015743 | 3300049581 | Bacteria | 7207 |
| 792 | Ga0501047_0023054 | 3300049581 | Bacteria | 5976 |
| 793 | Ga0501047_0023074 | 3300049581 | Bacteria | 5972 |
| 794 | Ga0501047_0100301 | 3300049581 | Bacteria | 2774 |
| 795 | Ga0501047_0127913 | 3300049581 | Bacteria | 2420 |
| 796 | Ga0501047_0152453 | 3300049581 | Bacteria | 2186 |
| 797 | Ga0501047_0176080 | 3300049581 | Bacteria | 2006 |
| 798 | Ga0501047_0181203 | 3300049581 | Bacteria | 1973 |
| 799 | Ga0501047_0194950 | 3300049581 | Bacteria | 1888 |
| 800 | Ga0501047_0206504 | 3300049581 | Bacteria | 1823 |
| 801 | Ga0501047_0245096 | 3300049581 | Bacteria | 1641 |
| 802 | Ga0501047_0318480 | 3300049581 | Bacteria | 1395 |
| 803 | Ga0501047_0335131 | 3300049581 | Bacteria | 1351 |
| 804 | Ga0501047_0353434 | 3300049581 | Bacteria | 1306 |
| 805 | Ga0501047_0414952 | 3300049581 | Bacteria | 1178 |
| 806 | Ga0501047_0457014 | 3300049581 | Bacteria | 1106 |
| 807 | Ga0501047_0757346 | 3300049581 | Bacteria | 787 |
| 808 | Ga0501047_0776464 | 3300049581 | Bacteria | 773 |
| 809 | Ga0501047_1193506 | 3300049581 | Bacteria | 574 |
| 810 | Ga0501047_1248537 | 3300049581 | Bacteria | 557 |
| 811 | Ga0501047_1265904 | 3300049581 | Bacteria | 551 |
| 812 | Ga0501048_0030318 | 3300049582 | Bacteria | 3913 |
| 813 | Ga0501048_0058389 | 3300049582 | Bacteria | 2735 |
| 814 | Ga0501048_0203637 | 3300049582 | Bacteria | 1403 |
| 815 | Ga0501048_0235293 | 3300049582 | Bacteria | 1300 |
| 816 | Ga0501048_0280029 | 3300049582 | Bacteria | 1186 |
| 817 | Ga0501048_0793705 | 3300049582 | Bacteria | 680 |
| 818 | Ga0501067_0052681 | 3300049583 | Bacteria | 2255 |
| 819 | Ga0501067_0064853 | 3300049583 | Bacteria | 2022 |
| 820 | Ga0501067_0091010 | 3300049583 | Bacteria | 1693 |
| 821 | Ga0501067_0140339 | 3300049583 | Bacteria | 1345 |
| 822 | Ga0501067_0144537 | 3300049583 | Bacteria | 1325 |
| 823 | Ga0501067_0175550 | 3300049583 | Bacteria | 1193 |
| 824 | Ga0501067_0286359 | 3300049583 | Bacteria | 917 |
| 825 | Ga0501068_0011134 | 3300049584 | Bacteria | 5067 |
| 826 | Ga0501068_0015296 | 3300049584 | Bacteria | 4404 |
| 827 | Ga0501068_0083047 | 3300049584 | Bacteria | 1968 |
| 828 | Ga0501068_0175925 | 3300049584 | Bacteria | 1352 |
| 829 | Ga0501068_0196318 | 3300049584 | Bacteria | 1279 |
| 830 | Ga0501068_0298881 | 3300049584 | Bacteria | 1030 |
| 831 | Ga0501068_0307507 | 3300049584 | Bacteria | 1015 |
| 832 | Ga0501068_0562731 | 3300049584 | Bacteria | 742 |
| 833 | Ga0501068_0891881 | 3300049584 | Bacteria | 585 |
| 834 | Ga0501068_1037556 | 3300049584 | Bacteria | 541 |
| 835 | Ga0501069_0004122 | 3300049585 | Bacteria | 7502 |
| 836 | Ga0501069_0004928 | 3300049585 | Bacteria | 6923 |
| 837 | Ga0501069_0013201 | 3300049585 | Bacteria | 4401 |
| 838 | Ga0501069_0060723 | 3300049585 | Bacteria | 2110 |
| 839 | Ga0501069_0122463 | 3300049585 | Bacteria | 1486 |
| 840 | Ga0501069_0138940 | 3300049585 | Bacteria | 1393 |
| 841 | Ga0501069_0306723 | 3300049585 | Bacteria | 931 |
| 842 | Ga0501069_0451519 | 3300049585 | Bacteria | 764 |
| 843 | Ga0501069_0723195 | 3300049585 | Bacteria | 601 |
| 844 | Ga0501070_0001286 | 3300049586 | Bacteria | 22525 |
| 845 | Ga0501070_0006284 | 3300049586 | Bacteria | 10111 |
| 846 | Ga0501070_0006301 | 3300049586 | Bacteria | 10097 |
| 847 | Ga0501070_0011237 | 3300049586 | Bacteria | 7561 |
| 848 | Ga0501070_0014064 | 3300049586 | Bacteria | 6737 |
| 849 | Ga0501070_0025506 | 3300049586 | Bacteria | 4958 |
| 850 | Ga0501070_0040568 | 3300049586 | Bacteria | 3881 |
| 851 | Ga0501070_0057678 | 3300049586 | Bacteria | 3219 |
| 852 | Ga0501070_0060281 | 3300049586 | Bacteria | 3145 |
| 853 | Ga0501070_0171551 | 3300049586 | Bacteria | 1786 |
| 854 | Ga0501070_0190795 | 3300049586 | Bacteria | 1684 |
| 855 | Ga0501070_0215956 | 3300049586 | Bacteria | 1573 |
| 856 | Ga0501070_0247320 | 3300049586 | Bacteria | 1459 |
| 857 | Ga0501070_0250574 | 3300049586 | Bacteria | 1448 |
| 858 | Ga0501070_0256784 | 3300049586 | Bacteria | 1429 |
| 859 | Ga0501070_0373060 | 3300049586 | Bacteria | 1156 |
| 860 | Ga0501070_0809439 | 3300049586 | Bacteria | 735 |
| 861 | Ga0501071_0046823 | 3300049587 | Bacteria | 3106 |
| 862 | Ga0501071_0101470 | 3300049587 | Bacteria | 2121 |
| 863 | Ga0501071_0201488 | 3300049587 | Bacteria | 1495 |
| 864 | Ga0501071_0288439 | 3300049587 | Bacteria | 1243 |
| 865 | Ga0501071_0547545 | 3300049587 | Bacteria | 889 |
| 866 | Ga0501071_0625049 | 3300049587 | Bacteria | 828 |
| 867 | Ga0501072_0338405 | 3300049588 | Bacteria | 1195 |
| 868 | Ga0501072_0468150 | 3300049588 | Bacteria | 998 |
| 869 | Ga0501072_0476060 | 3300049588 | Bacteria | 988 |
| 870 | Ga0501072_0509121 | 3300049588 | Bacteria | 952 |
| 871 | Ga0501073_0000083 | 3300049589 | Bacteria | 59733 |
| 872 | Ga0501073_0015881 | 3300049589 | Bacteria | 5456 |
| 873 | Ga0501073_0023164 | 3300049589 | Bacteria | 4463 |
| 874 | Ga0501073_0058581 | 3300049589 | Bacteria | 2691 |
| 875 | Ga0501073_0117358 | 3300049589 | Bacteria | 1844 |
| 876 | Ga0501073_0128507 | 3300049589 | Bacteria | 1756 |
| 877 | Ga0501073_0153236 | 3300049589 | Bacteria | 1597 |
| 878 | Ga0501073_0294738 | 3300049589 | Bacteria | 1119 |
| 879 | Ga0501073_0955702 | 3300049589 | Bacteria | 590 |
| 880 | Ga0501074_0002583 | 3300049590 | Bacteria | 12638 |
| 881 | Ga0501074_0012668 | 3300049590 | Bacteria | 6133 |
| 882 | Ga0501074_0035107 | 3300049590 | Bacteria | 3633 |
| 883 | Ga0501074_0174237 | 3300049590 | Bacteria | 1535 |
| 884 | Ga0501074_0187163 | 3300049590 | Bacteria | 1476 |
| 885 | Ga0501074_0215216 | 3300049590 | Bacteria | 1369 |
| 886 | Ga0501074_0462343 | 3300049590 | Bacteria | 899 |
| 887 | Ga0501074_1037662 | 3300049590 | Bacteria | 576 |
| 888 | Ga0501075_0515130 | 3300049591 | Bacteria | 913 |
| 889 | Ga0501075_1173828 | 3300049591 | Bacteria | 583 |
| 890 | Ga0501076_0347691 | 3300049592 | Bacteria | 1217 |
| 891 | Ga0501076_1553601 | 3300049592 | Bacteria | 543 |
| 892 | Ga0501077_0000088 | 3300049593 | Bacteria | 46551 |
| 893 | Ga0501079_0026674 | 3300049741 | Bacteria | 4430 |
| 894 | Ga0501079_0258482 | 3300049741 | Bacteria | 1361 |
| 895 | Ga0501079_0472590 | 3300049741 | Bacteria | 985 |
| 896 | Ga0501079_0657281 | 3300049741 | Bacteria | 825 |
| 897 | Ga0501079_0718271 | 3300049741 | Bacteria | 786 |
| 898 | Ga0501079_0847117 | 3300049741 | Bacteria | 720 |
| 899 | Ga0501080_0003162 | 3300049742 | Bacteria | 14508 |
| 900 | Ga0501080_0004752 | 3300049742 | Bacteria | 12113 |
| 901 | Ga0501080_0009625 | 3300049742 | Bacteria | 8822 |
| 902 | Ga0501080_0010339 | 3300049742 | Bacteria | 8535 |
| 903 | Ga0501080_0015400 | 3300049742 | Bacteria | 7048 |
| 904 | Ga0501080_0017194 | 3300049742 | Bacteria | 6681 |
| 905 | Ga0501080_0102533 | 3300049742 | Bacteria | 2654 |
| 906 | Ga0501080_0181593 | 3300049742 | Bacteria | 1936 |
| 907 | Ga0501080_0181639 | 3300049742 | Bacteria | 1935 |
| 908 | Ga0501080_0213642 | 3300049742 | Bacteria | 1767 |
| 909 | Ga0501080_0229455 | 3300049742 | Bacteria | 1697 |
| 910 | Ga0501080_0238618 | 3300049742 | Bacteria | 1660 |
| 911 | Ga0501080_0363496 | 3300049742 | Bacteria | 1305 |
| 912 | Ga0501080_0443693 | 3300049742 | Bacteria | 1164 |
| 913 | Ga0501080_0756129 | 3300049742 | Bacteria | 854 |
| 914 | Ga0501080_0850478 | 3300049742 | Bacteria | 798 |
| 915 | Ga0501080_1386239 | 3300049742 | Bacteria | 600 |
| 916 | Ga0501083_0001214 | 3300049744 | Bacteria | 17447 |
| 917 | Ga0501083_0020957 | 3300049744 | Bacteria | 4543 |
| 918 | Ga0501083_0187035 | 3300049744 | Bacteria | 1352 |
| 919 | Ga0501083_0192449 | 3300049744 | Bacteria | 1331 |
| 920 | Ga0501083_0255597 | 3300049744 | Bacteria | 1140 |
| 921 | Ga0501083_0861676 | 3300049744 | Bacteria | 589 |
| 922 | Ga0501083_1087553 | 3300049744 | Bacteria | 520 |
| 923 | Ga0501035_0000160 | 3300049822 | Bacteria | 82214 |
| 924 | Ga0501035_0002188 | 3300049822 | Bacteria | 19398 |
| 925 | Ga0501035_0022027 | 3300049822 | Bacteria | 5854 |
| 926 | Ga0501035_0023586 | 3300049822 | Bacteria | 5644 |
| 927 | Ga0501035_0037179 | 3300049822 | Bacteria | 4410 |
| 928 | Ga0501035_0043204 | 3300049822 | Bacteria | 4062 |
| 929 | Ga0501035_0055030 | 3300049822 | Bacteria | 3553 |
| 930 | Ga0501035_0079674 | 3300049822 | Bacteria | 2893 |
| 931 | Ga0501035_0099561 | 3300049822 | Bacteria | 2551 |
| 932 | Ga0501035_0115591 | 3300049822 | Bacteria | 2348 |
| 933 | Ga0501035_0115964 | 3300049822 | Bacteria | 2344 |
| 934 | Ga0501035_0122392 | 3300049822 | Bacteria | 2273 |
| 935 | Ga0501035_0139961 | 3300049822 | Bacteria | 2104 |
| 936 | Ga0501035_0150305 | 3300049822 | Bacteria | 2021 |
| 937 | Ga0501035_0161926 | 3300049822 | Bacteria | 1936 |
| 938 | Ga0501035_0213546 | 3300049822 | Bacteria | 1650 |
| 939 | Ga0501035_1531283 | 3300049822 | Bacteria | 508 |
| 940 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 941 | Ga0501044_0000544 | 3300049823 | Bacteria | 45911 |
| 942 | Ga0501044_0009229 | 3300049823 | Bacteria | 10770 |
| 943 | Ga0501044_0009814 | 3300049823 | Bacteria | 10410 |
| 944 | Ga0501044_0018610 | 3300049823 | Bacteria | 7441 |
| 945 | Ga0501044_0024732 | 3300049823 | Bacteria | 6370 |
| 946 | Ga0501044_0025827 | 3300049823 | Bacteria | 6226 |
| 947 | Ga0501044_0033457 | 3300049823 | Bacteria | 5402 |
| 948 | Ga0501044_0036148 | 3300049823 | Bacteria | 5168 |
| 949 | Ga0501044_0076702 | 3300049823 | Bacteria | 3391 |
| 950 | Ga0501044_0082042 | 3300049823 | Bacteria | 3263 |
| 951 | Ga0501044_0114449 | 3300049823 | Bacteria | 2703 |
| 952 | Ga0501044_0154439 | 3300049823 | Bacteria | 2275 |
| 953 | Ga0501044_0191494 | 3300049823 | Bacteria | 2007 |
| 954 | Ga0501044_0232392 | 3300049823 | Bacteria | 1791 |
| 955 | Ga0501044_0259727 | 3300049823 | Bacteria | 1675 |
| 956 | Ga0501044_0368868 | 3300049823 | Bacteria | 1352 |
| 957 | Ga0501044_0440662 | 3300049823 | Bacteria | 1210 |
| 958 | Ga0501044_0525585 | 3300049823 | Bacteria | 1082 |
| 959 | Ga0501044_0592359 | 3300049823 | Bacteria | 1002 |
| 960 | Ga0501044_1020005 | 3300049823 | Bacteria | 699 |
| 961 | Ga0501045_0001715 | 3300049824 | Bacteria | 14765 |
| 962 | Ga0501045_0485235 | 3300049824 | Bacteria | 918 |
| 963 | Ga0501045_1337791 | 3300049824 | Bacteria | 521 |
| 964 | nmdc:mga03n38_14252_c1 | 3300050490 | Bacteria | 3042 |
| 965 | nmdc:mga03n38_21372_c1 | 3300050490 | Bacteria | 2604 |
| 966 | nmdc:mga03n38_429542_c1 | 3300050490 | Bacteria | 732 |
| 967 | nmdc:mga03n38_746046_c1 | 3300050490 | Bacteria | 567 |
| 968 | nmdc:mga00v17_512278_c1 | 3300050491 | Bacteria | 777 |
| 969 | nmdc:mga0yw44_18471_c1 | 3300050492 | Bacteria | 3821 |
| 970 | nmdc:mga0yw44_212922_c1 | 3300050492 | Bacteria | 1279 |
| 971 | nmdc:mga0yw44_212931_c1 | 3300050492 | Bacteria | 1279 |
| 972 | nmdc:mga0yw44_542325_c1 | 3300050492 | Bacteria | 790 |
| 973 | nmdc:mga0yw44_60745_c1 | 3300050492 | Bacteria | 2316 |
| 974 | nmdc:mga0yw44_755433_c1 | 3300050492 | Bacteria | 660 |
| 975 | nmdc:mga0k408_676254_c1 | 3300050493 | Bacteria | 606 |
| 976 | nmdc:mga06z11_112461_c1 | 3300050494 | Bacteria | 1510 |
| 977 | nmdc:mga06z11_119069_c1 | 3300050494 | Bacteria | 1471 |
| 978 | nmdc:mga06z11_157752_c1 | 3300050494 | Bacteria | 1295 |
| 979 | nmdc:mga06z11_395338_c1 | 3300050494 | Bacteria | 832 |
| 980 | nmdc:mga06z11_787034_c1 | 3300050494 | Bacteria | 580 |
| 981 | nmdc:mga04h51_131147_c1 | 3300050495 | Bacteria | 943 |
| 982 | nmdc:mga04h51_255960_c1 | 3300050495 | Bacteria | 703 |
| 983 | nmdc:mga04h51_7863_c1 | 3300050495 | Bacteria | 2834 |
| 984 | nmdc:mga07m45_26183_c1 | 3300050496 | Bacteria | 3205 |
| 985 | nmdc:mga07m45_354090_c1 | 3300050496 | Bacteria | 853 |
| 986 | nmdc:mga07m45_5559_c1 | 3300050496 | Bacteria | 6288 |
| 987 | nmdc:mga0qj67_299_c1 | 3300050509 | Bacteria | 34404 |
| 988 | nmdc:mga06r32_1385318_c1 | 3300050510 | Bacteria | 645 |
| 989 | nmdc:mga0rr50_919365_c1 | 3300050513 | Bacteria | 746 |
| 990 | nmdc:mga0a205_654184_c1 | 3300050515 | Bacteria | 902 |
| 991 | nmdc:mga0sz30_14247_c1 | 3300050516 | Bacteria | 2669 |
| 992 | nmdc:mga0sz30_30979_c1 | 3300050516 | Bacteria | 2212 |
| 993 | Ga0495601_0216675 | 3300053077 | Bacteria | 1250 |
| 994 | Ga0500610_0168190 | 3300053079 | Bacteria | 1084 |
| 995 | Ga0495655_0237727 | 3300053083 | Bacteria | 608 |
| 996 | Ga0500644_0033161 | 3300053088 | Bacteria | 1656 |
| 997 | Ga0500647_0070822 | 3300053091 | Bacteria | 1676 |
| 998 | Ga0500566_0000320 | 3300053094 | Bacteria | 25974 |
| 999 | Ga0500640_027849 | 3300053095 | Bacteria | 2466 |
| 1000 | Ga0500650_0280870 | 3300053098 | Bacteria | 740 |
| 1001 | Ga0500556_0000009 | 3300053104 | Bacteria | 288111 |
| 1002 | Ga0500562_111930 | 3300053108 | Bacteria | 744 |
| 1003 | Ga0500572_001453 | 3300053111 | Bacteria | 6482 |
| 1004 | Ga0500572_006785 | 3300053111 | Bacteria | 2630 |
| 1005 | Ga0500580_223785 | 3300053113 | Bacteria | 589 |
| 1006 | Ga0500591_074354 | 3300053115 | Bacteria | 1531 |
| 1007 | Ga0500595_145202 | 3300053119 | Bacteria | 664 |
| 1008 | Ga0500608_029012 | 3300053122 | Bacteria | 2614 |
| 1009 | Ga0500618_053140 | 3300053125 | Bacteria | 916 |
| 1010 | Ga0500655_015396 | 3300053133 | Bacteria | 1403 |
| 1011 | Ga0500658_0019134 | 3300053134 | Bacteria | 2574 |
| 1012 | Ga0500559_0007811 | 3300053136 | Bacteria | 4724 |
| 1013 | Ga0500559_0012275 | 3300053136 | Bacteria | 3644 |
| 1014 | Ga0500559_0013950 | 3300053136 | Bacteria | 3396 |
| 1015 | Ga0500568_0001953 | 3300053139 | Bacteria | 12637 |
| 1016 | Ga0500568_0231839 | 3300053139 | Bacteria | 674 |
| 1017 | Ga0500588_0004535 | 3300053146 | Bacteria | 3018 |
| 1018 | Ga0500603_003307 | 3300053150 | Bacteria | 3463 |
| 1019 | Ga0500603_022818 | 3300053150 | Bacteria | 1553 |
| 1020 | Ga0500616_0024839 | 3300053153 | Bacteria | 3326 |
| 1021 | Ga0500620_004601 | 3300053155 | Bacteria | 3101 |
| 1022 | Ga0500627_0402866 | 3300053158 | Bacteria | 582 |
| 1023 | Ga0500630_005936 | 3300053159 | Bacteria | 5975 |
| 1024 | Ga0500638_024655 | 3300053162 | Bacteria | 2870 |
| 1025 | Ga0500639_002134 | 3300053163 | Bacteria | 9896 |
| 1026 | Ga0500639_019780 | 3300053163 | Bacteria | 3551 |
| 1027 | Ga0500636_0419595 | 3300053177 | Bacteria | 615 |
| 1028 | Ga0500637_0172514 | 3300053178 | Bacteria | 1242 |
| 1029 | Ga0500645_074069 | 3300053730 | Bacteria | 975 |
| 1030 | Ga0500609_013602 | 3300053731 | Bacteria | 1101 |
| 1031 | Ga0500609_020675 | 3300053731 | Bacteria | 897 |
| 1032 | Ga0500656_009071 | 3300053732 | Bacteria | 1065 |
| 1033 | Ga0500596_003981 | 3300053735 | Bacteria | 2750 |
| 1034 | Ga0500596_005235 | 3300053735 | Bacteria | 2306 |
| 1035 | Ga0501084_0000175 | 3300054114 | Bacteria | 50123 |
| 1036 | Ga0501084_0023050 | 3300054114 | Bacteria | 5196 |
| 1037 | Ga0501084_0582995 | 3300054114 | Bacteria | 945 |
| 1038 | Ga0501084_1010364 | 3300054114 | Bacteria | 699 |
| 1039 | Ga0587093_012340 | 3300059478 | Bacteria | 1036 |
| 1040 | Ga0587066_014974 | 3300059490 | Bacteria | 1199 |
| 1041 | Ga0587066_040569 | 3300059490 | Bacteria | 875 |
| 1042 | Ga0587066_081737 | 3300059490 | Bacteria | 701 |
| 1043 | Ga0587070_012050 | 3300059491 | Bacteria | 1306 |
| 1044 | Ga0587070_012736 | 3300059491 | Bacteria | 1284 |
| 1045 | Ga0587070_038250 | 3300059491 | Bacteria | 906 |
| 1046 | Ga0587077_011314 | 3300059493 | Bacteria | 1400 |
| 1047 | Ga0587077_110366 | 3300059493 | Bacteria | 673 |
| 1048 | Ga0587080_014343 | 3300059503 | Bacteria | 1225 |
| 1049 | Ga0587082_043435 | 3300059504 | Bacteria | 833 |
| 1050 | Ga0587082_109234 | 3300059504 | Bacteria | 612 |
| 1051 | Ga0587083_0245757 | 3300059505 | Bacteria | 531 |
| 1052 | Ga0587086_019549 | 3300059507 | Bacteria | 912 |
| 1053 | Ga0587088_148311 | 3300059508 | Bacteria | 565 |
| 1054 | Ga0587092_082209 | 3300059512 | Bacteria | 638 |
| 1055 | Ga0587094_007473 | 3300059513 | Bacteria | 1341 |
| 1056 | Ga0587106_013481 | 3300059605 | Bacteria | 1112 |
| 1057 | Ga0587099_011882 | 3300059622 | Bacteria | 889 |
| 1058 | Ga0587101_003234 | 3300059623 | Bacteria | 1638 |
| 1059 | Ga0587062_001756 | 3300059639 | Bacteria | 1946 |
| 1060 | Ga0587062_114779 | 3300059639 | Bacteria | 538 |
| 1061 | Ga0587069_017394 | 3300059642 | Bacteria | 1040 |
| 1062 | Ga0587072_013827 | 3300059643 | Bacteria | 1353 |
| 1063 | Ga0587072_027025 | 3300059643 | Bacteria | 1052 |
| 1064 | Ga0587072_031440 | 3300059643 | Bacteria | 993 |
| 1065 | Ga0587075_014892 | 3300059644 | Bacteria | 1088 |
| 1066 | Ga0587076_045829 | 3300059645 | Bacteria | 834 |
| 1067 | Ga0587078_006461 | 3300059646 | Bacteria | 1276 |
| 1068 | Ga0587079_027730 | 3300059647 | Bacteria | 1067 |
| 1069 | Ga0587107_000278 | 3300059652 | Bacteria | 3063 |
| 1070 | Ga0587114_051809 | 3300059655 | Bacteria | 697 |
| 1071 | Ga0587124_023994 | 3300059660 | Bacteria | 640 |
| 1072 | Ga0587071_014153 | 3300060344 | Bacteria | 1384 |
| 1073 | Ga0587071_062609 | 3300060344 | Bacteria | 794 |
| 1074 | Ga0587111_0030774 | 3300060346 | Bacteria | 1094 |
| 1075 | Ga0501082_0049749 | 3300060353 | Bacteria | 3614 |
| 1076 | Ga0501082_0161198 | 3300060353 | Bacteria | 1949 |
| 1077 | Ga0501082_0220581 | 3300060353 | Bacteria | 1650 |
| 1078 | Ga0501082_0227328 | 3300060353 | Bacteria | 1624 |
| 1079 | Ga0501082_0253081 | 3300060353 | Bacteria | 1532 |
| 1080 | Ga0501082_0689903 | 3300060353 | Bacteria | 894 |
| 1081 | Ga0466962_0322552 | 3300061719 | Bacteria | 766 |
| 1082 | Ga0466962_0535006 | 3300061719 | Bacteria | 595 |
| 1083 | Ga0530510_0407417 | 3300061734 | Bacteria | 1026 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10028569 | Ga0307513_100285698 | 118 |
| 2 | 3300031730 | Ga0307516_10057860 | Ga0307516_100578606 | 118 |
| 3 | 3300033180 | Ga0307510_10235297 | Ga0307510_102352973 | 118 |
| 4 | 3300036401 | Ga0373937_1299498 | Ga0373937_1299498_305_661 | 118 |
| 5 | 3300044901 | Ga0466960_0770748 | Ga0466960_0770748_208_570 | 118 |
| 6 | 3300053088 | Ga0500644_0033161 | Ga0500644_0033161_77_451 | 118 |
| 7 | 3300053108 | Ga0500562_111930 | Ga0500562_111930_54_428 | 118 |
| 8 | 3300021384 | Ga0213876_10003189 | Ga0213876_1000318910 | 120 |
| 9 | 3300028577 | Ga0265318_10000037 | Ga0265318_1000003710 | 120 |
| 10 | 3300039437 | Ga0436365_0544722 | Ga0436365_0544722_398_808 | 120 |
| 11 | 3300046477 | Ga0495664_0454931 | Ga0495664_0454931_288_698 | 120 |
| 12 | 3300046529 | Ga0495652_0270727 | Ga0495652_0270727_560_970 | 120 |
| 13 | 3300046536 | Ga0495587_0405187 | Ga0495587_0405187_334_744 | 120 |
| 14 | 3300049581 | Ga0501047_0457014 | Ga0501047_0457014_526_936 | 120 |
| 15 | 3300054114 | Ga0501084_0000175 | Ga0501084_0000175_45294_45704 | 120 |
| 16 | 3300005539 | Ga0068853_100114801 | Ga0068853_1001148016 | 121 |
| 17 | 3300005563 | Ga0068855_100047378 | Ga0068855_10004737810 | 121 |
| 18 | 3300005614 | Ga0068856_100369844 | Ga0068856_1003698444 | 121 |
| 19 | 3300005616 | Ga0068852_101715648 | Ga0068852_1017156481 | 121 |
| 20 | 3300005616 | Ga0068852_101918274 | Ga0068852_1019182741 | 121 |
| 21 | 3300005616 | Ga0068852_102361678 | Ga0068852_1023616781 | 121 |
| 22 | 3300006237 | Ga0097621_100818497 | Ga0097621_1008184972 | 121 |
| 23 | 3300009093 | Ga0105240_10004696 | Ga0105240_1000469626 | 121 |
| 24 | 3300009093 | Ga0105240_11183468 | Ga0105240_111834681 | 121 |
| 25 | 3300009101 | Ga0105247_10106510 | Ga0105247_101065104 | 121 |
| 26 | 3300009545 | Ga0105237_10944359 | Ga0105237_109443592 | 121 |
| 27 | 3300010375 | Ga0105239_10104618 | Ga0105239_101046185 | 121 |
| 28 | 3300010375 | Ga0105239_10256544 | Ga0105239_102565444 | 121 |
| 29 | 3300013105 | Ga0157369_10115778 | Ga0157369_101157784 | 121 |
| 30 | 3300025913 | Ga0207695_10000018 | Ga0207695_1000001836 | 121 |
| 31 | 3300025924 | Ga0207694_10000010 | Ga0207694_10000010358 | 121 |
| 32 | 3300025949 | Ga0207667_10000388 | Ga0207667_1000038865 | 121 |
| 33 | 3300026041 | Ga0207639_10029726 | Ga0207639_100297269 | 121 |
| 34 | 3300026142 | Ga0207698_10252997 | Ga0207698_102529972 | 121 |
| 35 | 3300026142 | Ga0207698_10380105 | Ga0207698_103801052 | 121 |
| 36 | 3300049460 | Ga0495682_0005207 | Ga0495682_0005207_1437_1847 | 121 |
| 37 | 3300053133 | Ga0500655_015396 | Ga0500655_015396_258_668 | 121 |
| 38 | 3300005615 | Ga0070702_100576219 | Ga0070702_1005762192 | 122 |
| 39 | 3300013306 | Ga0163162_11776650 | Ga0163162_117766502 | 122 |
| 40 | 3300048904 | Ga0496101_0659266 | Ga0496101_0659266_143_559 | 122 |
| 41 | 3300048905 | Ga0496102_0426059 | Ga0496102_0426059_247_663 | 122 |
| 42 | 3300048914 | Ga0496111_0748896 | Ga0496111_0748896_280_696 | 122 |
| 43 | 3300049583 | Ga0501067_0091010 | Ga0501067_0091010_551_967 | 122 |
| 44 | iso_pu_bacteria | 2503198000 | 2503202660 | 133 |
| 45 | iso_pu_bacteria | 2508501123 | 2509117725 | 133 |
| 46 | iso_pu_bacteria | 2508501127 | 2509143590 | 133 |
| 47 | iso_pu_bacteria | 2509276018 | 2509372995 | 133 |
| 48 | iso_pu_bacteria | 2509276022 | 2509397165 | 133 |
| 49 | iso_pu_bacteria | 2510065059 | 2510319913 | 133 |
| 50 | iso_pu_bacteria | 2511231027 | 2511390480 | 133 |
| 51 | iso_pu_bacteria | 2512875016 | 2512930566 | 133 |
| 52 | iso_pu_bacteria | 2512875024 | 2512958298 | 133 |
| 53 | iso_pu_bacteria | 2513237090 | 2513612127 | 133 |
| 54 | iso_pu_bacteria | 2513237164 | 2514032569 | 133 |
| 55 | iso_pu_bacteria | 2513237305 | 2514422080 | 133 |
| 56 | iso_pu_bacteria | 2513237351 | 2514589869 | 133 |
| 57 | iso_pu_bacteria | 2545555834 | 2545677358 | 133 |
| 58 | iso_pu_bacteria | 2588253730 | 2588516208 | 133 |
| 59 | iso_pu_bacteria | 2597489875 | 2597813655 | 133 |
| 60 | iso_pu_bacteria | 2599185301 | 2599939543 | 133 |
| 61 | iso_pu_bacteria | 2643221550 | 2643773786 | 133 |
| 62 | iso_pu_bacteria | 2643221551 | 2643775174 | 133 |
| 63 | iso_pu_bacteria | 2643221555 | 2643793620 | 133 |
| 64 | iso_pu_bacteria | 2643221564 | 2643837524 | 133 |
| 65 | iso_pu_bacteria | 2643221595 | 2643987303 | 133 |
| 66 | iso_pu_bacteria | 2643221623 | 2644131931 | 133 |
| 67 | iso_pu_bacteria | 2643221627 | 2644155627 | 133 |
| 68 | iso_pu_bacteria | 2687453392 | 2688599064 | 133 |
| 69 | iso_pu_bacteria | 2693429783 | 2694631913 | 133 |
| 70 | iso_pu_bacteria | 2693429784 | 2694634666 | 133 |
| 71 | iso_pu_bacteria | 2721755686 | 2723576068 | 133 |
| 72 | iso_pu_bacteria | 2738543024 | 2739309049 | 133 |
| 73 | iso_pu_bacteria | 2756170246 | 2756677758 | 133 |
| 74 | iso_pu_bacteria | 2757320392 | 2757572017 | 133 |
| 75 | iso_pu_bacteria | 2758568016 | 2758641831 | 133 |
| 76 | iso_pu_bacteria | 2765235802 | 2765465540 | 133 |
| 77 | iso_pu_bacteria | 2767802442 | 2770195565 | 133 |
| 78 | iso_pu_bacteria | 2775506902 | 2776271573 | 133 |
| 79 | iso_pu_bacteria | 2775506904 | 2776279915 | 133 |
| 80 | iso_pu_bacteria | 2791355123 | 2792750751 | 133 |
| 81 | iso_pu_bacteria | 2839993093 | 2839995592 | 133 |
| 82 | iso_pu_bacteria | 2840764183 | 2840768021 | 133 |
| 83 | iso_pu_bacteria | 2841734538 | 2841740451 | 133 |
| 84 | iso_pu_bacteria | 2842871566 | 2842872903 | 133 |
| 85 | iso_pu_bacteria | 2844002411 | 2844006796 | 133 |
| 86 | iso_pu_bacteria | 2844009547 | 2844014463 | 133 |
| 87 | iso_pu_bacteria | 2847670302 | 2847670796 | 133 |
| 88 | iso_pu_bacteria | 2847686936 | 2847687067 | 133 |
| 89 | iso_pu_bacteria | 2856314179 | 2856316253 | 133 |
| 90 | iso_pu_bacteria | 2856320880 | 2856325077 | 133 |
| 91 | iso_pu_bacteria | 2856328259 | 2856330565 | 133 |
| 92 | iso_pu_bacteria | 2856334872 | 2856340865 | 133 |
| 93 | iso_pu_bacteria | 2856342000 | 2856345833 | 133 |
| 94 | iso_pu_bacteria | 2856349417 | 2856349741 | 133 |
| 95 | iso_pu_bacteria | 2856356410 | 2856359235 | 133 |
| 96 | iso_pu_bacteria | 2856364286 | 2856369149 | 133 |
| 97 | iso_pu_bacteria | 2857349434 | 2857355587 | 133 |
| 98 | iso_pu_bacteria | 2857367948 | 2857372581 | 133 |
| 99 | iso_pu_bacteria | 2869162929 | 2869168976 | 133 |
| 100 | iso_pu_bacteria | 2869169390 | 2869174089 | 133 |
| 101 | iso_pu_bacteria | 2869234852 | 2869237161 | 133 |
| 102 | iso_pu_bacteria | 2869242130 | 2869243187 | 133 |
| 103 | iso_pu_bacteria | 2869249662 | 2869252742 | 133 |
| 104 | iso_pu_bacteria | 2869256925 | 2869262747 | 133 |
| 105 | iso_pu_bacteria | 2869264136 | 2869270264 | 133 |
| 106 | iso_pu_bacteria | 2869271264 | 2869273280 | 133 |
| 107 | iso_pu_bacteria | 2869278585 | 2869280901 | 133 |
| 108 | iso_pu_bacteria | 2869285874 | 2869288393 | 133 |
| 109 | iso_pu_bacteria | 2871429161 | 2871432102 | 133 |
| 110 | iso_pu_bacteria | 2871435913 | 2871439287 | 133 |
| 111 | iso_pu_bacteria | 2871444079 | 2871448837 | 133 |
| 112 | iso_pu_bacteria | 2871451962 | 2871455263 | 133 |
| 113 | iso_pu_bacteria | 2871459585 | 2871459674 | 133 |
| 114 | iso_pu_bacteria | 2871466892 | 2871470929 | 133 |
| 115 | iso_pu_bacteria | 2871474448 | 2871480989 | 133 |
| 116 | iso_pu_bacteria | 2871481445 | 2871484307 | 133 |
| 117 | iso_pu_bacteria | 2871488783 | 2871495251 | 133 |
| 118 | iso_pu_bacteria | 2871495908 | 2871500459 | 133 |
| 119 | iso_pu_bacteria | 2874109183 | 2874115358 | 133 |
| 120 | iso_pu_bacteria | 2874116593 | 2874120799 | 133 |
| 121 | iso_pu_bacteria | 2874123672 | 2874125710 | 133 |
| 122 | iso_pu_bacteria | 2874131515 | 2874137247 | 133 |
| 123 | iso_pu_bacteria | 2874139085 | 2874141431 | 133 |
| 124 | iso_pu_bacteria | 2874146452 | 2874150981 | 133 |
| 125 | iso_pu_bacteria | 2874155637 | 2874157320 | 133 |
| 126 | iso_pu_bacteria | 2874162495 | 2874163767 | 133 |
| 127 | iso_pu_bacteria | 2874168670 | 2874172574 | 133 |
| 128 | iso_pu_bacteria | 2876363079 | 2876368088 | 133 |
| 129 | iso_pu_bacteria | 2876377896 | 2876385317 | 133 |
| 130 | iso_pu_bacteria | 2876386047 | 2876392719 | 133 |
| 131 | iso_pu_bacteria | 2876392853 | 2876395264 | 133 |
| 132 | iso_pu_bacteria | 2876399893 | 2876405253 | 133 |
| 133 | iso_pu_bacteria | 2876406927 | 2876409340 | 133 |
| 134 | iso_pu_bacteria | 2876413966 | 2876417010 | 133 |
| 135 | iso_pu_bacteria | 2876420981 | 2876427161 | 133 |
| 136 | iso_pu_bacteria | 2878035449 | 2878041576 | 133 |
| 137 | iso_pu_bacteria | 2878730984 | 2878734406 | 133 |
| 138 | iso_pu_bacteria | 2878738818 | 2878743160 | 133 |
| 139 | iso_pu_bacteria | 2878745973 | 2878748821 | 133 |
| 140 | iso_pu_bacteria | 2878753008 | 2878758083 | 133 |
| 141 | iso_pu_bacteria | 2878760144 | 2878764548 | 133 |
| 142 | iso_pu_bacteria | 2878767105 | 2878771649 | 133 |
| 143 | iso_pu_bacteria | 2878774303 | 2878776388 | 133 |
| 144 | iso_pu_bacteria | 2878781027 | 2878782381 | 133 |
| 145 | iso_pu_bacteria | 2878788777 | 2878796103 | 133 |
| 146 | iso_pu_bacteria | 2881147464 | 2881152553 | 133 |
| 147 | iso_pu_bacteria | 2881155292 | 2881155980 | 133 |
| 148 | iso_pu_bacteria | 2881161766 | 2881161791 | 133 |
| 149 | iso_pu_bacteria | 2881845957 | 2881846267 | 133 |
| 150 | iso_pu_bacteria | 2881853255 | 2881859809 | 133 |
| 151 | iso_pu_bacteria | 2881861095 | 2881862930 | 133 |
| 152 | iso_pu_bacteria | 2882632389 | 2882633064 | 133 |
| 153 | iso_pu_bacteria | 2882912400 | 2882916440 | 133 |
| 154 | iso_pu_bacteria | 2883577096 | 2883581695 | 133 |
| 155 | iso_pu_bacteria | 2885305155 | 2885310676 | 133 |
| 156 | iso_pu_bacteria | 2885312484 | 2885317440 | 133 |
| 157 | iso_pu_bacteria | 2885318864 | 2885322432 | 133 |
| 158 | iso_pu_bacteria | 2885334103 | 2885340429 | 133 |
| 159 | iso_pu_bacteria | 2885342637 | 2885344965 | 133 |
| 160 | iso_pu_bacteria | 2885350715 | 2885356348 | 133 |
| 161 | iso_pu_bacteria | 2888337043 | 2888340692 | 133 |
| 162 | iso_pu_bacteria | 2888343758 | 2888347871 | 133 |
| 163 | iso_pu_bacteria | 2888350351 | 2888356888 | 133 |
| 164 | iso_pu_bacteria | 2889010040 | 2889011935 | 133 |
| 165 | iso_pu_bacteria | 2889016732 | 2889023133 | 133 |
| 166 | iso_pu_bacteria | 2894652903 | 2894654240 | 133 |
| 167 | iso_pu_bacteria | 2894772417 | 2894774435 | 133 |
| 168 | iso_pu_bacteria | 2894817345 | 2894818632 | 133 |
| 169 | iso_pu_bacteria | 2903448605 | 2903452108 | 133 |
| 170 | iso_pu_bacteria | 2903492973 | 2903495126 | 133 |
| 171 | iso_pu_bacteria | 2903492973 | 2903496185 | 133 |
| 172 | iso_pu_bacteria | 2903513507 | 2903514953 | 133 |
| 173 | iso_pu_bacteria | 2903521522 | 2903527084 | 133 |
| 174 | iso_pu_bacteria | 2903528002 | 2903533311 | 133 |
| 175 | iso_pu_bacteria | 2903540706 | 2903545272 | 133 |
| 176 | iso_pu_bacteria | 2904578770 | 2904583229 | 133 |
| 177 | iso_pu_bacteria | 2904659560 | 2904661894 | 133 |
| 178 | iso_pu_bacteria | 2906308376 | 2906311173 | 133 |
| 179 | iso_pu_bacteria | 2906321335 | 2906323940 | 133 |
| 180 | iso_pu_bacteria | 2906328253 | 2906328361 | 133 |
| 181 | iso_pu_bacteria | 2906354277 | 2906362585 | 133 |
| 182 | iso_pu_bacteria | 2906363423 | 2906370618 | 133 |
| 183 | iso_pu_bacteria | 2906370794 | 2906374322 | 133 |
| 184 | iso_pu_bacteria | 2906378014 | 2906379241 | 133 |
| 185 | iso_pu_bacteria | 2906386501 | 2906391757 | 133 |
| 186 | iso_pu_bacteria | 2906393657 | 2906398072 | 133 |
| 187 | iso_pu_bacteria | 2906401398 | 2906407938 | 133 |
| 188 | iso_pu_bacteria | 2906408224 | 2906410572 | 133 |
| 189 | iso_pu_bacteria | 2906414383 | 2906416390 | 133 |
| 190 | iso_pu_bacteria | 2906427513 | 2906432079 | 133 |
| 191 | iso_pu_bacteria | 2919119836 | 2919123877 | 133 |
| 192 | iso_pu_bacteria | 2922151315 | 2922154898 | 133 |
| 193 | iso_pu_bacteria | 2922158528 | 2922159633 | 133 |
| 194 | iso_pu_bacteria | 2922172374 | 2922175800 | 133 |
| 195 | iso_pu_bacteria | 2922178524 | 2922182768 | 133 |
| 196 | iso_pu_bacteria | 2922185730 | 2922191544 | 133 |
| 197 | iso_pu_bacteria | 2924710171 | 2924716988 | 133 |
| 198 | iso_pu_bacteria | 2924718760 | 2924725445 | 133 |
| 199 | iso_pu_bacteria | 2924726620 | 2924727278 | 133 |
| 200 | iso_pu_bacteria | 2924733363 | 2924736138 | 133 |
| 201 | iso_pu_bacteria | 2924741084 | 2924744183 | 133 |
| 202 | iso_pu_bacteria | 2924748358 | 2924750381 | 133 |
| 203 | iso_pu_bacteria | 2924754689 | 2924759042 | 133 |
| 204 | iso_pu_bacteria | 2924762789 | 2924763827 | 133 |
| 205 | iso_pu_bacteria | 2924776078 | 2924777274 | 133 |
| 206 | iso_pu_bacteria | 2924784321 | 2924785824 | 133 |
| 207 | iso_pu_bacteria | 2928521798 | 2928524360 | 133 |
| 208 | iso_pu_bacteria | 2937813078 | 2937813394 | 133 |
| 209 | iso_pu_bacteria | 2937822353 | 2937826673 | 133 |
| 210 | iso_pu_bacteria | 2937836603 | 2937839995 | 133 |
| 211 | iso_pu_bacteria | 2937843397 | 2937845877 | 133 |
| 212 | iso_pu_bacteria | 2937848649 | 2937853630 | 133 |
| 213 | iso_pu_bacteria | 2937861824 | 2937864416 | 133 |
| 214 | iso_pu_bacteria | 2937868953 | 2937869772 | 133 |
| 215 | iso_pu_bacteria | 2937877337 | 2937879321 | 133 |
| 216 | iso_pu_bacteria | 2937891427 | 2937898207 | 133 |
| 217 | iso_pu_bacteria | 2937972304 | 2937974945 | 133 |
| 218 | iso_pu_bacteria | 2937980651 | 2937988341 | 133 |
| 219 | iso_pu_bacteria | 2937994558 | 2937999122 | 133 |
| 220 | iso_pu_bacteria | 2938014810 | 2938019869 | 133 |
| 221 | iso_pu_bacteria | 2939669807 | 2939671386 | 133 |
| 222 | iso_pu_bacteria | 2954011201 | 2954015364 | 133 |
| 223 | iso_pu_bacteria | 2958034702 | 2958036864 | 133 |
| 224 | iso_pu_bacteria | 2958041894 | 2958050486 | 133 |
| 225 | iso_pu_bacteria | 2958064165 | 2958070268 | 133 |
| 226 | iso_pu_bacteria | 2958071322 | 2958072566 | 133 |
| 227 | iso_pu_bacteria | 2958084443 | 2958086496 | 133 |
| 228 | iso_pu_bacteria | 2958092219 | 2958100701 | 133 |
| 229 | iso_pu_bacteria | 2958100919 | 2958101582 | 133 |
| 230 | iso_pu_bacteria | 2958108152 | 2958110473 | 133 |
| 231 | iso_pu_bacteria | 2958115193 | 2958122497 | 133 |
| 232 | iso_pu_bacteria | 2958122699 | 2958130102 | 133 |
| 233 | iso_pu_bacteria | 2958130278 | 2958132794 | 133 |
| 234 | iso_pu_bacteria | 2958137437 | 2958142866 | 133 |
| 235 | iso_pu_bacteria | 2958144490 | 2958145625 | 133 |
| 236 | iso_pu_bacteria | 2958158011 | 2958162966 | 133 |
| 237 | iso_pu_bacteria | 2958165035 | 2958169596 | 133 |
| 238 | iso_pu_bacteria | 2958179912 | 2958182926 | 133 |
| 239 | iso_pu_bacteria | 2961077736 | 2961080806 | 133 |
| 240 | iso_pu_bacteria | 2961114664 | 2961117047 | 133 |
| 241 | iso_pu_bacteria | 2961127735 | 2961133188 | 133 |
| 242 | iso_pu_bacteria | 2961136820 | 2961139066 | 133 |
| 243 | iso_pu_bacteria | 2961163497 | 2961168056 | 133 |
| 244 | iso_pu_bacteria | 2961170736 | 2961174713 | 133 |
| 245 | iso_pu_bacteria | 2961183825 | 2961186459 | 133 |
| 246 | iso_pu_bacteria | 2963644680 | 2963648661 | 133 |
| 247 | iso_pu_bacteria | 2965018300 | 2965022875 | 133 |
| 248 | iso_pu_bacteria | 2965025482 | 2965027340 | 133 |
| 249 | iso_pu_bacteria | 2965040258 | 2965040812 | 133 |
| 250 | iso_pu_bacteria | 2965047637 | 2965050116 | 133 |
| 251 | iso_pu_bacteria | 2965062239 | 2965066165 | 133 |
| 252 | iso_pu_bacteria | 2965089291 | 2965091045 | 133 |
| 253 | iso_pu_bacteria | 2965102966 | 2965109557 | 133 |
| 254 | iso_pu_bacteria | 2965110997 | 2965118068 | 133 |
| 255 | iso_pu_bacteria | 2965119406 | 2965122192 | 133 |
| 256 | iso_pu_bacteria | 2967996073 | 2968000648 | 133 |
| 257 | iso_pu_bacteria | 2968003550 | 2968009979 | 133 |
| 258 | iso_pu_bacteria | 2968016561 | 2968017461 | 133 |
| 259 | iso_pu_bacteria | 2968083720 | 2968083888 | 133 |
| 260 | iso_pu_bacteria | 2968091066 | 2968092503 | 133 |
| 261 | iso_pu_bacteria | 2968097103 | 2968102409 | 133 |
| 262 | iso_pu_bacteria | 2968110612 | 2968112955 | 133 |
| 263 | iso_pu_bacteria | 2968117919 | 2968122812 | 133 |
| 264 | iso_pu_bacteria | 2968128360 | 2968128766 | 133 |
| 265 | iso_pu_bacteria | 2968171901 | 2968176456 | 133 |
| 266 | iso_pu_bacteria | 2970469710 | 2970472363 | 133 |
| 267 | iso_pu_bacteria | 2970489779 | 2970490910 | 133 |
| 268 | iso_pu_bacteria | 2970503327 | 2970507299 | 133 |
| 269 | iso_pu_bacteria | 2970510686 | 2970513852 | 133 |
| 270 | iso_pu_bacteria | 2970524798 | 2970530012 | 133 |
| 271 | iso_pu_bacteria | 2970532167 | 2970538246 | 133 |
| 272 | iso_pu_bacteria | 2970547951 | 2970548663 | 133 |
| 273 | iso_pu_bacteria | 2970554993 | 2970559395 | 133 |
| 274 | iso_pu_bacteria | 2970593180 | 2970595505 | 133 |
| 275 | iso_pu_bacteria | 2970619444 | 2970620321 | 133 |
| 276 | iso_pu_bacteria | 2970627176 | 2970631995 | 133 |
| 277 | iso_pu_bacteria | 2977821940 | 2977828843 | 133 |
| 278 | iso_pu_bacteria | 2977828996 | 2977829834 | 133 |
| 279 | iso_pu_bacteria | 2977843712 | 2977845394 | 133 |
| 280 | iso_pu_bacteria | 2977851361 | 2977851791 | 133 |
| 281 | iso_pu_bacteria | 2977858184 | 2977860266 | 133 |
| 282 | iso_pu_bacteria | 2977864932 | 2977871958 | 133 |
| 283 | iso_pu_bacteria | 2977872689 | 2977877374 | 133 |
| 284 | iso_pu_bacteria | 2977898635 | 2977906636 | 133 |
| 285 | iso_pu_bacteria | 2977907340 | 2977911818 | 133 |
| 286 | iso_pu_bacteria | 2977915119 | 2977917214 | 133 |
| 287 | iso_pu_bacteria | 2977922695 | 2977928127 | 133 |
| 288 | iso_pu_bacteria | 2977935797 | 2977939440 | 133 |
| 289 | iso_pu_bacteria | 2977942078 | 2977946927 | 133 |
| 290 | iso_pu_bacteria | 2977950692 | 2977951362 | 133 |
| 291 | iso_pu_bacteria | 2977957713 | 2977958673 | 133 |
| 292 | iso_pu_bacteria | 2977971508 | 2977976590 | 133 |
| 293 | iso_pu_bacteria | 2977986579 | 2977989487 | 133 |
| 294 | iso_pu_bacteria | 2979710463 | 2979716964 | 133 |
| 295 | iso_pu_bacteria | 2979742915 | 2979743187 | 133 |
| 296 | iso_pu_bacteria | 2979764755 | 2979765765 | 133 |
| 297 | iso_pu_bacteria | 2979772303 | 2979777661 | 133 |
| 298 | iso_pu_bacteria | 2979779861 | 2979783038 | 133 |
| 299 | iso_pu_bacteria | 2979793036 | 2979798556 | 133 |
| 300 | iso_pu_bacteria | 2979808191 | 2979812495 | 133 |
| 301 | iso_pu_bacteria | 2987636660 | 2987640721 | 133 |
| 302 | iso_pu_bacteria | 2987645492 | 2987647818 | 133 |
| 303 | iso_pu_bacteria | 2987652177 | 2987652489 | 133 |
| 304 | iso_pu_bacteria | 2987659509 | 2987664070 | 133 |
| 305 | iso_pu_bacteria | 2987666974 | 2987670295 | 133 |
| 306 | iso_pu_bacteria | 2987673487 | 2987674289 | 133 |
| 307 | iso_pu_bacteria | 2996310559 | 2996310956 | 133 |
| 308 | iso_pu_bacteria | 2996336353 | 2996340571 | 133 |
| 309 | iso_pu_bacteria | 2996341866 | 2996347148 | 133 |
| 310 | iso_pu_bacteria | 2996348954 | 2996351234 | 133 |
| 311 | iso_pu_bacteria | 2996386984 | 2996390911 | 133 |
| 312 | iso_pu_bacteria | 3000135777 | 3000136170 | 133 |
| 313 | iso_pu_bacteria | 3002141150 | 3002143945 | 133 |
| 314 | iso_pu_bacteria | 3004167301 | 3004170188 | 133 |
| 315 | iso_pu_bacteria | 3004188549 | 3004193125 | 133 |
| 316 | iso_pu_bacteria | 3004195979 | 3004197764 | 133 |
| 317 | iso_pu_bacteria | 3004203850 | 3004208918 | 133 |
| 318 | iso_pu_bacteria | 3004211236 | 3004213104 | 133 |
| 319 | iso_pu_bacteria | 3004218560 | 3004222133 | 133 |
| 320 | iso_pu_bacteria | 3004232784 | 3004239288 | 133 |
| 321 | iso_pu_bacteria | 3004239961 | 3004242910 | 133 |
| 322 | iso_pu_bacteria | 3004268573 | 3004273806 | 133 |
| 323 | iso_pu_bacteria | 3004275668 | 3004277932 | 133 |
| 324 | iso_pu_bacteria | 3004289098 | 3004290233 | 133 |
| 325 | iso_pu_bacteria | 3004334049 | 3004340242 | 133 |
| 326 | iso_pu_bacteria | 637000159 | 637073561 | 133 |
| 327 | iso_pu_bacteria | 643348564 | 643599650 | 133 |
| 328 | iso_pu_bacteria | 649633066 | 649873497 | 133 |
| 329 | iso_pu_bacteria | 8002285264 | 8002285922 | 133 |
| 330 | iso_pu_bacteria | 8004300914 | 8004304428 | 133 |
| 331 | iso_pu_bacteria | 8004312739 | 8004316469 | 133 |
| 332 | iso_pu_bacteria | 8004361976 | 8004366439 | 133 |
| 333 | iso_pu_bacteria | 8004374579 | 8004379595 | 133 |
| 334 | iso_pu_bacteria | 8004387939 | 8004390924 | 133 |
| 335 | iso_pu_bacteria | 8004395343 | 8004402340 | 133 |
| 336 | iso_pu_bacteria | 8004445564 | 8004451616 | 133 |
| 337 | iso_pu_bacteria | 8004633249 | 8004638921 | 133 |
| 338 | iso_pu_bacteria | 8004640170 | 8004643107 | 133 |
| 339 | iso_pu_bacteria | 8004695233 | 8004701073 | 133 |
| 340 | iso_pu_bacteria | 8004703790 | 8004714457 | 133 |
| 341 | iso_pu_bacteria | 8004714634 | 8004717476 | 133 |
| 342 | iso_pu_bacteria | 8004727605 | 8004731772 | 133 |
| 343 | iso_pu_bacteria | 8055617313 | 8055622004 | 133 |
| 344 | 3300009174 | Ga0105241_10295719 | Ga0105241_102957193 | 135 |
| 345 | 3300026142 | Ga0207698_12096819 | Ga0207698_120968192 | 135 |
| 346 | 3300060353 | Ga0501082_0227328 | Ga0501082_0227328_772_1182 | 135 |
| 347 | 3300005434 | Ga0070709_10053418 | Ga0070709_100534186 | 136 |
| 348 | 3300005435 | Ga0070714_101275745 | Ga0070714_1012757452 | 136 |
| 349 | 3300006042 | Ga0075368_10408645 | Ga0075368_104086451 | 136 |
| 350 | 3300012510 | Ga0157316_1041297 | Ga0157316_10412972 | 136 |
| 351 | 3300013306 | Ga0163162_10641078 | Ga0163162_106410782 | 136 |
| 352 | 3300014968 | Ga0157379_10010518 | Ga0157379_100105184 | 136 |
| 353 | 3300021441 | Ga0213871_10286220 | Ga0213871_102862202 | 136 |
| 354 | 3300025906 | Ga0207699_10645453 | Ga0207699_106454532 | 136 |
| 355 | 3300025929 | Ga0207664_10260683 | Ga0207664_102606833 | 136 |
| 356 | 3300028800 | Ga0265338_10340294 | Ga0265338_103402942 | 136 |
| 357 | 3300031241 | Ga0265325_10142648 | Ga0265325_101426482 | 136 |
| 358 | 3300031241 | Ga0265325_10436815 | Ga0265325_104368152 | 136 |
| 359 | 3300031242 | Ga0265329_10129057 | Ga0265329_101290572 | 136 |
| 360 | 3300031249 | Ga0265339_10038285 | Ga0265339_100382852 | 136 |
| 361 | 3300031250 | Ga0265331_10016180 | Ga0265331_100161809 | 136 |
| 362 | 3300031344 | Ga0265316_10076581 | Ga0265316_100765816 | 136 |
| 363 | 3300031548 | Ga0307408_100447469 | Ga0307408_1004474693 | 136 |
| 364 | 3300031595 | Ga0265313_10031690 | Ga0265313_100316902 | 136 |
| 365 | 3300031711 | Ga0265314_10084434 | Ga0265314_100844344 | 136 |
| 366 | 3300031712 | Ga0265342_10107995 | Ga0265342_101079952 | 136 |
| 367 | 3300031852 | Ga0307410_10088224 | Ga0307410_100882241 | 136 |
| 368 | 3300031901 | Ga0307406_10443616 | Ga0307406_104436163 | 136 |
| 369 | 3300031911 | Ga0307412_10030283 | Ga0307412_100302833 | 136 |
| 370 | 3300031995 | Ga0307409_100845007 | Ga0307409_1008450072 | 136 |
| 371 | 3300032126 | Ga0307415_100371306 | Ga0307415_1003713062 | 136 |
| 372 | 3300035172 | Ga0373955_0303048 | Ga0373955_0303048_489_902 | 136 |
| 373 | 3300036401 | Ga0373937_0025062 | Ga0373937_0025062_4426_4839 | 136 |
| 374 | 3300037853 | Ga0436364_0697961 | Ga0436364_0697961_565_975 | 136 |
| 375 | 3300039437 | Ga0436365_0973027 | Ga0436365_0973027_402_812 | 136 |
| 376 | 3300039453 | Ga0436362_1210898 | Ga0436362_1210898_221_634 | 136 |
| 377 | 3300046462 | Ga0495651_0323475 | Ga0495651_0323475_469_882 | 136 |
| 378 | 3300046516 | Ga0495628_0398834 | Ga0495628_0398834_287_700 | 136 |
| 379 | 3300046557 | Ga0495622_0354651 | Ga0495622_0354651_124_540 | 136 |
| 380 | 3300046678 | Ga0495599_0319617 | Ga0495599_0319617_236_649 | 136 |
| 381 | 3300048921 | Ga0496118_0142522 | Ga0496118_0142522_905_1315 | 136 |
| 382 | 3300048927 | Ga0496124_0095308 | Ga0496124_0095308_1442_1852 | 136 |
| 383 | 3300049568 | Ga0501031_0010832 | Ga0501031_0010832_1432_1848 | 136 |
| 384 | 3300049569 | Ga0501032_0051001 | Ga0501032_0051001_165_581 | 136 |
| 385 | 3300049570 | Ga0501033_0004963 | Ga0501033_0004963_5061_5477 | 136 |
| 386 | 3300049572 | Ga0501036_0186938 | Ga0501036_0186938_990_1406 | 136 |
| 387 | 3300049572 | Ga0501036_1004012 | Ga0501036_1004012_86_496 | 136 |
| 388 | 3300049573 | Ga0501037_0003453 | Ga0501037_0003453_2013_2429 | 136 |
| 389 | 3300049574 | Ga0501038_0216147 | Ga0501038_0216147_927_1343 | 136 |
| 390 | 3300049575 | Ga0501039_0054344 | Ga0501039_0054344_238_654 | 136 |
| 391 | 3300049578 | Ga0501042_0915857 | Ga0501042_0915857_43_453 | 136 |
| 392 | 3300049579 | Ga0501043_0007495 | Ga0501043_0007495_5893_6309 | 136 |
| 393 | 3300049581 | Ga0501047_0009718 | Ga0501047_0009718_935_1351 | 136 |
| 394 | 3300049581 | Ga0501047_0757346 | Ga0501047_0757346_265_681 | 136 |
| 395 | 3300049582 | Ga0501048_0793705 | Ga0501048_0793705_234_650 | 136 |
| 396 | 3300049822 | Ga0501035_0022027 | Ga0501035_0022027_999_1415 | 136 |
| 397 | 3300049823 | Ga0501044_0076702 | Ga0501044_0076702_307_723 | 136 |
| 398 | 3300049824 | Ga0501045_1337791 | Ga0501045_1337791_68_478 | 136 |
| 399 | 3300050492 | nmdc:mga0yw44_755433_c1 | nmdc:mga0yw44_755433_c1_112_522 | 136 |
| 400 | 3300053150 | Ga0500603_022818 | Ga0500603_022818_1087_1497 | 136 |
| 401 | 3300061719 | Ga0466962_0322552 | Ga0466962_0322552_307_717 | 136 |
| 402 | 3300001979 | JGI24740J21852_10011508 | JGI24740J21852_100115084 | 137 |
| 403 | 3300001989 | JGI24739J22299_10011564 | JGI24739J22299_100115643 | 137 |
| 404 | 3300001989 | JGI24739J22299_10023219 | JGI24739J22299_100232193 | 137 |
| 405 | 3300001990 | JGI24737J22298_10065756 | JGI24737J22298_100657563 | 137 |
| 406 | 3300002705 | JGI25156J39149_1004694 | JGI25156J39149_10046949 | 137 |
| 407 | 3300002741 | JGI25157J39369_1002241 | JGI25157J39369_10022412 | 137 |
| 408 | 3300003203 | JGI25406J46586_10001918 | JGI25406J46586_1000191813 | 137 |
| 409 | 3300003214 | JGI25165J46597_1001303 | JGI25165J46597_100130318 | 137 |
| 410 | 3300003762 | Ga0055542_1002774 | Ga0055542_10027749 | 137 |
| 411 | 3300003763 | Ga0055529_1005671 | Ga0055529_10056712 | 137 |
| 412 | 3300005327 | Ga0070658_10183900 | Ga0070658_101839002 | 137 |
| 413 | 3300005328 | Ga0070676_10143888 | Ga0070676_101438884 | 137 |
| 414 | 3300005334 | Ga0068869_100096159 | Ga0068869_1000961594 | 137 |
| 415 | 3300005334 | Ga0068869_101231623 | Ga0068869_1012316232 | 137 |
| 416 | 3300005335 | Ga0070666_10089881 | Ga0070666_100898816 | 137 |
| 417 | 3300005337 | Ga0070682_100255530 | Ga0070682_1002555302 | 137 |
| 418 | 3300005337 | Ga0070682_101760505 | Ga0070682_1017605051 | 137 |
| 419 | 3300005338 | Ga0068868_100073957 | Ga0068868_1000739572 | 137 |
| 420 | 3300005338 | Ga0068868_101574763 | Ga0068868_1015747631 | 137 |
| 421 | 3300005339 | Ga0070660_100981005 | Ga0070660_1009810051 | 137 |
| 422 | 3300005340 | Ga0070689_100111476 | Ga0070689_1001114763 | 137 |
| 423 | 3300005343 | Ga0070687_100094508 | Ga0070687_1000945081 | 137 |
| 424 | 3300005344 | Ga0070661_100021028 | Ga0070661_1000210283 | 137 |
| 425 | 3300005344 | Ga0070661_100049078 | Ga0070661_1000490785 | 137 |
| 426 | 3300005354 | Ga0070675_100203748 | Ga0070675_1002037482 | 137 |
| 427 | 3300005354 | Ga0070675_100559861 | Ga0070675_1005598612 | 137 |
| 428 | 3300005354 | Ga0070675_100763812 | Ga0070675_1007638121 | 137 |
| 429 | 3300005355 | Ga0070671_100280251 | Ga0070671_1002802511 | 137 |
| 430 | 3300005356 | Ga0070674_100294493 | Ga0070674_1002944933 | 137 |
| 431 | 3300005364 | Ga0070673_100326000 | Ga0070673_1003260003 | 137 |
| 432 | 3300005365 | Ga0070688_100209230 | Ga0070688_1002092303 | 137 |
| 433 | 3300005365 | Ga0070688_100394795 | Ga0070688_1003947952 | 137 |
| 434 | 3300005366 | Ga0070659_100338681 | Ga0070659_1003386812 | 137 |
| 435 | 3300005366 | Ga0070659_100689668 | Ga0070659_1006896682 | 137 |
| 436 | 3300005367 | Ga0070667_100277362 | Ga0070667_1002773622 | 137 |
| 437 | 3300005434 | Ga0070709_10020478 | Ga0070709_100204787 | 137 |
| 438 | 3300005435 | Ga0070714_100333680 | Ga0070714_1003336803 | 137 |
| 439 | 3300005435 | Ga0070714_100851782 | Ga0070714_1008517822 | 137 |
| 440 | 3300005436 | Ga0070713_100054584 | Ga0070713_1000545848 | 137 |
| 441 | 3300005436 | Ga0070713_101421033 | Ga0070713_1014210331 | 137 |
| 442 | 3300005437 | Ga0070710_10072682 | Ga0070710_100726823 | 137 |
| 443 | 3300005440 | Ga0070705_100594703 | Ga0070705_1005947031 | 137 |
| 444 | 3300005455 | Ga0070663_100031905 | Ga0070663_1000319053 | 137 |
| 445 | 3300005455 | Ga0070663_100105054 | Ga0070663_1001050545 | 137 |
| 446 | 3300005455 | Ga0070663_100151353 | Ga0070663_1001513532 | 137 |
| 447 | 3300005455 | Ga0070663_101334560 | Ga0070663_1013345601 | 137 |
| 448 | 3300005456 | Ga0070678_101419075 | Ga0070678_1014190751 | 137 |
| 449 | 3300005456 | Ga0070678_101904622 | Ga0070678_1019046221 | 137 |
| 450 | 3300005457 | Ga0070662_100137792 | Ga0070662_1001377925 | 137 |
| 451 | 3300005458 | Ga0070681_10742830 | Ga0070681_107428302 | 137 |
| 452 | 3300005471 | Ga0070698_100134303 | Ga0070698_1001343035 | 137 |
| 453 | 3300005530 | Ga0070679_100469604 | Ga0070679_1004696042 | 137 |
| 454 | 3300005535 | Ga0070684_101259428 | Ga0070684_1012594281 | 137 |
| 455 | 3300005535 | Ga0070684_101272144 | Ga0070684_1012721441 | 137 |
| 456 | 3300005536 | Ga0070697_100657013 | Ga0070697_1006570132 | 137 |
| 457 | 3300005539 | Ga0068853_100000888 | Ga0068853_10000088810 | 137 |
| 458 | 3300005539 | Ga0068853_100269462 | Ga0068853_1002694622 | 137 |
| 459 | 3300005539 | Ga0068853_100445767 | Ga0068853_1004457672 | 137 |
| 460 | 3300005548 | Ga0070665_100006166 | Ga0070665_10000616610 | 137 |
| 461 | 3300005548 | Ga0070665_100319540 | Ga0070665_1003195403 | 137 |
| 462 | 3300005563 | Ga0068855_100132159 | Ga0068855_1001321593 | 137 |
| 463 | 3300005563 | Ga0068855_100326596 | Ga0068855_1003265961 | 137 |
| 464 | 3300005563 | Ga0068855_100420269 | Ga0068855_1004202692 | 137 |
| 465 | 3300005563 | Ga0068855_101424104 | Ga0068855_1014241042 | 137 |
| 466 | 3300005564 | Ga0070664_100552558 | Ga0070664_1005525582 | 137 |
| 467 | 3300005577 | Ga0068857_100458367 | Ga0068857_1004583672 | 137 |
| 468 | 3300005577 | Ga0068857_100559042 | Ga0068857_1005590423 | 137 |
| 469 | 3300005577 | Ga0068857_100904146 | Ga0068857_1009041462 | 137 |
| 470 | 3300005578 | Ga0068854_100225910 | Ga0068854_1002259101 | 137 |
| 471 | 3300005578 | Ga0068854_100354078 | Ga0068854_1003540782 | 137 |
| 472 | 3300005614 | Ga0068856_100081776 | Ga0068856_1000817765 | 137 |
| 473 | 3300005614 | Ga0068856_100114919 | Ga0068856_1001149192 | 137 |
| 474 | 3300005614 | Ga0068856_100352912 | Ga0068856_1003529124 | 137 |
| 475 | 3300005614 | Ga0068856_101663352 | Ga0068856_1016633522 | 137 |
| 476 | 3300005616 | Ga0068852_100009612 | Ga0068852_10000961214 | 137 |
| 477 | 3300005616 | Ga0068852_100016813 | Ga0068852_1000168133 | 137 |
| 478 | 3300005616 | Ga0068852_100026746 | Ga0068852_1000267464 | 137 |
| 479 | 3300005616 | Ga0068852_100285464 | Ga0068852_1002854643 | 137 |
| 480 | 3300005719 | Ga0068861_100051723 | Ga0068861_1000517232 | 137 |
| 481 | 3300005719 | Ga0068861_100790679 | Ga0068861_1007906792 | 137 |
| 482 | 3300005834 | Ga0068851_10011945 | Ga0068851_100119453 | 137 |
| 483 | 3300005834 | Ga0068851_10129488 | Ga0068851_101294882 | 137 |
| 484 | 3300005834 | Ga0068851_10967984 | Ga0068851_109679841 | 137 |
| 485 | 3300005842 | Ga0068858_100277785 | Ga0068858_1002777855 | 137 |
| 486 | 3300005842 | Ga0068858_100376245 | Ga0068858_1003762453 | 137 |
| 487 | 3300005844 | Ga0068862_100150751 | Ga0068862_1001507516 | 137 |
| 488 | 3300005844 | Ga0068862_100593448 | Ga0068862_1005934482 | 137 |
| 489 | 3300005937 | Ga0081455_10012098 | Ga0081455_1001209810 | 137 |
| 490 | 3300005937 | Ga0081455_10046763 | Ga0081455_1004676310 | 137 |
| 491 | 3300005937 | Ga0081455_10127650 | Ga0081455_101276505 | 137 |
| 492 | 3300005983 | Ga0081540_1002663 | Ga0081540_100266311 | 137 |
| 493 | 3300005983 | Ga0081540_1016488 | Ga0081540_10164885 | 137 |
| 494 | 3300005983 | Ga0081540_1089513 | Ga0081540_10895134 | 137 |
| 495 | 3300005985 | Ga0081539_10000072 | Ga0081539_1000007210 | 137 |
| 496 | 3300005985 | Ga0081539_10004419 | Ga0081539_1000441910 | 137 |
| 497 | 3300005985 | Ga0081539_10019248 | Ga0081539_100192482 | 137 |
| 498 | 3300006028 | Ga0070717_10577894 | Ga0070717_105778941 | 137 |
| 499 | 3300006028 | Ga0070717_10859221 | Ga0070717_108592212 | 137 |
| 500 | 3300006038 | Ga0075365_10069048 | Ga0075365_100690481 | 137 |
| 501 | 3300006038 | Ga0075365_10170405 | Ga0075365_101704052 | 137 |
| 502 | 3300006038 | Ga0075365_10422342 | Ga0075365_104223421 | 137 |
| 503 | 3300006038 | Ga0075365_10741750 | Ga0075365_107417502 | 137 |
| 504 | 3300006038 | Ga0075365_11168730 | Ga0075365_111687301 | 137 |
| 505 | 3300006042 | Ga0075368_10166398 | Ga0075368_101663981 | 137 |
| 506 | 3300006042 | Ga0075368_10203166 | Ga0075368_102031661 | 137 |
| 507 | 3300006042 | Ga0075368_10364533 | Ga0075368_103645331 | 137 |
| 508 | 3300006048 | Ga0075363_100004858 | Ga0075363_1000048587 | 137 |
| 509 | 3300006048 | Ga0075363_100422880 | Ga0075363_1004228802 | 137 |
| 510 | 3300006048 | Ga0075363_100565768 | Ga0075363_1005657682 | 137 |
| 511 | 3300006173 | Ga0070716_100118595 | Ga0070716_1001185952 | 137 |
| 512 | 3300006175 | Ga0070712_100020783 | Ga0070712_1000207832 | 137 |
| 513 | 3300006175 | Ga0070712_100507373 | Ga0070712_1005073734 | 137 |
| 514 | 3300006175 | Ga0070712_101750514 | Ga0070712_1017505141 | 137 |
| 515 | 3300006177 | Ga0075362_10004861 | Ga0075362_100048612 | 137 |
| 516 | 3300006177 | Ga0075362_10014057 | Ga0075362_100140578 | 137 |
| 517 | 3300006177 | Ga0075362_10310555 | Ga0075362_103105552 | 137 |
| 518 | 3300006178 | Ga0075367_10148470 | Ga0075367_101484701 | 137 |
| 519 | 3300006178 | Ga0075367_10183139 | Ga0075367_101831392 | 137 |
| 520 | 3300006178 | Ga0075367_10421671 | Ga0075367_104216712 | 137 |
| 521 | 3300006178 | Ga0075367_10421684 | Ga0075367_104216842 | 137 |
| 522 | 3300006178 | Ga0075367_10875772 | Ga0075367_108757721 | 137 |
| 523 | 3300006186 | Ga0075369_10108834 | Ga0075369_101088342 | 137 |
| 524 | 3300006186 | Ga0075369_10139127 | Ga0075369_101391273 | 137 |
| 525 | 3300006186 | Ga0075369_10178884 | Ga0075369_101788842 | 137 |
| 526 | 3300006237 | Ga0097621_100769182 | Ga0097621_1007691822 | 137 |
| 527 | 3300006353 | Ga0075370_10003104 | Ga0075370_1000310410 | 137 |
| 528 | 3300006353 | Ga0075370_10176245 | Ga0075370_101762452 | 137 |
| 529 | 3300006358 | Ga0068871_100580240 | Ga0068871_1005802402 | 137 |
| 530 | 3300006846 | Ga0075430_100000605 | Ga0075430_1000006052 | 137 |
| 531 | 3300006871 | Ga0075434_101003988 | Ga0075434_1010039882 | 137 |
| 532 | 3300006881 | Ga0068865_100104366 | Ga0068865_1001043662 | 137 |
| 533 | 3300006931 | Ga0097620_100592678 | Ga0097620_1005926782 | 137 |
| 534 | 3300009093 | Ga0105240_10568612 | Ga0105240_105686122 | 137 |
| 535 | 3300009093 | Ga0105240_10747556 | Ga0105240_107475562 | 137 |
| 536 | 3300009098 | Ga0105245_10469358 | Ga0105245_104693582 | 137 |
| 537 | 3300009098 | Ga0105245_10731578 | Ga0105245_107315781 | 137 |
| 538 | 3300009098 | Ga0105245_10845108 | Ga0105245_108451082 | 137 |
| 539 | 3300009098 | Ga0105245_11455164 | Ga0105245_114551642 | 137 |
| 540 | 3300009101 | Ga0105247_10190156 | Ga0105247_101901563 | 137 |
| 541 | 3300009147 | Ga0114129_12169584 | Ga0114129_121695842 | 137 |
| 542 | 3300009147 | Ga0114129_12766950 | Ga0114129_127669501 | 137 |
| 543 | 3300009148 | Ga0105243_10119606 | Ga0105243_101196063 | 137 |
| 544 | 3300009148 | Ga0105243_11676020 | Ga0105243_116760202 | 137 |
| 545 | 3300009174 | Ga0105241_10040943 | Ga0105241_100409433 | 137 |
| 546 | 3300009174 | Ga0105241_10196158 | Ga0105241_101961584 | 137 |
| 547 | 3300009174 | Ga0105241_10256290 | Ga0105241_102562904 | 137 |
| 548 | 3300009174 | Ga0105241_11044501 | Ga0105241_110445012 | 137 |
| 549 | 3300009176 | Ga0105242_10064140 | Ga0105242_100641402 | 137 |
| 550 | 3300009545 | Ga0105237_10332155 | Ga0105237_103321554 | 137 |
| 551 | 3300009545 | Ga0105237_10586873 | Ga0105237_105868732 | 137 |
| 552 | 3300009545 | Ga0105237_10640967 | Ga0105237_106409672 | 137 |
| 553 | 3300009551 | Ga0105238_10012597 | Ga0105238_100125976 | 137 |
| 554 | 3300009551 | Ga0105238_10060184 | Ga0105238_100601848 | 137 |
| 555 | 3300009551 | Ga0105238_10290940 | Ga0105238_102909402 | 137 |
| 556 | 3300009551 | Ga0105238_10709028 | Ga0105238_107090282 | 137 |
| 557 | 3300009553 | Ga0105249_10525741 | Ga0105249_105257412 | 137 |
| 558 | 3300010375 | Ga0105239_10039505 | Ga0105239_100395054 | 137 |
| 559 | 3300010375 | Ga0105239_11270276 | Ga0105239_112702761 | 137 |
| 560 | 3300010375 | Ga0105239_11393482 | Ga0105239_113934822 | 137 |
| 561 | 3300011119 | Ga0105246_10114713 | Ga0105246_101147134 | 137 |
| 562 | 3300011119 | Ga0105246_10897680 | Ga0105246_108976803 | 137 |
| 563 | 3300012494 | Ga0157341_1047504 | Ga0157341_10475041 | 137 |
| 564 | 3300013100 | Ga0157373_10346246 | Ga0157373_103462462 | 137 |
| 565 | 3300013102 | Ga0157371_10043166 | Ga0157371_100431664 | 137 |
| 566 | 3300013102 | Ga0157371_10340940 | Ga0157371_103409403 | 137 |
| 567 | 3300013104 | Ga0157370_10033885 | Ga0157370_100338858 | 137 |
| 568 | 3300013104 | Ga0157370_10353884 | Ga0157370_103538842 | 137 |
| 569 | 3300013104 | Ga0157370_10710963 | Ga0157370_107109632 | 137 |
| 570 | 3300013104 | Ga0157370_11317979 | Ga0157370_113179792 | 137 |
| 571 | 3300013104 | Ga0157370_11550645 | Ga0157370_115506451 | 137 |
| 572 | 3300013105 | Ga0157369_10038065 | Ga0157369_100380652 | 137 |
| 573 | 3300013105 | Ga0157369_10687854 | Ga0157369_106878542 | 137 |
| 574 | 3300013105 | Ga0157369_10855454 | Ga0157369_108554542 | 137 |
| 575 | 3300013296 | Ga0157374_11004771 | Ga0157374_110047711 | 137 |
| 576 | 3300013296 | Ga0157374_11251300 | Ga0157374_112513001 | 137 |
| 577 | 3300013296 | Ga0157374_12366819 | Ga0157374_123668191 | 137 |
| 578 | 3300013297 | Ga0157378_10244775 | Ga0157378_102447753 | 137 |
| 579 | 3300013297 | Ga0157378_10273543 | Ga0157378_102735432 | 137 |
| 580 | 3300013306 | Ga0163162_10155250 | Ga0163162_101552502 | 137 |
| 581 | 3300013307 | Ga0157372_10064075 | Ga0157372_100640751 | 137 |
| 582 | 3300013307 | Ga0157372_10290744 | Ga0157372_102907442 | 137 |
| 583 | 3300013307 | Ga0157372_12852140 | Ga0157372_128521402 | 137 |
| 584 | 3300013308 | Ga0157375_10172923 | Ga0157375_101729232 | 137 |
| 585 | 3300014325 | Ga0163163_10072147 | Ga0163163_100721474 | 137 |
| 586 | 3300014325 | Ga0163163_11564471 | Ga0163163_115644712 | 137 |
| 587 | 3300014326 | Ga0157380_10499816 | Ga0157380_104998162 | 137 |
| 588 | 3300014326 | Ga0157380_12037108 | Ga0157380_120371082 | 137 |
| 589 | 3300014326 | Ga0157380_12510298 | Ga0157380_125102982 | 137 |
| 590 | 3300014326 | Ga0157380_12758068 | Ga0157380_127580681 | 137 |
| 591 | 3300014326 | Ga0157380_12766867 | Ga0157380_127668672 | 137 |
| 592 | 3300014497 | Ga0182008_10119741 | Ga0182008_101197411 | 137 |
| 593 | 3300014497 | Ga0182008_10149116 | Ga0182008_101491164 | 137 |
| 594 | 3300014745 | Ga0157377_10331116 | Ga0157377_103311162 | 137 |
| 595 | 3300014745 | Ga0157377_10826117 | Ga0157377_108261172 | 137 |
| 596 | 3300015261 | Ga0182006_1031634 | Ga0182006_10316346 | 137 |
| 597 | 3300015261 | Ga0182006_1126984 | Ga0182006_11269842 | 137 |
| 598 | 3300015265 | Ga0182005_1002173 | Ga0182005_100217315 | 137 |
| 599 | 3300015265 | Ga0182005_1041026 | Ga0182005_10410261 | 137 |
| 600 | 3300017792 | Ga0163161_10407732 | Ga0163161_104077322 | 137 |
| 601 | 3300017792 | Ga0163161_11253125 | Ga0163161_112531252 | 137 |
| 602 | 3300021358 | Ga0213873_10008313 | Ga0213873_100083132 | 137 |
| 603 | 3300021358 | Ga0213873_10011514 | Ga0213873_100115141 | 137 |
| 604 | 3300021377 | Ga0213874_10003891 | Ga0213874_100038915 | 137 |
| 605 | 3300021377 | Ga0213874_10018746 | Ga0213874_100187463 | 137 |
| 606 | 3300021384 | Ga0213876_10235011 | Ga0213876_102350112 | 137 |
| 607 | 3300021388 | Ga0213875_10080749 | Ga0213875_100807492 | 137 |
| 608 | 3300021441 | Ga0213871_10098758 | Ga0213871_100987581 | 137 |
| 609 | 3300022467 | Ga0224712_10023834 | Ga0224712_100238345 | 137 |
| 610 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002472 | 137 |
| 611 | 3300025253 | Ga0209677_100816 | Ga0209677_1008168 | 137 |
| 612 | 3300025254 | Ga0209148_1000038 | Ga0209148_100003877 | 137 |
| 613 | 3300025256 | Ga0209759_1000119 | Ga0209759_100011910 | 137 |
| 614 | 3300025261 | Ga0209233_1000188 | Ga0209233_100018850 | 137 |
| 615 | 3300025261 | Ga0209233_1029680 | Ga0209233_10296802 | 137 |
| 616 | 3300025272 | Ga0209455_1000204 | Ga0209455_100020410 | 137 |
| 617 | 3300025272 | Ga0209455_1005018 | Ga0209455_10050185 | 137 |
| 618 | 3300025294 | Ga0209025_1041276 | Ga0209025_10412764 | 137 |
| 619 | 3300025294 | Ga0209025_1098796 | Ga0209025_10987962 | 137 |
| 620 | 3300025294 | Ga0209025_1112992 | Ga0209025_11129922 | 137 |
| 621 | 3300025297 | Ga0209758_1006057 | Ga0209758_100605717 | 137 |
| 622 | 3300025315 | Ga0207697_10030257 | Ga0207697_100302576 | 137 |
| 623 | 3300025321 | Ga0207656_10000708 | Ga0207656_1000070812 | 137 |
| 624 | 3300025321 | Ga0207656_10029364 | Ga0207656_100293642 | 137 |
| 625 | 3300025893 | Ga0207682_10058611 | Ga0207682_100586114 | 137 |
| 626 | 3300025898 | Ga0207692_10144556 | Ga0207692_101445562 | 137 |
| 627 | 3300025900 | Ga0207710_10686447 | Ga0207710_106864471 | 137 |
| 628 | 3300025901 | Ga0207688_10024957 | Ga0207688_100249578 | 137 |
| 629 | 3300025901 | Ga0207688_10118156 | Ga0207688_101181562 | 137 |
| 630 | 3300025904 | Ga0207647_10069351 | Ga0207647_100693513 | 137 |
| 631 | 3300025904 | Ga0207647_10170361 | Ga0207647_101703612 | 137 |
| 632 | 3300025906 | Ga0207699_10183916 | Ga0207699_101839162 | 137 |
| 633 | 3300025907 | Ga0207645_10006221 | Ga0207645_1000622110 | 137 |
| 634 | 3300025909 | Ga0207705_10011637 | Ga0207705_100116378 | 137 |
| 635 | 3300025909 | Ga0207705_10187695 | Ga0207705_101876952 | 137 |
| 636 | 3300025911 | Ga0207654_10043479 | Ga0207654_100434792 | 137 |
| 637 | 3300025911 | Ga0207654_10462413 | Ga0207654_104624131 | 137 |
| 638 | 3300025911 | Ga0207654_11100659 | Ga0207654_111006592 | 137 |
| 639 | 3300025912 | Ga0207707_10357488 | Ga0207707_103574883 | 137 |
| 640 | 3300025913 | Ga0207695_10002347 | Ga0207695_1000234714 | 137 |
| 641 | 3300025913 | Ga0207695_10109547 | Ga0207695_101095473 | 137 |
| 642 | 3300025913 | Ga0207695_10253213 | Ga0207695_102532132 | 137 |
| 643 | 3300025914 | Ga0207671_10110334 | Ga0207671_101103343 | 137 |
| 644 | 3300025914 | Ga0207671_10237967 | Ga0207671_102379672 | 137 |
| 645 | 3300025915 | Ga0207693_10026373 | Ga0207693_1002637311 | 137 |
| 646 | 3300025915 | Ga0207693_10252031 | Ga0207693_102520314 | 137 |
| 647 | 3300025916 | Ga0207663_10089559 | Ga0207663_100895594 | 137 |
| 648 | 3300025918 | Ga0207662_10463199 | Ga0207662_104631992 | 137 |
| 649 | 3300025919 | Ga0207657_10011937 | Ga0207657_1001193710 | 137 |
| 650 | 3300025919 | Ga0207657_10678540 | Ga0207657_106785401 | 137 |
| 651 | 3300025920 | Ga0207649_10003305 | Ga0207649_1000330513 | 137 |
| 652 | 3300025920 | Ga0207649_10467790 | Ga0207649_104677901 | 137 |
| 653 | 3300025920 | Ga0207649_10529592 | Ga0207649_105295923 | 137 |
| 654 | 3300025924 | Ga0207694_10022428 | Ga0207694_100224288 | 137 |
| 655 | 3300025924 | Ga0207694_10033132 | Ga0207694_100331329 | 137 |
| 656 | 3300025924 | Ga0207694_10085496 | Ga0207694_100854962 | 137 |
| 657 | 3300025924 | Ga0207694_10462287 | Ga0207694_104622872 | 137 |
| 658 | 3300025925 | Ga0207650_10457164 | Ga0207650_104571643 | 137 |
| 659 | 3300025926 | Ga0207659_10616521 | Ga0207659_106165212 | 137 |
| 660 | 3300025927 | Ga0207687_10079261 | Ga0207687_100792613 | 137 |
| 661 | 3300025927 | Ga0207687_10494140 | Ga0207687_104941402 | 137 |
| 662 | 3300025928 | Ga0207700_10055325 | Ga0207700_100553257 | 137 |
| 663 | 3300025928 | Ga0207700_11239767 | Ga0207700_112397671 | 137 |
| 664 | 3300025932 | Ga0207690_10137165 | Ga0207690_101371654 | 137 |
| 665 | 3300025932 | Ga0207690_10370310 | Ga0207690_103703102 | 137 |
| 666 | 3300025932 | Ga0207690_10517750 | Ga0207690_105177502 | 137 |
| 667 | 3300025932 | Ga0207690_11392386 | Ga0207690_113923861 | 137 |
| 668 | 3300025933 | Ga0207706_10017336 | Ga0207706_100173369 | 137 |
| 669 | 3300025934 | Ga0207686_10098572 | Ga0207686_100985722 | 137 |
| 670 | 3300025935 | Ga0207709_10697778 | Ga0207709_106977782 | 137 |
| 671 | 3300025935 | Ga0207709_10903135 | Ga0207709_109031352 | 137 |
| 672 | 3300025936 | Ga0207670_11834158 | Ga0207670_118341581 | 137 |
| 673 | 3300025937 | Ga0207669_10237964 | Ga0207669_102379642 | 137 |
| 674 | 3300025937 | Ga0207669_10483614 | Ga0207669_104836142 | 137 |
| 675 | 3300025939 | Ga0207665_10159438 | Ga0207665_101594382 | 137 |
| 676 | 3300025940 | Ga0207691_10168157 | Ga0207691_101681575 | 137 |
| 677 | 3300025940 | Ga0207691_11119673 | Ga0207691_111196732 | 137 |
| 678 | 3300025941 | Ga0207711_10476855 | Ga0207711_104768552 | 137 |
| 679 | 3300025941 | Ga0207711_11132271 | Ga0207711_111322711 | 137 |
| 680 | 3300025942 | Ga0207689_10358749 | Ga0207689_103587491 | 137 |
| 681 | 3300025942 | Ga0207689_10379367 | Ga0207689_103793673 | 137 |
| 682 | 3300025942 | Ga0207689_10435269 | Ga0207689_104352691 | 137 |
| 683 | 3300025944 | Ga0207661_10550432 | Ga0207661_105504321 | 137 |
| 684 | 3300025945 | Ga0207679_10707568 | Ga0207679_107075682 | 137 |
| 685 | 3300025949 | Ga0207667_10000877 | Ga0207667_1000087723 | 137 |
| 686 | 3300025949 | Ga0207667_10119839 | Ga0207667_101198395 | 137 |
| 687 | 3300025949 | Ga0207667_10267115 | Ga0207667_102671153 | 137 |
| 688 | 3300025961 | Ga0207712_10770224 | Ga0207712_107702243 | 137 |
| 689 | 3300025972 | Ga0207668_10180850 | Ga0207668_101808504 | 137 |
| 690 | 3300025972 | Ga0207668_11783125 | Ga0207668_117831251 | 137 |
| 691 | 3300025981 | Ga0207640_10158340 | Ga0207640_101583402 | 137 |
| 692 | 3300025981 | Ga0207640_10268641 | Ga0207640_102686413 | 137 |
| 693 | 3300025981 | Ga0207640_11418914 | Ga0207640_114189142 | 137 |
| 694 | 3300026023 | Ga0207677_10234626 | Ga0207677_102346263 | 137 |
| 695 | 3300026023 | Ga0207677_11678840 | Ga0207677_116788401 | 137 |
| 696 | 3300026035 | Ga0207703_10200256 | Ga0207703_102002564 | 137 |
| 697 | 3300026041 | Ga0207639_10002448 | Ga0207639_1000244811 | 137 |
| 698 | 3300026041 | Ga0207639_10249047 | Ga0207639_102490474 | 137 |
| 699 | 3300026041 | Ga0207639_10386268 | Ga0207639_103862682 | 137 |
| 700 | 3300026041 | Ga0207639_10388172 | Ga0207639_103881722 | 137 |
| 701 | 3300026041 | Ga0207639_11788024 | Ga0207639_117880242 | 137 |
| 702 | 3300026067 | Ga0207678_10048388 | Ga0207678_100483886 | 137 |
| 703 | 3300026067 | Ga0207678_10049649 | Ga0207678_100496497 | 137 |
| 704 | 3300026067 | Ga0207678_10076186 | Ga0207678_100761865 | 137 |
| 705 | 3300026067 | Ga0207678_10612480 | Ga0207678_106124802 | 137 |
| 706 | 3300026067 | Ga0207678_11311165 | Ga0207678_113111651 | 137 |
| 707 | 3300026078 | Ga0207702_10014521 | Ga0207702_100145214 | 137 |
| 708 | 3300026078 | Ga0207702_10153650 | Ga0207702_101536504 | 137 |
| 709 | 3300026078 | Ga0207702_10473640 | Ga0207702_104736402 | 137 |
| 710 | 3300026078 | Ga0207702_11107845 | Ga0207702_111078452 | 137 |
| 711 | 3300026078 | Ga0207702_11748803 | Ga0207702_117488032 | 137 |
| 712 | 3300026089 | Ga0207648_10011030 | Ga0207648_100110309 | 137 |
| 713 | 3300026089 | Ga0207648_10095334 | Ga0207648_100953346 | 137 |
| 714 | 3300026095 | Ga0207676_10802442 | Ga0207676_108024423 | 137 |
| 715 | 3300026116 | Ga0207674_10128180 | Ga0207674_101281802 | 137 |
| 716 | 3300026116 | Ga0207674_10190354 | Ga0207674_101903542 | 137 |
| 717 | 3300026116 | Ga0207674_10386131 | Ga0207674_103861313 | 137 |
| 718 | 3300026116 | Ga0207674_10919994 | Ga0207674_109199942 | 137 |
| 719 | 3300026118 | Ga0207675_100040050 | Ga0207675_1000400502 | 137 |
| 720 | 3300026118 | Ga0207675_100090967 | Ga0207675_1000909672 | 137 |
| 721 | 3300026121 | Ga0207683_10016263 | Ga0207683_1001626310 | 137 |
| 722 | 3300026121 | Ga0207683_11118690 | Ga0207683_111186902 | 137 |
| 723 | 3300026142 | Ga0207698_10046854 | Ga0207698_100468544 | 137 |
| 724 | 3300026142 | Ga0207698_10089559 | Ga0207698_100895594 | 137 |
| 725 | 3300026142 | Ga0207698_10126898 | Ga0207698_101268982 | 137 |
| 726 | 3300027695 | Ga0209966_1038516 | Ga0209966_10385162 | 137 |
| 727 | 3300027866 | Ga0209813_10017271 | Ga0209813_100172715 | 137 |
| 728 | 3300027866 | Ga0209813_10102879 | Ga0209813_101028791 | 137 |
| 729 | 3300028379 | Ga0268266_10020829 | Ga0268266_1002082911 | 137 |
| 730 | 3300028379 | Ga0268266_10036033 | Ga0268266_100360332 | 137 |
| 731 | 3300028380 | Ga0268265_10401497 | Ga0268265_104014974 | 137 |
| 732 | 3300028556 | Ga0265337_1002429 | Ga0265337_100242914 | 137 |
| 733 | 3300028556 | Ga0265337_1008843 | Ga0265337_10088437 | 137 |
| 734 | 3300028558 | Ga0265326_10001795 | Ga0265326_100017954 | 137 |
| 735 | 3300028563 | Ga0265319_1001825 | Ga0265319_100182510 | 137 |
| 736 | 3300028563 | Ga0265319_1040122 | Ga0265319_10401224 | 137 |
| 737 | 3300028573 | Ga0265334_10000469 | Ga0265334_1000046915 | 137 |
| 738 | 3300028573 | Ga0265334_10052725 | Ga0265334_100527253 | 137 |
| 739 | 3300028577 | Ga0265318_10008934 | Ga0265318_100089348 | 137 |
| 740 | 3300028577 | Ga0265318_10041779 | Ga0265318_100417793 | 137 |
| 741 | 3300028653 | Ga0265323_10001237 | Ga0265323_1000123711 | 137 |
| 742 | 3300028654 | Ga0265322_10051676 | Ga0265322_100516762 | 137 |
| 743 | 3300028666 | Ga0265336_10000535 | Ga0265336_1000053520 | 137 |
| 744 | 3300028786 | Ga0307517_10185220 | Ga0307517_101852203 | 137 |
| 745 | 3300028800 | Ga0265338_10000131 | Ga0265338_10000131106 | 137 |
| 746 | 3300029957 | Ga0265324_10001269 | Ga0265324_1000126914 | 137 |
| 747 | 3300031235 | Ga0265330_10125296 | Ga0265330_101252963 | 137 |
| 748 | 3300031238 | Ga0265332_10115038 | Ga0265332_101150382 | 137 |
| 749 | 3300031238 | Ga0265332_10176541 | Ga0265332_101765412 | 137 |
| 750 | 3300031239 | Ga0265328_10038497 | Ga0265328_100384973 | 137 |
| 751 | 3300031239 | Ga0265328_10348579 | Ga0265328_103485792 | 137 |
| 752 | 3300031240 | Ga0265320_10006806 | Ga0265320_1000680611 | 137 |
| 753 | 3300031241 | Ga0265325_10048954 | Ga0265325_100489543 | 137 |
| 754 | 3300031241 | Ga0265325_10160262 | Ga0265325_101602622 | 137 |
| 755 | 3300031242 | Ga0265329_10054789 | Ga0265329_100547892 | 137 |
| 756 | 3300031247 | Ga0265340_10065829 | Ga0265340_100658293 | 137 |
| 757 | 3300031249 | Ga0265339_10012498 | Ga0265339_1001249810 | 137 |
| 758 | 3300031249 | Ga0265339_10045403 | Ga0265339_100454034 | 137 |
| 759 | 3300031249 | Ga0265339_10074118 | Ga0265339_100741182 | 137 |
| 760 | 3300031249 | Ga0265339_10255981 | Ga0265339_102559812 | 137 |
| 761 | 3300031250 | Ga0265331_10005639 | Ga0265331_100056399 | 137 |
| 762 | 3300031250 | Ga0265331_10084260 | Ga0265331_100842603 | 137 |
| 763 | 3300031250 | Ga0265331_10193919 | Ga0265331_101939192 | 137 |
| 764 | 3300031344 | Ga0265316_10015933 | Ga0265316_1001593311 | 137 |
| 765 | 3300031344 | Ga0265316_10498534 | Ga0265316_104985342 | 137 |
| 766 | 3300031456 | Ga0307513_10178755 | Ga0307513_101787553 | 137 |
| 767 | 3300031456 | Ga0307513_10212495 | Ga0307513_102124954 | 137 |
| 768 | 3300031456 | Ga0307513_10455881 | Ga0307513_104558812 | 137 |
| 769 | 3300031548 | Ga0307408_100357006 | Ga0307408_1003570064 | 137 |
| 770 | 3300031548 | Ga0307408_101689637 | Ga0307408_1016896372 | 137 |
| 771 | 3300031595 | Ga0265313_10003614 | Ga0265313_1000361410 | 137 |
| 772 | 3300031595 | Ga0265313_10022840 | Ga0265313_100228407 | 137 |
| 773 | 3300031595 | Ga0265313_10031974 | Ga0265313_100319745 | 137 |
| 774 | 3300031595 | Ga0265313_10052060 | Ga0265313_100520604 | 137 |
| 775 | 3300031711 | Ga0265314_10008857 | Ga0265314_100088575 | 137 |
| 776 | 3300031711 | Ga0265314_10028270 | Ga0265314_1002827010 | 137 |
| 777 | 3300031711 | Ga0265314_10615528 | Ga0265314_106155281 | 137 |
| 778 | 3300031712 | Ga0265342_10004137 | Ga0265342_1000413710 | 137 |
| 779 | 3300031712 | Ga0265342_10101676 | Ga0265342_101016761 | 137 |
| 780 | 3300031731 | Ga0307405_10167684 | Ga0307405_101676844 | 137 |
| 781 | 3300031731 | Ga0307405_10767112 | Ga0307405_107671123 | 137 |
| 782 | 3300031824 | Ga0307413_10738202 | Ga0307413_107382022 | 137 |
| 783 | 3300031852 | Ga0307410_10952505 | Ga0307410_109525052 | 137 |
| 784 | 3300031901 | Ga0307406_11160143 | Ga0307406_111601432 | 137 |
| 785 | 3300031903 | Ga0307407_10352119 | Ga0307407_103521193 | 137 |
| 786 | 3300031903 | Ga0307407_11031382 | Ga0307407_110313822 | 137 |
| 787 | 3300031911 | Ga0307412_10033696 | Ga0307412_100336962 | 137 |
| 788 | 3300031911 | Ga0307412_10778838 | Ga0307412_107788382 | 137 |
| 789 | 3300031995 | Ga0307409_100317323 | Ga0307409_1003173232 | 137 |
| 790 | 3300031995 | Ga0307409_100707130 | Ga0307409_1007071302 | 137 |
| 791 | 3300031995 | Ga0307409_101618333 | Ga0307409_1016183332 | 137 |
| 792 | 3300032002 | Ga0307416_100537909 | Ga0307416_1005379092 | 137 |
| 793 | 3300032002 | Ga0307416_101472812 | Ga0307416_1014728123 | 137 |
| 794 | 3300032004 | Ga0307414_10155793 | Ga0307414_101557933 | 137 |
| 795 | 3300032005 | Ga0307411_10460006 | Ga0307411_104600062 | 137 |
| 796 | 3300032126 | Ga0307415_100114769 | Ga0307415_1001147692 | 137 |
| 797 | 3300032126 | Ga0307415_100435537 | Ga0307415_1004355372 | 137 |
| 798 | 3300032126 | Ga0307415_100611652 | Ga0307415_1006116522 | 137 |
| 799 | 3300033180 | Ga0307510_10275184 | Ga0307510_102751844 | 137 |
| 800 | 3300035088 | Ga0373940_0141410 | Ga0373940_0141410_170_586 | 137 |
| 801 | 3300035089 | Ga0373944_0029385 | Ga0373944_0029385_387_803 | 137 |
| 802 | 3300035113 | Ga0373936_0113921 | Ga0373936_0113921_209_622 | 137 |
| 803 | 3300035118 | Ga0373954_0041438 | Ga0373954_0041438_490_906 | 137 |
| 804 | 3300035120 | Ga0373957_0119033 | Ga0373957_0119033_285_701 | 137 |
| 805 | 3300035121 | Ga0373960_0240473 | Ga0373960_0240473_138_551 | 137 |
| 806 | 3300035171 | Ga0373946_0052650 | Ga0373946_0052650_603_1019 | 137 |
| 807 | 3300035171 | Ga0373946_0303804 | Ga0373946_0303804_107_520 | 137 |
| 808 | 3300035172 | Ga0373955_0555436 | Ga0373955_0555436_83_499 | 137 |
| 809 | 3300035242 | Ga0373962_0085141 | Ga0373962_0085141_58_471 | 137 |
| 810 | 3300035410 | Ga0373924_0055558 | Ga0373924_0055558_430_846 | 137 |
| 811 | 3300035692 | Ga0373935_0318189 | Ga0373935_0318189_47_463 | 137 |
| 812 | 3300035695 | Ga0373927_0093236 | Ga0373927_0093236_682_1098 | 137 |
| 813 | 3300035724 | Ga0373933_0217946 | Ga0373933_0217946_415_828 | 137 |
| 814 | 3300035724 | Ga0373933_0262839 | Ga0373933_0262839_26_442 | 137 |
| 815 | 3300035725 | Ga0373947_1076269 | Ga0373947_1076269_46_462 | 137 |
| 816 | 3300036401 | Ga0373937_0229703 | Ga0373937_0229703_822_1238 | 137 |
| 817 | 3300037068 | Ga0373925_0686270 | Ga0373925_0686270_255_668 | 137 |
| 818 | 3300037068 | Ga0373925_0873216 | Ga0373925_0873216_137_550 | 137 |
| 819 | 3300037068 | Ga0373925_1050951 | Ga0373925_1050951_168_581 | 137 |
| 820 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_73195_73608 | 137 |
| 821 | 3300037312 | Ga0395899_0019478 | Ga0395899_0019478_3322_3735 | 137 |
| 822 | 3300037312 | Ga0395899_0075725 | Ga0395899_0075725_1766_2179 | 137 |
| 823 | 3300037312 | Ga0395899_0440335 | Ga0395899_0440335_386_799 | 137 |
| 824 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_177765_178178 | 137 |
| 825 | 3300037418 | Ga0395900_0012290 | Ga0395900_0012290_3600_4013 | 137 |
| 826 | 3300037418 | Ga0395900_0147149 | Ga0395900_0147149_577_990 | 137 |
| 827 | 3300037418 | Ga0395900_0609526 | Ga0395900_0609526_248_661 | 137 |
| 828 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_22825_23238 | 137 |
| 829 | 3300037466 | Ga0395898_0029950 | Ga0395898_0029950_1788_2201 | 137 |
| 830 | 3300037466 | Ga0395898_0131941 | Ga0395898_0131941_649_1062 | 137 |
| 831 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_107755_108168 | 137 |
| 832 | 3300037471 | Ga0395905_0446168 | Ga0395905_0446168_364_777 | 137 |
| 833 | 3300037471 | Ga0395905_1274895 | Ga0395905_1274895_199_612 | 137 |
| 834 | 3300037853 | Ga0436364_0076013 | Ga0436364_0076013_147_560 | 137 |
| 835 | 3300037853 | Ga0436364_0530881 | Ga0436364_0530881_1922_2335 | 137 |
| 836 | 3300037853 | Ga0436364_0765756 | Ga0436364_0765756_480_896 | 137 |
| 837 | 3300037853 | Ga0436364_1305283 | Ga0436364_1305283_191_607 | 137 |
| 838 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_107780_108193 | 137 |
| 839 | 3300038443 | Ga0395901_0036689 | Ga0395901_0036689_38_451 | 137 |
| 840 | 3300038443 | Ga0395901_0052439 | Ga0395901_0052439_613_1026 | 137 |
| 841 | 3300038735 | Ga0400485_17392 | Ga0400485_17392_403_837 | 137 |
| 842 | 3300038742 | Ga0400486_08264 | Ga0400486_08264_49_483 | 137 |
| 843 | 3300039437 | Ga0436365_0167537 | Ga0436365_0167537_478_891 | 137 |
| 844 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_39087_39500 | 137 |
| 845 | 3300039438 | Ga0436360_0323768 | Ga0436360_0323768_10_426 | 137 |
| 846 | 3300039438 | Ga0436360_0429536 | Ga0436360_0429536_1779_2195 | 137 |
| 847 | 3300039438 | Ga0436360_0564682 | Ga0436360_0564682_4276_4689 | 137 |
| 848 | 3300039438 | Ga0436360_1144658 | Ga0436360_1144658_898_1311 | 137 |
| 849 | 3300039438 | Ga0436360_1325924 | Ga0436360_1325924_144_557 | 137 |
| 850 | 3300039447 | Ga0436361_0237988 | Ga0436361_0237988_100_516 | 137 |
| 851 | 3300039450 | Ga0436363_0701091 | Ga0436363_0701091_832_1245 | 137 |
| 852 | 3300039450 | Ga0436363_0880899 | Ga0436363_0880899_461_874 | 137 |
| 853 | 3300039450 | Ga0436363_0939204 | Ga0436363_0939204_97_510 | 137 |
| 854 | 3300039450 | Ga0436363_1046285 | Ga0436363_1046285_8869_9282 | 137 |
| 855 | 3300039450 | Ga0436363_1077755 | Ga0436363_1077755_190_606 | 137 |
| 856 | 3300039450 | Ga0436363_1630341 | Ga0436363_1630341_124_555 | 137 |
| 857 | 3300039453 | Ga0436362_0687315 | Ga0436362_0687315_71_487 | 137 |
| 858 | 3300039453 | Ga0436362_0733157 | Ga0436362_0733157_1541_1954 | 137 |
| 859 | 3300041405 | Ga0439438_017474 | Ga0439438_017474_1052_1465 | 137 |
| 860 | 3300041408 | Ga0439453_0008967 | Ga0439453_0008967_198_611 | 137 |
| 861 | 3300041411 | Ga0439466_0110953 | Ga0439466_0110953_364_777 | 137 |
| 862 | 3300041413 | Ga0439465_0032376 | Ga0439465_0032376_308_721 | 137 |
| 863 | 3300041413 | Ga0439465_0119634 | Ga0439465_0119634_240_653 | 137 |
| 864 | 3300041443 | Ga0451789_1069382 | Ga0451789_1069382_324_737 | 137 |
| 865 | 3300041453 | Ga0451797_0510059 | Ga0451797_0510059_199_612 | 137 |
| 866 | 3300041460 | Ga0451802_1649373 | Ga0451802_1649373_434_847 | 137 |
| 867 | 3300041494 | Ga0451837_1213495 | Ga0451837_1213495_150_563 | 137 |
| 868 | 3300041494 | Ga0451837_1454596 | Ga0451837_1454596_922_1335 | 137 |
| 869 | 3300041505 | Ga0451849_1216811 | Ga0451849_1216811_130_543 | 137 |
| 870 | 3300041512 | Ga0451853_2656839 | Ga0451853_2656839_46_459 | 137 |
| 871 | 3300042001 | Ga0439441_077923 | Ga0439441_077923_196_609 | 137 |
| 872 | 3300042002 | Ga0439442_099155 | Ga0439442_099155_38_451 | 137 |
| 873 | 3300042004 | Ga0439445_0067786 | Ga0439445_0067786_514_927 | 137 |
| 874 | 3300042012 | Ga0439455_0018856 | Ga0439455_0018856_731_1144 | 137 |
| 875 | 3300042157 | Ga0439458_0020812 | Ga0439458_0020812_687_1100 | 137 |
| 876 | 3300042436 | Ga0439435_0004725 | Ga0439435_0004725_2414_2827 | 137 |
| 877 | 3300044656 | Ga0466969_0085473 | Ga0466969_0085473_207_620 | 137 |
| 878 | 3300044658 | Ga0466972_0010313 | Ga0466972_0010313_3864_4277 | 137 |
| 879 | 3300044693 | Ga0466961_0068632 | Ga0466961_0068632_1157_1570 | 137 |
| 880 | 3300044694 | Ga0466963_0292782 | Ga0466963_0292782_364_780 | 137 |
| 881 | 3300044694 | Ga0466963_0895951 | Ga0466963_0895951_102_518 | 137 |
| 882 | 3300044706 | Ga0466964_0380189 | Ga0466964_0380189_277_690 | 137 |
| 883 | 3300044719 | Ga0466971_0254118 | Ga0466971_0254118_93_506 | 137 |
| 884 | 3300044719 | Ga0466971_0426149 | Ga0466971_0426149_62_478 | 137 |
| 885 | 3300044842 | Ga0466957_1155472 | Ga0466957_1155472_35_448 | 137 |
| 886 | 3300044901 | Ga0466960_0029748 | Ga0466960_0029748_427_840 | 137 |
| 887 | 3300045049 | Ga0466959_0011129 | Ga0466959_0011129_1966_2379 | 137 |
| 888 | 3300045049 | Ga0466959_0590257 | Ga0466959_0590257_290_709 | 137 |
| 889 | 3300045836 | Ga0466958_0180617 | Ga0466958_0180617_312_725 | 137 |
| 890 | 3300045976 | Ga0466967_0549579 | Ga0466967_0549579_546_959 | 137 |
| 891 | 3300045976 | Ga0466967_0613874 | Ga0466967_0613874_149_565 | 137 |
| 892 | 3300045976 | Ga0466967_1157763 | Ga0466967_1157763_14_427 | 137 |
| 893 | 3300046454 | Ga0495592_0098665 | Ga0495592_0098665_379_792 | 137 |
| 894 | 3300046454 | Ga0495592_0439032 | Ga0495592_0439032_338_751 | 137 |
| 895 | 3300046455 | Ga0495603_0432529 | Ga0495603_0432529_282_698 | 137 |
| 896 | 3300046457 | Ga0495590_0047095 | Ga0495590_0047095_454_867 | 137 |
| 897 | 3300046459 | Ga0495629_0131013 | Ga0495629_0131013_209_622 | 137 |
| 898 | 3300046459 | Ga0495629_0304789 | Ga0495629_0304789_436_849 | 137 |
| 899 | 3300046460 | Ga0495638_0040593 | Ga0495638_0040593_1617_2030 | 137 |
| 900 | 3300046460 | Ga0495638_0276814 | Ga0495638_0276814_222_635 | 137 |
| 901 | 3300046471 | Ga0495650_0127613 | Ga0495650_0127613_103_516 | 137 |
| 902 | 3300046472 | Ga0495580_0059866 | Ga0495580_0059866_1794_2210 | 137 |
| 903 | 3300046473 | Ga0495582_0319921 | Ga0495582_0319921_436_849 | 137 |
| 904 | 3300046475 | Ga0495639_0242902 | Ga0495639_0242902_98_511 | 137 |
| 905 | 3300046477 | Ga0495664_0051700 | Ga0495664_0051700_1116_1529 | 137 |
| 906 | 3300046500 | Ga0495596_0060347 | Ga0495596_0060347_356_769 | 137 |
| 907 | 3300046500 | Ga0495596_0130125 | Ga0495596_0130125_352_765 | 137 |
| 908 | 3300046501 | Ga0495607_0477595 | Ga0495607_0477595_96_509 | 137 |
| 909 | 3300046501 | Ga0495607_0524058 | Ga0495607_0524058_79_492 | 137 |
| 910 | 3300046506 | Ga0495583_0049116 | Ga0495583_0049116_897_1310 | 137 |
| 911 | 3300046506 | Ga0495583_0143975 | Ga0495583_0143975_262_675 | 137 |
| 912 | 3300046512 | Ga0495610_0327868 | Ga0495610_0327868_65_478 | 137 |
| 913 | 3300046513 | Ga0495616_0047418 | Ga0495616_0047418_1173_1586 | 137 |
| 914 | 3300046514 | Ga0495618_0307148 | Ga0495618_0307148_410_823 | 137 |
| 915 | 3300046515 | Ga0495620_0008766 | Ga0495620_0008766_1320_1733 | 137 |
| 916 | 3300046520 | Ga0495637_0027395 | Ga0495637_0027395_502_915 | 137 |
| 917 | 3300046522 | Ga0495643_0011617 | Ga0495643_0011617_4719_5132 | 137 |
| 918 | 3300046537 | Ga0495598_0165155 | Ga0495598_0165155_56_469 | 137 |
| 919 | 3300046542 | Ga0495597_0076584 | Ga0495597_0076584_232_645 | 137 |
| 920 | 3300046543 | Ga0495645_0165319 | Ga0495645_0165319_951_1364 | 137 |
| 921 | 3300046616 | Ga0495668_0252348 | Ga0495668_0252348_27_440 | 137 |
| 922 | 3300046648 | Ga0495611_0261712 | Ga0495611_0261712_87_500 | 137 |
| 923 | 3300046660 | Ga0495625_0220780 | Ga0495625_0220780_258_671 | 137 |
| 924 | 3300046660 | Ga0495625_0292882 | Ga0495625_0292882_108_521 | 137 |
| 925 | 3300046675 | Ga0495657_0068294 | Ga0495657_0068294_1069_1482 | 137 |
| 926 | 3300046683 | Ga0495658_0111501 | Ga0495658_0111501_895_1308 | 137 |
| 927 | 3300046683 | Ga0495658_0276678 | Ga0495658_0276678_111_524 | 137 |
| 928 | 3300046684 | Ga0495669_0294413 | Ga0495669_0294413_201_614 | 137 |
| 929 | 3300046691 | Ga0495670_0102193 | Ga0495670_0102193_79_492 | 137 |
| 930 | 3300046810 | Ga0495660_0007203 | Ga0495660_0007203_3114_3527 | 137 |
| 931 | 3300047315 | Ga0495581_0065369 | Ga0495581_0065369_1308_1721 | 137 |
| 932 | 3300047317 | Ga0495604_0233671 | Ga0495604_0233671_562_975 | 137 |
| 933 | 3300047317 | Ga0495604_0604734 | Ga0495604_0604734_82_498 | 137 |
| 934 | 3300047320 | Ga0495672_0073202 | Ga0495672_0073202_1467_1880 | 137 |
| 935 | 3300047320 | Ga0495672_0113829 | Ga0495672_0113829_178_591 | 137 |
| 936 | 3300047320 | Ga0495672_0117241 | Ga0495672_0117241_845_1258 | 137 |
| 937 | 3300047322 | Ga0495680_0065932 | Ga0495680_0065932_977_1390 | 137 |
| 938 | 3300047443 | Ga0495687_013562 | Ga0495687_013562_1015_1428 | 137 |
| 939 | 3300047446 | Ga0495679_059554 | Ga0495679_059554_221_634 | 137 |
| 940 | 3300047469 | Ga0495673_0187945 | Ga0495673_0187945_243_656 | 137 |
| 941 | 3300047472 | Ga0495686_0013227 | Ga0495686_0013227_363_776 | 137 |
| 942 | 3300047472 | Ga0495686_0184288 | Ga0495686_0184288_406_819 | 137 |
| 943 | 3300048088 | Ga0495602_0752933 | Ga0495602_0752933_174_587 | 137 |
| 944 | 3300048090 | Ga0495615_0042760 | Ga0495615_0042760_520_933 | 137 |
| 945 | 3300048091 | Ga0495626_0073504 | Ga0495626_0073504_674_1087 | 137 |
| 946 | 3300048903 | Ga0496100_0594067 | Ga0496100_0594067_278_691 | 137 |
| 947 | 3300048904 | Ga0496101_0639867 | Ga0496101_0639867_329_742 | 137 |
| 948 | 3300048907 | Ga0496104_0250153 | Ga0496104_0250153_622_1035 | 137 |
| 949 | 3300048908 | Ga0496105_0915100 | Ga0496105_0915100_164_577 | 137 |
| 950 | 3300048909 | Ga0496106_0680519 | Ga0496106_0680519_228_641 | 137 |
| 951 | 3300048909 | Ga0496106_0810384 | Ga0496106_0810384_109_522 | 137 |
| 952 | 3300048909 | Ga0496106_1487973 | Ga0496106_1487973_60_473 | 137 |
| 953 | 3300048911 | Ga0496108_1093656 | Ga0496108_1093656_42_458 | 137 |
| 954 | 3300048912 | Ga0496109_0361483 | Ga0496109_0361483_74_487 | 137 |
| 955 | 3300048912 | Ga0496109_0492074 | Ga0496109_0492074_594_1007 | 137 |
| 956 | 3300048913 | Ga0496110_0764248 | Ga0496110_0764248_336_749 | 137 |
| 957 | 3300048914 | Ga0496111_0318265 | Ga0496111_0318265_629_1042 | 137 |
| 958 | 3300048915 | Ga0496112_0063587 | Ga0496112_0063587_923_1336 | 137 |
| 959 | 3300048916 | Ga0496113_0260126 | Ga0496113_0260126_494_907 | 137 |
| 960 | 3300048916 | Ga0496113_0630790 | Ga0496113_0630790_191_604 | 137 |
| 961 | 3300048918 | Ga0496115_0181345 | Ga0496115_0181345_633_1046 | 137 |
| 962 | 3300048920 | Ga0496117_0123621 | Ga0496117_0123621_468_881 | 137 |
| 963 | 3300048921 | Ga0496118_0038146 | Ga0496118_0038146_3136_3549 | 137 |
| 964 | 3300048921 | Ga0496118_0070157 | Ga0496118_0070157_2109_2522 | 137 |
| 965 | 3300048921 | Ga0496118_0234990 | Ga0496118_0234990_110_523 | 137 |
| 966 | 3300048922 | Ga0496119_0000372 | Ga0496119_0000372_36287_36700 | 137 |
| 967 | 3300048922 | Ga0496119_0064924 | Ga0496119_0064924_478_891 | 137 |
| 968 | 3300048922 | Ga0496119_0081757 | Ga0496119_0081757_157_570 | 137 |
| 969 | 3300048922 | Ga0496119_0122432 | Ga0496119_0122432_991_1404 | 137 |
| 970 | 3300048922 | Ga0496119_0181727 | Ga0496119_0181727_385_798 | 137 |
| 971 | 3300048922 | Ga0496119_0204607 | Ga0496119_0204607_167_580 | 137 |
| 972 | 3300048923 | Ga0496120_0045101 | Ga0496120_0045101_482_895 | 137 |
| 973 | 3300048923 | Ga0496120_0065139 | Ga0496120_0065139_532_945 | 137 |
| 974 | 3300048923 | Ga0496120_0293618 | Ga0496120_0293618_57_470 | 137 |
| 975 | 3300048924 | Ga0496121_0035490 | Ga0496121_0035490_3141_3554 | 137 |
| 976 | 3300048924 | Ga0496121_0194855 | Ga0496121_0194855_476_889 | 137 |
| 977 | 3300048924 | Ga0496121_0428716 | Ga0496121_0428716_69_482 | 137 |
| 978 | 3300048925 | Ga0496122_0006451 | Ga0496122_0006451_12029_12442 | 137 |
| 979 | 3300048925 | Ga0496122_0255799 | Ga0496122_0255799_103_516 | 137 |
| 980 | 3300048926 | Ga0496123_0017126 | Ga0496123_0017126_4470_4883 | 137 |
| 981 | 3300048927 | Ga0496124_0105288 | Ga0496124_0105288_1709_2122 | 137 |
| 982 | 3300048928 | Ga0496125_0134455 | Ga0496125_0134455_977_1390 | 137 |
| 983 | 3300048928 | Ga0496125_0243721 | Ga0496125_0243721_342_755 | 137 |
| 984 | 3300048928 | Ga0496125_0380311 | Ga0496125_0380311_152_565 | 137 |
| 985 | 3300048929 | Ga0496126_0055058 | Ga0496126_0055058_302_715 | 137 |
| 986 | 3300048929 | Ga0496126_0164769 | Ga0496126_0164769_776_1189 | 137 |
| 987 | 3300048929 | Ga0496126_0282853 | Ga0496126_0282853_527_940 | 137 |
| 988 | 3300048929 | Ga0496126_0347592 | Ga0496126_0347592_385_798 | 137 |
| 989 | 3300049129 | Ga0501309_013314 | Ga0501309_013314_155_568 | 137 |
| 990 | 3300049161 | Ga0501305_054534 | Ga0501305_054534_201_614 | 137 |
| 991 | 3300049529 | Ga0501313_010924 | Ga0501313_010924_353_784 | 137 |
| 992 | 3300049529 | Ga0501313_047583 | Ga0501313_047583_47_460 | 137 |
| 993 | 3300049531 | Ga0501315_049789 | Ga0501315_049789_49_462 | 137 |
| 994 | 3300049533 | Ga0501317_002279 | Ga0501317_002279_780_1199 | 137 |
| 995 | 3300049534 | Ga0501318_001867 | Ga0501318_001867_428_847 | 137 |
| 996 | 3300049536 | Ga0501320_018996 | Ga0501320_018996_347_760 | 137 |
| 997 | 3300049568 | Ga0501031_0000651 | Ga0501031_0000651_15607_16020 | 137 |
| 998 | 3300049568 | Ga0501031_0003843 | Ga0501031_0003843_4673_5086 | 137 |
| 999 | 3300049568 | Ga0501031_0016670 | Ga0501031_0016670_3978_4391 | 137 |
| 1000 | 3300049568 | Ga0501031_0341948 | Ga0501031_0341948_328_741 | 137 |
| 1001 | 3300049568 | Ga0501031_0800168 | Ga0501031_0800168_17_430 | 137 |
| 1002 | 3300049569 | Ga0501032_0000111 | Ga0501032_0000111_4528_4941 | 137 |
| 1003 | 3300049569 | Ga0501032_0001915 | Ga0501032_0001915_6864_7277 | 137 |
| 1004 | 3300049569 | Ga0501032_0003488 | Ga0501032_0003488_7156_7569 | 137 |
| 1005 | 3300049569 | Ga0501032_0012326 | Ga0501032_0012326_2097_2510 | 137 |
| 1006 | 3300049569 | Ga0501032_0111144 | Ga0501032_0111144_512_925 | 137 |
| 1007 | 3300049569 | Ga0501032_0119107 | Ga0501032_0119107_541_954 | 137 |
| 1008 | 3300049569 | Ga0501032_0165400 | Ga0501032_0165400_439_852 | 137 |
| 1009 | 3300049569 | Ga0501032_0188536 | Ga0501032_0188536_678_1091 | 137 |
| 1010 | 3300049569 | Ga0501032_0237913 | Ga0501032_0237913_624_1037 | 137 |
| 1011 | 3300049569 | Ga0501032_0305998 | Ga0501032_0305998_322_735 | 137 |
| 1012 | 3300049569 | Ga0501032_0399755 | Ga0501032_0399755_190_603 | 137 |
| 1013 | 3300049569 | Ga0501032_0612912 | Ga0501032_0612912_153_566 | 137 |
| 1014 | 3300049569 | Ga0501032_0737764 | Ga0501032_0737764_83_496 | 137 |
| 1015 | 3300049570 | Ga0501033_0000121 | Ga0501033_0000121_42816_43229 | 137 |
| 1016 | 3300049570 | Ga0501033_0006462 | Ga0501033_0006462_7963_8376 | 137 |
| 1017 | 3300049570 | Ga0501033_0018118 | Ga0501033_0018118_4553_4966 | 137 |
| 1018 | 3300049570 | Ga0501033_0037361 | Ga0501033_0037361_1314_1727 | 137 |
| 1019 | 3300049570 | Ga0501033_0059135 | Ga0501033_0059135_1779_2192 | 137 |
| 1020 | 3300049570 | Ga0501033_0126195 | Ga0501033_0126195_147_560 | 137 |
| 1021 | 3300049570 | Ga0501033_0139684 | Ga0501033_0139684_580_993 | 137 |
| 1022 | 3300049570 | Ga0501033_0141883 | Ga0501033_0141883_750_1163 | 137 |
| 1023 | 3300049570 | Ga0501033_0194748 | Ga0501033_0194748_786_1199 | 137 |
| 1024 | 3300049570 | Ga0501033_0717400 | Ga0501033_0717400_38_451 | 137 |
| 1025 | 3300049571 | Ga0501034_0000298 | Ga0501034_0000298_83289_83702 | 137 |
| 1026 | 3300049571 | Ga0501034_0009013 | Ga0501034_0009013_6018_6431 | 137 |
| 1027 | 3300049571 | Ga0501034_0014685 | Ga0501034_0014685_5474_5887 | 137 |
| 1028 | 3300049571 | Ga0501034_0014987 | Ga0501034_0014987_3713_4126 | 137 |
| 1029 | 3300049571 | Ga0501034_0026519 | Ga0501034_0026519_4528_4941 | 137 |
| 1030 | 3300049571 | Ga0501034_0035212 | Ga0501034_0035212_1590_2003 | 137 |
| 1031 | 3300049571 | Ga0501034_0050055 | Ga0501034_0050055_3197_3610 | 137 |
| 1032 | 3300049571 | Ga0501034_0064759 | Ga0501034_0064759_139_552 | 137 |
| 1033 | 3300049571 | Ga0501034_0071741 | Ga0501034_0071741_1989_2402 | 137 |
| 1034 | 3300049571 | Ga0501034_0078177 | Ga0501034_0078177_132_545 | 137 |
| 1035 | 3300049571 | Ga0501034_0093906 | Ga0501034_0093906_611_1024 | 137 |
| 1036 | 3300049571 | Ga0501034_0172892 | Ga0501034_0172892_344_757 | 137 |
| 1037 | 3300049571 | Ga0501034_0185421 | Ga0501034_0185421_829_1242 | 137 |
| 1038 | 3300049571 | Ga0501034_0271516 | Ga0501034_0271516_178_591 | 137 |
| 1039 | 3300049571 | Ga0501034_0337605 | Ga0501034_0337605_557_970 | 137 |
| 1040 | 3300049571 | Ga0501034_0381046 | Ga0501034_0381046_604_1017 | 137 |
| 1041 | 3300049571 | Ga0501034_0594197 | Ga0501034_0594197_370_783 | 137 |
| 1042 | 3300049571 | Ga0501034_0679958 | Ga0501034_0679958_369_782 | 137 |
| 1043 | 3300049571 | Ga0501034_0753945 | Ga0501034_0753945_72_485 | 137 |
| 1044 | 3300049571 | Ga0501034_0760920 | Ga0501034_0760920_301_714 | 137 |
| 1045 | 3300049572 | Ga0501036_0000724 | Ga0501036_0000724_19881_20294 | 137 |
| 1046 | 3300049572 | Ga0501036_0002605 | Ga0501036_0002605_9283_9696 | 137 |
| 1047 | 3300049572 | Ga0501036_0014004 | Ga0501036_0014004_2388_2801 | 137 |
| 1048 | 3300049572 | Ga0501036_0038561 | Ga0501036_0038561_907_1320 | 137 |
| 1049 | 3300049572 | Ga0501036_0230566 | Ga0501036_0230566_516_929 | 137 |
| 1050 | 3300049572 | Ga0501036_0582833 | Ga0501036_0582833_70_483 | 137 |
| 1051 | 3300049572 | Ga0501036_0838139 | Ga0501036_0838139_159_572 | 137 |
| 1052 | 3300049572 | Ga0501036_0867987 | Ga0501036_0867987_122_535 | 137 |
| 1053 | 3300049572 | Ga0501036_1103135 | Ga0501036_1103135_93_506 | 137 |
| 1054 | 3300049573 | Ga0501037_0000131 | Ga0501037_0000131_64862_65275 | 137 |
| 1055 | 3300049573 | Ga0501037_0000191 | Ga0501037_0000191_51960_52373 | 137 |
| 1056 | 3300049573 | Ga0501037_0000195 | Ga0501037_0000195_54194_54607 | 137 |
| 1057 | 3300049573 | Ga0501037_0014952 | Ga0501037_0014952_4563_4976 | 137 |
| 1058 | 3300049573 | Ga0501037_0067854 | Ga0501037_0067854_928_1341 | 137 |
| 1059 | 3300049573 | Ga0501037_0108318 | Ga0501037_0108318_189_602 | 137 |
| 1060 | 3300049573 | Ga0501037_0158968 | Ga0501037_0158968_745_1158 | 137 |
| 1061 | 3300049573 | Ga0501037_0171288 | Ga0501037_0171288_269_682 | 137 |
| 1062 | 3300049573 | Ga0501037_0208097 | Ga0501037_0208097_881_1294 | 137 |
| 1063 | 3300049573 | Ga0501037_0346999 | Ga0501037_0346999_355_768 | 137 |
| 1064 | 3300049573 | Ga0501037_0382566 | Ga0501037_0382566_365_778 | 137 |
| 1065 | 3300049573 | Ga0501037_0519909 | Ga0501037_0519909_10_423 | 137 |
| 1066 | 3300049574 | Ga0501038_0000109 | Ga0501038_0000109_64862_65275 | 137 |
| 1067 | 3300049574 | Ga0501038_0001299 | Ga0501038_0001299_4628_5041 | 137 |
| 1068 | 3300049574 | Ga0501038_0001882 | Ga0501038_0001882_14433_14846 | 137 |
| 1069 | 3300049574 | Ga0501038_0005274 | Ga0501038_0005274_7156_7569 | 137 |
| 1070 | 3300049574 | Ga0501038_0029459 | Ga0501038_0029459_2542_2955 | 137 |
| 1071 | 3300049574 | Ga0501038_0039812 | Ga0501038_0039812_812_1225 | 137 |
| 1072 | 3300049574 | Ga0501038_0131427 | Ga0501038_0131427_716_1129 | 137 |
| 1073 | 3300049574 | Ga0501038_0132340 | Ga0501038_0132340_933_1346 | 137 |
| 1074 | 3300049574 | Ga0501038_0132662 | Ga0501038_0132662_441_854 | 137 |
| 1075 | 3300049574 | Ga0501038_0169820 | Ga0501038_0169820_350_763 | 137 |
| 1076 | 3300049574 | Ga0501038_0242003 | Ga0501038_0242003_820_1233 | 137 |
| 1077 | 3300049574 | Ga0501038_0309115 | Ga0501038_0309115_626_1039 | 137 |
| 1078 | 3300049575 | Ga0501039_0000080 | Ga0501039_0000080_67654_68067 | 137 |
| 1079 | 3300049575 | Ga0501039_0002279 | Ga0501039_0002279_4528_4941 | 137 |
| 1080 | 3300049575 | Ga0501039_0195543 | Ga0501039_0195543_806_1219 | 137 |
| 1081 | 3300049575 | Ga0501039_0240450 | Ga0501039_0240450_520_933 | 137 |
| 1082 | 3300049575 | Ga0501039_0271682 | Ga0501039_0271682_36_449 | 137 |
| 1083 | 3300049575 | Ga0501039_0525627 | Ga0501039_0525627_248_667 | 137 |
| 1084 | 3300049576 | Ga0501040_0107203 | Ga0501040_0107203_608_1021 | 137 |
| 1085 | 3300049577 | Ga0501041_0089200 | Ga0501041_0089200_826_1239 | 137 |
| 1086 | 3300049577 | Ga0501041_0219781 | Ga0501041_0219781_336_749 | 137 |
| 1087 | 3300049578 | Ga0501042_0403503 | Ga0501042_0403503_351_764 | 137 |
| 1088 | 3300049579 | Ga0501043_0000080 | Ga0501043_0000080_4467_4880 | 137 |
| 1089 | 3300049579 | Ga0501043_0004023 | Ga0501043_0004023_4453_4866 | 137 |
| 1090 | 3300049579 | Ga0501043_0012997 | Ga0501043_0012997_2093_2506 | 137 |
| 1091 | 3300049579 | Ga0501043_0038138 | Ga0501043_0038138_341_754 | 137 |
| 1092 | 3300049579 | Ga0501043_0047851 | Ga0501043_0047851_728_1141 | 137 |
| 1093 | 3300049579 | Ga0501043_0055891 | Ga0501043_0055891_591_1004 | 137 |
| 1094 | 3300049579 | Ga0501043_0060820 | Ga0501043_0060820_2273_2686 | 137 |
| 1095 | 3300049579 | Ga0501043_0089103 | Ga0501043_0089103_50_463 | 137 |
| 1096 | 3300049579 | Ga0501043_0099954 | Ga0501043_0099954_1077_1490 | 137 |
| 1097 | 3300049579 | Ga0501043_0113305 | Ga0501043_0113305_711_1124 | 137 |
| 1098 | 3300049579 | Ga0501043_0126611 | Ga0501043_0126611_1002_1415 | 137 |
| 1099 | 3300049579 | Ga0501043_0260320 | Ga0501043_0260320_822_1235 | 137 |
| 1100 | 3300049579 | Ga0501043_0311955 | Ga0501043_0311955_701_1114 | 137 |
| 1101 | 3300049579 | Ga0501043_0631661 | Ga0501043_0631661_344_757 | 137 |
| 1102 | 3300049580 | Ga0501046_0103794 | Ga0501046_0103794_732_1145 | 137 |
| 1103 | 3300049580 | Ga0501046_0144271 | Ga0501046_0144271_868_1281 | 137 |
| 1104 | 3300049580 | Ga0501046_0242537 | Ga0501046_0242537_519_932 | 137 |
| 1105 | 3300049580 | Ga0501046_0312805 | Ga0501046_0312805_208_621 | 137 |
| 1106 | 3300049581 | Ga0501047_0015743 | Ga0501047_0015743_5677_6090 | 137 |
| 1107 | 3300049581 | Ga0501047_0023054 | Ga0501047_0023054_441_854 | 137 |
| 1108 | 3300049581 | Ga0501047_0023074 | Ga0501047_0023074_4632_5045 | 137 |
| 1109 | 3300049581 | Ga0501047_0100301 | Ga0501047_0100301_1907_2320 | 137 |
| 1110 | 3300049581 | Ga0501047_0127913 | Ga0501047_0127913_148_561 | 137 |
| 1111 | 3300049581 | Ga0501047_0152453 | Ga0501047_0152453_777_1190 | 137 |
| 1112 | 3300049581 | Ga0501047_0176080 | Ga0501047_0176080_288_701 | 137 |
| 1113 | 3300049581 | Ga0501047_0181203 | Ga0501047_0181203_1155_1568 | 137 |
| 1114 | 3300049581 | Ga0501047_0194950 | Ga0501047_0194950_341_754 | 137 |
| 1115 | 3300049581 | Ga0501047_0206504 | Ga0501047_0206504_1369_1782 | 137 |
| 1116 | 3300049581 | Ga0501047_0245096 | Ga0501047_0245096_333_746 | 137 |
| 1117 | 3300049581 | Ga0501047_0318480 | Ga0501047_0318480_885_1298 | 137 |
| 1118 | 3300049581 | Ga0501047_0335131 | Ga0501047_0335131_135_548 | 137 |
| 1119 | 3300049581 | Ga0501047_0353434 | Ga0501047_0353434_778_1191 | 137 |
| 1120 | 3300049581 | Ga0501047_0414952 | Ga0501047_0414952_432_845 | 137 |
| 1121 | 3300049581 | Ga0501047_0776464 | Ga0501047_0776464_255_668 | 137 |
| 1122 | 3300049581 | Ga0501047_1193506 | Ga0501047_1193506_113_526 | 137 |
| 1123 | 3300049581 | Ga0501047_1248537 | Ga0501047_1248537_23_436 | 137 |
| 1124 | 3300049581 | Ga0501047_1265904 | Ga0501047_1265904_17_430 | 137 |
| 1125 | 3300049582 | Ga0501048_0030318 | Ga0501048_0030318_3311_3724 | 137 |
| 1126 | 3300049582 | Ga0501048_0058389 | Ga0501048_0058389_2158_2571 | 137 |
| 1127 | 3300049582 | Ga0501048_0203637 | Ga0501048_0203637_730_1143 | 137 |
| 1128 | 3300049582 | Ga0501048_0235293 | Ga0501048_0235293_169_582 | 137 |
| 1129 | 3300049582 | Ga0501048_0280029 | Ga0501048_0280029_455_868 | 137 |
| 1130 | 3300049583 | Ga0501067_0052681 | Ga0501067_0052681_1412_1825 | 137 |
| 1131 | 3300049583 | Ga0501067_0064853 | Ga0501067_0064853_1236_1649 | 137 |
| 1132 | 3300049583 | Ga0501067_0140339 | Ga0501067_0140339_842_1255 | 137 |
| 1133 | 3300049583 | Ga0501067_0144537 | Ga0501067_0144537_488_901 | 137 |
| 1134 | 3300049583 | Ga0501067_0175550 | Ga0501067_0175550_332_745 | 137 |
| 1135 | 3300049583 | Ga0501067_0286359 | Ga0501067_0286359_407_820 | 137 |
| 1136 | 3300049584 | Ga0501068_0011134 | Ga0501068_0011134_1725_2138 | 137 |
| 1137 | 3300049584 | Ga0501068_0015296 | Ga0501068_0015296_516_929 | 137 |
| 1138 | 3300049584 | Ga0501068_0083047 | Ga0501068_0083047_392_805 | 137 |
| 1139 | 3300049584 | Ga0501068_0175925 | Ga0501068_0175925_64_477 | 137 |
| 1140 | 3300049584 | Ga0501068_0196318 | Ga0501068_0196318_82_495 | 137 |
| 1141 | 3300049584 | Ga0501068_0298881 | Ga0501068_0298881_17_430 | 137 |
| 1142 | 3300049584 | Ga0501068_0307507 | Ga0501068_0307507_292_705 | 137 |
| 1143 | 3300049584 | Ga0501068_0562731 | Ga0501068_0562731_165_578 | 137 |
| 1144 | 3300049584 | Ga0501068_0891881 | Ga0501068_0891881_153_566 | 137 |
| 1145 | 3300049584 | Ga0501068_1037556 | Ga0501068_1037556_69_482 | 137 |
| 1146 | 3300049585 | Ga0501069_0004122 | Ga0501069_0004122_6524_6937 | 137 |
| 1147 | 3300049585 | Ga0501069_0004928 | Ga0501069_0004928_201_614 | 137 |
| 1148 | 3300049585 | Ga0501069_0013201 | Ga0501069_0013201_1276_1689 | 137 |
| 1149 | 3300049585 | Ga0501069_0060723 | Ga0501069_0060723_152_565 | 137 |
| 1150 | 3300049585 | Ga0501069_0122463 | Ga0501069_0122463_593_1006 | 137 |
| 1151 | 3300049585 | Ga0501069_0138940 | Ga0501069_0138940_89_502 | 137 |
| 1152 | 3300049585 | Ga0501069_0306723 | Ga0501069_0306723_149_562 | 137 |
| 1153 | 3300049585 | Ga0501069_0451519 | Ga0501069_0451519_151_564 | 137 |
| 1154 | 3300049585 | Ga0501069_0723195 | Ga0501069_0723195_42_455 | 137 |
| 1155 | 3300049586 | Ga0501070_0001286 | Ga0501070_0001286_6382_6795 | 137 |
| 1156 | 3300049586 | Ga0501070_0006284 | Ga0501070_0006284_4423_4836 | 137 |
| 1157 | 3300049586 | Ga0501070_0006301 | Ga0501070_0006301_5233_5646 | 137 |
| 1158 | 3300049586 | Ga0501070_0011237 | Ga0501070_0011237_5733_6146 | 137 |
| 1159 | 3300049586 | Ga0501070_0014064 | Ga0501070_0014064_1858_2271 | 137 |
| 1160 | 3300049586 | Ga0501070_0025506 | Ga0501070_0025506_2726_3139 | 137 |
| 1161 | 3300049586 | Ga0501070_0040568 | Ga0501070_0040568_616_1029 | 137 |
| 1162 | 3300049586 | Ga0501070_0057678 | Ga0501070_0057678_555_968 | 137 |
| 1163 | 3300049586 | Ga0501070_0060281 | Ga0501070_0060281_2125_2538 | 137 |
| 1164 | 3300049586 | Ga0501070_0171551 | Ga0501070_0171551_487_900 | 137 |
| 1165 | 3300049586 | Ga0501070_0190795 | Ga0501070_0190795_582_995 | 137 |
| 1166 | 3300049586 | Ga0501070_0215956 | Ga0501070_0215956_132_545 | 137 |
| 1167 | 3300049586 | Ga0501070_0247320 | Ga0501070_0247320_152_565 | 137 |
| 1168 | 3300049586 | Ga0501070_0250574 | Ga0501070_0250574_89_502 | 137 |
| 1169 | 3300049586 | Ga0501070_0256784 | Ga0501070_0256784_385_798 | 137 |
| 1170 | 3300049586 | Ga0501070_0373060 | Ga0501070_0373060_596_1009 | 137 |
| 1171 | 3300049586 | Ga0501070_0809439 | Ga0501070_0809439_310_723 | 137 |
| 1172 | 3300049587 | Ga0501071_0046823 | Ga0501071_0046823_1341_1754 | 137 |
| 1173 | 3300049587 | Ga0501071_0101470 | Ga0501071_0101470_426_839 | 137 |
| 1174 | 3300049587 | Ga0501071_0201488 | Ga0501071_0201488_920_1333 | 137 |
| 1175 | 3300049587 | Ga0501071_0288439 | Ga0501071_0288439_487_900 | 137 |
| 1176 | 3300049587 | Ga0501071_0547545 | Ga0501071_0547545_40_453 | 137 |
| 1177 | 3300049587 | Ga0501071_0625049 | Ga0501071_0625049_295_708 | 137 |
| 1178 | 3300049588 | Ga0501072_0338405 | Ga0501072_0338405_768_1181 | 137 |
| 1179 | 3300049588 | Ga0501072_0468150 | Ga0501072_0468150_245_658 | 137 |
| 1180 | 3300049588 | Ga0501072_0476060 | Ga0501072_0476060_13_426 | 137 |
| 1181 | 3300049588 | Ga0501072_0509121 | Ga0501072_0509121_146_559 | 137 |
| 1182 | 3300049589 | Ga0501073_0000083 | Ga0501073_0000083_43914_44327 | 137 |
| 1183 | 3300049589 | Ga0501073_0015881 | Ga0501073_0015881_3042_3455 | 137 |
| 1184 | 3300049589 | Ga0501073_0023164 | Ga0501073_0023164_3559_3972 | 137 |
| 1185 | 3300049589 | Ga0501073_0058581 | Ga0501073_0058581_2178_2591 | 137 |
| 1186 | 3300049589 | Ga0501073_0117358 | Ga0501073_0117358_710_1123 | 137 |
| 1187 | 3300049589 | Ga0501073_0128507 | Ga0501073_0128507_1226_1639 | 137 |
| 1188 | 3300049589 | Ga0501073_0153236 | Ga0501073_0153236_915_1328 | 137 |
| 1189 | 3300049589 | Ga0501073_0294738 | Ga0501073_0294738_82_495 | 137 |
| 1190 | 3300049589 | Ga0501073_0955702 | Ga0501073_0955702_11_424 | 137 |
| 1191 | 3300049590 | Ga0501074_0002583 | Ga0501074_0002583_4446_4859 | 137 |
| 1192 | 3300049590 | Ga0501074_0012668 | Ga0501074_0012668_1196_1609 | 137 |
| 1193 | 3300049590 | Ga0501074_0035107 | Ga0501074_0035107_1210_1623 | 137 |
| 1194 | 3300049590 | Ga0501074_0174237 | Ga0501074_0174237_826_1239 | 137 |
| 1195 | 3300049590 | Ga0501074_0187163 | Ga0501074_0187163_535_948 | 137 |
| 1196 | 3300049590 | Ga0501074_0215216 | Ga0501074_0215216_116_529 | 137 |
| 1197 | 3300049590 | Ga0501074_0462343 | Ga0501074_0462343_361_774 | 137 |
| 1198 | 3300049590 | Ga0501074_1037662 | Ga0501074_1037662_62_475 | 137 |
| 1199 | 3300049591 | Ga0501075_0515130 | Ga0501075_0515130_227_640 | 137 |
| 1200 | 3300049591 | Ga0501075_1173828 | Ga0501075_1173828_49_465 | 137 |
| 1201 | 3300049592 | Ga0501076_0347691 | Ga0501076_0347691_220_633 | 137 |
| 1202 | 3300049592 | Ga0501076_1553601 | Ga0501076_1553601_34_447 | 137 |
| 1203 | 3300049593 | Ga0501077_0000088 | Ga0501077_0000088_14675_15088 | 137 |
| 1204 | 3300049741 | Ga0501079_0026674 | Ga0501079_0026674_1857_2270 | 137 |
| 1205 | 3300049741 | Ga0501079_0258482 | Ga0501079_0258482_214_627 | 137 |
| 1206 | 3300049741 | Ga0501079_0472590 | Ga0501079_0472590_538_951 | 137 |
| 1207 | 3300049741 | Ga0501079_0657281 | Ga0501079_0657281_34_447 | 137 |
| 1208 | 3300049741 | Ga0501079_0718271 | Ga0501079_0718271_303_716 | 137 |
| 1209 | 3300049741 | Ga0501079_0847117 | Ga0501079_0847117_284_697 | 137 |
| 1210 | 3300049742 | Ga0501080_0003162 | Ga0501080_0003162_7663_8076 | 137 |
| 1211 | 3300049742 | Ga0501080_0004752 | Ga0501080_0004752_437_850 | 137 |
| 1212 | 3300049742 | Ga0501080_0009625 | Ga0501080_0009625_7511_7924 | 137 |
| 1213 | 3300049742 | Ga0501080_0010339 | Ga0501080_0010339_7045_7458 | 137 |
| 1214 | 3300049742 | Ga0501080_0015400 | Ga0501080_0015400_5716_6129 | 137 |
| 1215 | 3300049742 | Ga0501080_0017194 | Ga0501080_0017194_4685_5098 | 137 |
| 1216 | 3300049742 | Ga0501080_0102533 | Ga0501080_0102533_2084_2497 | 137 |
| 1217 | 3300049742 | Ga0501080_0181593 | Ga0501080_0181593_1027_1440 | 137 |
| 1218 | 3300049742 | Ga0501080_0181639 | Ga0501080_0181639_915_1328 | 137 |
| 1219 | 3300049742 | Ga0501080_0213642 | Ga0501080_0213642_599_1012 | 137 |
| 1220 | 3300049742 | Ga0501080_0229455 | Ga0501080_0229455_16_429 | 137 |
| 1221 | 3300049742 | Ga0501080_0238618 | Ga0501080_0238618_714_1127 | 137 |
| 1222 | 3300049742 | Ga0501080_0363496 | Ga0501080_0363496_194_607 | 137 |
| 1223 | 3300049742 | Ga0501080_0443693 | Ga0501080_0443693_723_1136 | 137 |
| 1224 | 3300049742 | Ga0501080_0756129 | Ga0501080_0756129_311_724 | 137 |
| 1225 | 3300049742 | Ga0501080_0850478 | Ga0501080_0850478_164_577 | 137 |
| 1226 | 3300049742 | Ga0501080_1386239 | Ga0501080_1386239_112_525 | 137 |
| 1227 | 3300049744 | Ga0501083_0001214 | Ga0501083_0001214_12572_12985 | 137 |
| 1228 | 3300049744 | Ga0501083_0020957 | Ga0501083_0020957_1534_1947 | 137 |
| 1229 | 3300049744 | Ga0501083_0187035 | Ga0501083_0187035_807_1220 | 137 |
| 1230 | 3300049744 | Ga0501083_0192449 | Ga0501083_0192449_436_849 | 137 |
| 1231 | 3300049744 | Ga0501083_0255597 | Ga0501083_0255597_156_569 | 137 |
| 1232 | 3300049744 | Ga0501083_0861676 | Ga0501083_0861676_155_568 | 137 |
| 1233 | 3300049744 | Ga0501083_1087553 | Ga0501083_1087553_16_429 | 137 |
| 1234 | 3300049822 | Ga0501035_0000160 | Ga0501035_0000160_4443_4856 | 137 |
| 1235 | 3300049822 | Ga0501035_0002188 | Ga0501035_0002188_14433_14846 | 137 |
| 1236 | 3300049822 | Ga0501035_0023586 | Ga0501035_0023586_4777_5190 | 137 |
| 1237 | 3300049822 | Ga0501035_0037179 | Ga0501035_0037179_55_468 | 137 |
| 1238 | 3300049822 | Ga0501035_0043204 | Ga0501035_0043204_2689_3102 | 137 |
| 1239 | 3300049822 | Ga0501035_0055030 | Ga0501035_0055030_3126_3539 | 137 |
| 1240 | 3300049822 | Ga0501035_0079674 | Ga0501035_0079674_488_901 | 137 |
| 1241 | 3300049822 | Ga0501035_0099561 | Ga0501035_0099561_1463_1876 | 137 |
| 1242 | 3300049822 | Ga0501035_0115591 | Ga0501035_0115591_1380_1793 | 137 |
| 1243 | 3300049822 | Ga0501035_0115964 | Ga0501035_0115964_403_816 | 137 |
| 1244 | 3300049822 | Ga0501035_0122392 | Ga0501035_0122392_445_858 | 137 |
| 1245 | 3300049822 | Ga0501035_0139961 | Ga0501035_0139961_1538_1951 | 137 |
| 1246 | 3300049822 | Ga0501035_0150305 | Ga0501035_0150305_833_1246 | 137 |
| 1247 | 3300049822 | Ga0501035_0161926 | Ga0501035_0161926_742_1155 | 137 |
| 1248 | 3300049822 | Ga0501035_0213546 | Ga0501035_0213546_239_652 | 137 |
| 1249 | 3300049822 | Ga0501035_1531283 | Ga0501035_1531283_16_429 | 137 |
| 1250 | 3300049823 | Ga0501044_0000234 | Ga0501044_0000234_64862_65275 | 137 |
| 1251 | 3300049823 | Ga0501044_0000544 | Ga0501044_0000544_44035_44448 | 137 |
| 1252 | 3300049823 | Ga0501044_0009229 | Ga0501044_0009229_4553_4966 | 137 |
| 1253 | 3300049823 | Ga0501044_0009814 | Ga0501044_0009814_2121_2534 | 137 |
| 1254 | 3300049823 | Ga0501044_0018610 | Ga0501044_0018610_5442_5855 | 137 |
| 1255 | 3300049823 | Ga0501044_0024732 | Ga0501044_0024732_2599_3012 | 137 |
| 1256 | 3300049823 | Ga0501044_0025827 | Ga0501044_0025827_5285_5698 | 137 |
| 1257 | 3300049823 | Ga0501044_0033457 | Ga0501044_0033457_2548_2961 | 137 |
| 1258 | 3300049823 | Ga0501044_0036148 | Ga0501044_0036148_883_1296 | 137 |
| 1259 | 3300049823 | Ga0501044_0082042 | Ga0501044_0082042_186_599 | 137 |
| 1260 | 3300049823 | Ga0501044_0114449 | Ga0501044_0114449_1681_2094 | 137 |
| 1261 | 3300049823 | Ga0501044_0154439 | Ga0501044_0154439_1747_2160 | 137 |
| 1262 | 3300049823 | Ga0501044_0191494 | Ga0501044_0191494_710_1123 | 137 |
| 1263 | 3300049823 | Ga0501044_0232392 | Ga0501044_0232392_898_1311 | 137 |
| 1264 | 3300049823 | Ga0501044_0259727 | Ga0501044_0259727_656_1069 | 137 |
| 1265 | 3300049823 | Ga0501044_0368868 | Ga0501044_0368868_922_1335 | 137 |
| 1266 | 3300049823 | Ga0501044_0440662 | Ga0501044_0440662_645_1058 | 137 |
| 1267 | 3300049823 | Ga0501044_0525585 | Ga0501044_0525585_493_906 | 137 |
| 1268 | 3300049823 | Ga0501044_0592359 | Ga0501044_0592359_172_585 | 137 |
| 1269 | 3300049823 | Ga0501044_1020005 | Ga0501044_1020005_15_428 | 137 |
| 1270 | 3300049824 | Ga0501045_0001715 | Ga0501045_0001715_12080_12493 | 137 |
| 1271 | 3300049824 | Ga0501045_0485235 | Ga0501045_0485235_203_616 | 137 |
| 1272 | 3300050490 | nmdc:mga03n38_14252_c1 | nmdc:mga03n38_14252_c1_1922_2335 | 137 |
| 1273 | 3300050490 | nmdc:mga03n38_21372_c1 | nmdc:mga03n38_21372_c1_398_811 | 137 |
| 1274 | 3300050490 | nmdc:mga03n38_429542_c1 | nmdc:mga03n38_429542_c1_158_571 | 137 |
| 1275 | 3300050490 | nmdc:mga03n38_746046_c1 | nmdc:mga03n38_746046_c1_88_501 | 137 |
| 1276 | 3300050491 | nmdc:mga00v17_512278_c1 | nmdc:mga00v17_512278_c1_240_653 | 137 |
| 1277 | 3300050492 | nmdc:mga0yw44_18471_c1 | nmdc:mga0yw44_18471_c1_2225_2638 | 137 |
| 1278 | 3300050492 | nmdc:mga0yw44_212922_c1 | nmdc:mga0yw44_212922_c1_537_950 | 137 |
| 1279 | 3300050492 | nmdc:mga0yw44_212931_c1 | nmdc:mga0yw44_212931_c1_467_880 | 137 |
| 1280 | 3300050492 | nmdc:mga0yw44_542325_c1 | nmdc:mga0yw44_542325_c1_22_435 | 137 |
| 1281 | 3300050492 | nmdc:mga0yw44_60745_c1 | nmdc:mga0yw44_60745_c1_1531_1944 | 137 |
| 1282 | 3300050493 | nmdc:mga0k408_676254_c1 | nmdc:mga0k408_676254_c1_15_428 | 137 |
| 1283 | 3300050494 | nmdc:mga06z11_112461_c1 | nmdc:mga06z11_112461_c1_184_597 | 137 |
| 1284 | 3300050494 | nmdc:mga06z11_119069_c1 | nmdc:mga06z11_119069_c1_254_667 | 137 |
| 1285 | 3300050494 | nmdc:mga06z11_157752_c1 | nmdc:mga06z11_157752_c1_464_877 | 137 |
| 1286 | 3300050494 | nmdc:mga06z11_395338_c1 | nmdc:mga06z11_395338_c1_308_721 | 137 |
| 1287 | 3300050494 | nmdc:mga06z11_787034_c1 | nmdc:mga06z11_787034_c1_124_537 | 137 |
| 1288 | 3300050495 | nmdc:mga04h51_131147_c1 | nmdc:mga04h51_131147_c1_194_607 | 137 |
| 1289 | 3300050495 | nmdc:mga04h51_255960_c1 | nmdc:mga04h51_255960_c1_10_423 | 137 |
| 1290 | 3300050495 | nmdc:mga04h51_7863_c1 | nmdc:mga04h51_7863_c1_502_915 | 137 |
| 1291 | 3300050496 | nmdc:mga07m45_26183_c1 | nmdc:mga07m45_26183_c1_2476_2889 | 137 |
| 1292 | 3300050496 | nmdc:mga07m45_354090_c1 | nmdc:mga07m45_354090_c1_311_724 | 137 |
| 1293 | 3300050496 | nmdc:mga07m45_5559_c1 | nmdc:mga07m45_5559_c1_1021_1434 | 137 |
| 1294 | 3300050509 | nmdc:mga0qj67_299_c1 | nmdc:mga0qj67_299_c1_32896_33309 | 137 |
| 1295 | 3300050510 | nmdc:mga06r32_1385318_c1 | nmdc:mga06r32_1385318_c1_193_606 | 137 |
| 1296 | 3300050513 | nmdc:mga0rr50_919365_c1 | nmdc:mga0rr50_919365_c1_109_522 | 137 |
| 1297 | 3300050515 | nmdc:mga0a205_654184_c1 | nmdc:mga0a205_654184_c1_113_526 | 137 |
| 1298 | 3300050516 | nmdc:mga0sz30_14247_c1 | nmdc:mga0sz30_14247_c1_1717_2130 | 137 |
| 1299 | 3300050516 | nmdc:mga0sz30_30979_c1 | nmdc:mga0sz30_30979_c1_1028_1441 | 137 |
| 1300 | 3300053077 | Ga0495601_0216675 | Ga0495601_0216675_488_901 | 137 |
| 1301 | 3300053079 | Ga0500610_0168190 | Ga0500610_0168190_302_715 | 137 |
| 1302 | 3300053083 | Ga0495655_0237727 | Ga0495655_0237727_141_554 | 137 |
| 1303 | 3300053091 | Ga0500647_0070822 | Ga0500647_0070822_637_1050 | 137 |
| 1304 | 3300053094 | Ga0500566_0000320 | Ga0500566_0000320_20727_21140 | 137 |
| 1305 | 3300053095 | Ga0500640_027849 | Ga0500640_027849_237_650 | 137 |
| 1306 | 3300053098 | Ga0500650_0280870 | Ga0500650_0280870_232_645 | 137 |
| 1307 | 3300053104 | Ga0500556_0000009 | Ga0500556_0000009_148549_148962 | 137 |
| 1308 | 3300053111 | Ga0500572_001453 | Ga0500572_001453_3714_4127 | 137 |
| 1309 | 3300053111 | Ga0500572_006785 | Ga0500572_006785_2187_2600 | 137 |
| 1310 | 3300053113 | Ga0500580_223785 | Ga0500580_223785_144_557 | 137 |
| 1311 | 3300053115 | Ga0500591_074354 | Ga0500591_074354_519_932 | 137 |
| 1312 | 3300053119 | Ga0500595_145202 | Ga0500595_145202_93_506 | 137 |
| 1313 | 3300053122 | Ga0500608_029012 | Ga0500608_029012_1547_1960 | 137 |
| 1314 | 3300053125 | Ga0500618_053140 | Ga0500618_053140_397_819 | 137 |
| 1315 | 3300053134 | Ga0500658_0019134 | Ga0500658_0019134_517_930 | 137 |
| 1316 | 3300053136 | Ga0500559_0007811 | Ga0500559_0007811_3674_4087 | 137 |
| 1317 | 3300053136 | Ga0500559_0012275 | Ga0500559_0012275_255_668 | 137 |
| 1318 | 3300053136 | Ga0500559_0013950 | Ga0500559_0013950_322_735 | 137 |
| 1319 | 3300053139 | Ga0500568_0001953 | Ga0500568_0001953_7701_8114 | 137 |
| 1320 | 3300053139 | Ga0500568_0231839 | Ga0500568_0231839_120_533 | 137 |
| 1321 | 3300053146 | Ga0500588_0004535 | Ga0500588_0004535_1023_1442 | 137 |
| 1322 | 3300053150 | Ga0500603_003307 | Ga0500603_003307_2154_2567 | 137 |
| 1323 | 3300053153 | Ga0500616_0024839 | Ga0500616_0024839_1172_1585 | 137 |
| 1324 | 3300053155 | Ga0500620_004601 | Ga0500620_004601_780_1193 | 137 |
| 1325 | 3300053158 | Ga0500627_0402866 | Ga0500627_0402866_105_518 | 137 |
| 1326 | 3300053159 | Ga0500630_005936 | Ga0500630_005936_1123_1536 | 137 |
| 1327 | 3300053162 | Ga0500638_024655 | Ga0500638_024655_2175_2588 | 137 |
| 1328 | 3300053163 | Ga0500639_002134 | Ga0500639_002134_872_1285 | 137 |
| 1329 | 3300053163 | Ga0500639_019780 | Ga0500639_019780_241_654 | 137 |
| 1330 | 3300053177 | Ga0500636_0419595 | Ga0500636_0419595_74_487 | 137 |
| 1331 | 3300053178 | Ga0500637_0172514 | Ga0500637_0172514_710_1123 | 137 |
| 1332 | 3300053730 | Ga0500645_074069 | Ga0500645_074069_414_827 | 137 |
| 1333 | 3300053731 | Ga0500609_013602 | Ga0500609_013602_414_827 | 137 |
| 1334 | 3300053731 | Ga0500609_020675 | Ga0500609_020675_83_502 | 137 |
| 1335 | 3300053732 | Ga0500656_009071 | Ga0500656_009071_97_528 | 137 |
| 1336 | 3300053735 | Ga0500596_003981 | Ga0500596_003981_440_853 | 137 |
| 1337 | 3300053735 | Ga0500596_005235 | Ga0500596_005235_1397_1810 | 137 |
| 1338 | 3300054114 | Ga0501084_0023050 | Ga0501084_0023050_2354_2767 | 137 |
| 1339 | 3300054114 | Ga0501084_0582995 | Ga0501084_0582995_517_930 | 137 |
| 1340 | 3300054114 | Ga0501084_1010364 | Ga0501084_1010364_182_595 | 137 |
| 1341 | 3300059478 | Ga0587093_012340 | Ga0587093_012340_137_550 | 137 |
| 1342 | 3300059490 | Ga0587066_014974 | Ga0587066_014974_670_1083 | 137 |
| 1343 | 3300059490 | Ga0587066_040569 | Ga0587066_040569_114_527 | 137 |
| 1344 | 3300059490 | Ga0587066_081737 | Ga0587066_081737_127_540 | 137 |
| 1345 | 3300059491 | Ga0587070_012050 | Ga0587070_012050_124_537 | 137 |
| 1346 | 3300059491 | Ga0587070_012736 | Ga0587070_012736_846_1262 | 137 |
| 1347 | 3300059491 | Ga0587070_038250 | Ga0587070_038250_81_494 | 137 |
| 1348 | 3300059493 | Ga0587077_011314 | Ga0587077_011314_972_1385 | 137 |
| 1349 | 3300059493 | Ga0587077_110366 | Ga0587077_110366_150_563 | 137 |
| 1350 | 3300059503 | Ga0587080_014343 | Ga0587080_014343_88_501 | 137 |
| 1351 | 3300059504 | Ga0587082_043435 | Ga0587082_043435_27_440 | 137 |
| 1352 | 3300059504 | Ga0587082_109234 | Ga0587082_109234_65_478 | 137 |
| 1353 | 3300059505 | Ga0587083_0245757 | Ga0587083_0245757_28_441 | 137 |
| 1354 | 3300059507 | Ga0587086_019549 | Ga0587086_019549_51_464 | 137 |
| 1355 | 3300059508 | Ga0587088_148311 | Ga0587088_148311_32_445 | 137 |
| 1356 | 3300059512 | Ga0587092_082209 | Ga0587092_082209_83_496 | 137 |
| 1357 | 3300059513 | Ga0587094_007473 | Ga0587094_007473_560_973 | 137 |
| 1358 | 3300059605 | Ga0587106_013481 | Ga0587106_013481_102_515 | 137 |
| 1359 | 3300059622 | Ga0587099_011882 | Ga0587099_011882_341_754 | 137 |
| 1360 | 3300059623 | Ga0587101_003234 | Ga0587101_003234_621_1034 | 137 |
| 1361 | 3300059639 | Ga0587062_001756 | Ga0587062_001756_1132_1545 | 137 |
| 1362 | 3300059639 | Ga0587062_114779 | Ga0587062_114779_108_521 | 137 |
| 1363 | 3300059642 | Ga0587069_017394 | Ga0587069_017394_405_818 | 137 |
| 1364 | 3300059643 | Ga0587072_013827 | Ga0587072_013827_154_567 | 137 |
| 1365 | 3300059643 | Ga0587072_027025 | Ga0587072_027025_64_480 | 137 |
| 1366 | 3300059643 | Ga0587072_031440 | Ga0587072_031440_515_928 | 137 |
| 1367 | 3300059644 | Ga0587075_014892 | Ga0587075_014892_41_454 | 137 |
| 1368 | 3300059645 | Ga0587076_045829 | Ga0587076_045829_158_571 | 137 |
| 1369 | 3300059646 | Ga0587078_006461 | Ga0587078_006461_650_1063 | 137 |
| 1370 | 3300059647 | Ga0587079_027730 | Ga0587079_027730_86_502 | 137 |
| 1371 | 3300059652 | Ga0587107_000278 | Ga0587107_000278_70_483 | 137 |
| 1372 | 3300059655 | Ga0587114_051809 | Ga0587114_051809_241_654 | 137 |
| 1373 | 3300059660 | Ga0587124_023994 | Ga0587124_023994_66_479 | 137 |
| 1374 | 3300060344 | Ga0587071_014153 | Ga0587071_014153_836_1249 | 137 |
| 1375 | 3300060344 | Ga0587071_062609 | Ga0587071_062609_27_440 | 137 |
| 1376 | 3300060346 | Ga0587111_0030774 | Ga0587111_0030774_518_931 | 137 |
| 1377 | 3300060353 | Ga0501082_0049749 | Ga0501082_0049749_1696_2109 | 137 |
| 1378 | 3300060353 | Ga0501082_0161198 | Ga0501082_0161198_678_1091 | 137 |
| 1379 | 3300060353 | Ga0501082_0220581 | Ga0501082_0220581_828_1241 | 137 |
| 1380 | 3300060353 | Ga0501082_0253081 | Ga0501082_0253081_603_1016 | 137 |
| 1381 | 3300060353 | Ga0501082_0689903 | Ga0501082_0689903_430_843 | 137 |
| 1382 | 3300061719 | Ga0466962_0535006 | Ga0466962_0535006_24_440 | 137 |
| 1383 | 3300061734 | Ga0530510_0407417 | Ga0530510_0407417_231_644 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7of3-assembly1.cif.gz_N | structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 (dataset2). | 0.8486 | 30 | 134 |
| 7ods-assembly1.cif.gz_N | state b of the human mitoribosomal large subunit assembly intermediate | 0.8241 | 30 | 134 |
| 7o9m-assembly1.cif.gz_N | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module | 0.8228 | 30 | 134 |
| 8eui-assembly1.cif.gz_I | ytm1 associated nascent 60s ribosome (-fkbp39) state 3 | 0.8127 | 32 | 132 |
| 7odr-assembly1.cif.gz_N | state a of the human mitoribosomal large subunit assembly intermediate | 0.8006 | 30 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6gbzM01 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 | 0.8831 | 29 | 137 | 3.90.1170.10 |
| 6gbzM01 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 | 0.8271 | 29 | 137 | 3.90.1170.10 |
| af_Q9Y822_37_214_3.90.1170.10 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 | 0.7825 | 27 | 133 | 3.90.1170.10 |
| 6qulN01 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 | 0.7753 | 24 | 137 | 3.90.1170.10 |
| 4kbuQ01 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 | 0.7746 | 28 | 136 | 3.90.1170.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R6WWT8-F1-model_v4 | Uncharacterized protein | 0.8463 | 32 | 137 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G8DKE1-F1-model_v4 | Ribosomal protein L16 | 0.818 | 29 | 137 |
GO:0003735
GO:0005739 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1Q6VHX4-F1-model_v4 | 50S ribosomal protein L16 | 0.8172 | 30 | 137 |
GO:0000049
GO:0003735 GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A0K2RWM8-F1-model_v4 | Ribosomal protein L16 | 0.8166 | 29 | 133 |
GO:0003735
GO:0005739 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A5B9RSE0-F1-model_v4 | 50S ribosomal protein L16, chloroplastic | 0.8162 | 30 | 135 |
GO:0003735
GO:0005762 GO:0009507 GO:0019843 GO:0032543 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar