F493536

General Info

Members Datasets Scaffolds Average Seq Length
1383 752 1083 136

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10826117|Ga0157377_108261172
Length 145
Sequence MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRAITREMKRAGRVWIRIFPDVPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDGVNDETAREALRLGAGKLPIKTKVVTRTDAGLTMEVVL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
15 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
16 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
17 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
18 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
19 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
20 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
21 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
22 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
23 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
24 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
25 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
26 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
27 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
28 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
29 2738543024 Aminobacter sp. AP02 Isolate Unclassified
30 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
31 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
32 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
33 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
34 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
35 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
36 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
37 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
38 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
39 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
40 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
41 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
42 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
43 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
44 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
45 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
46 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
47 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
48 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
49 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
50 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
51 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
52 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
53 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
54 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
55 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
56 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
57 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
58 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
59 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
60 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
61 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
62 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
63 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
64 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
65 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
66 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
67 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
68 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
69 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
70 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
71 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
72 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
73 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
74 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
75 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
76 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
77 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
78 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
79 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
80 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
81 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
82 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
83 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
84 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
85 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
86 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
87 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
88 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
89 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
90 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
91 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
92 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
93 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
94 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
95 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
96 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
97 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
98 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
99 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
100 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
101 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
102 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
103 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
104 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
105 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
106 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
107 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
108 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
109 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
110 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
111 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
112 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
113 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
114 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
115 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
116 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
117 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
118 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
119 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
120 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
121 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
122 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
123 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
124 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
125 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
126 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
127 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
128 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
129 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
130 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
131 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
132 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
133 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
134 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
135 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
136 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
137 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
138 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
139 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
140 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
141 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
142 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
143 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
144 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
145 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
146 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
147 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
148 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
149 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
150 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
151 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
152 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
153 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
154 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
155 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
156 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
157 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
158 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
159 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
160 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
161 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
162 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
163 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
164 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
165 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
166 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
167 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
168 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
169 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
170 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
171 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
172 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
173 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
174 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
175 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
176 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
177 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
178 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
179 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
180 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
181 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
182 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
183 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
184 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
185 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
186 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
187 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
188 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
189 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
190 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
191 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
192 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
193 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
194 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
195 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
196 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
197 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
198 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
199 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
200 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
201 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
202 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
203 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
204 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
205 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
206 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
207 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
208 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
209 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
210 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
211 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
212 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
213 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
214 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
215 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
216 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
217 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
218 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
219 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
220 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
221 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
222 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
223 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
224 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
225 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
226 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
227 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
228 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
229 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
230 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
231 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
232 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
233 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
234 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
235 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
236 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
237 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
238 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
239 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
240 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
241 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
242 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
243 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
244 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
245 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
246 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
247 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
248 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
249 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
250 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
251 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
252 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
253 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
254 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
255 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
256 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
257 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
258 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
259 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
260 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
261 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
262 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
263 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
264 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
265 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
266 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
267 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
268 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
269 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
270 3004167301 Mesorhizobium loti 582 Isolate Unclassified
271 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
272 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
273 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
274 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
275 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
276 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
277 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
278 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
279 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
280 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
281 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
282 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
283 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
284 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
285 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
286 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
287 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
288 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
289 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
290 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
291 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
292 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
293 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
294 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
295 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
296 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
297 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
298 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
299 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
300 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
301 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
302 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
303 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
304 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
305 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
306 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
307 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
308 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
309 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
310 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
311 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
312 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
313 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
314 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
315 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
316 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
317 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
318 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
319 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
320 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
321 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
322 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
323 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
324 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
325 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
326 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
327 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
328 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
329 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
330 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
331 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
332 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
333 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
334 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
335 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
336 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
337 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
338 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
339 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
340 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
341 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
342 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
343 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
344 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
345 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
346 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
347 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
348 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
349 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
350 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
351 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
352 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
353 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
354 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
355 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
356 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
357 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
358 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
359 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
360 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
361 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
362 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
363 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
364 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
365 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
366 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
367 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
368 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
369 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
370 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
371 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
372 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
373 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
374 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
375 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
376 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
377 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
378 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
379 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
380 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
381 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
382 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
383 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
384 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
385 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
386 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
387 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
388 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
389 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
390 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
391 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
394 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
395 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
397 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
398 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
451 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
452 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
455 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
456 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
457 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
458 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
459 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
460 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
461 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
462 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
463 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
464 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
465 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
466 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
467 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
468 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
469 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
470 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
471 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
472 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
473 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
474 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
475 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
476 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
477 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
478 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
479 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
480 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
481 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
482 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
483 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
484 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
485 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
486 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
487 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
488 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
489 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
490 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
491 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
492 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
493 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
494 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
495 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
496 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
497 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
498 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
499 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
500 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
501 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
502 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
503 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
504 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
505 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
506 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
507 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
508 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
509 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
510 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
511 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
512 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
513 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
514 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
515 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
516 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
517 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
518 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
519 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
520 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
521 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
522 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
523 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
524 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
525 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
526 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
527 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
528 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
529 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
530 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
531 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
532 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
533 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
534 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
535 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
536 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
537 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
538 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
539 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
540 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
541 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
542 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
543 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
544 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
545 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
546 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
547 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
548 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
549 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
550 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
551 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
552 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
553 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
554 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
555 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
556 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
557 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
558 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
559 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
560 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
561 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
562 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
563 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
564 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
565 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
566 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
567 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
568 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
569 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
570 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
571 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
572 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
573 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
574 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
575 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
576 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
577 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
578 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
579 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
580 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
581 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
582 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
583 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
584 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
585 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
586 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
587 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
588 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
589 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
590 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
591 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
592 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
593 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
594 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
595 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
596 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
597 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
598 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
599 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
600 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
601 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
602 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
603 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
604 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
605 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
606 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
607 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
608 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
609 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
610 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
611 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
612 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
613 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
614 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
615 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
616 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
617 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
618 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
619 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
622 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
630 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
636 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
639 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
640 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
641 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
642 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
643 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
644 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
645 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
646 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
647 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
648 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
649 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
650 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
651 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
652 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
653 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
654 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
655 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
656 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
657 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
659 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
660 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
661 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
662 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
663 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
664 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
665 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
666 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
667 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
668 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
669 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
670 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
671 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
672 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
673 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
674 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
675 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
676 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
677 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
678 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
679 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
680 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
681 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
682 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
683 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
684 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
685 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
686 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
687 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
688 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
689 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
690 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
691 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
692 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
693 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
694 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
695 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
696 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
697 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
698 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
699 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
700 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
701 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
702 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
703 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
704 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
705 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
706 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
733 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
734 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
735 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
736 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
737 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
738 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
739 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
740 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
741 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
742 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
743 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
744 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
745 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
746 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
747 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
748 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
749 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
750 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
751 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
752 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.05
Metatranscriptomes 3.25
Isolates 21.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 17.64
Rhizoplane 1.81
Rhizosphere 65.22
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011508 3300001979 Bacteria 3365
2 JGI24739J22299_10011564 3300001989 Bacteria 3258
3 JGI24739J22299_10023219 3300001989 Bacteria 2194
4 JGI24737J22298_10065756 3300001990 Bacteria 1086
5 JGI25156J39149_1004694 3300002705 Bacteria 4104
6 JGI25157J39369_1002241 3300002741 Bacteria 5220
7 JGI25406J46586_10001918 3300003203 Bacteria 9806
8 JGI25165J46597_1001303 3300003214 Bacteria 14268
9 Ga0055542_1002774 3300003762 Bacteria 5300
10 Ga0055529_1005671 3300003763 Bacteria 1787
11 Ga0070658_10183900 3300005327 Bacteria 1759
12 Ga0070676_10143888 3300005328 Bacteria 1520
13 Ga0068869_100096159 3300005334 Bacteria 2235
14 Ga0068869_101231623 3300005334 Bacteria 658
15 Ga0070666_10089881 3300005335 Bacteria 2108
16 Ga0070682_100255530 3300005337 Bacteria 1265
17 Ga0070682_101760505 3300005337 Bacteria 540
18 Ga0068868_100073957 3300005338 Bacteria 2721
19 Ga0068868_101574763 3300005338 Bacteria 617
20 Ga0070660_100981005 3300005339 Bacteria 714
21 Ga0070689_100111476 3300005340 Bacteria 2176
22 Ga0070687_100094508 3300005343 Bacteria 1660
23 Ga0070661_100021028 3300005344 Bacteria 4658
24 Ga0070661_100049078 3300005344 Bacteria 3090
25 Ga0070675_100203748 3300005354 Bacteria 1717
26 Ga0070675_100559861 3300005354 Bacteria 1034
27 Ga0070675_100763812 3300005354 Bacteria 882
28 Ga0070671_100280251 3300005355 Bacteria 1418
29 Ga0070674_100294493 3300005356 Bacteria 1291
30 Ga0070673_100326000 3300005364 Bacteria 1357
31 Ga0070688_100209230 3300005365 Bacteria 1369
32 Ga0070688_100394795 3300005365 Bacteria 1023
33 Ga0070659_100338681 3300005366 Bacteria 1260
34 Ga0070659_100689668 3300005366 Bacteria 882
35 Ga0070667_100277362 3300005367 Bacteria 1505
36 Ga0070709_10020478 3300005434 Bacteria 3837
37 Ga0070709_10053418 3300005434 Bacteria 2544
38 Ga0070714_100333680 3300005435 Bacteria 1421
39 Ga0070714_100851782 3300005435 Bacteria 884
40 Ga0070714_101275745 3300005435 Bacteria 717
41 Ga0070713_100054584 3300005436 Bacteria 3316
42 Ga0070713_101421033 3300005436 Bacteria 673
43 Ga0070710_10072682 3300005437 Bacteria 1986
44 Ga0070705_100594703 3300005440 Bacteria 855
45 Ga0070663_100031905 3300005455 Bacteria 3626
46 Ga0070663_100105054 3300005455 Bacteria 2113
47 Ga0070663_100151353 3300005455 Bacteria 1779
48 Ga0070663_101334560 3300005455 Bacteria 634
49 Ga0070678_101419075 3300005456 Bacteria 649
50 Ga0070678_101904622 3300005456 Bacteria 561
51 Ga0070662_100137792 3300005457 Bacteria 1888
52 Ga0070681_10742830 3300005458 Bacteria 898
53 Ga0070698_100134303 3300005471 Bacteria 2429
54 Ga0070679_100469604 3300005530 Bacteria 1202
55 Ga0070684_101259428 3300005535 Bacteria 696
56 Ga0070684_101272144 3300005535 Bacteria 692
57 Ga0070697_100657013 3300005536 Bacteria 923
58 Ga0068853_100000888 3300005539 Bacteria 20812
59 Ga0068853_100114801 3300005539 Bacteria 2396
60 Ga0068853_100269462 3300005539 Bacteria 1567
61 Ga0068853_100445767 3300005539 Bacteria 1217
62 Ga0070665_100006166 3300005548 Bacteria 12264
63 Ga0070665_100319540 3300005548 Bacteria 1557
64 Ga0068855_100047378 3300005563 Bacteria 5078
65 Ga0068855_100132159 3300005563 Bacteria 2849
66 Ga0068855_100326596 3300005563 Bacteria 1694
67 Ga0068855_100420269 3300005563 Bacteria 1462
68 Ga0068855_101424104 3300005563 Bacteria 714
69 Ga0070664_100552558 3300005564 Bacteria 1065
70 Ga0068857_100458367 3300005577 Bacteria 1193
71 Ga0068857_100559042 3300005577 Bacteria 1078
72 Ga0068857_100904146 3300005577 Bacteria 847
73 Ga0068854_100225910 3300005578 Bacteria 1483
74 Ga0068854_100354078 3300005578 Bacteria 1202
75 Ga0068856_100081776 3300005614 Bacteria 3205
76 Ga0068856_100114919 3300005614 Bacteria 2690
77 Ga0068856_100352912 3300005614 Bacteria 1489
78 Ga0068856_100369844 3300005614 Bacteria 1452
79 Ga0068856_101663352 3300005614 Bacteria 651
80 Ga0070702_100576219 3300005615 Bacteria 840
81 Ga0068852_100009612 3300005616 Bacteria 7185
82 Ga0068852_100016813 3300005616 Bacteria 5719
83 Ga0068852_100026746 3300005616 Bacteria 4695
84 Ga0068852_100285464 3300005616 Bacteria 1592
85 Ga0068852_101715648 3300005616 Bacteria 650
86 Ga0068852_101918274 3300005616 Bacteria 614
87 Ga0068852_102361678 3300005616 Bacteria 552
88 Ga0068861_100051723 3300005719 Bacteria 3120
89 Ga0068861_100790679 3300005719 Bacteria 890
90 Ga0068851_10011945 3300005834 Bacteria 4083
91 Ga0068851_10129488 3300005834 Bacteria 1363
92 Ga0068851_10967984 3300005834 Bacteria 536
93 Ga0068858_100277785 3300005842 Bacteria 1594
94 Ga0068858_100376245 3300005842 Bacteria 1362
95 Ga0068862_100150751 3300005844 Bacteria 2069
96 Ga0068862_100593448 3300005844 Bacteria 1062
97 Ga0081455_10012098 3300005937 Bacteria 8627
98 Ga0081455_10046763 3300005937 Bacteria 3752
99 Ga0081455_10127650 3300005937 Bacteria 1993
100 Ga0081540_1002663 3300005983 Bacteria 14523
101 Ga0081540_1016488 3300005983 Bacteria 4620
102 Ga0081540_1089513 3300005983 Bacteria 1358
103 Ga0081539_10000072 3300005985 Bacteria 232726
104 Ga0081539_10004419 3300005985 Bacteria 15563
105 Ga0081539_10019248 3300005985 Bacteria 4683
106 Ga0070717_10577894 3300006028 Bacteria 1019
107 Ga0070717_10859221 3300006028 Bacteria 826
108 Ga0075365_10069048 3300006038 Bacteria 2375
109 Ga0075365_10170405 3300006038 Bacteria 1519
110 Ga0075365_10422342 3300006038 Bacteria 941
111 Ga0075365_10741750 3300006038 Bacteria 693
112 Ga0075365_11168730 3300006038 Bacteria 541
113 Ga0075368_10166398 3300006042 Bacteria 925
114 Ga0075368_10203166 3300006042 Bacteria 839
115 Ga0075368_10364533 3300006042 Bacteria 630
116 Ga0075368_10408645 3300006042 Bacteria 597
117 Ga0075363_100004858 3300006048 Bacteria 5938
118 Ga0075363_100422880 3300006048 Bacteria 785
119 Ga0075363_100565768 3300006048 Bacteria 679
120 Ga0070716_100118595 3300006173 Bacteria 1652
121 Ga0070712_100020783 3300006175 Bacteria 4300
122 Ga0070712_100507373 3300006175 Bacteria 1012
123 Ga0070712_101750514 3300006175 Bacteria 544
124 Ga0075362_10004861 3300006177 Bacteria 4855
125 Ga0075362_10014057 3300006177 Bacteria 3222
126 Ga0075362_10310555 3300006177 Bacteria 784
127 Ga0075367_10148470 3300006178 Bacteria 1454
128 Ga0075367_10183139 3300006178 Bacteria 1306
129 Ga0075367_10421671 3300006178 Bacteria 845
130 Ga0075367_10421684 3300006178 Bacteria 845
131 Ga0075367_10875772 3300006178 Bacteria 572
132 Ga0075369_10108834 3300006186 Bacteria 1248
133 Ga0075369_10139127 3300006186 Bacteria 1106
134 Ga0075369_10178884 3300006186 Bacteria 976
135 Ga0097621_100769182 3300006237 Bacteria 890
136 Ga0097621_100818497 3300006237 Bacteria 864
137 Ga0075370_10003104 3300006353 Bacteria 7840
138 Ga0075370_10176245 3300006353 Bacteria 1257
139 Ga0068871_100580240 3300006358 Bacteria 1018
140 Ga0075430_100000605 3300006846 Bacteria 27377
141 Ga0075434_101003988 3300006871 Bacteria 848
142 Ga0068865_100104366 3300006881 Bacteria 2080
143 Ga0097620_100592678 3300006931 Bacteria 1202
144 Ga0105240_10004696 3300009093 Bacteria 20647
145 Ga0105240_10568612 3300009093 Bacteria 1252
146 Ga0105240_10747556 3300009093 Bacteria 1063
147 Ga0105240_11183468 3300009093 Bacteria 810
148 Ga0105245_10469358 3300009098 Bacteria 1270
149 Ga0105245_10731578 3300009098 Bacteria 1024
150 Ga0105245_10845108 3300009098 Bacteria 955
151 Ga0105245_11455164 3300009098 Bacteria 736
152 Ga0105247_10106510 3300009101 Bacteria 1799
153 Ga0105247_10190156 3300009101 Bacteria 1374
154 Ga0114129_12169584 3300009147 Bacteria 669
155 Ga0114129_12766950 3300009147 Bacteria 584
156 Ga0105243_10119606 3300009148 Bacteria 2218
157 Ga0105243_11676020 3300009148 Bacteria 664
158 Ga0105241_10040943 3300009174 Bacteria 3499
159 Ga0105241_10196158 3300009174 Bacteria 1683
160 Ga0105241_10256290 3300009174 Bacteria 1485
161 Ga0105241_10295719 3300009174 Bacteria 1388
162 Ga0105241_11044501 3300009174 Bacteria 766
163 Ga0105242_10064140 3300009176 Bacteria 3027
164 Ga0105237_10332155 3300009545 Bacteria 1524
165 Ga0105237_10586873 3300009545 Bacteria 1121
166 Ga0105237_10640967 3300009545 Bacteria 1069
167 Ga0105237_10944359 3300009545 Bacteria 869
168 Ga0105238_10012597 3300009551 Bacteria 8537
169 Ga0105238_10060184 3300009551 Bacteria 3803
170 Ga0105238_10290940 3300009551 Bacteria 1616
171 Ga0105238_10709028 3300009551 Bacteria 1018
172 Ga0105249_10525741 3300009553 Bacteria 1231
173 Ga0105239_10039505 3300010375 Bacteria 5170
174 Ga0105239_10104618 3300010375 Bacteria 3134
175 Ga0105239_10256544 3300010375 Bacteria 1965
176 Ga0105239_11270276 3300010375 Bacteria 849
177 Ga0105239_11393482 3300010375 Bacteria 809
178 Ga0105246_10114713 3300011119 Bacteria 1985
179 Ga0105246_10897680 3300011119 Bacteria 794
180 Ga0157341_1047504 3300012494 Bacteria 515
181 Ga0157316_1041297 3300012510 Bacteria 602
182 Ga0157373_10346246 3300013100 Bacteria 1060
183 Ga0157371_10043166 3300013102 Bacteria 3213
184 Ga0157371_10340940 3300013102 Bacteria 1090
185 Ga0157370_10033885 3300013104 Bacteria 4977
186 Ga0157370_10353884 3300013104 Bacteria 1353
187 Ga0157370_10710963 3300013104 Bacteria 917
188 Ga0157370_11317979 3300013104 Bacteria 650
189 Ga0157370_11550645 3300013104 Bacteria 595
190 Ga0157369_10038065 3300013105 Bacteria 5262
191 Ga0157369_10115778 3300013105 Bacteria 2847
192 Ga0157369_10687854 3300013105 Bacteria 1054
193 Ga0157369_10855454 3300013105 Bacteria 933
194 Ga0157374_11004771 3300013296 Bacteria 853
195 Ga0157374_11251300 3300013296 Bacteria 764
196 Ga0157374_12366819 3300013296 Bacteria 558
197 Ga0157378_10244775 3300013297 Bacteria 1715
198 Ga0157378_10273543 3300013297 Bacteria 1625
199 Ga0163162_10155250 3300013306 Bacteria 2408
200 Ga0163162_10641078 3300013306 Bacteria 1186
201 Ga0163162_11776650 3300013306 Bacteria 705
202 Ga0157372_10064075 3300013307 Bacteria 4123
203 Ga0157372_10290744 3300013307 Bacteria 1900
204 Ga0157372_12852140 3300013307 Bacteria 554
205 Ga0157375_10172923 3300013308 Bacteria 2308
206 Ga0163163_10072147 3300014325 Bacteria 3442
207 Ga0163163_11564471 3300014325 Bacteria 720
208 Ga0157380_10499816 3300014326 Bacteria 1181
209 Ga0157380_12037108 3300014326 Bacteria 636
210 Ga0157380_12510298 3300014326 Bacteria 581
211 Ga0157380_12758068 3300014326 Bacteria 558
212 Ga0157380_12766867 3300014326 Bacteria 557
213 Ga0182008_10119741 3300014497 Bacteria 1308
214 Ga0182008_10149116 3300014497 Bacteria 1173
215 Ga0157377_10331116 3300014745 Bacteria 1015
216 Ga0157377_10826117 3300014745 Bacteria 686
217 Ga0157379_10010518 3300014968 Bacteria 8065
218 Ga0182006_1031634 3300015261 Bacteria 2130
219 Ga0182006_1126984 3300015261 Bacteria 881
220 Ga0182005_1002173 3300015265 Bacteria 7236
221 Ga0182005_1041026 3300015265 Bacteria 1258
222 Ga0163161_10407732 3300017792 Bacteria 1091
223 Ga0163161_11253125 3300017792 Bacteria 643
224 Ga0213873_10008313 3300021358 Bacteria 2115
225 Ga0213873_10011514 3300021358 Bacteria 1895
226 Ga0213874_10003891 3300021377 Bacteria 3358
227 Ga0213874_10018746 3300021377 Bacteria 1874
228 Ga0213876_10003189 3300021384 Bacteria 9433
229 Ga0213876_10235011 3300021384 Bacteria 974
230 Ga0213875_10080749 3300021388 Bacteria 1517
231 Ga0213871_10098758 3300021441 Bacteria 852
232 Ga0213871_10286220 3300021441 Bacteria 530
233 Ga0224712_10023834 3300022467 Bacteria 2130
234 Ga0209026_1000002 3300025250 Bacteria 1136158
235 Ga0209677_100816 3300025253 Bacteria 15575
236 Ga0209148_1000038 3300025254 Bacteria 493744
237 Ga0209759_1000119 3300025256 Bacteria 141051
238 Ga0209233_1000188 3300025261 Bacteria 132904
239 Ga0209233_1029680 3300025261 Bacteria 1297
240 Ga0209455_1000204 3300025272 Bacteria 85420
241 Ga0209455_1005018 3300025272 Bacteria 4193
242 Ga0209025_1041276 3300025294 Bacteria 1979
243 Ga0209025_1098796 3300025294 Bacteria 931
244 Ga0209025_1112992 3300025294 Bacteria 829
245 Ga0209758_1006057 3300025297 Bacteria 8913
246 Ga0207697_10030257 3300025315 Bacteria 2216
247 Ga0207656_10000708 3300025321 Bacteria 10913
248 Ga0207656_10029364 3300025321 Bacteria 2264
249 Ga0207682_10058611 3300025893 Bacteria 1607
250 Ga0207692_10144556 3300025898 Bacteria 1356
251 Ga0207710_10686447 3300025900 Bacteria 537
252 Ga0207688_10024957 3300025901 Bacteria 3280
253 Ga0207688_10118156 3300025901 Bacteria 1545
254 Ga0207647_10069351 3300025904 Bacteria 2131
255 Ga0207647_10170361 3300025904 Bacteria 1268
256 Ga0207699_10183916 3300025906 Bacteria 1406
257 Ga0207699_10645453 3300025906 Bacteria 773
258 Ga0207645_10006221 3300025907 Bacteria 8578
259 Ga0207705_10011637 3300025909 Bacteria 6358
260 Ga0207705_10187695 3300025909 Bacteria 1562
261 Ga0207654_10043479 3300025911 Bacteria 2547
262 Ga0207654_10462413 3300025911 Bacteria 891
263 Ga0207654_11100659 3300025911 Bacteria 579
264 Ga0207707_10357488 3300025912 Bacteria 1258
265 Ga0207695_10000018 3300025913 Bacteria 766611
266 Ga0207695_10002347 3300025913 Bacteria 28115
267 Ga0207695_10109547 3300025913 Bacteria 2743
268 Ga0207695_10253213 3300025913 Bacteria 1660
269 Ga0207671_10110334 3300025914 Bacteria 2093
270 Ga0207671_10237967 3300025914 Bacteria 1430
271 Ga0207693_10026373 3300025915 Bacteria 4599
272 Ga0207693_10252031 3300025915 Bacteria 1385
273 Ga0207663_10089559 3300025916 Bacteria 2038
274 Ga0207662_10463199 3300025918 Bacteria 868
275 Ga0207657_10011937 3300025919 Bacteria 8597
276 Ga0207657_10678540 3300025919 Bacteria 801
277 Ga0207649_10003305 3300025920 Bacteria 8827
278 Ga0207649_10467790 3300025920 Bacteria 954
279 Ga0207649_10529592 3300025920 Bacteria 899
280 Ga0207694_10000010 3300025924 Bacteria 439722
281 Ga0207694_10022428 3300025924 Bacteria 4789
282 Ga0207694_10033132 3300025924 Bacteria 3957
283 Ga0207694_10085496 3300025924 Bacteria 2483
284 Ga0207694_10462287 3300025924 Bacteria 1060
285 Ga0207650_10457164 3300025925 Bacteria 1063
286 Ga0207659_10616521 3300025926 Bacteria 926
287 Ga0207687_10079261 3300025927 Bacteria 2368
288 Ga0207687_10494140 3300025927 Bacteria 1020
289 Ga0207700_10055325 3300025928 Bacteria 2982
290 Ga0207700_11239767 3300025928 Bacteria 665
291 Ga0207664_10260683 3300025929 Bacteria 1516
292 Ga0207690_10137165 3300025932 Bacteria 1797
293 Ga0207690_10370310 3300025932 Bacteria 1136
294 Ga0207690_10517750 3300025932 Bacteria 966
295 Ga0207690_11392386 3300025932 Bacteria 586
296 Ga0207706_10017336 3300025933 Bacteria 6487
297 Ga0207686_10098572 3300025934 Bacteria 1946
298 Ga0207709_10697778 3300025935 Bacteria 812
299 Ga0207709_10903135 3300025935 Bacteria 718
300 Ga0207670_11834158 3300025936 Bacteria 516
301 Ga0207669_10237964 3300025937 Bacteria 1348
302 Ga0207669_10483614 3300025937 Bacteria 987
303 Ga0207665_10159438 3300025939 Bacteria 1622
304 Ga0207691_10168157 3300025940 Bacteria 1921
305 Ga0207691_11119673 3300025940 Bacteria 654
306 Ga0207711_10476855 3300025941 Bacteria 1162
307 Ga0207711_11132271 3300025941 Bacteria 724
308 Ga0207689_10358749 3300025942 Bacteria 1212
309 Ga0207689_10379367 3300025942 Bacteria 1177
310 Ga0207689_10435269 3300025942 Bacteria 1095
311 Ga0207661_10550432 3300025944 Bacteria 1057
312 Ga0207679_10707568 3300025945 Bacteria 914
313 Ga0207667_10000388 3300025949 Bacteria 59263
314 Ga0207667_10000877 3300025949 Bacteria 38435
315 Ga0207667_10119839 3300025949 Bacteria 2712
316 Ga0207667_10267115 3300025949 Bacteria 1749
317 Ga0207712_10770224 3300025961 Bacteria 844
318 Ga0207668_10180850 3300025972 Bacteria 1663
319 Ga0207668_11783125 3300025972 Bacteria 555
320 Ga0207640_10158340 3300025981 Bacteria 1672
321 Ga0207640_10268641 3300025981 Bacteria 1333
322 Ga0207640_11418914 3300025981 Bacteria 622
323 Ga0207677_10234626 3300026023 Bacteria 1480
324 Ga0207677_11678840 3300026023 Bacteria 589
325 Ga0207703_10200256 3300026035 Bacteria 1774
326 Ga0207639_10002448 3300026041 Bacteria 12454
327 Ga0207639_10029726 3300026041 Bacteria 4004
328 Ga0207639_10249047 3300026041 Bacteria 1548
329 Ga0207639_10386268 3300026041 Bacteria 1258
330 Ga0207639_10388172 3300026041 Bacteria 1255
331 Ga0207639_11788024 3300026041 Bacteria 575
332 Ga0207678_10048388 3300026067 Bacteria 3675
333 Ga0207678_10049649 3300026067 Bacteria 3626
334 Ga0207678_10076186 3300026067 Bacteria 2873
335 Ga0207678_10612480 3300026067 Bacteria 955
336 Ga0207678_11311165 3300026067 Bacteria 640
337 Ga0207702_10014521 3300026078 Bacteria 6538
338 Ga0207702_10153650 3300026078 Bacteria 2096
339 Ga0207702_10473640 3300026078 Bacteria 1218
340 Ga0207702_11107845 3300026078 Bacteria 786
341 Ga0207702_11748803 3300026078 Bacteria 614
342 Ga0207648_10011030 3300026089 Bacteria 8530
343 Ga0207648_10095334 3300026089 Bacteria 2603
344 Ga0207676_10802442 3300026095 Bacteria 918
345 Ga0207674_10128180 3300026116 Bacteria 2502
346 Ga0207674_10190354 3300026116 Bacteria 2001
347 Ga0207674_10386131 3300026116 Bacteria 1354
348 Ga0207674_10919994 3300026116 Bacteria 843
349 Ga0207675_100040050 3300026118 Bacteria 4372
350 Ga0207675_100090967 3300026118 Bacteria 2869
351 Ga0207683_10016263 3300026121 Bacteria 6330
352 Ga0207683_11118690 3300026121 Bacteria 731
353 Ga0207698_10046854 3300026142 Bacteria 3269
354 Ga0207698_10089559 3300026142 Bacteria 2513
355 Ga0207698_10126898 3300026142 Bacteria 2172
356 Ga0207698_10252997 3300026142 Bacteria 1613
357 Ga0207698_10380105 3300026142 Bacteria 1343
358 Ga0207698_12096819 3300026142 Bacteria 579
359 Ga0209966_1038516 3300027695 Bacteria 990
360 Ga0209813_10017271 3300027866 Bacteria 1979
361 Ga0209813_10102879 3300027866 Bacteria 974
362 Ga0268266_10020829 3300028379 Bacteria 5592
363 Ga0268266_10036033 3300028379 Bacteria 4209
364 Ga0268265_10401497 3300028380 Bacteria 1267
365 Ga0265337_1002429 3300028556 Bacteria 8569
366 Ga0265337_1008843 3300028556 Bacteria 3630
367 Ga0265326_10001795 3300028558 Bacteria 7402
368 Ga0265319_1001825 3300028563 Bacteria 12143
369 Ga0265319_1040122 3300028563 Bacteria 1584
370 Ga0265334_10000469 3300028573 Bacteria 20809
371 Ga0265334_10052725 3300028573 Bacteria 1556
372 Ga0265318_10000037 3300028577 Bacteria 138223
373 Ga0265318_10008934 3300028577 Bacteria 4437
374 Ga0265318_10041779 3300028577 Bacteria 1741
375 Ga0265323_10001237 3300028653 Bacteria 12839
376 Ga0265322_10051676 3300028654 Bacteria 1166
377 Ga0265336_10000535 3300028666 Bacteria 21804
378 Ga0307517_10185220 3300028786 Bacteria 1334
379 Ga0265338_10000131 3300028800 Bacteria 137627
380 Ga0265338_10340294 3300028800 Bacteria 1081
381 Ga0265324_10001269 3300029957 Bacteria 14862
382 Ga0265330_10125296 3300031235 Bacteria 1094
383 Ga0265332_10115038 3300031238 Bacteria 1132
384 Ga0265332_10176541 3300031238 Bacteria 891
385 Ga0265328_10038497 3300031239 Bacteria 1765
386 Ga0265328_10348579 3300031239 Bacteria 576
387 Ga0265320_10006806 3300031240 Bacteria 7169
388 Ga0265325_10048954 3300031241 Bacteria 2183
389 Ga0265325_10142648 3300031241 Bacteria 1138
390 Ga0265325_10160262 3300031241 Bacteria 1059
391 Ga0265325_10436815 3300031241 Bacteria 571
392 Ga0265329_10054789 3300031242 Bacteria 1266
393 Ga0265329_10129057 3300031242 Bacteria 813
394 Ga0265340_10065829 3300031247 Bacteria 1725
395 Ga0265339_10012498 3300031249 Bacteria 5181
396 Ga0265339_10038285 3300031249 Bacteria 2676
397 Ga0265339_10045403 3300031249 Bacteria 2418
398 Ga0265339_10074118 3300031249 Bacteria 1809
399 Ga0265339_10255981 3300031249 Bacteria 846
400 Ga0265331_10005639 3300031250 Bacteria 7527
401 Ga0265331_10016180 3300031250 Bacteria 3921
402 Ga0265331_10084260 3300031250 Bacteria 1474
403 Ga0265331_10193919 3300031250 Bacteria 916
404 Ga0265316_10015933 3300031344 Bacteria 6544
405 Ga0265316_10076581 3300031344 Bacteria 2570
406 Ga0265316_10498534 3300031344 Bacteria 870
407 Ga0307513_10028569 3300031456 Bacteria 6373
408 Ga0307513_10178755 3300031456 Bacteria 1988
409 Ga0307513_10212495 3300031456 Bacteria 1764
410 Ga0307513_10455881 3300031456 Bacteria 1002
411 Ga0307408_100357006 3300031548 Bacteria 1242
412 Ga0307408_100447469 3300031548 Bacteria 1120
413 Ga0307408_101689637 3300031548 Bacteria 603
414 Ga0265313_10003614 3300031595 Bacteria 12415
415 Ga0265313_10022840 3300031595 Bacteria 3384
416 Ga0265313_10031690 3300031595 Bacteria 2707
417 Ga0265313_10031974 3300031595 Bacteria 2693
418 Ga0265313_10052060 3300031595 Bacteria 1956
419 Ga0265314_10008857 3300031711 Bacteria 8590
420 Ga0265314_10028270 3300031711 Bacteria 4183
421 Ga0265314_10084434 3300031711 Bacteria 2084
422 Ga0265314_10615528 3300031711 Bacteria 558
423 Ga0265342_10004137 3300031712 Bacteria 11550
424 Ga0265342_10101676 3300031712 Bacteria 1636
425 Ga0265342_10107995 3300031712 Bacteria 1578
426 Ga0307516_10057860 3300031730 Bacteria 3775
427 Ga0307405_10167684 3300031731 Bacteria 1563
428 Ga0307405_10767112 3300031731 Bacteria 805
429 Ga0307413_10738202 3300031824 Bacteria 822
430 Ga0307410_10088224 3300031852 Bacteria 2196
431 Ga0307410_10952505 3300031852 Bacteria 738
432 Ga0307406_10443616 3300031901 Bacteria 1039
433 Ga0307406_11160143 3300031901 Bacteria 669
434 Ga0307407_10352119 3300031903 Bacteria 1043
435 Ga0307407_11031382 3300031903 Bacteria 637
436 Ga0307412_10030283 3300031911 Bacteria 3406
437 Ga0307412_10033696 3300031911 Bacteria 3258
438 Ga0307412_10778838 3300031911 Bacteria 828
439 Ga0307409_100317323 3300031995 Bacteria 1457
440 Ga0307409_100707130 3300031995 Bacteria 1007
441 Ga0307409_100845007 3300031995 Bacteria 926
442 Ga0307409_101618333 3300031995 Bacteria 676
443 Ga0307416_100537909 3300032002 Bacteria 1240
444 Ga0307416_101472812 3300032002 Bacteria 786
445 Ga0307414_10155793 3300032004 Bacteria 1808
446 Ga0307411_10460006 3300032005 Bacteria 1066
447 Ga0307415_100114769 3300032126 Bacteria 2006
448 Ga0307415_100371306 3300032126 Bacteria 1211
449 Ga0307415_100435537 3300032126 Bacteria 1129
450 Ga0307415_100611652 3300032126 Bacteria 971
451 Ga0307510_10235297 3300033180 Bacteria 1331
452 Ga0307510_10275184 3300033180 Bacteria 1157
453 Ga0373940_0141410 3300035088 Bacteria 761
454 Ga0373944_0029385 3300035089 Bacteria 1643
455 Ga0373936_0113921 3300035113 Bacteria 1150
456 Ga0373954_0041438 3300035118 Bacteria 2147
457 Ga0373957_0119033 3300035120 Bacteria 1068
458 Ga0373960_0240473 3300035121 Bacteria 654
459 Ga0373946_0052650 3300035171 Bacteria 1708
460 Ga0373946_0303804 3300035171 Bacteria 789
461 Ga0373955_0303048 3300035172 Bacteria 963
462 Ga0373955_0555436 3300035172 Bacteria 702
463 Ga0373962_0085141 3300035242 Bacteria 966
464 Ga0373924_0055558 3300035410 Bacteria 1648
465 Ga0373935_0318189 3300035692 Bacteria 1103
466 Ga0373927_0093236 3300035695 Bacteria 1956
467 Ga0373933_0217946 3300035724 Bacteria 1224
468 Ga0373933_0262839 3300035724 Bacteria 1113
469 Ga0373947_1076269 3300035725 Bacteria 548
470 Ga0373937_0025062 3300036401 Bacteria 5384
471 Ga0373937_0229703 3300036401 Bacteria 1747
472 Ga0373937_1299498 3300036401 Bacteria 675
473 Ga0373925_0686270 3300037068 Bacteria 844
474 Ga0373925_0873216 3300037068 Bacteria 741
475 Ga0373925_1050951 3300037068 Bacteria 670
476 Ga0395899_0000073 3300037312 Bacteria 181387
477 Ga0395899_0019478 3300037312 Bacteria 5153
478 Ga0395899_0075725 3300037312 Bacteria 2457
479 Ga0395899_0440335 3300037312 Bacteria 855
480 Ga0395900_0000027 3300037418 Bacteria 285957
481 Ga0395900_0012290 3300037418 Bacteria 8757
482 Ga0395900_0147149 3300037418 Bacteria 2408
483 Ga0395900_0609526 3300037418 Bacteria 1031
484 Ga0395898_0000255 3300037466 Bacteria 131017
485 Ga0395898_0029950 3300037466 Bacteria 5449
486 Ga0395898_0131941 3300037466 Bacteria 2392
487 Ga0395905_0000032 3300037471 Bacteria 285932
488 Ga0395905_0446168 3300037471 Bacteria 1191
489 Ga0395905_1274895 3300037471 Bacteria 638
490 Ga0436364_0076013 3300037853 Bacteria 637
491 Ga0436364_0530881 3300037853 Bacteria 2434
492 Ga0436364_0697961 3300037853 Bacteria 1498
493 Ga0436364_0765756 3300037853 Bacteria 1335
494 Ga0436364_1305283 3300037853 Bacteria 2225
495 Ga0395901_0000110 3300038443 Bacteria 112682
496 Ga0395901_0036689 3300038443 Bacteria 5066
497 Ga0395901_0052439 3300038443 Bacteria 4239
498 Ga0400485_17392 3300038735 Bacteria 1093
499 Ga0400486_08264 3300038742 Bacteria 1833
500 Ga0436365_0167537 3300039437 Bacteria 1043
501 Ga0436365_0544722 3300039437 Bacteria 16758
502 Ga0436365_0973027 3300039437 Bacteria 1422
503 Ga0436365_1253031 3300039437 Bacteria 47093
504 Ga0436360_0323768 3300039438 Bacteria 591
505 Ga0436360_0429536 3300039438 Bacteria 3039
506 Ga0436360_0564682 3300039438 Bacteria 5174
507 Ga0436360_1144658 3300039438 Bacteria 1406
508 Ga0436360_1325924 3300039438 Bacteria 1284
509 Ga0436361_0237988 3300039447 Bacteria 620
510 Ga0436363_0701091 3300039450 Bacteria 1472
511 Ga0436363_0880899 3300039450 Bacteria 6318
512 Ga0436363_0939204 3300039450 Bacteria 612
513 Ga0436363_1046285 3300039450 Bacteria 10399
514 Ga0436363_1077755 3300039450 Bacteria 662
515 Ga0436363_1630341 3300039450 Bacteria 952
516 Ga0436362_0687315 3300039453 Bacteria 575
517 Ga0436362_0733157 3300039453 Bacteria 4042
518 Ga0436362_1210898 3300039453 Bacteria 946
519 Ga0439438_017474 3300041405 Bacteria 2064
520 Ga0439453_0008967 3300041408 Bacteria 1620
521 Ga0439466_0110953 3300041411 Bacteria 851
522 Ga0439465_0032376 3300041413 Bacteria 1669
523 Ga0439465_0119634 3300041413 Bacteria 922
524 Ga0451789_1069382 3300041443 Bacteria 911
525 Ga0451797_0510059 3300041453 Bacteria 758
526 Ga0451802_1649373 3300041460 Bacteria 940
527 Ga0451837_1213495 3300041494 Bacteria 656
528 Ga0451837_1454596 3300041494 Bacteria 1588
529 Ga0451849_1216811 3300041505 Bacteria 599
530 Ga0451853_2656839 3300041512 Bacteria 531
531 Ga0439441_077923 3300042001 Bacteria 718
532 Ga0439442_099155 3300042002 Bacteria 630
533 Ga0439445_0067786 3300042004 Bacteria 984
534 Ga0439455_0018856 3300042012 Bacteria 1622
535 Ga0439458_0020812 3300042157 Bacteria 1516
536 Ga0439435_0004725 3300042436 Bacteria 2953
537 Ga0466969_0085473 3300044656 Bacteria 1500
538 Ga0466972_0010313 3300044658 Bacteria 4691
539 Ga0466961_0068632 3300044693 Bacteria 2251
540 Ga0466963_0292782 3300044694 Bacteria 1145
541 Ga0466963_0895951 3300044694 Bacteria 625
542 Ga0466964_0380189 3300044706 Bacteria 733
543 Ga0466971_0254118 3300044719 Bacteria 838
544 Ga0466971_0426149 3300044719 Bacteria 649
545 Ga0466957_1155472 3300044842 Bacteria 559
546 Ga0466960_0029748 3300044901 Bacteria 2509
547 Ga0466960_0770748 3300044901 Bacteria 581
548 Ga0466959_0011129 3300045049 Bacteria 6456
549 Ga0466959_0590257 3300045049 Bacteria 748
550 Ga0466958_0180617 3300045836 Bacteria 1339
551 Ga0466967_0549579 3300045976 Bacteria 1137
552 Ga0466967_0613874 3300045976 Bacteria 1074
553 Ga0466967_1157763 3300045976 Bacteria 771
554 Ga0495592_0098665 3300046454 Bacteria 2085
555 Ga0495592_0439032 3300046454 Bacteria 820
556 Ga0495603_0432529 3300046455 Bacteria 754
557 Ga0495590_0047095 3300046457 Bacteria 1504
558 Ga0495629_0131013 3300046459 Bacteria 1747
559 Ga0495629_0304789 3300046459 Bacteria 1090
560 Ga0495638_0040593 3300046460 Bacteria 2948
561 Ga0495638_0276814 3300046460 Bacteria 913
562 Ga0495651_0323475 3300046462 Bacteria 1027
563 Ga0495650_0127613 3300046471 Bacteria 931
564 Ga0495580_0059866 3300046472 Bacteria 2676
565 Ga0495582_0319921 3300046473 Bacteria 893
566 Ga0495639_0242902 3300046475 Bacteria 889
567 Ga0495664_0051700 3300046477 Bacteria 2440
568 Ga0495664_0454931 3300046477 Bacteria 766
569 Ga0495596_0060347 3300046500 Bacteria 1478
570 Ga0495596_0130125 3300046500 Bacteria 977
571 Ga0495607_0477595 3300046501 Bacteria 556
572 Ga0495607_0524058 3300046501 Bacteria 523
573 Ga0495583_0049116 3300046506 Bacteria 1934
574 Ga0495583_0143975 3300046506 Bacteria 991
575 Ga0495610_0327868 3300046512 Bacteria 582
576 Ga0495616_0047418 3300046513 Bacteria 2164
577 Ga0495618_0307148 3300046514 Bacteria 985
578 Ga0495620_0008766 3300046515 Bacteria 5412
579 Ga0495628_0398834 3300046516 Bacteria 1005
580 Ga0495637_0027395 3300046520 Bacteria 2550
581 Ga0495643_0011617 3300046522 Bacteria 5353
582 Ga0495652_0270727 3300046529 Bacteria 1249
583 Ga0495587_0405187 3300046536 Bacteria 758
584 Ga0495598_0165155 3300046537 Bacteria 781
585 Ga0495597_0076584 3300046542 Bacteria 1434
586 Ga0495645_0165319 3300046543 Bacteria 1527
587 Ga0495622_0354651 3300046557 Bacteria 635
588 Ga0495668_0252348 3300046616 Bacteria 966
589 Ga0495611_0261712 3300046648 Bacteria 801
590 Ga0495625_0220780 3300046660 Bacteria 1242
591 Ga0495625_0292882 3300046660 Bacteria 1044
592 Ga0495657_0068294 3300046675 Bacteria 2330
593 Ga0495599_0319617 3300046678 Bacteria 935
594 Ga0495658_0111501 3300046683 Bacteria 1645
595 Ga0495658_0276678 3300046683 Bacteria 1059
596 Ga0495669_0294413 3300046684 Bacteria 782
597 Ga0495670_0102193 3300046691 Bacteria 1477
598 Ga0495660_0007203 3300046810 Bacteria 6548
599 Ga0495581_0065369 3300047315 Bacteria 2103
600 Ga0495604_0233671 3300047317 Bacteria 1260
601 Ga0495604_0604734 3300047317 Bacteria 703
602 Ga0495672_0073202 3300047320 Bacteria 1933
603 Ga0495672_0113829 3300047320 Bacteria 1448
604 Ga0495672_0117241 3300047320 Bacteria 1421
605 Ga0495680_0065932 3300047322 Bacteria 2772
606 Ga0495687_013562 3300047443 Bacteria 4244
607 Ga0495679_059554 3300047446 Bacteria 1123
608 Ga0495673_0187945 3300047469 Bacteria 779
609 Ga0495686_0013227 3300047472 Bacteria 5734
610 Ga0495686_0184288 3300047472 Bacteria 1207
611 Ga0495602_0752933 3300048088 Bacteria 657
612 Ga0495615_0042760 3300048090 Bacteria 1137
613 Ga0495626_0073504 3300048091 Bacteria 1531
614 Ga0496100_0594067 3300048903 Bacteria 859
615 Ga0496101_0639867 3300048904 Bacteria 840
616 Ga0496101_0659266 3300048904 Bacteria 827
617 Ga0496102_0426059 3300048905 Bacteria 1246
618 Ga0496104_0250153 3300048907 Bacteria 1685
619 Ga0496105_0915100 3300048908 Bacteria 660
620 Ga0496106_0680519 3300048909 Bacteria 821
621 Ga0496106_0810384 3300048909 Bacteria 742
622 Ga0496106_1487973 3300048909 Bacteria 521
623 Ga0496108_1093656 3300048911 Bacteria 678
624 Ga0496109_0361483 3300048912 Bacteria 1371
625 Ga0496109_0492074 3300048912 Bacteria 1158
626 Ga0496110_0764248 3300048913 Bacteria 870
627 Ga0496111_0318265 3300048914 Bacteria 1152
628 Ga0496111_0748896 3300048914 Bacteria 709
629 Ga0496112_0063587 3300048915 Bacteria 3640
630 Ga0496113_0260126 3300048916 Bacteria 1386
631 Ga0496113_0630790 3300048916 Bacteria 857
632 Ga0496115_0181345 3300048918 Bacteria 1740
633 Ga0496117_0123621 3300048920 Bacteria 1584
634 Ga0496118_0038146 3300048921 Bacteria 3855
635 Ga0496118_0070157 3300048921 Bacteria 2532
636 Ga0496118_0142522 3300048921 Bacteria 1516
637 Ga0496118_0234990 3300048921 Bacteria 1054
638 Ga0496119_0000372 3300048922 Bacteria 62094
639 Ga0496119_0064924 3300048922 Bacteria 2165
640 Ga0496119_0081757 3300048922 Bacteria 1859
641 Ga0496119_0122432 3300048922 Bacteria 1428
642 Ga0496119_0181727 3300048922 Bacteria 1102
643 Ga0496119_0204607 3300048922 Bacteria 1019
644 Ga0496120_0045101 3300048923 Bacteria 2556
645 Ga0496120_0065139 3300048923 Bacteria 2020
646 Ga0496120_0293618 3300048923 Bacteria 747
647 Ga0496121_0035490 3300048924 Bacteria 4468
648 Ga0496121_0194855 3300048924 Bacteria 1449
649 Ga0496121_0428716 3300048924 Bacteria 858
650 Ga0496122_0006451 3300048925 Bacteria 13461
651 Ga0496122_0255799 3300048925 Bacteria 976
652 Ga0496123_0017126 3300048926 Bacteria 5847
653 Ga0496124_0095308 3300048927 Bacteria 2419
654 Ga0496124_0105288 3300048927 Bacteria 2279
655 Ga0496125_0134455 3300048928 Bacteria 1733
656 Ga0496125_0243721 3300048928 Bacteria 1139
657 Ga0496125_0380311 3300048928 Bacteria 832
658 Ga0496126_0055058 3300048929 Bacteria 3600
659 Ga0496126_0164769 3300048929 Bacteria 1892
660 Ga0496126_0282853 3300048929 Bacteria 1373
661 Ga0496126_0347592 3300048929 Bacteria 1214
662 Ga0501309_013314 3300049129 Bacteria 1093
663 Ga0501305_054534 3300049161 Bacteria 677
664 Ga0495682_0005207 3300049460 Bacteria 5432
665 Ga0501313_010924 3300049529 Bacteria 1041
666 Ga0501313_047583 3300049529 Bacteria 587
667 Ga0501315_049789 3300049531 Bacteria 656
668 Ga0501317_002279 3300049533 Bacteria 1793
669 Ga0501318_001867 3300049534 Bacteria 1741
670 Ga0501320_018996 3300049536 Bacteria 781
671 Ga0501031_0000651 3300049568 Bacteria 20547
672 Ga0501031_0003843 3300049568 Bacteria 9657
673 Ga0501031_0010832 3300049568 Bacteria 5936
674 Ga0501031_0016670 3300049568 Bacteria 4771
675 Ga0501031_0341948 3300049568 Bacteria 969
676 Ga0501031_0800168 3300049568 Bacteria 604
677 Ga0501032_0000111 3300049569 Bacteria 69802
678 Ga0501032_0001915 3300049569 Bacteria 16407
679 Ga0501032_0003488 3300049569 Bacteria 12021
680 Ga0501032_0012326 3300049569 Bacteria 6112
681 Ga0501032_0051001 3300049569 Bacteria 2790
682 Ga0501032_0111144 3300049569 Bacteria 1813
683 Ga0501032_0119107 3300049569 Bacteria 1746
684 Ga0501032_0165400 3300049569 Bacteria 1451
685 Ga0501032_0188536 3300049569 Bacteria 1348
686 Ga0501032_0237913 3300049569 Bacteria 1183
687 Ga0501032_0305998 3300049569 Bacteria 1027
688 Ga0501032_0399755 3300049569 Bacteria 882
689 Ga0501032_0612912 3300049569 Bacteria 692
690 Ga0501032_0737764 3300049569 Bacteria 623
691 Ga0501033_0000121 3300049570 Bacteria 75242
692 Ga0501033_0004963 3300049570 Bacteria 10583
693 Ga0501033_0006462 3300049570 Bacteria 9172
694 Ga0501033_0018118 3300049570 Bacteria 5320
695 Ga0501033_0037361 3300049570 Bacteria 3635
696 Ga0501033_0059135 3300049570 Bacteria 2830
697 Ga0501033_0126195 3300049570 Bacteria 1855
698 Ga0501033_0139684 3300049570 Bacteria 1751
699 Ga0501033_0141883 3300049570 Bacteria 1736
700 Ga0501033_0194748 3300049570 Bacteria 1449
701 Ga0501033_0717400 3300049570 Bacteria 679
702 Ga0501034_0000298 3300049571 Bacteria 88154
703 Ga0501034_0009013 3300049571 Bacteria 10479
704 Ga0501034_0014685 3300049571 Bacteria 8064
705 Ga0501034_0014987 3300049571 Bacteria 7973
706 Ga0501034_0026519 3300049571 Bacteria 5901
707 Ga0501034_0035212 3300049571 Bacteria 5076
708 Ga0501034_0050055 3300049571 Bacteria 4214
709 Ga0501034_0064759 3300049571 Bacteria 3669
710 Ga0501034_0071741 3300049571 Bacteria 3472
711 Ga0501034_0078177 3300049571 Bacteria 3313
712 Ga0501034_0093906 3300049571 Bacteria 2996
713 Ga0501034_0172892 3300049571 Bacteria 2126
714 Ga0501034_0185421 3300049571 Bacteria 2044
715 Ga0501034_0271516 3300049571 Bacteria 1636
716 Ga0501034_0337605 3300049571 Bacteria 1437
717 Ga0501034_0381046 3300049571 Bacteria 1335
718 Ga0501034_0594197 3300049571 Bacteria 1013
719 Ga0501034_0679958 3300049571 Bacteria 929
720 Ga0501034_0753945 3300049571 Bacteria 869
721 Ga0501034_0760920 3300049571 Bacteria 863
722 Ga0501036_0000724 3300049572 Bacteria 24360
723 Ga0501036_0002605 3300049572 Bacteria 14223
724 Ga0501036_0014004 3300049572 Bacteria 6665
725 Ga0501036_0038561 3300049572 Bacteria 4044
726 Ga0501036_0186938 3300049572 Bacteria 1743
727 Ga0501036_0230566 3300049572 Bacteria 1554
728 Ga0501036_0582833 3300049572 Bacteria 928
729 Ga0501036_0838139 3300049572 Bacteria 756
730 Ga0501036_0867987 3300049572 Bacteria 741
731 Ga0501036_1004012 3300049572 Bacteria 683
732 Ga0501036_1103135 3300049572 Bacteria 648
733 Ga0501037_0000131 3300049573 Bacteria 69802
734 Ga0501037_0000191 3300049573 Bacteria 56839
735 Ga0501037_0000195 3300049573 Bacteria 55440
736 Ga0501037_0003453 3300049573 Bacteria 11480
737 Ga0501037_0014952 3300049573 Bacteria 5708
738 Ga0501037_0067854 3300049573 Bacteria 2596
739 Ga0501037_0108318 3300049573 Bacteria 2002
740 Ga0501037_0158968 3300049573 Bacteria 1611
741 Ga0501037_0171288 3300049573 Bacteria 1543
742 Ga0501037_0208097 3300049573 Bacteria 1380
743 Ga0501037_0346999 3300049573 Bacteria 1024
744 Ga0501037_0382566 3300049573 Bacteria 967
745 Ga0501037_0519909 3300049573 Bacteria 806
746 Ga0501038_0000109 3300049574 Bacteria 69802
747 Ga0501038_0001299 3300049574 Bacteria 22755
748 Ga0501038_0001882 3300049574 Bacteria 19398
749 Ga0501038_0005274 3300049574 Bacteria 12021
750 Ga0501038_0029459 3300049574 Bacteria 4863
751 Ga0501038_0039812 3300049574 Bacteria 4110
752 Ga0501038_0131427 3300049574 Bacteria 2055
753 Ga0501038_0132340 3300049574 Bacteria 2046
754 Ga0501038_0132662 3300049574 Bacteria 2043
755 Ga0501038_0169820 3300049574 Bacteria 1766
756 Ga0501038_0216147 3300049574 Bacteria 1531
757 Ga0501038_0242003 3300049574 Bacteria 1432
758 Ga0501038_0309115 3300049574 Bacteria 1239
759 Ga0501039_0000080 3300049575 Bacteria 72519
760 Ga0501039_0002279 3300049575 Bacteria 14235
761 Ga0501039_0054344 3300049575 Bacteria 3099
762 Ga0501039_0195543 3300049575 Bacteria 1590
763 Ga0501039_0240450 3300049575 Bacteria 1423
764 Ga0501039_0271682 3300049575 Bacteria 1332
765 Ga0501039_0525627 3300049575 Bacteria 929
766 Ga0501040_0107203 3300049576 Bacteria 1952
767 Ga0501041_0089200 3300049577 Bacteria 1904
768 Ga0501041_0219781 3300049577 Bacteria 1192
769 Ga0501042_0403503 3300049578 Bacteria 990
770 Ga0501042_0915857 3300049578 Bacteria 639
771 Ga0501043_0000080 3300049579 Bacteria 85372
772 Ga0501043_0004023 3300049579 Bacteria 12021
773 Ga0501043_0007495 3300049579 Bacteria 8664
774 Ga0501043_0012997 3300049579 Bacteria 6508
775 Ga0501043_0038138 3300049579 Bacteria 3779
776 Ga0501043_0047851 3300049579 Bacteria 3362
777 Ga0501043_0055891 3300049579 Bacteria 3100
778 Ga0501043_0060820 3300049579 Bacteria 2965
779 Ga0501043_0089103 3300049579 Bacteria 2425
780 Ga0501043_0099954 3300049579 Bacteria 2280
781 Ga0501043_0113305 3300049579 Bacteria 2130
782 Ga0501043_0126611 3300049579 Bacteria 2003
783 Ga0501043_0260320 3300049579 Bacteria 1334
784 Ga0501043_0311955 3300049579 Bacteria 1200
785 Ga0501043_0631661 3300049579 Bacteria 788
786 Ga0501046_0103794 3300049580 Bacteria 2179
787 Ga0501046_0144271 3300049580 Bacteria 1799
788 Ga0501046_0242537 3300049580 Bacteria 1329
789 Ga0501046_0312805 3300049580 Bacteria 1145
790 Ga0501047_0009718 3300049581 Bacteria 9096
791 Ga0501047_0015743 3300049581 Bacteria 7207
792 Ga0501047_0023054 3300049581 Bacteria 5976
793 Ga0501047_0023074 3300049581 Bacteria 5972
794 Ga0501047_0100301 3300049581 Bacteria 2774
795 Ga0501047_0127913 3300049581 Bacteria 2420
796 Ga0501047_0152453 3300049581 Bacteria 2186
797 Ga0501047_0176080 3300049581 Bacteria 2006
798 Ga0501047_0181203 3300049581 Bacteria 1973
799 Ga0501047_0194950 3300049581 Bacteria 1888
800 Ga0501047_0206504 3300049581 Bacteria 1823
801 Ga0501047_0245096 3300049581 Bacteria 1641
802 Ga0501047_0318480 3300049581 Bacteria 1395
803 Ga0501047_0335131 3300049581 Bacteria 1351
804 Ga0501047_0353434 3300049581 Bacteria 1306
805 Ga0501047_0414952 3300049581 Bacteria 1178
806 Ga0501047_0457014 3300049581 Bacteria 1106
807 Ga0501047_0757346 3300049581 Bacteria 787
808 Ga0501047_0776464 3300049581 Bacteria 773
809 Ga0501047_1193506 3300049581 Bacteria 574
810 Ga0501047_1248537 3300049581 Bacteria 557
811 Ga0501047_1265904 3300049581 Bacteria 551
812 Ga0501048_0030318 3300049582 Bacteria 3913
813 Ga0501048_0058389 3300049582 Bacteria 2735
814 Ga0501048_0203637 3300049582 Bacteria 1403
815 Ga0501048_0235293 3300049582 Bacteria 1300
816 Ga0501048_0280029 3300049582 Bacteria 1186
817 Ga0501048_0793705 3300049582 Bacteria 680
818 Ga0501067_0052681 3300049583 Bacteria 2255
819 Ga0501067_0064853 3300049583 Bacteria 2022
820 Ga0501067_0091010 3300049583 Bacteria 1693
821 Ga0501067_0140339 3300049583 Bacteria 1345
822 Ga0501067_0144537 3300049583 Bacteria 1325
823 Ga0501067_0175550 3300049583 Bacteria 1193
824 Ga0501067_0286359 3300049583 Bacteria 917
825 Ga0501068_0011134 3300049584 Bacteria 5067
826 Ga0501068_0015296 3300049584 Bacteria 4404
827 Ga0501068_0083047 3300049584 Bacteria 1968
828 Ga0501068_0175925 3300049584 Bacteria 1352
829 Ga0501068_0196318 3300049584 Bacteria 1279
830 Ga0501068_0298881 3300049584 Bacteria 1030
831 Ga0501068_0307507 3300049584 Bacteria 1015
832 Ga0501068_0562731 3300049584 Bacteria 742
833 Ga0501068_0891881 3300049584 Bacteria 585
834 Ga0501068_1037556 3300049584 Bacteria 541
835 Ga0501069_0004122 3300049585 Bacteria 7502
836 Ga0501069_0004928 3300049585 Bacteria 6923
837 Ga0501069_0013201 3300049585 Bacteria 4401
838 Ga0501069_0060723 3300049585 Bacteria 2110
839 Ga0501069_0122463 3300049585 Bacteria 1486
840 Ga0501069_0138940 3300049585 Bacteria 1393
841 Ga0501069_0306723 3300049585 Bacteria 931
842 Ga0501069_0451519 3300049585 Bacteria 764
843 Ga0501069_0723195 3300049585 Bacteria 601
844 Ga0501070_0001286 3300049586 Bacteria 22525
845 Ga0501070_0006284 3300049586 Bacteria 10111
846 Ga0501070_0006301 3300049586 Bacteria 10097
847 Ga0501070_0011237 3300049586 Bacteria 7561
848 Ga0501070_0014064 3300049586 Bacteria 6737
849 Ga0501070_0025506 3300049586 Bacteria 4958
850 Ga0501070_0040568 3300049586 Bacteria 3881
851 Ga0501070_0057678 3300049586 Bacteria 3219
852 Ga0501070_0060281 3300049586 Bacteria 3145
853 Ga0501070_0171551 3300049586 Bacteria 1786
854 Ga0501070_0190795 3300049586 Bacteria 1684
855 Ga0501070_0215956 3300049586 Bacteria 1573
856 Ga0501070_0247320 3300049586 Bacteria 1459
857 Ga0501070_0250574 3300049586 Bacteria 1448
858 Ga0501070_0256784 3300049586 Bacteria 1429
859 Ga0501070_0373060 3300049586 Bacteria 1156
860 Ga0501070_0809439 3300049586 Bacteria 735
861 Ga0501071_0046823 3300049587 Bacteria 3106
862 Ga0501071_0101470 3300049587 Bacteria 2121
863 Ga0501071_0201488 3300049587 Bacteria 1495
864 Ga0501071_0288439 3300049587 Bacteria 1243
865 Ga0501071_0547545 3300049587 Bacteria 889
866 Ga0501071_0625049 3300049587 Bacteria 828
867 Ga0501072_0338405 3300049588 Bacteria 1195
868 Ga0501072_0468150 3300049588 Bacteria 998
869 Ga0501072_0476060 3300049588 Bacteria 988
870 Ga0501072_0509121 3300049588 Bacteria 952
871 Ga0501073_0000083 3300049589 Bacteria 59733
872 Ga0501073_0015881 3300049589 Bacteria 5456
873 Ga0501073_0023164 3300049589 Bacteria 4463
874 Ga0501073_0058581 3300049589 Bacteria 2691
875 Ga0501073_0117358 3300049589 Bacteria 1844
876 Ga0501073_0128507 3300049589 Bacteria 1756
877 Ga0501073_0153236 3300049589 Bacteria 1597
878 Ga0501073_0294738 3300049589 Bacteria 1119
879 Ga0501073_0955702 3300049589 Bacteria 590
880 Ga0501074_0002583 3300049590 Bacteria 12638
881 Ga0501074_0012668 3300049590 Bacteria 6133
882 Ga0501074_0035107 3300049590 Bacteria 3633
883 Ga0501074_0174237 3300049590 Bacteria 1535
884 Ga0501074_0187163 3300049590 Bacteria 1476
885 Ga0501074_0215216 3300049590 Bacteria 1369
886 Ga0501074_0462343 3300049590 Bacteria 899
887 Ga0501074_1037662 3300049590 Bacteria 576
888 Ga0501075_0515130 3300049591 Bacteria 913
889 Ga0501075_1173828 3300049591 Bacteria 583
890 Ga0501076_0347691 3300049592 Bacteria 1217
891 Ga0501076_1553601 3300049592 Bacteria 543
892 Ga0501077_0000088 3300049593 Bacteria 46551
893 Ga0501079_0026674 3300049741 Bacteria 4430
894 Ga0501079_0258482 3300049741 Bacteria 1361
895 Ga0501079_0472590 3300049741 Bacteria 985
896 Ga0501079_0657281 3300049741 Bacteria 825
897 Ga0501079_0718271 3300049741 Bacteria 786
898 Ga0501079_0847117 3300049741 Bacteria 720
899 Ga0501080_0003162 3300049742 Bacteria 14508
900 Ga0501080_0004752 3300049742 Bacteria 12113
901 Ga0501080_0009625 3300049742 Bacteria 8822
902 Ga0501080_0010339 3300049742 Bacteria 8535
903 Ga0501080_0015400 3300049742 Bacteria 7048
904 Ga0501080_0017194 3300049742 Bacteria 6681
905 Ga0501080_0102533 3300049742 Bacteria 2654
906 Ga0501080_0181593 3300049742 Bacteria 1936
907 Ga0501080_0181639 3300049742 Bacteria 1935
908 Ga0501080_0213642 3300049742 Bacteria 1767
909 Ga0501080_0229455 3300049742 Bacteria 1697
910 Ga0501080_0238618 3300049742 Bacteria 1660
911 Ga0501080_0363496 3300049742 Bacteria 1305
912 Ga0501080_0443693 3300049742 Bacteria 1164
913 Ga0501080_0756129 3300049742 Bacteria 854
914 Ga0501080_0850478 3300049742 Bacteria 798
915 Ga0501080_1386239 3300049742 Bacteria 600
916 Ga0501083_0001214 3300049744 Bacteria 17447
917 Ga0501083_0020957 3300049744 Bacteria 4543
918 Ga0501083_0187035 3300049744 Bacteria 1352
919 Ga0501083_0192449 3300049744 Bacteria 1331
920 Ga0501083_0255597 3300049744 Bacteria 1140
921 Ga0501083_0861676 3300049744 Bacteria 589
922 Ga0501083_1087553 3300049744 Bacteria 520
923 Ga0501035_0000160 3300049822 Bacteria 82214
924 Ga0501035_0002188 3300049822 Bacteria 19398
925 Ga0501035_0022027 3300049822 Bacteria 5854
926 Ga0501035_0023586 3300049822 Bacteria 5644
927 Ga0501035_0037179 3300049822 Bacteria 4410
928 Ga0501035_0043204 3300049822 Bacteria 4062
929 Ga0501035_0055030 3300049822 Bacteria 3553
930 Ga0501035_0079674 3300049822 Bacteria 2893
931 Ga0501035_0099561 3300049822 Bacteria 2551
932 Ga0501035_0115591 3300049822 Bacteria 2348
933 Ga0501035_0115964 3300049822 Bacteria 2344
934 Ga0501035_0122392 3300049822 Bacteria 2273
935 Ga0501035_0139961 3300049822 Bacteria 2104
936 Ga0501035_0150305 3300049822 Bacteria 2021
937 Ga0501035_0161926 3300049822 Bacteria 1936
938 Ga0501035_0213546 3300049822 Bacteria 1650
939 Ga0501035_1531283 3300049822 Bacteria 508
940 Ga0501044_0000234 3300049823 Bacteria 69802
941 Ga0501044_0000544 3300049823 Bacteria 45911
942 Ga0501044_0009229 3300049823 Bacteria 10770
943 Ga0501044_0009814 3300049823 Bacteria 10410
944 Ga0501044_0018610 3300049823 Bacteria 7441
945 Ga0501044_0024732 3300049823 Bacteria 6370
946 Ga0501044_0025827 3300049823 Bacteria 6226
947 Ga0501044_0033457 3300049823 Bacteria 5402
948 Ga0501044_0036148 3300049823 Bacteria 5168
949 Ga0501044_0076702 3300049823 Bacteria 3391
950 Ga0501044_0082042 3300049823 Bacteria 3263
951 Ga0501044_0114449 3300049823 Bacteria 2703
952 Ga0501044_0154439 3300049823 Bacteria 2275
953 Ga0501044_0191494 3300049823 Bacteria 2007
954 Ga0501044_0232392 3300049823 Bacteria 1791
955 Ga0501044_0259727 3300049823 Bacteria 1675
956 Ga0501044_0368868 3300049823 Bacteria 1352
957 Ga0501044_0440662 3300049823 Bacteria 1210
958 Ga0501044_0525585 3300049823 Bacteria 1082
959 Ga0501044_0592359 3300049823 Bacteria 1002
960 Ga0501044_1020005 3300049823 Bacteria 699
961 Ga0501045_0001715 3300049824 Bacteria 14765
962 Ga0501045_0485235 3300049824 Bacteria 918
963 Ga0501045_1337791 3300049824 Bacteria 521
964 nmdc:mga03n38_14252_c1 3300050490 Bacteria 3042
965 nmdc:mga03n38_21372_c1 3300050490 Bacteria 2604
966 nmdc:mga03n38_429542_c1 3300050490 Bacteria 732
967 nmdc:mga03n38_746046_c1 3300050490 Bacteria 567
968 nmdc:mga00v17_512278_c1 3300050491 Bacteria 777
969 nmdc:mga0yw44_18471_c1 3300050492 Bacteria 3821
970 nmdc:mga0yw44_212922_c1 3300050492 Bacteria 1279
971 nmdc:mga0yw44_212931_c1 3300050492 Bacteria 1279
972 nmdc:mga0yw44_542325_c1 3300050492 Bacteria 790
973 nmdc:mga0yw44_60745_c1 3300050492 Bacteria 2316
974 nmdc:mga0yw44_755433_c1 3300050492 Bacteria 660
975 nmdc:mga0k408_676254_c1 3300050493 Bacteria 606
976 nmdc:mga06z11_112461_c1 3300050494 Bacteria 1510
977 nmdc:mga06z11_119069_c1 3300050494 Bacteria 1471
978 nmdc:mga06z11_157752_c1 3300050494 Bacteria 1295
979 nmdc:mga06z11_395338_c1 3300050494 Bacteria 832
980 nmdc:mga06z11_787034_c1 3300050494 Bacteria 580
981 nmdc:mga04h51_131147_c1 3300050495 Bacteria 943
982 nmdc:mga04h51_255960_c1 3300050495 Bacteria 703
983 nmdc:mga04h51_7863_c1 3300050495 Bacteria 2834
984 nmdc:mga07m45_26183_c1 3300050496 Bacteria 3205
985 nmdc:mga07m45_354090_c1 3300050496 Bacteria 853
986 nmdc:mga07m45_5559_c1 3300050496 Bacteria 6288
987 nmdc:mga0qj67_299_c1 3300050509 Bacteria 34404
988 nmdc:mga06r32_1385318_c1 3300050510 Bacteria 645
989 nmdc:mga0rr50_919365_c1 3300050513 Bacteria 746
990 nmdc:mga0a205_654184_c1 3300050515 Bacteria 902
991 nmdc:mga0sz30_14247_c1 3300050516 Bacteria 2669
992 nmdc:mga0sz30_30979_c1 3300050516 Bacteria 2212
993 Ga0495601_0216675 3300053077 Bacteria 1250
994 Ga0500610_0168190 3300053079 Bacteria 1084
995 Ga0495655_0237727 3300053083 Bacteria 608
996 Ga0500644_0033161 3300053088 Bacteria 1656
997 Ga0500647_0070822 3300053091 Bacteria 1676
998 Ga0500566_0000320 3300053094 Bacteria 25974
999 Ga0500640_027849 3300053095 Bacteria 2466
1000 Ga0500650_0280870 3300053098 Bacteria 740
1001 Ga0500556_0000009 3300053104 Bacteria 288111
1002 Ga0500562_111930 3300053108 Bacteria 744
1003 Ga0500572_001453 3300053111 Bacteria 6482
1004 Ga0500572_006785 3300053111 Bacteria 2630
1005 Ga0500580_223785 3300053113 Bacteria 589
1006 Ga0500591_074354 3300053115 Bacteria 1531
1007 Ga0500595_145202 3300053119 Bacteria 664
1008 Ga0500608_029012 3300053122 Bacteria 2614
1009 Ga0500618_053140 3300053125 Bacteria 916
1010 Ga0500655_015396 3300053133 Bacteria 1403
1011 Ga0500658_0019134 3300053134 Bacteria 2574
1012 Ga0500559_0007811 3300053136 Bacteria 4724
1013 Ga0500559_0012275 3300053136 Bacteria 3644
1014 Ga0500559_0013950 3300053136 Bacteria 3396
1015 Ga0500568_0001953 3300053139 Bacteria 12637
1016 Ga0500568_0231839 3300053139 Bacteria 674
1017 Ga0500588_0004535 3300053146 Bacteria 3018
1018 Ga0500603_003307 3300053150 Bacteria 3463
1019 Ga0500603_022818 3300053150 Bacteria 1553
1020 Ga0500616_0024839 3300053153 Bacteria 3326
1021 Ga0500620_004601 3300053155 Bacteria 3101
1022 Ga0500627_0402866 3300053158 Bacteria 582
1023 Ga0500630_005936 3300053159 Bacteria 5975
1024 Ga0500638_024655 3300053162 Bacteria 2870
1025 Ga0500639_002134 3300053163 Bacteria 9896
1026 Ga0500639_019780 3300053163 Bacteria 3551
1027 Ga0500636_0419595 3300053177 Bacteria 615
1028 Ga0500637_0172514 3300053178 Bacteria 1242
1029 Ga0500645_074069 3300053730 Bacteria 975
1030 Ga0500609_013602 3300053731 Bacteria 1101
1031 Ga0500609_020675 3300053731 Bacteria 897
1032 Ga0500656_009071 3300053732 Bacteria 1065
1033 Ga0500596_003981 3300053735 Bacteria 2750
1034 Ga0500596_005235 3300053735 Bacteria 2306
1035 Ga0501084_0000175 3300054114 Bacteria 50123
1036 Ga0501084_0023050 3300054114 Bacteria 5196
1037 Ga0501084_0582995 3300054114 Bacteria 945
1038 Ga0501084_1010364 3300054114 Bacteria 699
1039 Ga0587093_012340 3300059478 Bacteria 1036
1040 Ga0587066_014974 3300059490 Bacteria 1199
1041 Ga0587066_040569 3300059490 Bacteria 875
1042 Ga0587066_081737 3300059490 Bacteria 701
1043 Ga0587070_012050 3300059491 Bacteria 1306
1044 Ga0587070_012736 3300059491 Bacteria 1284
1045 Ga0587070_038250 3300059491 Bacteria 906
1046 Ga0587077_011314 3300059493 Bacteria 1400
1047 Ga0587077_110366 3300059493 Bacteria 673
1048 Ga0587080_014343 3300059503 Bacteria 1225
1049 Ga0587082_043435 3300059504 Bacteria 833
1050 Ga0587082_109234 3300059504 Bacteria 612
1051 Ga0587083_0245757 3300059505 Bacteria 531
1052 Ga0587086_019549 3300059507 Bacteria 912
1053 Ga0587088_148311 3300059508 Bacteria 565
1054 Ga0587092_082209 3300059512 Bacteria 638
1055 Ga0587094_007473 3300059513 Bacteria 1341
1056 Ga0587106_013481 3300059605 Bacteria 1112
1057 Ga0587099_011882 3300059622 Bacteria 889
1058 Ga0587101_003234 3300059623 Bacteria 1638
1059 Ga0587062_001756 3300059639 Bacteria 1946
1060 Ga0587062_114779 3300059639 Bacteria 538
1061 Ga0587069_017394 3300059642 Bacteria 1040
1062 Ga0587072_013827 3300059643 Bacteria 1353
1063 Ga0587072_027025 3300059643 Bacteria 1052
1064 Ga0587072_031440 3300059643 Bacteria 993
1065 Ga0587075_014892 3300059644 Bacteria 1088
1066 Ga0587076_045829 3300059645 Bacteria 834
1067 Ga0587078_006461 3300059646 Bacteria 1276
1068 Ga0587079_027730 3300059647 Bacteria 1067
1069 Ga0587107_000278 3300059652 Bacteria 3063
1070 Ga0587114_051809 3300059655 Bacteria 697
1071 Ga0587124_023994 3300059660 Bacteria 640
1072 Ga0587071_014153 3300060344 Bacteria 1384
1073 Ga0587071_062609 3300060344 Bacteria 794
1074 Ga0587111_0030774 3300060346 Bacteria 1094
1075 Ga0501082_0049749 3300060353 Bacteria 3614
1076 Ga0501082_0161198 3300060353 Bacteria 1949
1077 Ga0501082_0220581 3300060353 Bacteria 1650
1078 Ga0501082_0227328 3300060353 Bacteria 1624
1079 Ga0501082_0253081 3300060353 Bacteria 1532
1080 Ga0501082_0689903 3300060353 Bacteria 894
1081 Ga0466962_0322552 3300061719 Bacteria 766
1082 Ga0466962_0535006 3300061719 Bacteria 595
1083 Ga0530510_0407417 3300061734 Bacteria 1026

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10028569 Ga0307513_100285698 118
2 3300031730 Ga0307516_10057860 Ga0307516_100578606 118
3 3300033180 Ga0307510_10235297 Ga0307510_102352973 118
4 3300036401 Ga0373937_1299498 Ga0373937_1299498_305_661 118
5 3300044901 Ga0466960_0770748 Ga0466960_0770748_208_570 118
6 3300053088 Ga0500644_0033161 Ga0500644_0033161_77_451 118
7 3300053108 Ga0500562_111930 Ga0500562_111930_54_428 118
8 3300021384 Ga0213876_10003189 Ga0213876_1000318910 120
9 3300028577 Ga0265318_10000037 Ga0265318_1000003710 120
10 3300039437 Ga0436365_0544722 Ga0436365_0544722_398_808 120
11 3300046477 Ga0495664_0454931 Ga0495664_0454931_288_698 120
12 3300046529 Ga0495652_0270727 Ga0495652_0270727_560_970 120
13 3300046536 Ga0495587_0405187 Ga0495587_0405187_334_744 120
14 3300049581 Ga0501047_0457014 Ga0501047_0457014_526_936 120
15 3300054114 Ga0501084_0000175 Ga0501084_0000175_45294_45704 120
16 3300005539 Ga0068853_100114801 Ga0068853_1001148016 121
17 3300005563 Ga0068855_100047378 Ga0068855_10004737810 121
18 3300005614 Ga0068856_100369844 Ga0068856_1003698444 121
19 3300005616 Ga0068852_101715648 Ga0068852_1017156481 121
20 3300005616 Ga0068852_101918274 Ga0068852_1019182741 121
21 3300005616 Ga0068852_102361678 Ga0068852_1023616781 121
22 3300006237 Ga0097621_100818497 Ga0097621_1008184972 121
23 3300009093 Ga0105240_10004696 Ga0105240_1000469626 121
24 3300009093 Ga0105240_11183468 Ga0105240_111834681 121
25 3300009101 Ga0105247_10106510 Ga0105247_101065104 121
26 3300009545 Ga0105237_10944359 Ga0105237_109443592 121
27 3300010375 Ga0105239_10104618 Ga0105239_101046185 121
28 3300010375 Ga0105239_10256544 Ga0105239_102565444 121
29 3300013105 Ga0157369_10115778 Ga0157369_101157784 121
30 3300025913 Ga0207695_10000018 Ga0207695_1000001836 121
31 3300025924 Ga0207694_10000010 Ga0207694_10000010358 121
32 3300025949 Ga0207667_10000388 Ga0207667_1000038865 121
33 3300026041 Ga0207639_10029726 Ga0207639_100297269 121
34 3300026142 Ga0207698_10252997 Ga0207698_102529972 121
35 3300026142 Ga0207698_10380105 Ga0207698_103801052 121
36 3300049460 Ga0495682_0005207 Ga0495682_0005207_1437_1847 121
37 3300053133 Ga0500655_015396 Ga0500655_015396_258_668 121
38 3300005615 Ga0070702_100576219 Ga0070702_1005762192 122
39 3300013306 Ga0163162_11776650 Ga0163162_117766502 122
40 3300048904 Ga0496101_0659266 Ga0496101_0659266_143_559 122
41 3300048905 Ga0496102_0426059 Ga0496102_0426059_247_663 122
42 3300048914 Ga0496111_0748896 Ga0496111_0748896_280_696 122
43 3300049583 Ga0501067_0091010 Ga0501067_0091010_551_967 122
44 iso_pu_bacteria 2503198000 2503202660 133
45 iso_pu_bacteria 2508501123 2509117725 133
46 iso_pu_bacteria 2508501127 2509143590 133
47 iso_pu_bacteria 2509276018 2509372995 133
48 iso_pu_bacteria 2509276022 2509397165 133
49 iso_pu_bacteria 2510065059 2510319913 133
50 iso_pu_bacteria 2511231027 2511390480 133
51 iso_pu_bacteria 2512875016 2512930566 133
52 iso_pu_bacteria 2512875024 2512958298 133
53 iso_pu_bacteria 2513237090 2513612127 133
54 iso_pu_bacteria 2513237164 2514032569 133
55 iso_pu_bacteria 2513237305 2514422080 133
56 iso_pu_bacteria 2513237351 2514589869 133
57 iso_pu_bacteria 2545555834 2545677358 133
58 iso_pu_bacteria 2588253730 2588516208 133
59 iso_pu_bacteria 2597489875 2597813655 133
60 iso_pu_bacteria 2599185301 2599939543 133
61 iso_pu_bacteria 2643221550 2643773786 133
62 iso_pu_bacteria 2643221551 2643775174 133
63 iso_pu_bacteria 2643221555 2643793620 133
64 iso_pu_bacteria 2643221564 2643837524 133
65 iso_pu_bacteria 2643221595 2643987303 133
66 iso_pu_bacteria 2643221623 2644131931 133
67 iso_pu_bacteria 2643221627 2644155627 133
68 iso_pu_bacteria 2687453392 2688599064 133
69 iso_pu_bacteria 2693429783 2694631913 133
70 iso_pu_bacteria 2693429784 2694634666 133
71 iso_pu_bacteria 2721755686 2723576068 133
72 iso_pu_bacteria 2738543024 2739309049 133
73 iso_pu_bacteria 2756170246 2756677758 133
74 iso_pu_bacteria 2757320392 2757572017 133
75 iso_pu_bacteria 2758568016 2758641831 133
76 iso_pu_bacteria 2765235802 2765465540 133
77 iso_pu_bacteria 2767802442 2770195565 133
78 iso_pu_bacteria 2775506902 2776271573 133
79 iso_pu_bacteria 2775506904 2776279915 133
80 iso_pu_bacteria 2791355123 2792750751 133
81 iso_pu_bacteria 2839993093 2839995592 133
82 iso_pu_bacteria 2840764183 2840768021 133
83 iso_pu_bacteria 2841734538 2841740451 133
84 iso_pu_bacteria 2842871566 2842872903 133
85 iso_pu_bacteria 2844002411 2844006796 133
86 iso_pu_bacteria 2844009547 2844014463 133
87 iso_pu_bacteria 2847670302 2847670796 133
88 iso_pu_bacteria 2847686936 2847687067 133
89 iso_pu_bacteria 2856314179 2856316253 133
90 iso_pu_bacteria 2856320880 2856325077 133
91 iso_pu_bacteria 2856328259 2856330565 133
92 iso_pu_bacteria 2856334872 2856340865 133
93 iso_pu_bacteria 2856342000 2856345833 133
94 iso_pu_bacteria 2856349417 2856349741 133
95 iso_pu_bacteria 2856356410 2856359235 133
96 iso_pu_bacteria 2856364286 2856369149 133
97 iso_pu_bacteria 2857349434 2857355587 133
98 iso_pu_bacteria 2857367948 2857372581 133
99 iso_pu_bacteria 2869162929 2869168976 133
100 iso_pu_bacteria 2869169390 2869174089 133
101 iso_pu_bacteria 2869234852 2869237161 133
102 iso_pu_bacteria 2869242130 2869243187 133
103 iso_pu_bacteria 2869249662 2869252742 133
104 iso_pu_bacteria 2869256925 2869262747 133
105 iso_pu_bacteria 2869264136 2869270264 133
106 iso_pu_bacteria 2869271264 2869273280 133
107 iso_pu_bacteria 2869278585 2869280901 133
108 iso_pu_bacteria 2869285874 2869288393 133
109 iso_pu_bacteria 2871429161 2871432102 133
110 iso_pu_bacteria 2871435913 2871439287 133
111 iso_pu_bacteria 2871444079 2871448837 133
112 iso_pu_bacteria 2871451962 2871455263 133
113 iso_pu_bacteria 2871459585 2871459674 133
114 iso_pu_bacteria 2871466892 2871470929 133
115 iso_pu_bacteria 2871474448 2871480989 133
116 iso_pu_bacteria 2871481445 2871484307 133
117 iso_pu_bacteria 2871488783 2871495251 133
118 iso_pu_bacteria 2871495908 2871500459 133
119 iso_pu_bacteria 2874109183 2874115358 133
120 iso_pu_bacteria 2874116593 2874120799 133
121 iso_pu_bacteria 2874123672 2874125710 133
122 iso_pu_bacteria 2874131515 2874137247 133
123 iso_pu_bacteria 2874139085 2874141431 133
124 iso_pu_bacteria 2874146452 2874150981 133
125 iso_pu_bacteria 2874155637 2874157320 133
126 iso_pu_bacteria 2874162495 2874163767 133
127 iso_pu_bacteria 2874168670 2874172574 133
128 iso_pu_bacteria 2876363079 2876368088 133
129 iso_pu_bacteria 2876377896 2876385317 133
130 iso_pu_bacteria 2876386047 2876392719 133
131 iso_pu_bacteria 2876392853 2876395264 133
132 iso_pu_bacteria 2876399893 2876405253 133
133 iso_pu_bacteria 2876406927 2876409340 133
134 iso_pu_bacteria 2876413966 2876417010 133
135 iso_pu_bacteria 2876420981 2876427161 133
136 iso_pu_bacteria 2878035449 2878041576 133
137 iso_pu_bacteria 2878730984 2878734406 133
138 iso_pu_bacteria 2878738818 2878743160 133
139 iso_pu_bacteria 2878745973 2878748821 133
140 iso_pu_bacteria 2878753008 2878758083 133
141 iso_pu_bacteria 2878760144 2878764548 133
142 iso_pu_bacteria 2878767105 2878771649 133
143 iso_pu_bacteria 2878774303 2878776388 133
144 iso_pu_bacteria 2878781027 2878782381 133
145 iso_pu_bacteria 2878788777 2878796103 133
146 iso_pu_bacteria 2881147464 2881152553 133
147 iso_pu_bacteria 2881155292 2881155980 133
148 iso_pu_bacteria 2881161766 2881161791 133
149 iso_pu_bacteria 2881845957 2881846267 133
150 iso_pu_bacteria 2881853255 2881859809 133
151 iso_pu_bacteria 2881861095 2881862930 133
152 iso_pu_bacteria 2882632389 2882633064 133
153 iso_pu_bacteria 2882912400 2882916440 133
154 iso_pu_bacteria 2883577096 2883581695 133
155 iso_pu_bacteria 2885305155 2885310676 133
156 iso_pu_bacteria 2885312484 2885317440 133
157 iso_pu_bacteria 2885318864 2885322432 133
158 iso_pu_bacteria 2885334103 2885340429 133
159 iso_pu_bacteria 2885342637 2885344965 133
160 iso_pu_bacteria 2885350715 2885356348 133
161 iso_pu_bacteria 2888337043 2888340692 133
162 iso_pu_bacteria 2888343758 2888347871 133
163 iso_pu_bacteria 2888350351 2888356888 133
164 iso_pu_bacteria 2889010040 2889011935 133
165 iso_pu_bacteria 2889016732 2889023133 133
166 iso_pu_bacteria 2894652903 2894654240 133
167 iso_pu_bacteria 2894772417 2894774435 133
168 iso_pu_bacteria 2894817345 2894818632 133
169 iso_pu_bacteria 2903448605 2903452108 133
170 iso_pu_bacteria 2903492973 2903495126 133
171 iso_pu_bacteria 2903492973 2903496185 133
172 iso_pu_bacteria 2903513507 2903514953 133
173 iso_pu_bacteria 2903521522 2903527084 133
174 iso_pu_bacteria 2903528002 2903533311 133
175 iso_pu_bacteria 2903540706 2903545272 133
176 iso_pu_bacteria 2904578770 2904583229 133
177 iso_pu_bacteria 2904659560 2904661894 133
178 iso_pu_bacteria 2906308376 2906311173 133
179 iso_pu_bacteria 2906321335 2906323940 133
180 iso_pu_bacteria 2906328253 2906328361 133
181 iso_pu_bacteria 2906354277 2906362585 133
182 iso_pu_bacteria 2906363423 2906370618 133
183 iso_pu_bacteria 2906370794 2906374322 133
184 iso_pu_bacteria 2906378014 2906379241 133
185 iso_pu_bacteria 2906386501 2906391757 133
186 iso_pu_bacteria 2906393657 2906398072 133
187 iso_pu_bacteria 2906401398 2906407938 133
188 iso_pu_bacteria 2906408224 2906410572 133
189 iso_pu_bacteria 2906414383 2906416390 133
190 iso_pu_bacteria 2906427513 2906432079 133
191 iso_pu_bacteria 2919119836 2919123877 133
192 iso_pu_bacteria 2922151315 2922154898 133
193 iso_pu_bacteria 2922158528 2922159633 133
194 iso_pu_bacteria 2922172374 2922175800 133
195 iso_pu_bacteria 2922178524 2922182768 133
196 iso_pu_bacteria 2922185730 2922191544 133
197 iso_pu_bacteria 2924710171 2924716988 133
198 iso_pu_bacteria 2924718760 2924725445 133
199 iso_pu_bacteria 2924726620 2924727278 133
200 iso_pu_bacteria 2924733363 2924736138 133
201 iso_pu_bacteria 2924741084 2924744183 133
202 iso_pu_bacteria 2924748358 2924750381 133
203 iso_pu_bacteria 2924754689 2924759042 133
204 iso_pu_bacteria 2924762789 2924763827 133
205 iso_pu_bacteria 2924776078 2924777274 133
206 iso_pu_bacteria 2924784321 2924785824 133
207 iso_pu_bacteria 2928521798 2928524360 133
208 iso_pu_bacteria 2937813078 2937813394 133
209 iso_pu_bacteria 2937822353 2937826673 133
210 iso_pu_bacteria 2937836603 2937839995 133
211 iso_pu_bacteria 2937843397 2937845877 133
212 iso_pu_bacteria 2937848649 2937853630 133
213 iso_pu_bacteria 2937861824 2937864416 133
214 iso_pu_bacteria 2937868953 2937869772 133
215 iso_pu_bacteria 2937877337 2937879321 133
216 iso_pu_bacteria 2937891427 2937898207 133
217 iso_pu_bacteria 2937972304 2937974945 133
218 iso_pu_bacteria 2937980651 2937988341 133
219 iso_pu_bacteria 2937994558 2937999122 133
220 iso_pu_bacteria 2938014810 2938019869 133
221 iso_pu_bacteria 2939669807 2939671386 133
222 iso_pu_bacteria 2954011201 2954015364 133
223 iso_pu_bacteria 2958034702 2958036864 133
224 iso_pu_bacteria 2958041894 2958050486 133
225 iso_pu_bacteria 2958064165 2958070268 133
226 iso_pu_bacteria 2958071322 2958072566 133
227 iso_pu_bacteria 2958084443 2958086496 133
228 iso_pu_bacteria 2958092219 2958100701 133
229 iso_pu_bacteria 2958100919 2958101582 133
230 iso_pu_bacteria 2958108152 2958110473 133
231 iso_pu_bacteria 2958115193 2958122497 133
232 iso_pu_bacteria 2958122699 2958130102 133
233 iso_pu_bacteria 2958130278 2958132794 133
234 iso_pu_bacteria 2958137437 2958142866 133
235 iso_pu_bacteria 2958144490 2958145625 133
236 iso_pu_bacteria 2958158011 2958162966 133
237 iso_pu_bacteria 2958165035 2958169596 133
238 iso_pu_bacteria 2958179912 2958182926 133
239 iso_pu_bacteria 2961077736 2961080806 133
240 iso_pu_bacteria 2961114664 2961117047 133
241 iso_pu_bacteria 2961127735 2961133188 133
242 iso_pu_bacteria 2961136820 2961139066 133
243 iso_pu_bacteria 2961163497 2961168056 133
244 iso_pu_bacteria 2961170736 2961174713 133
245 iso_pu_bacteria 2961183825 2961186459 133
246 iso_pu_bacteria 2963644680 2963648661 133
247 iso_pu_bacteria 2965018300 2965022875 133
248 iso_pu_bacteria 2965025482 2965027340 133
249 iso_pu_bacteria 2965040258 2965040812 133
250 iso_pu_bacteria 2965047637 2965050116 133
251 iso_pu_bacteria 2965062239 2965066165 133
252 iso_pu_bacteria 2965089291 2965091045 133
253 iso_pu_bacteria 2965102966 2965109557 133
254 iso_pu_bacteria 2965110997 2965118068 133
255 iso_pu_bacteria 2965119406 2965122192 133
256 iso_pu_bacteria 2967996073 2968000648 133
257 iso_pu_bacteria 2968003550 2968009979 133
258 iso_pu_bacteria 2968016561 2968017461 133
259 iso_pu_bacteria 2968083720 2968083888 133
260 iso_pu_bacteria 2968091066 2968092503 133
261 iso_pu_bacteria 2968097103 2968102409 133
262 iso_pu_bacteria 2968110612 2968112955 133
263 iso_pu_bacteria 2968117919 2968122812 133
264 iso_pu_bacteria 2968128360 2968128766 133
265 iso_pu_bacteria 2968171901 2968176456 133
266 iso_pu_bacteria 2970469710 2970472363 133
267 iso_pu_bacteria 2970489779 2970490910 133
268 iso_pu_bacteria 2970503327 2970507299 133
269 iso_pu_bacteria 2970510686 2970513852 133
270 iso_pu_bacteria 2970524798 2970530012 133
271 iso_pu_bacteria 2970532167 2970538246 133
272 iso_pu_bacteria 2970547951 2970548663 133
273 iso_pu_bacteria 2970554993 2970559395 133
274 iso_pu_bacteria 2970593180 2970595505 133
275 iso_pu_bacteria 2970619444 2970620321 133
276 iso_pu_bacteria 2970627176 2970631995 133
277 iso_pu_bacteria 2977821940 2977828843 133
278 iso_pu_bacteria 2977828996 2977829834 133
279 iso_pu_bacteria 2977843712 2977845394 133
280 iso_pu_bacteria 2977851361 2977851791 133
281 iso_pu_bacteria 2977858184 2977860266 133
282 iso_pu_bacteria 2977864932 2977871958 133
283 iso_pu_bacteria 2977872689 2977877374 133
284 iso_pu_bacteria 2977898635 2977906636 133
285 iso_pu_bacteria 2977907340 2977911818 133
286 iso_pu_bacteria 2977915119 2977917214 133
287 iso_pu_bacteria 2977922695 2977928127 133
288 iso_pu_bacteria 2977935797 2977939440 133
289 iso_pu_bacteria 2977942078 2977946927 133
290 iso_pu_bacteria 2977950692 2977951362 133
291 iso_pu_bacteria 2977957713 2977958673 133
292 iso_pu_bacteria 2977971508 2977976590 133
293 iso_pu_bacteria 2977986579 2977989487 133
294 iso_pu_bacteria 2979710463 2979716964 133
295 iso_pu_bacteria 2979742915 2979743187 133
296 iso_pu_bacteria 2979764755 2979765765 133
297 iso_pu_bacteria 2979772303 2979777661 133
298 iso_pu_bacteria 2979779861 2979783038 133
299 iso_pu_bacteria 2979793036 2979798556 133
300 iso_pu_bacteria 2979808191 2979812495 133
301 iso_pu_bacteria 2987636660 2987640721 133
302 iso_pu_bacteria 2987645492 2987647818 133
303 iso_pu_bacteria 2987652177 2987652489 133
304 iso_pu_bacteria 2987659509 2987664070 133
305 iso_pu_bacteria 2987666974 2987670295 133
306 iso_pu_bacteria 2987673487 2987674289 133
307 iso_pu_bacteria 2996310559 2996310956 133
308 iso_pu_bacteria 2996336353 2996340571 133
309 iso_pu_bacteria 2996341866 2996347148 133
310 iso_pu_bacteria 2996348954 2996351234 133
311 iso_pu_bacteria 2996386984 2996390911 133
312 iso_pu_bacteria 3000135777 3000136170 133
313 iso_pu_bacteria 3002141150 3002143945 133
314 iso_pu_bacteria 3004167301 3004170188 133
315 iso_pu_bacteria 3004188549 3004193125 133
316 iso_pu_bacteria 3004195979 3004197764 133
317 iso_pu_bacteria 3004203850 3004208918 133
318 iso_pu_bacteria 3004211236 3004213104 133
319 iso_pu_bacteria 3004218560 3004222133 133
320 iso_pu_bacteria 3004232784 3004239288 133
321 iso_pu_bacteria 3004239961 3004242910 133
322 iso_pu_bacteria 3004268573 3004273806 133
323 iso_pu_bacteria 3004275668 3004277932 133
324 iso_pu_bacteria 3004289098 3004290233 133
325 iso_pu_bacteria 3004334049 3004340242 133
326 iso_pu_bacteria 637000159 637073561 133
327 iso_pu_bacteria 643348564 643599650 133
328 iso_pu_bacteria 649633066 649873497 133
329 iso_pu_bacteria 8002285264 8002285922 133
330 iso_pu_bacteria 8004300914 8004304428 133
331 iso_pu_bacteria 8004312739 8004316469 133
332 iso_pu_bacteria 8004361976 8004366439 133
333 iso_pu_bacteria 8004374579 8004379595 133
334 iso_pu_bacteria 8004387939 8004390924 133
335 iso_pu_bacteria 8004395343 8004402340 133
336 iso_pu_bacteria 8004445564 8004451616 133
337 iso_pu_bacteria 8004633249 8004638921 133
338 iso_pu_bacteria 8004640170 8004643107 133
339 iso_pu_bacteria 8004695233 8004701073 133
340 iso_pu_bacteria 8004703790 8004714457 133
341 iso_pu_bacteria 8004714634 8004717476 133
342 iso_pu_bacteria 8004727605 8004731772 133
343 iso_pu_bacteria 8055617313 8055622004 133
344 3300009174 Ga0105241_10295719 Ga0105241_102957193 135
345 3300026142 Ga0207698_12096819 Ga0207698_120968192 135
346 3300060353 Ga0501082_0227328 Ga0501082_0227328_772_1182 135
347 3300005434 Ga0070709_10053418 Ga0070709_100534186 136
348 3300005435 Ga0070714_101275745 Ga0070714_1012757452 136
349 3300006042 Ga0075368_10408645 Ga0075368_104086451 136
350 3300012510 Ga0157316_1041297 Ga0157316_10412972 136
351 3300013306 Ga0163162_10641078 Ga0163162_106410782 136
352 3300014968 Ga0157379_10010518 Ga0157379_100105184 136
353 3300021441 Ga0213871_10286220 Ga0213871_102862202 136
354 3300025906 Ga0207699_10645453 Ga0207699_106454532 136
355 3300025929 Ga0207664_10260683 Ga0207664_102606833 136
356 3300028800 Ga0265338_10340294 Ga0265338_103402942 136
357 3300031241 Ga0265325_10142648 Ga0265325_101426482 136
358 3300031241 Ga0265325_10436815 Ga0265325_104368152 136
359 3300031242 Ga0265329_10129057 Ga0265329_101290572 136
360 3300031249 Ga0265339_10038285 Ga0265339_100382852 136
361 3300031250 Ga0265331_10016180 Ga0265331_100161809 136
362 3300031344 Ga0265316_10076581 Ga0265316_100765816 136
363 3300031548 Ga0307408_100447469 Ga0307408_1004474693 136
364 3300031595 Ga0265313_10031690 Ga0265313_100316902 136
365 3300031711 Ga0265314_10084434 Ga0265314_100844344 136
366 3300031712 Ga0265342_10107995 Ga0265342_101079952 136
367 3300031852 Ga0307410_10088224 Ga0307410_100882241 136
368 3300031901 Ga0307406_10443616 Ga0307406_104436163 136
369 3300031911 Ga0307412_10030283 Ga0307412_100302833 136
370 3300031995 Ga0307409_100845007 Ga0307409_1008450072 136
371 3300032126 Ga0307415_100371306 Ga0307415_1003713062 136
372 3300035172 Ga0373955_0303048 Ga0373955_0303048_489_902 136
373 3300036401 Ga0373937_0025062 Ga0373937_0025062_4426_4839 136
374 3300037853 Ga0436364_0697961 Ga0436364_0697961_565_975 136
375 3300039437 Ga0436365_0973027 Ga0436365_0973027_402_812 136
376 3300039453 Ga0436362_1210898 Ga0436362_1210898_221_634 136
377 3300046462 Ga0495651_0323475 Ga0495651_0323475_469_882 136
378 3300046516 Ga0495628_0398834 Ga0495628_0398834_287_700 136
379 3300046557 Ga0495622_0354651 Ga0495622_0354651_124_540 136
380 3300046678 Ga0495599_0319617 Ga0495599_0319617_236_649 136
381 3300048921 Ga0496118_0142522 Ga0496118_0142522_905_1315 136
382 3300048927 Ga0496124_0095308 Ga0496124_0095308_1442_1852 136
383 3300049568 Ga0501031_0010832 Ga0501031_0010832_1432_1848 136
384 3300049569 Ga0501032_0051001 Ga0501032_0051001_165_581 136
385 3300049570 Ga0501033_0004963 Ga0501033_0004963_5061_5477 136
386 3300049572 Ga0501036_0186938 Ga0501036_0186938_990_1406 136
387 3300049572 Ga0501036_1004012 Ga0501036_1004012_86_496 136
388 3300049573 Ga0501037_0003453 Ga0501037_0003453_2013_2429 136
389 3300049574 Ga0501038_0216147 Ga0501038_0216147_927_1343 136
390 3300049575 Ga0501039_0054344 Ga0501039_0054344_238_654 136
391 3300049578 Ga0501042_0915857 Ga0501042_0915857_43_453 136
392 3300049579 Ga0501043_0007495 Ga0501043_0007495_5893_6309 136
393 3300049581 Ga0501047_0009718 Ga0501047_0009718_935_1351 136
394 3300049581 Ga0501047_0757346 Ga0501047_0757346_265_681 136
395 3300049582 Ga0501048_0793705 Ga0501048_0793705_234_650 136
396 3300049822 Ga0501035_0022027 Ga0501035_0022027_999_1415 136
397 3300049823 Ga0501044_0076702 Ga0501044_0076702_307_723 136
398 3300049824 Ga0501045_1337791 Ga0501045_1337791_68_478 136
399 3300050492 nmdc:mga0yw44_755433_c1 nmdc:mga0yw44_755433_c1_112_522 136
400 3300053150 Ga0500603_022818 Ga0500603_022818_1087_1497 136
401 3300061719 Ga0466962_0322552 Ga0466962_0322552_307_717 136
402 3300001979 JGI24740J21852_10011508 JGI24740J21852_100115084 137
403 3300001989 JGI24739J22299_10011564 JGI24739J22299_100115643 137
404 3300001989 JGI24739J22299_10023219 JGI24739J22299_100232193 137
405 3300001990 JGI24737J22298_10065756 JGI24737J22298_100657563 137
406 3300002705 JGI25156J39149_1004694 JGI25156J39149_10046949 137
407 3300002741 JGI25157J39369_1002241 JGI25157J39369_10022412 137
408 3300003203 JGI25406J46586_10001918 JGI25406J46586_1000191813 137
409 3300003214 JGI25165J46597_1001303 JGI25165J46597_100130318 137
410 3300003762 Ga0055542_1002774 Ga0055542_10027749 137
411 3300003763 Ga0055529_1005671 Ga0055529_10056712 137
412 3300005327 Ga0070658_10183900 Ga0070658_101839002 137
413 3300005328 Ga0070676_10143888 Ga0070676_101438884 137
414 3300005334 Ga0068869_100096159 Ga0068869_1000961594 137
415 3300005334 Ga0068869_101231623 Ga0068869_1012316232 137
416 3300005335 Ga0070666_10089881 Ga0070666_100898816 137
417 3300005337 Ga0070682_100255530 Ga0070682_1002555302 137
418 3300005337 Ga0070682_101760505 Ga0070682_1017605051 137
419 3300005338 Ga0068868_100073957 Ga0068868_1000739572 137
420 3300005338 Ga0068868_101574763 Ga0068868_1015747631 137
421 3300005339 Ga0070660_100981005 Ga0070660_1009810051 137
422 3300005340 Ga0070689_100111476 Ga0070689_1001114763 137
423 3300005343 Ga0070687_100094508 Ga0070687_1000945081 137
424 3300005344 Ga0070661_100021028 Ga0070661_1000210283 137
425 3300005344 Ga0070661_100049078 Ga0070661_1000490785 137
426 3300005354 Ga0070675_100203748 Ga0070675_1002037482 137
427 3300005354 Ga0070675_100559861 Ga0070675_1005598612 137
428 3300005354 Ga0070675_100763812 Ga0070675_1007638121 137
429 3300005355 Ga0070671_100280251 Ga0070671_1002802511 137
430 3300005356 Ga0070674_100294493 Ga0070674_1002944933 137
431 3300005364 Ga0070673_100326000 Ga0070673_1003260003 137
432 3300005365 Ga0070688_100209230 Ga0070688_1002092303 137
433 3300005365 Ga0070688_100394795 Ga0070688_1003947952 137
434 3300005366 Ga0070659_100338681 Ga0070659_1003386812 137
435 3300005366 Ga0070659_100689668 Ga0070659_1006896682 137
436 3300005367 Ga0070667_100277362 Ga0070667_1002773622 137
437 3300005434 Ga0070709_10020478 Ga0070709_100204787 137
438 3300005435 Ga0070714_100333680 Ga0070714_1003336803 137
439 3300005435 Ga0070714_100851782 Ga0070714_1008517822 137
440 3300005436 Ga0070713_100054584 Ga0070713_1000545848 137
441 3300005436 Ga0070713_101421033 Ga0070713_1014210331 137
442 3300005437 Ga0070710_10072682 Ga0070710_100726823 137
443 3300005440 Ga0070705_100594703 Ga0070705_1005947031 137
444 3300005455 Ga0070663_100031905 Ga0070663_1000319053 137
445 3300005455 Ga0070663_100105054 Ga0070663_1001050545 137
446 3300005455 Ga0070663_100151353 Ga0070663_1001513532 137
447 3300005455 Ga0070663_101334560 Ga0070663_1013345601 137
448 3300005456 Ga0070678_101419075 Ga0070678_1014190751 137
449 3300005456 Ga0070678_101904622 Ga0070678_1019046221 137
450 3300005457 Ga0070662_100137792 Ga0070662_1001377925 137
451 3300005458 Ga0070681_10742830 Ga0070681_107428302 137
452 3300005471 Ga0070698_100134303 Ga0070698_1001343035 137
453 3300005530 Ga0070679_100469604 Ga0070679_1004696042 137
454 3300005535 Ga0070684_101259428 Ga0070684_1012594281 137
455 3300005535 Ga0070684_101272144 Ga0070684_1012721441 137
456 3300005536 Ga0070697_100657013 Ga0070697_1006570132 137
457 3300005539 Ga0068853_100000888 Ga0068853_10000088810 137
458 3300005539 Ga0068853_100269462 Ga0068853_1002694622 137
459 3300005539 Ga0068853_100445767 Ga0068853_1004457672 137
460 3300005548 Ga0070665_100006166 Ga0070665_10000616610 137
461 3300005548 Ga0070665_100319540 Ga0070665_1003195403 137
462 3300005563 Ga0068855_100132159 Ga0068855_1001321593 137
463 3300005563 Ga0068855_100326596 Ga0068855_1003265961 137
464 3300005563 Ga0068855_100420269 Ga0068855_1004202692 137
465 3300005563 Ga0068855_101424104 Ga0068855_1014241042 137
466 3300005564 Ga0070664_100552558 Ga0070664_1005525582 137
467 3300005577 Ga0068857_100458367 Ga0068857_1004583672 137
468 3300005577 Ga0068857_100559042 Ga0068857_1005590423 137
469 3300005577 Ga0068857_100904146 Ga0068857_1009041462 137
470 3300005578 Ga0068854_100225910 Ga0068854_1002259101 137
471 3300005578 Ga0068854_100354078 Ga0068854_1003540782 137
472 3300005614 Ga0068856_100081776 Ga0068856_1000817765 137
473 3300005614 Ga0068856_100114919 Ga0068856_1001149192 137
474 3300005614 Ga0068856_100352912 Ga0068856_1003529124 137
475 3300005614 Ga0068856_101663352 Ga0068856_1016633522 137
476 3300005616 Ga0068852_100009612 Ga0068852_10000961214 137
477 3300005616 Ga0068852_100016813 Ga0068852_1000168133 137
478 3300005616 Ga0068852_100026746 Ga0068852_1000267464 137
479 3300005616 Ga0068852_100285464 Ga0068852_1002854643 137
480 3300005719 Ga0068861_100051723 Ga0068861_1000517232 137
481 3300005719 Ga0068861_100790679 Ga0068861_1007906792 137
482 3300005834 Ga0068851_10011945 Ga0068851_100119453 137
483 3300005834 Ga0068851_10129488 Ga0068851_101294882 137
484 3300005834 Ga0068851_10967984 Ga0068851_109679841 137
485 3300005842 Ga0068858_100277785 Ga0068858_1002777855 137
486 3300005842 Ga0068858_100376245 Ga0068858_1003762453 137
487 3300005844 Ga0068862_100150751 Ga0068862_1001507516 137
488 3300005844 Ga0068862_100593448 Ga0068862_1005934482 137
489 3300005937 Ga0081455_10012098 Ga0081455_1001209810 137
490 3300005937 Ga0081455_10046763 Ga0081455_1004676310 137
491 3300005937 Ga0081455_10127650 Ga0081455_101276505 137
492 3300005983 Ga0081540_1002663 Ga0081540_100266311 137
493 3300005983 Ga0081540_1016488 Ga0081540_10164885 137
494 3300005983 Ga0081540_1089513 Ga0081540_10895134 137
495 3300005985 Ga0081539_10000072 Ga0081539_1000007210 137
496 3300005985 Ga0081539_10004419 Ga0081539_1000441910 137
497 3300005985 Ga0081539_10019248 Ga0081539_100192482 137
498 3300006028 Ga0070717_10577894 Ga0070717_105778941 137
499 3300006028 Ga0070717_10859221 Ga0070717_108592212 137
500 3300006038 Ga0075365_10069048 Ga0075365_100690481 137
501 3300006038 Ga0075365_10170405 Ga0075365_101704052 137
502 3300006038 Ga0075365_10422342 Ga0075365_104223421 137
503 3300006038 Ga0075365_10741750 Ga0075365_107417502 137
504 3300006038 Ga0075365_11168730 Ga0075365_111687301 137
505 3300006042 Ga0075368_10166398 Ga0075368_101663981 137
506 3300006042 Ga0075368_10203166 Ga0075368_102031661 137
507 3300006042 Ga0075368_10364533 Ga0075368_103645331 137
508 3300006048 Ga0075363_100004858 Ga0075363_1000048587 137
509 3300006048 Ga0075363_100422880 Ga0075363_1004228802 137
510 3300006048 Ga0075363_100565768 Ga0075363_1005657682 137
511 3300006173 Ga0070716_100118595 Ga0070716_1001185952 137
512 3300006175 Ga0070712_100020783 Ga0070712_1000207832 137
513 3300006175 Ga0070712_100507373 Ga0070712_1005073734 137
514 3300006175 Ga0070712_101750514 Ga0070712_1017505141 137
515 3300006177 Ga0075362_10004861 Ga0075362_100048612 137
516 3300006177 Ga0075362_10014057 Ga0075362_100140578 137
517 3300006177 Ga0075362_10310555 Ga0075362_103105552 137
518 3300006178 Ga0075367_10148470 Ga0075367_101484701 137
519 3300006178 Ga0075367_10183139 Ga0075367_101831392 137
520 3300006178 Ga0075367_10421671 Ga0075367_104216712 137
521 3300006178 Ga0075367_10421684 Ga0075367_104216842 137
522 3300006178 Ga0075367_10875772 Ga0075367_108757721 137
523 3300006186 Ga0075369_10108834 Ga0075369_101088342 137
524 3300006186 Ga0075369_10139127 Ga0075369_101391273 137
525 3300006186 Ga0075369_10178884 Ga0075369_101788842 137
526 3300006237 Ga0097621_100769182 Ga0097621_1007691822 137
527 3300006353 Ga0075370_10003104 Ga0075370_1000310410 137
528 3300006353 Ga0075370_10176245 Ga0075370_101762452 137
529 3300006358 Ga0068871_100580240 Ga0068871_1005802402 137
530 3300006846 Ga0075430_100000605 Ga0075430_1000006052 137
531 3300006871 Ga0075434_101003988 Ga0075434_1010039882 137
532 3300006881 Ga0068865_100104366 Ga0068865_1001043662 137
533 3300006931 Ga0097620_100592678 Ga0097620_1005926782 137
534 3300009093 Ga0105240_10568612 Ga0105240_105686122 137
535 3300009093 Ga0105240_10747556 Ga0105240_107475562 137
536 3300009098 Ga0105245_10469358 Ga0105245_104693582 137
537 3300009098 Ga0105245_10731578 Ga0105245_107315781 137
538 3300009098 Ga0105245_10845108 Ga0105245_108451082 137
539 3300009098 Ga0105245_11455164 Ga0105245_114551642 137
540 3300009101 Ga0105247_10190156 Ga0105247_101901563 137
541 3300009147 Ga0114129_12169584 Ga0114129_121695842 137
542 3300009147 Ga0114129_12766950 Ga0114129_127669501 137
543 3300009148 Ga0105243_10119606 Ga0105243_101196063 137
544 3300009148 Ga0105243_11676020 Ga0105243_116760202 137
545 3300009174 Ga0105241_10040943 Ga0105241_100409433 137
546 3300009174 Ga0105241_10196158 Ga0105241_101961584 137
547 3300009174 Ga0105241_10256290 Ga0105241_102562904 137
548 3300009174 Ga0105241_11044501 Ga0105241_110445012 137
549 3300009176 Ga0105242_10064140 Ga0105242_100641402 137
550 3300009545 Ga0105237_10332155 Ga0105237_103321554 137
551 3300009545 Ga0105237_10586873 Ga0105237_105868732 137
552 3300009545 Ga0105237_10640967 Ga0105237_106409672 137
553 3300009551 Ga0105238_10012597 Ga0105238_100125976 137
554 3300009551 Ga0105238_10060184 Ga0105238_100601848 137
555 3300009551 Ga0105238_10290940 Ga0105238_102909402 137
556 3300009551 Ga0105238_10709028 Ga0105238_107090282 137
557 3300009553 Ga0105249_10525741 Ga0105249_105257412 137
558 3300010375 Ga0105239_10039505 Ga0105239_100395054 137
559 3300010375 Ga0105239_11270276 Ga0105239_112702761 137
560 3300010375 Ga0105239_11393482 Ga0105239_113934822 137
561 3300011119 Ga0105246_10114713 Ga0105246_101147134 137
562 3300011119 Ga0105246_10897680 Ga0105246_108976803 137
563 3300012494 Ga0157341_1047504 Ga0157341_10475041 137
564 3300013100 Ga0157373_10346246 Ga0157373_103462462 137
565 3300013102 Ga0157371_10043166 Ga0157371_100431664 137
566 3300013102 Ga0157371_10340940 Ga0157371_103409403 137
567 3300013104 Ga0157370_10033885 Ga0157370_100338858 137
568 3300013104 Ga0157370_10353884 Ga0157370_103538842 137
569 3300013104 Ga0157370_10710963 Ga0157370_107109632 137
570 3300013104 Ga0157370_11317979 Ga0157370_113179792 137
571 3300013104 Ga0157370_11550645 Ga0157370_115506451 137
572 3300013105 Ga0157369_10038065 Ga0157369_100380652 137
573 3300013105 Ga0157369_10687854 Ga0157369_106878542 137
574 3300013105 Ga0157369_10855454 Ga0157369_108554542 137
575 3300013296 Ga0157374_11004771 Ga0157374_110047711 137
576 3300013296 Ga0157374_11251300 Ga0157374_112513001 137
577 3300013296 Ga0157374_12366819 Ga0157374_123668191 137
578 3300013297 Ga0157378_10244775 Ga0157378_102447753 137
579 3300013297 Ga0157378_10273543 Ga0157378_102735432 137
580 3300013306 Ga0163162_10155250 Ga0163162_101552502 137
581 3300013307 Ga0157372_10064075 Ga0157372_100640751 137
582 3300013307 Ga0157372_10290744 Ga0157372_102907442 137
583 3300013307 Ga0157372_12852140 Ga0157372_128521402 137
584 3300013308 Ga0157375_10172923 Ga0157375_101729232 137
585 3300014325 Ga0163163_10072147 Ga0163163_100721474 137
586 3300014325 Ga0163163_11564471 Ga0163163_115644712 137
587 3300014326 Ga0157380_10499816 Ga0157380_104998162 137
588 3300014326 Ga0157380_12037108 Ga0157380_120371082 137
589 3300014326 Ga0157380_12510298 Ga0157380_125102982 137
590 3300014326 Ga0157380_12758068 Ga0157380_127580681 137
591 3300014326 Ga0157380_12766867 Ga0157380_127668672 137
592 3300014497 Ga0182008_10119741 Ga0182008_101197411 137
593 3300014497 Ga0182008_10149116 Ga0182008_101491164 137
594 3300014745 Ga0157377_10331116 Ga0157377_103311162 137
595 3300014745 Ga0157377_10826117 Ga0157377_108261172 137
596 3300015261 Ga0182006_1031634 Ga0182006_10316346 137
597 3300015261 Ga0182006_1126984 Ga0182006_11269842 137
598 3300015265 Ga0182005_1002173 Ga0182005_100217315 137
599 3300015265 Ga0182005_1041026 Ga0182005_10410261 137
600 3300017792 Ga0163161_10407732 Ga0163161_104077322 137
601 3300017792 Ga0163161_11253125 Ga0163161_112531252 137
602 3300021358 Ga0213873_10008313 Ga0213873_100083132 137
603 3300021358 Ga0213873_10011514 Ga0213873_100115141 137
604 3300021377 Ga0213874_10003891 Ga0213874_100038915 137
605 3300021377 Ga0213874_10018746 Ga0213874_100187463 137
606 3300021384 Ga0213876_10235011 Ga0213876_102350112 137
607 3300021388 Ga0213875_10080749 Ga0213875_100807492 137
608 3300021441 Ga0213871_10098758 Ga0213871_100987581 137
609 3300022467 Ga0224712_10023834 Ga0224712_100238345 137
610 3300025250 Ga0209026_1000002 Ga0209026_1000002472 137
611 3300025253 Ga0209677_100816 Ga0209677_1008168 137
612 3300025254 Ga0209148_1000038 Ga0209148_100003877 137
613 3300025256 Ga0209759_1000119 Ga0209759_100011910 137
614 3300025261 Ga0209233_1000188 Ga0209233_100018850 137
615 3300025261 Ga0209233_1029680 Ga0209233_10296802 137
616 3300025272 Ga0209455_1000204 Ga0209455_100020410 137
617 3300025272 Ga0209455_1005018 Ga0209455_10050185 137
618 3300025294 Ga0209025_1041276 Ga0209025_10412764 137
619 3300025294 Ga0209025_1098796 Ga0209025_10987962 137
620 3300025294 Ga0209025_1112992 Ga0209025_11129922 137
621 3300025297 Ga0209758_1006057 Ga0209758_100605717 137
622 3300025315 Ga0207697_10030257 Ga0207697_100302576 137
623 3300025321 Ga0207656_10000708 Ga0207656_1000070812 137
624 3300025321 Ga0207656_10029364 Ga0207656_100293642 137
625 3300025893 Ga0207682_10058611 Ga0207682_100586114 137
626 3300025898 Ga0207692_10144556 Ga0207692_101445562 137
627 3300025900 Ga0207710_10686447 Ga0207710_106864471 137
628 3300025901 Ga0207688_10024957 Ga0207688_100249578 137
629 3300025901 Ga0207688_10118156 Ga0207688_101181562 137
630 3300025904 Ga0207647_10069351 Ga0207647_100693513 137
631 3300025904 Ga0207647_10170361 Ga0207647_101703612 137
632 3300025906 Ga0207699_10183916 Ga0207699_101839162 137
633 3300025907 Ga0207645_10006221 Ga0207645_1000622110 137
634 3300025909 Ga0207705_10011637 Ga0207705_100116378 137
635 3300025909 Ga0207705_10187695 Ga0207705_101876952 137
636 3300025911 Ga0207654_10043479 Ga0207654_100434792 137
637 3300025911 Ga0207654_10462413 Ga0207654_104624131 137
638 3300025911 Ga0207654_11100659 Ga0207654_111006592 137
639 3300025912 Ga0207707_10357488 Ga0207707_103574883 137
640 3300025913 Ga0207695_10002347 Ga0207695_1000234714 137
641 3300025913 Ga0207695_10109547 Ga0207695_101095473 137
642 3300025913 Ga0207695_10253213 Ga0207695_102532132 137
643 3300025914 Ga0207671_10110334 Ga0207671_101103343 137
644 3300025914 Ga0207671_10237967 Ga0207671_102379672 137
645 3300025915 Ga0207693_10026373 Ga0207693_1002637311 137
646 3300025915 Ga0207693_10252031 Ga0207693_102520314 137
647 3300025916 Ga0207663_10089559 Ga0207663_100895594 137
648 3300025918 Ga0207662_10463199 Ga0207662_104631992 137
649 3300025919 Ga0207657_10011937 Ga0207657_1001193710 137
650 3300025919 Ga0207657_10678540 Ga0207657_106785401 137
651 3300025920 Ga0207649_10003305 Ga0207649_1000330513 137
652 3300025920 Ga0207649_10467790 Ga0207649_104677901 137
653 3300025920 Ga0207649_10529592 Ga0207649_105295923 137
654 3300025924 Ga0207694_10022428 Ga0207694_100224288 137
655 3300025924 Ga0207694_10033132 Ga0207694_100331329 137
656 3300025924 Ga0207694_10085496 Ga0207694_100854962 137
657 3300025924 Ga0207694_10462287 Ga0207694_104622872 137
658 3300025925 Ga0207650_10457164 Ga0207650_104571643 137
659 3300025926 Ga0207659_10616521 Ga0207659_106165212 137
660 3300025927 Ga0207687_10079261 Ga0207687_100792613 137
661 3300025927 Ga0207687_10494140 Ga0207687_104941402 137
662 3300025928 Ga0207700_10055325 Ga0207700_100553257 137
663 3300025928 Ga0207700_11239767 Ga0207700_112397671 137
664 3300025932 Ga0207690_10137165 Ga0207690_101371654 137
665 3300025932 Ga0207690_10370310 Ga0207690_103703102 137
666 3300025932 Ga0207690_10517750 Ga0207690_105177502 137
667 3300025932 Ga0207690_11392386 Ga0207690_113923861 137
668 3300025933 Ga0207706_10017336 Ga0207706_100173369 137
669 3300025934 Ga0207686_10098572 Ga0207686_100985722 137
670 3300025935 Ga0207709_10697778 Ga0207709_106977782 137
671 3300025935 Ga0207709_10903135 Ga0207709_109031352 137
672 3300025936 Ga0207670_11834158 Ga0207670_118341581 137
673 3300025937 Ga0207669_10237964 Ga0207669_102379642 137
674 3300025937 Ga0207669_10483614 Ga0207669_104836142 137
675 3300025939 Ga0207665_10159438 Ga0207665_101594382 137
676 3300025940 Ga0207691_10168157 Ga0207691_101681575 137
677 3300025940 Ga0207691_11119673 Ga0207691_111196732 137
678 3300025941 Ga0207711_10476855 Ga0207711_104768552 137
679 3300025941 Ga0207711_11132271 Ga0207711_111322711 137
680 3300025942 Ga0207689_10358749 Ga0207689_103587491 137
681 3300025942 Ga0207689_10379367 Ga0207689_103793673 137
682 3300025942 Ga0207689_10435269 Ga0207689_104352691 137
683 3300025944 Ga0207661_10550432 Ga0207661_105504321 137
684 3300025945 Ga0207679_10707568 Ga0207679_107075682 137
685 3300025949 Ga0207667_10000877 Ga0207667_1000087723 137
686 3300025949 Ga0207667_10119839 Ga0207667_101198395 137
687 3300025949 Ga0207667_10267115 Ga0207667_102671153 137
688 3300025961 Ga0207712_10770224 Ga0207712_107702243 137
689 3300025972 Ga0207668_10180850 Ga0207668_101808504 137
690 3300025972 Ga0207668_11783125 Ga0207668_117831251 137
691 3300025981 Ga0207640_10158340 Ga0207640_101583402 137
692 3300025981 Ga0207640_10268641 Ga0207640_102686413 137
693 3300025981 Ga0207640_11418914 Ga0207640_114189142 137
694 3300026023 Ga0207677_10234626 Ga0207677_102346263 137
695 3300026023 Ga0207677_11678840 Ga0207677_116788401 137
696 3300026035 Ga0207703_10200256 Ga0207703_102002564 137
697 3300026041 Ga0207639_10002448 Ga0207639_1000244811 137
698 3300026041 Ga0207639_10249047 Ga0207639_102490474 137
699 3300026041 Ga0207639_10386268 Ga0207639_103862682 137
700 3300026041 Ga0207639_10388172 Ga0207639_103881722 137
701 3300026041 Ga0207639_11788024 Ga0207639_117880242 137
702 3300026067 Ga0207678_10048388 Ga0207678_100483886 137
703 3300026067 Ga0207678_10049649 Ga0207678_100496497 137
704 3300026067 Ga0207678_10076186 Ga0207678_100761865 137
705 3300026067 Ga0207678_10612480 Ga0207678_106124802 137
706 3300026067 Ga0207678_11311165 Ga0207678_113111651 137
707 3300026078 Ga0207702_10014521 Ga0207702_100145214 137
708 3300026078 Ga0207702_10153650 Ga0207702_101536504 137
709 3300026078 Ga0207702_10473640 Ga0207702_104736402 137
710 3300026078 Ga0207702_11107845 Ga0207702_111078452 137
711 3300026078 Ga0207702_11748803 Ga0207702_117488032 137
712 3300026089 Ga0207648_10011030 Ga0207648_100110309 137
713 3300026089 Ga0207648_10095334 Ga0207648_100953346 137
714 3300026095 Ga0207676_10802442 Ga0207676_108024423 137
715 3300026116 Ga0207674_10128180 Ga0207674_101281802 137
716 3300026116 Ga0207674_10190354 Ga0207674_101903542 137
717 3300026116 Ga0207674_10386131 Ga0207674_103861313 137
718 3300026116 Ga0207674_10919994 Ga0207674_109199942 137
719 3300026118 Ga0207675_100040050 Ga0207675_1000400502 137
720 3300026118 Ga0207675_100090967 Ga0207675_1000909672 137
721 3300026121 Ga0207683_10016263 Ga0207683_1001626310 137
722 3300026121 Ga0207683_11118690 Ga0207683_111186902 137
723 3300026142 Ga0207698_10046854 Ga0207698_100468544 137
724 3300026142 Ga0207698_10089559 Ga0207698_100895594 137
725 3300026142 Ga0207698_10126898 Ga0207698_101268982 137
726 3300027695 Ga0209966_1038516 Ga0209966_10385162 137
727 3300027866 Ga0209813_10017271 Ga0209813_100172715 137
728 3300027866 Ga0209813_10102879 Ga0209813_101028791 137
729 3300028379 Ga0268266_10020829 Ga0268266_1002082911 137
730 3300028379 Ga0268266_10036033 Ga0268266_100360332 137
731 3300028380 Ga0268265_10401497 Ga0268265_104014974 137
732 3300028556 Ga0265337_1002429 Ga0265337_100242914 137
733 3300028556 Ga0265337_1008843 Ga0265337_10088437 137
734 3300028558 Ga0265326_10001795 Ga0265326_100017954 137
735 3300028563 Ga0265319_1001825 Ga0265319_100182510 137
736 3300028563 Ga0265319_1040122 Ga0265319_10401224 137
737 3300028573 Ga0265334_10000469 Ga0265334_1000046915 137
738 3300028573 Ga0265334_10052725 Ga0265334_100527253 137
739 3300028577 Ga0265318_10008934 Ga0265318_100089348 137
740 3300028577 Ga0265318_10041779 Ga0265318_100417793 137
741 3300028653 Ga0265323_10001237 Ga0265323_1000123711 137
742 3300028654 Ga0265322_10051676 Ga0265322_100516762 137
743 3300028666 Ga0265336_10000535 Ga0265336_1000053520 137
744 3300028786 Ga0307517_10185220 Ga0307517_101852203 137
745 3300028800 Ga0265338_10000131 Ga0265338_10000131106 137
746 3300029957 Ga0265324_10001269 Ga0265324_1000126914 137
747 3300031235 Ga0265330_10125296 Ga0265330_101252963 137
748 3300031238 Ga0265332_10115038 Ga0265332_101150382 137
749 3300031238 Ga0265332_10176541 Ga0265332_101765412 137
750 3300031239 Ga0265328_10038497 Ga0265328_100384973 137
751 3300031239 Ga0265328_10348579 Ga0265328_103485792 137
752 3300031240 Ga0265320_10006806 Ga0265320_1000680611 137
753 3300031241 Ga0265325_10048954 Ga0265325_100489543 137
754 3300031241 Ga0265325_10160262 Ga0265325_101602622 137
755 3300031242 Ga0265329_10054789 Ga0265329_100547892 137
756 3300031247 Ga0265340_10065829 Ga0265340_100658293 137
757 3300031249 Ga0265339_10012498 Ga0265339_1001249810 137
758 3300031249 Ga0265339_10045403 Ga0265339_100454034 137
759 3300031249 Ga0265339_10074118 Ga0265339_100741182 137
760 3300031249 Ga0265339_10255981 Ga0265339_102559812 137
761 3300031250 Ga0265331_10005639 Ga0265331_100056399 137
762 3300031250 Ga0265331_10084260 Ga0265331_100842603 137
763 3300031250 Ga0265331_10193919 Ga0265331_101939192 137
764 3300031344 Ga0265316_10015933 Ga0265316_1001593311 137
765 3300031344 Ga0265316_10498534 Ga0265316_104985342 137
766 3300031456 Ga0307513_10178755 Ga0307513_101787553 137
767 3300031456 Ga0307513_10212495 Ga0307513_102124954 137
768 3300031456 Ga0307513_10455881 Ga0307513_104558812 137
769 3300031548 Ga0307408_100357006 Ga0307408_1003570064 137
770 3300031548 Ga0307408_101689637 Ga0307408_1016896372 137
771 3300031595 Ga0265313_10003614 Ga0265313_1000361410 137
772 3300031595 Ga0265313_10022840 Ga0265313_100228407 137
773 3300031595 Ga0265313_10031974 Ga0265313_100319745 137
774 3300031595 Ga0265313_10052060 Ga0265313_100520604 137
775 3300031711 Ga0265314_10008857 Ga0265314_100088575 137
776 3300031711 Ga0265314_10028270 Ga0265314_1002827010 137
777 3300031711 Ga0265314_10615528 Ga0265314_106155281 137
778 3300031712 Ga0265342_10004137 Ga0265342_1000413710 137
779 3300031712 Ga0265342_10101676 Ga0265342_101016761 137
780 3300031731 Ga0307405_10167684 Ga0307405_101676844 137
781 3300031731 Ga0307405_10767112 Ga0307405_107671123 137
782 3300031824 Ga0307413_10738202 Ga0307413_107382022 137
783 3300031852 Ga0307410_10952505 Ga0307410_109525052 137
784 3300031901 Ga0307406_11160143 Ga0307406_111601432 137
785 3300031903 Ga0307407_10352119 Ga0307407_103521193 137
786 3300031903 Ga0307407_11031382 Ga0307407_110313822 137
787 3300031911 Ga0307412_10033696 Ga0307412_100336962 137
788 3300031911 Ga0307412_10778838 Ga0307412_107788382 137
789 3300031995 Ga0307409_100317323 Ga0307409_1003173232 137
790 3300031995 Ga0307409_100707130 Ga0307409_1007071302 137
791 3300031995 Ga0307409_101618333 Ga0307409_1016183332 137
792 3300032002 Ga0307416_100537909 Ga0307416_1005379092 137
793 3300032002 Ga0307416_101472812 Ga0307416_1014728123 137
794 3300032004 Ga0307414_10155793 Ga0307414_101557933 137
795 3300032005 Ga0307411_10460006 Ga0307411_104600062 137
796 3300032126 Ga0307415_100114769 Ga0307415_1001147692 137
797 3300032126 Ga0307415_100435537 Ga0307415_1004355372 137
798 3300032126 Ga0307415_100611652 Ga0307415_1006116522 137
799 3300033180 Ga0307510_10275184 Ga0307510_102751844 137
800 3300035088 Ga0373940_0141410 Ga0373940_0141410_170_586 137
801 3300035089 Ga0373944_0029385 Ga0373944_0029385_387_803 137
802 3300035113 Ga0373936_0113921 Ga0373936_0113921_209_622 137
803 3300035118 Ga0373954_0041438 Ga0373954_0041438_490_906 137
804 3300035120 Ga0373957_0119033 Ga0373957_0119033_285_701 137
805 3300035121 Ga0373960_0240473 Ga0373960_0240473_138_551 137
806 3300035171 Ga0373946_0052650 Ga0373946_0052650_603_1019 137
807 3300035171 Ga0373946_0303804 Ga0373946_0303804_107_520 137
808 3300035172 Ga0373955_0555436 Ga0373955_0555436_83_499 137
809 3300035242 Ga0373962_0085141 Ga0373962_0085141_58_471 137
810 3300035410 Ga0373924_0055558 Ga0373924_0055558_430_846 137
811 3300035692 Ga0373935_0318189 Ga0373935_0318189_47_463 137
812 3300035695 Ga0373927_0093236 Ga0373927_0093236_682_1098 137
813 3300035724 Ga0373933_0217946 Ga0373933_0217946_415_828 137
814 3300035724 Ga0373933_0262839 Ga0373933_0262839_26_442 137
815 3300035725 Ga0373947_1076269 Ga0373947_1076269_46_462 137
816 3300036401 Ga0373937_0229703 Ga0373937_0229703_822_1238 137
817 3300037068 Ga0373925_0686270 Ga0373925_0686270_255_668 137
818 3300037068 Ga0373925_0873216 Ga0373925_0873216_137_550 137
819 3300037068 Ga0373925_1050951 Ga0373925_1050951_168_581 137
820 3300037312 Ga0395899_0000073 Ga0395899_0000073_73195_73608 137
821 3300037312 Ga0395899_0019478 Ga0395899_0019478_3322_3735 137
822 3300037312 Ga0395899_0075725 Ga0395899_0075725_1766_2179 137
823 3300037312 Ga0395899_0440335 Ga0395899_0440335_386_799 137
824 3300037418 Ga0395900_0000027 Ga0395900_0000027_177765_178178 137
825 3300037418 Ga0395900_0012290 Ga0395900_0012290_3600_4013 137
826 3300037418 Ga0395900_0147149 Ga0395900_0147149_577_990 137
827 3300037418 Ga0395900_0609526 Ga0395900_0609526_248_661 137
828 3300037466 Ga0395898_0000255 Ga0395898_0000255_22825_23238 137
829 3300037466 Ga0395898_0029950 Ga0395898_0029950_1788_2201 137
830 3300037466 Ga0395898_0131941 Ga0395898_0131941_649_1062 137
831 3300037471 Ga0395905_0000032 Ga0395905_0000032_107755_108168 137
832 3300037471 Ga0395905_0446168 Ga0395905_0446168_364_777 137
833 3300037471 Ga0395905_1274895 Ga0395905_1274895_199_612 137
834 3300037853 Ga0436364_0076013 Ga0436364_0076013_147_560 137
835 3300037853 Ga0436364_0530881 Ga0436364_0530881_1922_2335 137
836 3300037853 Ga0436364_0765756 Ga0436364_0765756_480_896 137
837 3300037853 Ga0436364_1305283 Ga0436364_1305283_191_607 137
838 3300038443 Ga0395901_0000110 Ga0395901_0000110_107780_108193 137
839 3300038443 Ga0395901_0036689 Ga0395901_0036689_38_451 137
840 3300038443 Ga0395901_0052439 Ga0395901_0052439_613_1026 137
841 3300038735 Ga0400485_17392 Ga0400485_17392_403_837 137
842 3300038742 Ga0400486_08264 Ga0400486_08264_49_483 137
843 3300039437 Ga0436365_0167537 Ga0436365_0167537_478_891 137
844 3300039437 Ga0436365_1253031 Ga0436365_1253031_39087_39500 137
845 3300039438 Ga0436360_0323768 Ga0436360_0323768_10_426 137
846 3300039438 Ga0436360_0429536 Ga0436360_0429536_1779_2195 137
847 3300039438 Ga0436360_0564682 Ga0436360_0564682_4276_4689 137
848 3300039438 Ga0436360_1144658 Ga0436360_1144658_898_1311 137
849 3300039438 Ga0436360_1325924 Ga0436360_1325924_144_557 137
850 3300039447 Ga0436361_0237988 Ga0436361_0237988_100_516 137
851 3300039450 Ga0436363_0701091 Ga0436363_0701091_832_1245 137
852 3300039450 Ga0436363_0880899 Ga0436363_0880899_461_874 137
853 3300039450 Ga0436363_0939204 Ga0436363_0939204_97_510 137
854 3300039450 Ga0436363_1046285 Ga0436363_1046285_8869_9282 137
855 3300039450 Ga0436363_1077755 Ga0436363_1077755_190_606 137
856 3300039450 Ga0436363_1630341 Ga0436363_1630341_124_555 137
857 3300039453 Ga0436362_0687315 Ga0436362_0687315_71_487 137
858 3300039453 Ga0436362_0733157 Ga0436362_0733157_1541_1954 137
859 3300041405 Ga0439438_017474 Ga0439438_017474_1052_1465 137
860 3300041408 Ga0439453_0008967 Ga0439453_0008967_198_611 137
861 3300041411 Ga0439466_0110953 Ga0439466_0110953_364_777 137
862 3300041413 Ga0439465_0032376 Ga0439465_0032376_308_721 137
863 3300041413 Ga0439465_0119634 Ga0439465_0119634_240_653 137
864 3300041443 Ga0451789_1069382 Ga0451789_1069382_324_737 137
865 3300041453 Ga0451797_0510059 Ga0451797_0510059_199_612 137
866 3300041460 Ga0451802_1649373 Ga0451802_1649373_434_847 137
867 3300041494 Ga0451837_1213495 Ga0451837_1213495_150_563 137
868 3300041494 Ga0451837_1454596 Ga0451837_1454596_922_1335 137
869 3300041505 Ga0451849_1216811 Ga0451849_1216811_130_543 137
870 3300041512 Ga0451853_2656839 Ga0451853_2656839_46_459 137
871 3300042001 Ga0439441_077923 Ga0439441_077923_196_609 137
872 3300042002 Ga0439442_099155 Ga0439442_099155_38_451 137
873 3300042004 Ga0439445_0067786 Ga0439445_0067786_514_927 137
874 3300042012 Ga0439455_0018856 Ga0439455_0018856_731_1144 137
875 3300042157 Ga0439458_0020812 Ga0439458_0020812_687_1100 137
876 3300042436 Ga0439435_0004725 Ga0439435_0004725_2414_2827 137
877 3300044656 Ga0466969_0085473 Ga0466969_0085473_207_620 137
878 3300044658 Ga0466972_0010313 Ga0466972_0010313_3864_4277 137
879 3300044693 Ga0466961_0068632 Ga0466961_0068632_1157_1570 137
880 3300044694 Ga0466963_0292782 Ga0466963_0292782_364_780 137
881 3300044694 Ga0466963_0895951 Ga0466963_0895951_102_518 137
882 3300044706 Ga0466964_0380189 Ga0466964_0380189_277_690 137
883 3300044719 Ga0466971_0254118 Ga0466971_0254118_93_506 137
884 3300044719 Ga0466971_0426149 Ga0466971_0426149_62_478 137
885 3300044842 Ga0466957_1155472 Ga0466957_1155472_35_448 137
886 3300044901 Ga0466960_0029748 Ga0466960_0029748_427_840 137
887 3300045049 Ga0466959_0011129 Ga0466959_0011129_1966_2379 137
888 3300045049 Ga0466959_0590257 Ga0466959_0590257_290_709 137
889 3300045836 Ga0466958_0180617 Ga0466958_0180617_312_725 137
890 3300045976 Ga0466967_0549579 Ga0466967_0549579_546_959 137
891 3300045976 Ga0466967_0613874 Ga0466967_0613874_149_565 137
892 3300045976 Ga0466967_1157763 Ga0466967_1157763_14_427 137
893 3300046454 Ga0495592_0098665 Ga0495592_0098665_379_792 137
894 3300046454 Ga0495592_0439032 Ga0495592_0439032_338_751 137
895 3300046455 Ga0495603_0432529 Ga0495603_0432529_282_698 137
896 3300046457 Ga0495590_0047095 Ga0495590_0047095_454_867 137
897 3300046459 Ga0495629_0131013 Ga0495629_0131013_209_622 137
898 3300046459 Ga0495629_0304789 Ga0495629_0304789_436_849 137
899 3300046460 Ga0495638_0040593 Ga0495638_0040593_1617_2030 137
900 3300046460 Ga0495638_0276814 Ga0495638_0276814_222_635 137
901 3300046471 Ga0495650_0127613 Ga0495650_0127613_103_516 137
902 3300046472 Ga0495580_0059866 Ga0495580_0059866_1794_2210 137
903 3300046473 Ga0495582_0319921 Ga0495582_0319921_436_849 137
904 3300046475 Ga0495639_0242902 Ga0495639_0242902_98_511 137
905 3300046477 Ga0495664_0051700 Ga0495664_0051700_1116_1529 137
906 3300046500 Ga0495596_0060347 Ga0495596_0060347_356_769 137
907 3300046500 Ga0495596_0130125 Ga0495596_0130125_352_765 137
908 3300046501 Ga0495607_0477595 Ga0495607_0477595_96_509 137
909 3300046501 Ga0495607_0524058 Ga0495607_0524058_79_492 137
910 3300046506 Ga0495583_0049116 Ga0495583_0049116_897_1310 137
911 3300046506 Ga0495583_0143975 Ga0495583_0143975_262_675 137
912 3300046512 Ga0495610_0327868 Ga0495610_0327868_65_478 137
913 3300046513 Ga0495616_0047418 Ga0495616_0047418_1173_1586 137
914 3300046514 Ga0495618_0307148 Ga0495618_0307148_410_823 137
915 3300046515 Ga0495620_0008766 Ga0495620_0008766_1320_1733 137
916 3300046520 Ga0495637_0027395 Ga0495637_0027395_502_915 137
917 3300046522 Ga0495643_0011617 Ga0495643_0011617_4719_5132 137
918 3300046537 Ga0495598_0165155 Ga0495598_0165155_56_469 137
919 3300046542 Ga0495597_0076584 Ga0495597_0076584_232_645 137
920 3300046543 Ga0495645_0165319 Ga0495645_0165319_951_1364 137
921 3300046616 Ga0495668_0252348 Ga0495668_0252348_27_440 137
922 3300046648 Ga0495611_0261712 Ga0495611_0261712_87_500 137
923 3300046660 Ga0495625_0220780 Ga0495625_0220780_258_671 137
924 3300046660 Ga0495625_0292882 Ga0495625_0292882_108_521 137
925 3300046675 Ga0495657_0068294 Ga0495657_0068294_1069_1482 137
926 3300046683 Ga0495658_0111501 Ga0495658_0111501_895_1308 137
927 3300046683 Ga0495658_0276678 Ga0495658_0276678_111_524 137
928 3300046684 Ga0495669_0294413 Ga0495669_0294413_201_614 137
929 3300046691 Ga0495670_0102193 Ga0495670_0102193_79_492 137
930 3300046810 Ga0495660_0007203 Ga0495660_0007203_3114_3527 137
931 3300047315 Ga0495581_0065369 Ga0495581_0065369_1308_1721 137
932 3300047317 Ga0495604_0233671 Ga0495604_0233671_562_975 137
933 3300047317 Ga0495604_0604734 Ga0495604_0604734_82_498 137
934 3300047320 Ga0495672_0073202 Ga0495672_0073202_1467_1880 137
935 3300047320 Ga0495672_0113829 Ga0495672_0113829_178_591 137
936 3300047320 Ga0495672_0117241 Ga0495672_0117241_845_1258 137
937 3300047322 Ga0495680_0065932 Ga0495680_0065932_977_1390 137
938 3300047443 Ga0495687_013562 Ga0495687_013562_1015_1428 137
939 3300047446 Ga0495679_059554 Ga0495679_059554_221_634 137
940 3300047469 Ga0495673_0187945 Ga0495673_0187945_243_656 137
941 3300047472 Ga0495686_0013227 Ga0495686_0013227_363_776 137
942 3300047472 Ga0495686_0184288 Ga0495686_0184288_406_819 137
943 3300048088 Ga0495602_0752933 Ga0495602_0752933_174_587 137
944 3300048090 Ga0495615_0042760 Ga0495615_0042760_520_933 137
945 3300048091 Ga0495626_0073504 Ga0495626_0073504_674_1087 137
946 3300048903 Ga0496100_0594067 Ga0496100_0594067_278_691 137
947 3300048904 Ga0496101_0639867 Ga0496101_0639867_329_742 137
948 3300048907 Ga0496104_0250153 Ga0496104_0250153_622_1035 137
949 3300048908 Ga0496105_0915100 Ga0496105_0915100_164_577 137
950 3300048909 Ga0496106_0680519 Ga0496106_0680519_228_641 137
951 3300048909 Ga0496106_0810384 Ga0496106_0810384_109_522 137
952 3300048909 Ga0496106_1487973 Ga0496106_1487973_60_473 137
953 3300048911 Ga0496108_1093656 Ga0496108_1093656_42_458 137
954 3300048912 Ga0496109_0361483 Ga0496109_0361483_74_487 137
955 3300048912 Ga0496109_0492074 Ga0496109_0492074_594_1007 137
956 3300048913 Ga0496110_0764248 Ga0496110_0764248_336_749 137
957 3300048914 Ga0496111_0318265 Ga0496111_0318265_629_1042 137
958 3300048915 Ga0496112_0063587 Ga0496112_0063587_923_1336 137
959 3300048916 Ga0496113_0260126 Ga0496113_0260126_494_907 137
960 3300048916 Ga0496113_0630790 Ga0496113_0630790_191_604 137
961 3300048918 Ga0496115_0181345 Ga0496115_0181345_633_1046 137
962 3300048920 Ga0496117_0123621 Ga0496117_0123621_468_881 137
963 3300048921 Ga0496118_0038146 Ga0496118_0038146_3136_3549 137
964 3300048921 Ga0496118_0070157 Ga0496118_0070157_2109_2522 137
965 3300048921 Ga0496118_0234990 Ga0496118_0234990_110_523 137
966 3300048922 Ga0496119_0000372 Ga0496119_0000372_36287_36700 137
967 3300048922 Ga0496119_0064924 Ga0496119_0064924_478_891 137
968 3300048922 Ga0496119_0081757 Ga0496119_0081757_157_570 137
969 3300048922 Ga0496119_0122432 Ga0496119_0122432_991_1404 137
970 3300048922 Ga0496119_0181727 Ga0496119_0181727_385_798 137
971 3300048922 Ga0496119_0204607 Ga0496119_0204607_167_580 137
972 3300048923 Ga0496120_0045101 Ga0496120_0045101_482_895 137
973 3300048923 Ga0496120_0065139 Ga0496120_0065139_532_945 137
974 3300048923 Ga0496120_0293618 Ga0496120_0293618_57_470 137
975 3300048924 Ga0496121_0035490 Ga0496121_0035490_3141_3554 137
976 3300048924 Ga0496121_0194855 Ga0496121_0194855_476_889 137
977 3300048924 Ga0496121_0428716 Ga0496121_0428716_69_482 137
978 3300048925 Ga0496122_0006451 Ga0496122_0006451_12029_12442 137
979 3300048925 Ga0496122_0255799 Ga0496122_0255799_103_516 137
980 3300048926 Ga0496123_0017126 Ga0496123_0017126_4470_4883 137
981 3300048927 Ga0496124_0105288 Ga0496124_0105288_1709_2122 137
982 3300048928 Ga0496125_0134455 Ga0496125_0134455_977_1390 137
983 3300048928 Ga0496125_0243721 Ga0496125_0243721_342_755 137
984 3300048928 Ga0496125_0380311 Ga0496125_0380311_152_565 137
985 3300048929 Ga0496126_0055058 Ga0496126_0055058_302_715 137
986 3300048929 Ga0496126_0164769 Ga0496126_0164769_776_1189 137
987 3300048929 Ga0496126_0282853 Ga0496126_0282853_527_940 137
988 3300048929 Ga0496126_0347592 Ga0496126_0347592_385_798 137
989 3300049129 Ga0501309_013314 Ga0501309_013314_155_568 137
990 3300049161 Ga0501305_054534 Ga0501305_054534_201_614 137
991 3300049529 Ga0501313_010924 Ga0501313_010924_353_784 137
992 3300049529 Ga0501313_047583 Ga0501313_047583_47_460 137
993 3300049531 Ga0501315_049789 Ga0501315_049789_49_462 137
994 3300049533 Ga0501317_002279 Ga0501317_002279_780_1199 137
995 3300049534 Ga0501318_001867 Ga0501318_001867_428_847 137
996 3300049536 Ga0501320_018996 Ga0501320_018996_347_760 137
997 3300049568 Ga0501031_0000651 Ga0501031_0000651_15607_16020 137
998 3300049568 Ga0501031_0003843 Ga0501031_0003843_4673_5086 137
999 3300049568 Ga0501031_0016670 Ga0501031_0016670_3978_4391 137
1000 3300049568 Ga0501031_0341948 Ga0501031_0341948_328_741 137
1001 3300049568 Ga0501031_0800168 Ga0501031_0800168_17_430 137
1002 3300049569 Ga0501032_0000111 Ga0501032_0000111_4528_4941 137
1003 3300049569 Ga0501032_0001915 Ga0501032_0001915_6864_7277 137
1004 3300049569 Ga0501032_0003488 Ga0501032_0003488_7156_7569 137
1005 3300049569 Ga0501032_0012326 Ga0501032_0012326_2097_2510 137
1006 3300049569 Ga0501032_0111144 Ga0501032_0111144_512_925 137
1007 3300049569 Ga0501032_0119107 Ga0501032_0119107_541_954 137
1008 3300049569 Ga0501032_0165400 Ga0501032_0165400_439_852 137
1009 3300049569 Ga0501032_0188536 Ga0501032_0188536_678_1091 137
1010 3300049569 Ga0501032_0237913 Ga0501032_0237913_624_1037 137
1011 3300049569 Ga0501032_0305998 Ga0501032_0305998_322_735 137
1012 3300049569 Ga0501032_0399755 Ga0501032_0399755_190_603 137
1013 3300049569 Ga0501032_0612912 Ga0501032_0612912_153_566 137
1014 3300049569 Ga0501032_0737764 Ga0501032_0737764_83_496 137
1015 3300049570 Ga0501033_0000121 Ga0501033_0000121_42816_43229 137
1016 3300049570 Ga0501033_0006462 Ga0501033_0006462_7963_8376 137
1017 3300049570 Ga0501033_0018118 Ga0501033_0018118_4553_4966 137
1018 3300049570 Ga0501033_0037361 Ga0501033_0037361_1314_1727 137
1019 3300049570 Ga0501033_0059135 Ga0501033_0059135_1779_2192 137
1020 3300049570 Ga0501033_0126195 Ga0501033_0126195_147_560 137
1021 3300049570 Ga0501033_0139684 Ga0501033_0139684_580_993 137
1022 3300049570 Ga0501033_0141883 Ga0501033_0141883_750_1163 137
1023 3300049570 Ga0501033_0194748 Ga0501033_0194748_786_1199 137
1024 3300049570 Ga0501033_0717400 Ga0501033_0717400_38_451 137
1025 3300049571 Ga0501034_0000298 Ga0501034_0000298_83289_83702 137
1026 3300049571 Ga0501034_0009013 Ga0501034_0009013_6018_6431 137
1027 3300049571 Ga0501034_0014685 Ga0501034_0014685_5474_5887 137
1028 3300049571 Ga0501034_0014987 Ga0501034_0014987_3713_4126 137
1029 3300049571 Ga0501034_0026519 Ga0501034_0026519_4528_4941 137
1030 3300049571 Ga0501034_0035212 Ga0501034_0035212_1590_2003 137
1031 3300049571 Ga0501034_0050055 Ga0501034_0050055_3197_3610 137
1032 3300049571 Ga0501034_0064759 Ga0501034_0064759_139_552 137
1033 3300049571 Ga0501034_0071741 Ga0501034_0071741_1989_2402 137
1034 3300049571 Ga0501034_0078177 Ga0501034_0078177_132_545 137
1035 3300049571 Ga0501034_0093906 Ga0501034_0093906_611_1024 137
1036 3300049571 Ga0501034_0172892 Ga0501034_0172892_344_757 137
1037 3300049571 Ga0501034_0185421 Ga0501034_0185421_829_1242 137
1038 3300049571 Ga0501034_0271516 Ga0501034_0271516_178_591 137
1039 3300049571 Ga0501034_0337605 Ga0501034_0337605_557_970 137
1040 3300049571 Ga0501034_0381046 Ga0501034_0381046_604_1017 137
1041 3300049571 Ga0501034_0594197 Ga0501034_0594197_370_783 137
1042 3300049571 Ga0501034_0679958 Ga0501034_0679958_369_782 137
1043 3300049571 Ga0501034_0753945 Ga0501034_0753945_72_485 137
1044 3300049571 Ga0501034_0760920 Ga0501034_0760920_301_714 137
1045 3300049572 Ga0501036_0000724 Ga0501036_0000724_19881_20294 137
1046 3300049572 Ga0501036_0002605 Ga0501036_0002605_9283_9696 137
1047 3300049572 Ga0501036_0014004 Ga0501036_0014004_2388_2801 137
1048 3300049572 Ga0501036_0038561 Ga0501036_0038561_907_1320 137
1049 3300049572 Ga0501036_0230566 Ga0501036_0230566_516_929 137
1050 3300049572 Ga0501036_0582833 Ga0501036_0582833_70_483 137
1051 3300049572 Ga0501036_0838139 Ga0501036_0838139_159_572 137
1052 3300049572 Ga0501036_0867987 Ga0501036_0867987_122_535 137
1053 3300049572 Ga0501036_1103135 Ga0501036_1103135_93_506 137
1054 3300049573 Ga0501037_0000131 Ga0501037_0000131_64862_65275 137
1055 3300049573 Ga0501037_0000191 Ga0501037_0000191_51960_52373 137
1056 3300049573 Ga0501037_0000195 Ga0501037_0000195_54194_54607 137
1057 3300049573 Ga0501037_0014952 Ga0501037_0014952_4563_4976 137
1058 3300049573 Ga0501037_0067854 Ga0501037_0067854_928_1341 137
1059 3300049573 Ga0501037_0108318 Ga0501037_0108318_189_602 137
1060 3300049573 Ga0501037_0158968 Ga0501037_0158968_745_1158 137
1061 3300049573 Ga0501037_0171288 Ga0501037_0171288_269_682 137
1062 3300049573 Ga0501037_0208097 Ga0501037_0208097_881_1294 137
1063 3300049573 Ga0501037_0346999 Ga0501037_0346999_355_768 137
1064 3300049573 Ga0501037_0382566 Ga0501037_0382566_365_778 137
1065 3300049573 Ga0501037_0519909 Ga0501037_0519909_10_423 137
1066 3300049574 Ga0501038_0000109 Ga0501038_0000109_64862_65275 137
1067 3300049574 Ga0501038_0001299 Ga0501038_0001299_4628_5041 137
1068 3300049574 Ga0501038_0001882 Ga0501038_0001882_14433_14846 137
1069 3300049574 Ga0501038_0005274 Ga0501038_0005274_7156_7569 137
1070 3300049574 Ga0501038_0029459 Ga0501038_0029459_2542_2955 137
1071 3300049574 Ga0501038_0039812 Ga0501038_0039812_812_1225 137
1072 3300049574 Ga0501038_0131427 Ga0501038_0131427_716_1129 137
1073 3300049574 Ga0501038_0132340 Ga0501038_0132340_933_1346 137
1074 3300049574 Ga0501038_0132662 Ga0501038_0132662_441_854 137
1075 3300049574 Ga0501038_0169820 Ga0501038_0169820_350_763 137
1076 3300049574 Ga0501038_0242003 Ga0501038_0242003_820_1233 137
1077 3300049574 Ga0501038_0309115 Ga0501038_0309115_626_1039 137
1078 3300049575 Ga0501039_0000080 Ga0501039_0000080_67654_68067 137
1079 3300049575 Ga0501039_0002279 Ga0501039_0002279_4528_4941 137
1080 3300049575 Ga0501039_0195543 Ga0501039_0195543_806_1219 137
1081 3300049575 Ga0501039_0240450 Ga0501039_0240450_520_933 137
1082 3300049575 Ga0501039_0271682 Ga0501039_0271682_36_449 137
1083 3300049575 Ga0501039_0525627 Ga0501039_0525627_248_667 137
1084 3300049576 Ga0501040_0107203 Ga0501040_0107203_608_1021 137
1085 3300049577 Ga0501041_0089200 Ga0501041_0089200_826_1239 137
1086 3300049577 Ga0501041_0219781 Ga0501041_0219781_336_749 137
1087 3300049578 Ga0501042_0403503 Ga0501042_0403503_351_764 137
1088 3300049579 Ga0501043_0000080 Ga0501043_0000080_4467_4880 137
1089 3300049579 Ga0501043_0004023 Ga0501043_0004023_4453_4866 137
1090 3300049579 Ga0501043_0012997 Ga0501043_0012997_2093_2506 137
1091 3300049579 Ga0501043_0038138 Ga0501043_0038138_341_754 137
1092 3300049579 Ga0501043_0047851 Ga0501043_0047851_728_1141 137
1093 3300049579 Ga0501043_0055891 Ga0501043_0055891_591_1004 137
1094 3300049579 Ga0501043_0060820 Ga0501043_0060820_2273_2686 137
1095 3300049579 Ga0501043_0089103 Ga0501043_0089103_50_463 137
1096 3300049579 Ga0501043_0099954 Ga0501043_0099954_1077_1490 137
1097 3300049579 Ga0501043_0113305 Ga0501043_0113305_711_1124 137
1098 3300049579 Ga0501043_0126611 Ga0501043_0126611_1002_1415 137
1099 3300049579 Ga0501043_0260320 Ga0501043_0260320_822_1235 137
1100 3300049579 Ga0501043_0311955 Ga0501043_0311955_701_1114 137
1101 3300049579 Ga0501043_0631661 Ga0501043_0631661_344_757 137
1102 3300049580 Ga0501046_0103794 Ga0501046_0103794_732_1145 137
1103 3300049580 Ga0501046_0144271 Ga0501046_0144271_868_1281 137
1104 3300049580 Ga0501046_0242537 Ga0501046_0242537_519_932 137
1105 3300049580 Ga0501046_0312805 Ga0501046_0312805_208_621 137
1106 3300049581 Ga0501047_0015743 Ga0501047_0015743_5677_6090 137
1107 3300049581 Ga0501047_0023054 Ga0501047_0023054_441_854 137
1108 3300049581 Ga0501047_0023074 Ga0501047_0023074_4632_5045 137
1109 3300049581 Ga0501047_0100301 Ga0501047_0100301_1907_2320 137
1110 3300049581 Ga0501047_0127913 Ga0501047_0127913_148_561 137
1111 3300049581 Ga0501047_0152453 Ga0501047_0152453_777_1190 137
1112 3300049581 Ga0501047_0176080 Ga0501047_0176080_288_701 137
1113 3300049581 Ga0501047_0181203 Ga0501047_0181203_1155_1568 137
1114 3300049581 Ga0501047_0194950 Ga0501047_0194950_341_754 137
1115 3300049581 Ga0501047_0206504 Ga0501047_0206504_1369_1782 137
1116 3300049581 Ga0501047_0245096 Ga0501047_0245096_333_746 137
1117 3300049581 Ga0501047_0318480 Ga0501047_0318480_885_1298 137
1118 3300049581 Ga0501047_0335131 Ga0501047_0335131_135_548 137
1119 3300049581 Ga0501047_0353434 Ga0501047_0353434_778_1191 137
1120 3300049581 Ga0501047_0414952 Ga0501047_0414952_432_845 137
1121 3300049581 Ga0501047_0776464 Ga0501047_0776464_255_668 137
1122 3300049581 Ga0501047_1193506 Ga0501047_1193506_113_526 137
1123 3300049581 Ga0501047_1248537 Ga0501047_1248537_23_436 137
1124 3300049581 Ga0501047_1265904 Ga0501047_1265904_17_430 137
1125 3300049582 Ga0501048_0030318 Ga0501048_0030318_3311_3724 137
1126 3300049582 Ga0501048_0058389 Ga0501048_0058389_2158_2571 137
1127 3300049582 Ga0501048_0203637 Ga0501048_0203637_730_1143 137
1128 3300049582 Ga0501048_0235293 Ga0501048_0235293_169_582 137
1129 3300049582 Ga0501048_0280029 Ga0501048_0280029_455_868 137
1130 3300049583 Ga0501067_0052681 Ga0501067_0052681_1412_1825 137
1131 3300049583 Ga0501067_0064853 Ga0501067_0064853_1236_1649 137
1132 3300049583 Ga0501067_0140339 Ga0501067_0140339_842_1255 137
1133 3300049583 Ga0501067_0144537 Ga0501067_0144537_488_901 137
1134 3300049583 Ga0501067_0175550 Ga0501067_0175550_332_745 137
1135 3300049583 Ga0501067_0286359 Ga0501067_0286359_407_820 137
1136 3300049584 Ga0501068_0011134 Ga0501068_0011134_1725_2138 137
1137 3300049584 Ga0501068_0015296 Ga0501068_0015296_516_929 137
1138 3300049584 Ga0501068_0083047 Ga0501068_0083047_392_805 137
1139 3300049584 Ga0501068_0175925 Ga0501068_0175925_64_477 137
1140 3300049584 Ga0501068_0196318 Ga0501068_0196318_82_495 137
1141 3300049584 Ga0501068_0298881 Ga0501068_0298881_17_430 137
1142 3300049584 Ga0501068_0307507 Ga0501068_0307507_292_705 137
1143 3300049584 Ga0501068_0562731 Ga0501068_0562731_165_578 137
1144 3300049584 Ga0501068_0891881 Ga0501068_0891881_153_566 137
1145 3300049584 Ga0501068_1037556 Ga0501068_1037556_69_482 137
1146 3300049585 Ga0501069_0004122 Ga0501069_0004122_6524_6937 137
1147 3300049585 Ga0501069_0004928 Ga0501069_0004928_201_614 137
1148 3300049585 Ga0501069_0013201 Ga0501069_0013201_1276_1689 137
1149 3300049585 Ga0501069_0060723 Ga0501069_0060723_152_565 137
1150 3300049585 Ga0501069_0122463 Ga0501069_0122463_593_1006 137
1151 3300049585 Ga0501069_0138940 Ga0501069_0138940_89_502 137
1152 3300049585 Ga0501069_0306723 Ga0501069_0306723_149_562 137
1153 3300049585 Ga0501069_0451519 Ga0501069_0451519_151_564 137
1154 3300049585 Ga0501069_0723195 Ga0501069_0723195_42_455 137
1155 3300049586 Ga0501070_0001286 Ga0501070_0001286_6382_6795 137
1156 3300049586 Ga0501070_0006284 Ga0501070_0006284_4423_4836 137
1157 3300049586 Ga0501070_0006301 Ga0501070_0006301_5233_5646 137
1158 3300049586 Ga0501070_0011237 Ga0501070_0011237_5733_6146 137
1159 3300049586 Ga0501070_0014064 Ga0501070_0014064_1858_2271 137
1160 3300049586 Ga0501070_0025506 Ga0501070_0025506_2726_3139 137
1161 3300049586 Ga0501070_0040568 Ga0501070_0040568_616_1029 137
1162 3300049586 Ga0501070_0057678 Ga0501070_0057678_555_968 137
1163 3300049586 Ga0501070_0060281 Ga0501070_0060281_2125_2538 137
1164 3300049586 Ga0501070_0171551 Ga0501070_0171551_487_900 137
1165 3300049586 Ga0501070_0190795 Ga0501070_0190795_582_995 137
1166 3300049586 Ga0501070_0215956 Ga0501070_0215956_132_545 137
1167 3300049586 Ga0501070_0247320 Ga0501070_0247320_152_565 137
1168 3300049586 Ga0501070_0250574 Ga0501070_0250574_89_502 137
1169 3300049586 Ga0501070_0256784 Ga0501070_0256784_385_798 137
1170 3300049586 Ga0501070_0373060 Ga0501070_0373060_596_1009 137
1171 3300049586 Ga0501070_0809439 Ga0501070_0809439_310_723 137
1172 3300049587 Ga0501071_0046823 Ga0501071_0046823_1341_1754 137
1173 3300049587 Ga0501071_0101470 Ga0501071_0101470_426_839 137
1174 3300049587 Ga0501071_0201488 Ga0501071_0201488_920_1333 137
1175 3300049587 Ga0501071_0288439 Ga0501071_0288439_487_900 137
1176 3300049587 Ga0501071_0547545 Ga0501071_0547545_40_453 137
1177 3300049587 Ga0501071_0625049 Ga0501071_0625049_295_708 137
1178 3300049588 Ga0501072_0338405 Ga0501072_0338405_768_1181 137
1179 3300049588 Ga0501072_0468150 Ga0501072_0468150_245_658 137
1180 3300049588 Ga0501072_0476060 Ga0501072_0476060_13_426 137
1181 3300049588 Ga0501072_0509121 Ga0501072_0509121_146_559 137
1182 3300049589 Ga0501073_0000083 Ga0501073_0000083_43914_44327 137
1183 3300049589 Ga0501073_0015881 Ga0501073_0015881_3042_3455 137
1184 3300049589 Ga0501073_0023164 Ga0501073_0023164_3559_3972 137
1185 3300049589 Ga0501073_0058581 Ga0501073_0058581_2178_2591 137
1186 3300049589 Ga0501073_0117358 Ga0501073_0117358_710_1123 137
1187 3300049589 Ga0501073_0128507 Ga0501073_0128507_1226_1639 137
1188 3300049589 Ga0501073_0153236 Ga0501073_0153236_915_1328 137
1189 3300049589 Ga0501073_0294738 Ga0501073_0294738_82_495 137
1190 3300049589 Ga0501073_0955702 Ga0501073_0955702_11_424 137
1191 3300049590 Ga0501074_0002583 Ga0501074_0002583_4446_4859 137
1192 3300049590 Ga0501074_0012668 Ga0501074_0012668_1196_1609 137
1193 3300049590 Ga0501074_0035107 Ga0501074_0035107_1210_1623 137
1194 3300049590 Ga0501074_0174237 Ga0501074_0174237_826_1239 137
1195 3300049590 Ga0501074_0187163 Ga0501074_0187163_535_948 137
1196 3300049590 Ga0501074_0215216 Ga0501074_0215216_116_529 137
1197 3300049590 Ga0501074_0462343 Ga0501074_0462343_361_774 137
1198 3300049590 Ga0501074_1037662 Ga0501074_1037662_62_475 137
1199 3300049591 Ga0501075_0515130 Ga0501075_0515130_227_640 137
1200 3300049591 Ga0501075_1173828 Ga0501075_1173828_49_465 137
1201 3300049592 Ga0501076_0347691 Ga0501076_0347691_220_633 137
1202 3300049592 Ga0501076_1553601 Ga0501076_1553601_34_447 137
1203 3300049593 Ga0501077_0000088 Ga0501077_0000088_14675_15088 137
1204 3300049741 Ga0501079_0026674 Ga0501079_0026674_1857_2270 137
1205 3300049741 Ga0501079_0258482 Ga0501079_0258482_214_627 137
1206 3300049741 Ga0501079_0472590 Ga0501079_0472590_538_951 137
1207 3300049741 Ga0501079_0657281 Ga0501079_0657281_34_447 137
1208 3300049741 Ga0501079_0718271 Ga0501079_0718271_303_716 137
1209 3300049741 Ga0501079_0847117 Ga0501079_0847117_284_697 137
1210 3300049742 Ga0501080_0003162 Ga0501080_0003162_7663_8076 137
1211 3300049742 Ga0501080_0004752 Ga0501080_0004752_437_850 137
1212 3300049742 Ga0501080_0009625 Ga0501080_0009625_7511_7924 137
1213 3300049742 Ga0501080_0010339 Ga0501080_0010339_7045_7458 137
1214 3300049742 Ga0501080_0015400 Ga0501080_0015400_5716_6129 137
1215 3300049742 Ga0501080_0017194 Ga0501080_0017194_4685_5098 137
1216 3300049742 Ga0501080_0102533 Ga0501080_0102533_2084_2497 137
1217 3300049742 Ga0501080_0181593 Ga0501080_0181593_1027_1440 137
1218 3300049742 Ga0501080_0181639 Ga0501080_0181639_915_1328 137
1219 3300049742 Ga0501080_0213642 Ga0501080_0213642_599_1012 137
1220 3300049742 Ga0501080_0229455 Ga0501080_0229455_16_429 137
1221 3300049742 Ga0501080_0238618 Ga0501080_0238618_714_1127 137
1222 3300049742 Ga0501080_0363496 Ga0501080_0363496_194_607 137
1223 3300049742 Ga0501080_0443693 Ga0501080_0443693_723_1136 137
1224 3300049742 Ga0501080_0756129 Ga0501080_0756129_311_724 137
1225 3300049742 Ga0501080_0850478 Ga0501080_0850478_164_577 137
1226 3300049742 Ga0501080_1386239 Ga0501080_1386239_112_525 137
1227 3300049744 Ga0501083_0001214 Ga0501083_0001214_12572_12985 137
1228 3300049744 Ga0501083_0020957 Ga0501083_0020957_1534_1947 137
1229 3300049744 Ga0501083_0187035 Ga0501083_0187035_807_1220 137
1230 3300049744 Ga0501083_0192449 Ga0501083_0192449_436_849 137
1231 3300049744 Ga0501083_0255597 Ga0501083_0255597_156_569 137
1232 3300049744 Ga0501083_0861676 Ga0501083_0861676_155_568 137
1233 3300049744 Ga0501083_1087553 Ga0501083_1087553_16_429 137
1234 3300049822 Ga0501035_0000160 Ga0501035_0000160_4443_4856 137
1235 3300049822 Ga0501035_0002188 Ga0501035_0002188_14433_14846 137
1236 3300049822 Ga0501035_0023586 Ga0501035_0023586_4777_5190 137
1237 3300049822 Ga0501035_0037179 Ga0501035_0037179_55_468 137
1238 3300049822 Ga0501035_0043204 Ga0501035_0043204_2689_3102 137
1239 3300049822 Ga0501035_0055030 Ga0501035_0055030_3126_3539 137
1240 3300049822 Ga0501035_0079674 Ga0501035_0079674_488_901 137
1241 3300049822 Ga0501035_0099561 Ga0501035_0099561_1463_1876 137
1242 3300049822 Ga0501035_0115591 Ga0501035_0115591_1380_1793 137
1243 3300049822 Ga0501035_0115964 Ga0501035_0115964_403_816 137
1244 3300049822 Ga0501035_0122392 Ga0501035_0122392_445_858 137
1245 3300049822 Ga0501035_0139961 Ga0501035_0139961_1538_1951 137
1246 3300049822 Ga0501035_0150305 Ga0501035_0150305_833_1246 137
1247 3300049822 Ga0501035_0161926 Ga0501035_0161926_742_1155 137
1248 3300049822 Ga0501035_0213546 Ga0501035_0213546_239_652 137
1249 3300049822 Ga0501035_1531283 Ga0501035_1531283_16_429 137
1250 3300049823 Ga0501044_0000234 Ga0501044_0000234_64862_65275 137
1251 3300049823 Ga0501044_0000544 Ga0501044_0000544_44035_44448 137
1252 3300049823 Ga0501044_0009229 Ga0501044_0009229_4553_4966 137
1253 3300049823 Ga0501044_0009814 Ga0501044_0009814_2121_2534 137
1254 3300049823 Ga0501044_0018610 Ga0501044_0018610_5442_5855 137
1255 3300049823 Ga0501044_0024732 Ga0501044_0024732_2599_3012 137
1256 3300049823 Ga0501044_0025827 Ga0501044_0025827_5285_5698 137
1257 3300049823 Ga0501044_0033457 Ga0501044_0033457_2548_2961 137
1258 3300049823 Ga0501044_0036148 Ga0501044_0036148_883_1296 137
1259 3300049823 Ga0501044_0082042 Ga0501044_0082042_186_599 137
1260 3300049823 Ga0501044_0114449 Ga0501044_0114449_1681_2094 137
1261 3300049823 Ga0501044_0154439 Ga0501044_0154439_1747_2160 137
1262 3300049823 Ga0501044_0191494 Ga0501044_0191494_710_1123 137
1263 3300049823 Ga0501044_0232392 Ga0501044_0232392_898_1311 137
1264 3300049823 Ga0501044_0259727 Ga0501044_0259727_656_1069 137
1265 3300049823 Ga0501044_0368868 Ga0501044_0368868_922_1335 137
1266 3300049823 Ga0501044_0440662 Ga0501044_0440662_645_1058 137
1267 3300049823 Ga0501044_0525585 Ga0501044_0525585_493_906 137
1268 3300049823 Ga0501044_0592359 Ga0501044_0592359_172_585 137
1269 3300049823 Ga0501044_1020005 Ga0501044_1020005_15_428 137
1270 3300049824 Ga0501045_0001715 Ga0501045_0001715_12080_12493 137
1271 3300049824 Ga0501045_0485235 Ga0501045_0485235_203_616 137
1272 3300050490 nmdc:mga03n38_14252_c1 nmdc:mga03n38_14252_c1_1922_2335 137
1273 3300050490 nmdc:mga03n38_21372_c1 nmdc:mga03n38_21372_c1_398_811 137
1274 3300050490 nmdc:mga03n38_429542_c1 nmdc:mga03n38_429542_c1_158_571 137
1275 3300050490 nmdc:mga03n38_746046_c1 nmdc:mga03n38_746046_c1_88_501 137
1276 3300050491 nmdc:mga00v17_512278_c1 nmdc:mga00v17_512278_c1_240_653 137
1277 3300050492 nmdc:mga0yw44_18471_c1 nmdc:mga0yw44_18471_c1_2225_2638 137
1278 3300050492 nmdc:mga0yw44_212922_c1 nmdc:mga0yw44_212922_c1_537_950 137
1279 3300050492 nmdc:mga0yw44_212931_c1 nmdc:mga0yw44_212931_c1_467_880 137
1280 3300050492 nmdc:mga0yw44_542325_c1 nmdc:mga0yw44_542325_c1_22_435 137
1281 3300050492 nmdc:mga0yw44_60745_c1 nmdc:mga0yw44_60745_c1_1531_1944 137
1282 3300050493 nmdc:mga0k408_676254_c1 nmdc:mga0k408_676254_c1_15_428 137
1283 3300050494 nmdc:mga06z11_112461_c1 nmdc:mga06z11_112461_c1_184_597 137
1284 3300050494 nmdc:mga06z11_119069_c1 nmdc:mga06z11_119069_c1_254_667 137
1285 3300050494 nmdc:mga06z11_157752_c1 nmdc:mga06z11_157752_c1_464_877 137
1286 3300050494 nmdc:mga06z11_395338_c1 nmdc:mga06z11_395338_c1_308_721 137
1287 3300050494 nmdc:mga06z11_787034_c1 nmdc:mga06z11_787034_c1_124_537 137
1288 3300050495 nmdc:mga04h51_131147_c1 nmdc:mga04h51_131147_c1_194_607 137
1289 3300050495 nmdc:mga04h51_255960_c1 nmdc:mga04h51_255960_c1_10_423 137
1290 3300050495 nmdc:mga04h51_7863_c1 nmdc:mga04h51_7863_c1_502_915 137
1291 3300050496 nmdc:mga07m45_26183_c1 nmdc:mga07m45_26183_c1_2476_2889 137
1292 3300050496 nmdc:mga07m45_354090_c1 nmdc:mga07m45_354090_c1_311_724 137
1293 3300050496 nmdc:mga07m45_5559_c1 nmdc:mga07m45_5559_c1_1021_1434 137
1294 3300050509 nmdc:mga0qj67_299_c1 nmdc:mga0qj67_299_c1_32896_33309 137
1295 3300050510 nmdc:mga06r32_1385318_c1 nmdc:mga06r32_1385318_c1_193_606 137
1296 3300050513 nmdc:mga0rr50_919365_c1 nmdc:mga0rr50_919365_c1_109_522 137
1297 3300050515 nmdc:mga0a205_654184_c1 nmdc:mga0a205_654184_c1_113_526 137
1298 3300050516 nmdc:mga0sz30_14247_c1 nmdc:mga0sz30_14247_c1_1717_2130 137
1299 3300050516 nmdc:mga0sz30_30979_c1 nmdc:mga0sz30_30979_c1_1028_1441 137
1300 3300053077 Ga0495601_0216675 Ga0495601_0216675_488_901 137
1301 3300053079 Ga0500610_0168190 Ga0500610_0168190_302_715 137
1302 3300053083 Ga0495655_0237727 Ga0495655_0237727_141_554 137
1303 3300053091 Ga0500647_0070822 Ga0500647_0070822_637_1050 137
1304 3300053094 Ga0500566_0000320 Ga0500566_0000320_20727_21140 137
1305 3300053095 Ga0500640_027849 Ga0500640_027849_237_650 137
1306 3300053098 Ga0500650_0280870 Ga0500650_0280870_232_645 137
1307 3300053104 Ga0500556_0000009 Ga0500556_0000009_148549_148962 137
1308 3300053111 Ga0500572_001453 Ga0500572_001453_3714_4127 137
1309 3300053111 Ga0500572_006785 Ga0500572_006785_2187_2600 137
1310 3300053113 Ga0500580_223785 Ga0500580_223785_144_557 137
1311 3300053115 Ga0500591_074354 Ga0500591_074354_519_932 137
1312 3300053119 Ga0500595_145202 Ga0500595_145202_93_506 137
1313 3300053122 Ga0500608_029012 Ga0500608_029012_1547_1960 137
1314 3300053125 Ga0500618_053140 Ga0500618_053140_397_819 137
1315 3300053134 Ga0500658_0019134 Ga0500658_0019134_517_930 137
1316 3300053136 Ga0500559_0007811 Ga0500559_0007811_3674_4087 137
1317 3300053136 Ga0500559_0012275 Ga0500559_0012275_255_668 137
1318 3300053136 Ga0500559_0013950 Ga0500559_0013950_322_735 137
1319 3300053139 Ga0500568_0001953 Ga0500568_0001953_7701_8114 137
1320 3300053139 Ga0500568_0231839 Ga0500568_0231839_120_533 137
1321 3300053146 Ga0500588_0004535 Ga0500588_0004535_1023_1442 137
1322 3300053150 Ga0500603_003307 Ga0500603_003307_2154_2567 137
1323 3300053153 Ga0500616_0024839 Ga0500616_0024839_1172_1585 137
1324 3300053155 Ga0500620_004601 Ga0500620_004601_780_1193 137
1325 3300053158 Ga0500627_0402866 Ga0500627_0402866_105_518 137
1326 3300053159 Ga0500630_005936 Ga0500630_005936_1123_1536 137
1327 3300053162 Ga0500638_024655 Ga0500638_024655_2175_2588 137
1328 3300053163 Ga0500639_002134 Ga0500639_002134_872_1285 137
1329 3300053163 Ga0500639_019780 Ga0500639_019780_241_654 137
1330 3300053177 Ga0500636_0419595 Ga0500636_0419595_74_487 137
1331 3300053178 Ga0500637_0172514 Ga0500637_0172514_710_1123 137
1332 3300053730 Ga0500645_074069 Ga0500645_074069_414_827 137
1333 3300053731 Ga0500609_013602 Ga0500609_013602_414_827 137
1334 3300053731 Ga0500609_020675 Ga0500609_020675_83_502 137
1335 3300053732 Ga0500656_009071 Ga0500656_009071_97_528 137
1336 3300053735 Ga0500596_003981 Ga0500596_003981_440_853 137
1337 3300053735 Ga0500596_005235 Ga0500596_005235_1397_1810 137
1338 3300054114 Ga0501084_0023050 Ga0501084_0023050_2354_2767 137
1339 3300054114 Ga0501084_0582995 Ga0501084_0582995_517_930 137
1340 3300054114 Ga0501084_1010364 Ga0501084_1010364_182_595 137
1341 3300059478 Ga0587093_012340 Ga0587093_012340_137_550 137
1342 3300059490 Ga0587066_014974 Ga0587066_014974_670_1083 137
1343 3300059490 Ga0587066_040569 Ga0587066_040569_114_527 137
1344 3300059490 Ga0587066_081737 Ga0587066_081737_127_540 137
1345 3300059491 Ga0587070_012050 Ga0587070_012050_124_537 137
1346 3300059491 Ga0587070_012736 Ga0587070_012736_846_1262 137
1347 3300059491 Ga0587070_038250 Ga0587070_038250_81_494 137
1348 3300059493 Ga0587077_011314 Ga0587077_011314_972_1385 137
1349 3300059493 Ga0587077_110366 Ga0587077_110366_150_563 137
1350 3300059503 Ga0587080_014343 Ga0587080_014343_88_501 137
1351 3300059504 Ga0587082_043435 Ga0587082_043435_27_440 137
1352 3300059504 Ga0587082_109234 Ga0587082_109234_65_478 137
1353 3300059505 Ga0587083_0245757 Ga0587083_0245757_28_441 137
1354 3300059507 Ga0587086_019549 Ga0587086_019549_51_464 137
1355 3300059508 Ga0587088_148311 Ga0587088_148311_32_445 137
1356 3300059512 Ga0587092_082209 Ga0587092_082209_83_496 137
1357 3300059513 Ga0587094_007473 Ga0587094_007473_560_973 137
1358 3300059605 Ga0587106_013481 Ga0587106_013481_102_515 137
1359 3300059622 Ga0587099_011882 Ga0587099_011882_341_754 137
1360 3300059623 Ga0587101_003234 Ga0587101_003234_621_1034 137
1361 3300059639 Ga0587062_001756 Ga0587062_001756_1132_1545 137
1362 3300059639 Ga0587062_114779 Ga0587062_114779_108_521 137
1363 3300059642 Ga0587069_017394 Ga0587069_017394_405_818 137
1364 3300059643 Ga0587072_013827 Ga0587072_013827_154_567 137
1365 3300059643 Ga0587072_027025 Ga0587072_027025_64_480 137
1366 3300059643 Ga0587072_031440 Ga0587072_031440_515_928 137
1367 3300059644 Ga0587075_014892 Ga0587075_014892_41_454 137
1368 3300059645 Ga0587076_045829 Ga0587076_045829_158_571 137
1369 3300059646 Ga0587078_006461 Ga0587078_006461_650_1063 137
1370 3300059647 Ga0587079_027730 Ga0587079_027730_86_502 137
1371 3300059652 Ga0587107_000278 Ga0587107_000278_70_483 137
1372 3300059655 Ga0587114_051809 Ga0587114_051809_241_654 137
1373 3300059660 Ga0587124_023994 Ga0587124_023994_66_479 137
1374 3300060344 Ga0587071_014153 Ga0587071_014153_836_1249 137
1375 3300060344 Ga0587071_062609 Ga0587071_062609_27_440 137
1376 3300060346 Ga0587111_0030774 Ga0587111_0030774_518_931 137
1377 3300060353 Ga0501082_0049749 Ga0501082_0049749_1696_2109 137
1378 3300060353 Ga0501082_0161198 Ga0501082_0161198_678_1091 137
1379 3300060353 Ga0501082_0220581 Ga0501082_0220581_828_1241 137
1380 3300060353 Ga0501082_0253081 Ga0501082_0253081_603_1016 137
1381 3300060353 Ga0501082_0689903 Ga0501082_0689903_430_843 137
1382 3300061719 Ga0466962_0535006 Ga0466962_0535006_24_440 137
1383 3300061734 Ga0530510_0407417 Ga0530510_0407417_231_644 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

4

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7of3-assembly1.cif.gz_N structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 (dataset2). 0.8486 30 134
7ods-assembly1.cif.gz_N state b of the human mitoribosomal large subunit assembly intermediate 0.8241 30 134
7o9m-assembly1.cif.gz_N human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module 0.8228 30 134
8eui-assembly1.cif.gz_I ytm1 associated nascent 60s ribosome (-fkbp39) state 3 0.8127 32 132
7odr-assembly1.cif.gz_N state a of the human mitoribosomal large subunit assembly intermediate 0.8006 30 134
ID Description Score Start End Superfamily
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8831 29 137 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8271 29 137 3.90.1170.10
af_Q9Y822_37_214_3.90.1170.10 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7825 27 133 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7753 24 137 3.90.1170.10
4kbuQ01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7746 28 136 3.90.1170.10
ID Description Score Start End GO Terms
AF-A0A2R6WWT8-F1-model_v4 Uncharacterized protein 0.8463 32 137 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G8DKE1-F1-model_v4 Ribosomal protein L16 0.818 29 137 GO:0003735
GO:0005739
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6VHX4-F1-model_v4 50S ribosomal protein L16 0.8172 30 137 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A0K2RWM8-F1-model_v4 Ribosomal protein L16 0.8166 29 133 GO:0003735
GO:0005739
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5B9RSE0-F1-model_v4 50S ribosomal protein L16, chloroplastic 0.8162 30 135 GO:0003735
GO:0005762
GO:0009507
GO:0019843
GO:0032543

Feature Viewer

pLDDT pTM Quality
73.16 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map