F493541

General Info

Members Datasets Scaffolds Average Seq Length
1383 659 2766 380

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0040071|Ga0495599_0040071_463_1776
Length 437
Sequence VLATWAGGQFGAGLGACAERDAPRSKTRPGRVTKKLLPAAVLNRQPAFFHFKVARIESMSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGVDGTAGKLLAFAGHTDVVPTGPLEQWHSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVAAHPAHRGSIAFLITSDEEGPATDGTVKVVEALQARGERMDYCIVGEPTSSTQFGDMVKNGRRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNIHSGTGATNVIPGHADVMFNFRFSTASTVEGLQARVHAILDKHDLDYDLQWTVSGLPFLTPRGDLSNALAKAIKDETGVSTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEVAHIEPLKNVYRRVLEQLIA

Samples

Sample ID Description Type Environment
1 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
122 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
123 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
124 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
125 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
245 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
256 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
257 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
260 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
261 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
262 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
263 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
353 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
354 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
374 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
377 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
385 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
395 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
408 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
413 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
414 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
415 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
416 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
417 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
420 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
426 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
427 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
428 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
429 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
430 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
431 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
432 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
433 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
434 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
435 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
436 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
437 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
438 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
439 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
440 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
441 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
442 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
443 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
444 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
445 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
446 2519103095 Burkholderia sp. KJ006 Isolate Nodule
447 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
448 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
449 2547132181 Kosakonia sacchari SP1 Isolate Stem
450 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
451 2561511199 Enterobacter sp. R4-368 Isolate Nodule
452 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
453 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
454 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
455 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
456 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
457 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
458 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
459 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
460 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
461 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
462 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
463 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
464 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
465 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
466 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
467 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
468 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
469 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
470 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
471 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
472 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
473 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
474 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
475 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
476 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
477 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
478 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
479 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
480 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
481 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
482 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
483 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
484 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
485 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
486 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
487 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
488 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
489 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
490 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
491 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
492 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
493 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
494 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
495 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
496 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
497 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
498 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
499 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
500 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
501 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
502 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
503 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
504 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
505 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
506 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
507 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
508 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
509 2636415599 Klebsiella variicola DX120E Isolate Unclassified
510 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
511 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
512 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
513 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
514 2643221660 Methylibium sp. Root1272 Isolate Unclassified
515 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
516 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
517 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
518 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
519 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
520 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
521 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
522 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
523 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
524 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
525 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
526 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
527 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
528 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
529 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
530 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
531 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
532 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
533 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
534 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
535 2751185917 Enterobacter sp. HK169 Isolate Unclassified
536 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
537 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
538 2775507074 Klebsiella sp. D5A Isolate Unclassified
539 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
540 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
541 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
542 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
543 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
544 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
545 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
546 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
547 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
548 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
549 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
550 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
551 2818991450 Burkholderia sp. 604 Isolate Unclassified
552 2818991452 Burkholderia cepacia 561 Isolate Unclassified
553 2821118458 Enterobacter asburiae 609 Isolate Unclassified
554 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
555 2831864461 Roseateles noduli HZ7 Isolate Nodule
556 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
557 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
558 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
559 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
560 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
561 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
562 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
563 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
564 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
565 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
566 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
567 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
568 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
569 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
570 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
571 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
572 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
573 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
574 2876601092 Pantoea endophytica 596 Isolate Unclassified
575 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
576 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
577 2885266251 Ralstonia sp. SET104 Isolate Nodule
578 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
579 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
580 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
581 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
582 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
583 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
584 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
585 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
586 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
587 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
588 2904504865 Serratia marcescens 1822 Isolate Unclassified
589 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
590 2904564687 Burkholderia sp. 571 Isolate Unclassified
591 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
592 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
593 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
594 2919150387 Rahnella aceris 1817 Isolate Unclassified
595 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
596 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
597 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
598 2927143783 Rahnella sp. 2050 Isolate Unclassified
599 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
600 2928058823 Ralstonia sp. 1138 Isolate Unclassified
601 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
602 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
603 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
604 2928163908 Burkholderia sp. 567 Isolate Unclassified
605 2928170801 Burkholderia sp. 572 Isolate Unclassified
606 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
607 2928536128 Burkholderia sola 565 Isolate Unclassified
608 2932406140 Serratia sp. 2723 Isolate Rhizosphere
609 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
610 2937539931 Pantoea sp. LS15 Isolate Unclassified
611 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
612 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
613 2939577877 Serratia sp. 509 Isolate Rhizosphere
614 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
615 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
616 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
617 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
618 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
619 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
620 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
621 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
622 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
623 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
624 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
625 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
626 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
627 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
628 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
629 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
630 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
631 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
632 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
633 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
634 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
635 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
636 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
637 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
638 8018221730 Enterobacter sp. CM29 Isolate Unclassified
639 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
640 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
641 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
642 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
643 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
644 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
645 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
646 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
647 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
648 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
649 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
650 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
651 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
652 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
653 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
654 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
655 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
656 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
657 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
658 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
659 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.79
Metatranscriptomes 0.22
Isolates 16.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 15.76
Nodule 3.11
Rhizoplane 6.94
Rhizosphere 56.83
Stem 0.07
Stem Tuber 0.51
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495599_0040071 3300046678 Bacteria 2942
2 SwRhRL2b_contig_704441 2162886007 Bacteria 5639
3 JGI24741J21665_1002292 3300001915 Bacteria 5038
4 JGI24740J21852_10000707 3300001979 Bacteria 14462
5 JGI24740J21852_10001478 3300001979 Bacteria 10792
6 JGI24739J22299_10009567 3300001989 Bacteria 3607
7 JGI24739J22299_10019743 3300001989 Bacteria 2410
8 JGI24735J21928_10000304 3300002067 Bacteria 17151
9 JGI24735J21928_10000392 3300002067 Bacteria 15199
10 JGI24735J21928_10000462 3300002067 Bacteria 14300
11 JGI24735J21928_10003854 3300002067 Bacteria 5076
12 JGI24735J21928_10028720 3300002067 Bacteria 1660
13 JGI25155J39150_1000002 3300002704 Bacteria 292156
14 JGI25156J39149_1000003 3300002705 Bacteria 305434
15 JGI25156J39149_1000913 3300002705 Bacteria 14473
16 JGI25156J39149_1001040 3300002705 Bacteria 12889
17 JGI25156J39149_1001634 3300002705 Bacteria 9121
18 JGI25156J39149_1010984 3300002705 Bacteria 2084
19 JGI25154J39366_1000009 3300002738 Bacteria 305408
20 JGI25154J39366_1000362 3300002738 Bacteria 25735
21 JGI25157J39369_1000002 3300002741 Bacteria 305434
22 JGI25163J39215_1000065 3300002771 Bacteria 47718
23 JGI25164J39214_1000014 3300002772 Bacteria 219691
24 JGI25152J39213_1006266 3300002773 Bacteria 3287
25 JGI25150J39212_1003024 3300002774 Bacteria 4036
26 JGI25159J45721_1000296 3300002987 Bacteria 23321
27 JGI25159J45721_1003417 3300002987 Bacteria 5618
28 JGI25151J46595_10011762 3300003187 Bacteria 4009
29 JGI25151J46595_10013678 3300003187 Bacteria 3642
30 JGI25151J46595_10032951 3300003187 Bacteria 2001
31 JGI25165J46597_1002348 3300003214 Bacteria 6356
32 JGI25153J46596_10000871 3300003215 Bacteria 18391
33 JGI25153J46596_10003388 3300003215 Bacteria 8937
34 rootL2_10011738 3300003322 Bacteria 2705
35 rootL2_10113845 3300003322 Bacteria 2293
36 JGI25160J50197_1000102 3300003354 Bacteria 82464
37 JGI25160J50197_1000123 3300003354 Bacteria 70031
38 JGI25161J50226_1000032 3300003374 Bacteria 138440
39 Ga0055538_1000005 3300003751 Bacteria 575218
40 Ga0055538_1001322 3300003751 Bacteria 4973
41 Ga0055539_1000007 3300003752 Bacteria 575218
42 Ga0055539_1000100 3300003752 Bacteria 100406
43 Ga0055533_1000009 3300003756 Bacteria 575218
44 Ga0055533_1000235 3300003756 Bacteria 36089
45 Ga0055533_1001261 3300003756 Bacteria 6944
46 Ga0055532_1000001 3300003758 Bacteria 1119836
47 Ga0055532_1000127 3300003758 Bacteria 75964
48 Ga0055532_1000944 3300003758 Bacteria 9337
49 Ga0055525_1000010 3300003759 Bacteria 575218
50 Ga0055525_1000444 3300003759 Bacteria 23721
51 Ga0055525_1000505 3300003759 Bacteria 19389
52 Ga0055527_1000002 3300003760 Bacteria 830488
53 Ga0055535_1000001 3300003761 Bacteria 1119836
54 Ga0055535_1000140 3300003761 Bacteria 75964
55 Ga0055542_1000001 3300003762 Bacteria 1119836
56 Ga0055542_1001376 3300003762 Bacteria 12374
57 Ga0055529_1000026 3300003763 Bacteria 293254
58 Ga0055529_1000230 3300003763 Bacteria 71040
59 Ga0055529_1001316 3300003763 Bacteria 8427
60 Ga0055526_1001657 3300003771 Bacteria 15630
61 Ga0055526_1022565 3300003771 Bacteria 2135
62 Ga0055537_1000079 3300003773 Bacteria 69953
63 Ga0055537_1006004 3300003773 Bacteria 3152
64 Ga0055524_1000012 3300003775 Bacteria 260384
65 Ga0055524_1001692 3300003775 Bacteria 12282
66 Ga0055536_1000380 3300003781 Bacteria 32625
67 Ga0055534_1000670 3300003784 Bacteria 17182
68 Ga0055534_1001102 3300003784 Bacteria 11482
69 Ga0055534_1001506 3300003784 Bacteria 9171
70 Ga0055534_1002359 3300003784 Bacteria 6590
71 Ga0055534_1005936 3300003784 Bacteria 3169
72 Ga0055528_1000563 3300003790 Bacteria 28211
73 Ga0055528_1003000 3300003790 Bacteria 8724
74 Ga0055530_10000218 3300003791 Bacteria 51314
75 Ga0055540_1000012 3300003792 Bacteria 262667
76 Ga0055541_1000005 3300003841 Bacteria 575218
77 Ga0055541_1003952 3300003841 Bacteria 2736
78 Ga0058692_1000303 3300003856 Bacteria 24919
79 Ga0058692_1000379 3300003856 Bacteria 21285
80 Ga0058692_1007200 3300003856 Bacteria 2978
81 Ga0055543_1000405 3300004625 Bacteria 27361
82 Ga0055543_1004541 3300004625 Bacteria 3748
83 Ga0065165_1000848 3300005262 Bacteria 40071
84 Ga0065165_1000995 3300005262 Bacteria 34985
85 Ga0065165_1001389 3300005262 Bacteria 26545
86 Ga0065165_1002021 3300005262 Bacteria 18891
87 Ga0065165_1009528 3300005262 Bacteria 4341
88 Ga0065165_1023112 3300005262 Bacteria 2115
89 Ga0065165_1024685 3300005262 Bacteria 2014
90 Ga0065165_1041329 3300005262 Bacteria 1370
91 Ga0065704_10000399 3300005289 Bacteria 23507
92 Ga0065704_10001052 3300005289 Bacteria 20106
93 Ga0065704_10001579 3300005289 Bacteria 16572
94 Ga0065704_10076648 3300005289 Bacteria 5018
95 Ga0065704_10083775 3300005289 Bacteria 3420
96 Ga0065707_10124464 3300005295 Bacteria 2043
97 Ga0070658_10003021 3300005327 Bacteria 13917
98 Ga0070658_10003785 3300005327 Bacteria 12392
99 Ga0070677_10020938 3300005333 Bacteria 2391
100 Ga0068869_100047431 3300005334 Bacteria 3103
101 Ga0070666_10026070 3300005335 Bacteria 3816
102 Ga0070682_100069419 3300005337 Bacteria 2250
103 Ga0068868_100051963 3300005338 Bacteria 3226
104 Ga0070660_100000046 3300005339 Bacteria 70459
105 Ga0070660_100010130 3300005339 Bacteria 6653
106 Ga0070661_100000057 3300005344 Bacteria 87637
107 Ga0070661_100113362 3300005344 Bacteria 2026
108 Ga0070669_100009144 3300005353 Bacteria 7061
109 Ga0070669_100012088 3300005353 Bacteria 6127
110 Ga0070669_100014256 3300005353 Bacteria 5656
111 Ga0070669_100017532 3300005353 Bacteria 5108
112 Ga0070675_100001690 3300005354 Bacteria 16286
113 Ga0070675_100094704 3300005354 Bacteria 2506
114 Ga0070671_100005306 3300005355 Bacteria 10280
115 Ga0070671_100025777 3300005355 Bacteria 4827
116 Ga0070671_100036625 3300005355 Bacteria 4069
117 Ga0070671_100150550 3300005355 Bacteria 1965
118 Ga0070671_100203348 3300005355 Bacteria 1680
119 Ga0070674_100164252 3300005356 Bacteria 1687
120 Ga0070673_100002697 3300005364 Bacteria 10877
121 Ga0070673_100005484 3300005364 Bacteria 8122
122 Ga0070659_100000510 3300005366 Bacteria 28529
123 Ga0070659_100020442 3300005366 Bacteria 5028
124 Ga0070659_100030772 3300005366 Bacteria 4154
125 Ga0070667_100000372 3300005367 Bacteria 48979
126 Ga0070700_100001032 3300005441 Bacteria 13767
127 Ga0070700_100006423 3300005441 Bacteria 6287
128 Ga0070663_100000105 3300005455 Bacteria 38796
129 Ga0070663_100002402 3300005455 Bacteria 10533
130 Ga0070663_100005278 3300005455 Bacteria 7663
131 Ga0070663_100156409 3300005455 Bacteria 1752
132 Ga0070678_100053616 3300005456 Bacteria 2933
133 Ga0070662_100001379 3300005457 Bacteria 14952
134 Ga0070662_100020685 3300005457 Bacteria 4487
135 Ga0068867_100003272 3300005459 Bacteria 11413
136 Ga0068867_100003992 3300005459 Bacteria 10379
137 Ga0068867_100006509 3300005459 Bacteria 8254
138 Ga0068867_100090294 3300005459 Bacteria 2324
139 Ga0068867_100163460 3300005459 Bacteria 1757
140 Ga0068853_100025283 3300005539 Bacteria 4982
141 Ga0070672_100000338 3300005543 Bacteria 26932
142 Ga0070672_100001803 3300005543 Bacteria 13392
143 Ga0070672_100122201 3300005543 Bacteria 2132
144 Ga0070672_100292362 3300005543 Bacteria 1380
145 Ga0070665_100000255 3300005548 Bacteria 88289
146 Ga0070665_100026204 3300005548 Bacteria 5871
147 Ga0068855_100003042 3300005563 Bacteria 20540
148 Ga0068855_100007312 3300005563 Bacteria 13379
149 Ga0068855_100039740 3300005563 Bacteria 5585
150 Ga0070664_100000008 3300005564 Bacteria 173734
151 Ga0070664_100072980 3300005564 Bacteria 2944
152 Ga0070664_100204982 3300005564 Bacteria 1761
153 Ga0068857_100135934 3300005577 Bacteria 2219
154 Ga0068857_100187637 3300005577 Bacteria 1883
155 Ga0068854_100000072 3300005578 Bacteria 72718
156 Ga0068856_100000009 3300005614 Bacteria 181448
157 Ga0068856_100031125 3300005614 Bacteria 5219
158 Ga0068852_100289532 3300005616 Bacteria 1582
159 Ga0068864_100021723 3300005618 Bacteria 5375
160 Ga0068864_100155989 3300005618 Bacteria 2072
161 Ga0068861_100008083 3300005719 Bacteria 7235
162 Ga0068851_10028395 3300005834 Bacteria 2764
163 Ga0068870_10083323 3300005840 Bacteria 1772
164 Ga0068863_100059509 3300005841 Bacteria 3614
165 Ga0068858_100308478 3300005842 Bacteria 1511
166 Ga0068860_100207568 3300005843 Bacteria 1900
167 Ga0068862_100021669 3300005844 Bacteria 5373
168 Ga0068862_100064649 3300005844 Bacteria 3150
169 Ga0075368_10003139 3300006042 Bacteria 5485
170 Ga0075363_100006667 3300006048 Bacteria 5265
171 Ga0075363_100130373 3300006048 Bacteria 1410
172 Ga0075364_10020463 3300006051 Bacteria 4161
173 Ga0075364_10050921 3300006051 Bacteria 2704
174 Ga0075364_10082628 3300006051 Bacteria 2125
175 Ga0075362_10022906 3300006177 Bacteria 2636
176 Ga0075367_10007819 3300006178 Bacteria 5500
177 Ga0075366_10000464 3300006195 Bacteria 18904
178 Ga0075366_10001059 3300006195 Bacteria 13503
179 Ga0075366_10008134 3300006195 Bacteria 5818
180 Ga0075366_10010331 3300006195 Bacteria 5240
181 Ga0075366_10018201 3300006195 Bacteria 4055
182 Ga0075366_10097725 3300006195 Bacteria 1761
183 Ga0097621_100020144 3300006237 Bacteria 5136
184 Ga0097621_100040483 3300006237 Bacteria 3747
185 Ga0075370_10017106 3300006353 Bacteria 3913
186 Ga0075370_10023309 3300006353 Bacteria 3407
187 Ga0075370_10077002 3300006353 Bacteria 1914
188 Ga0075370_10133028 3300006353 Bacteria 1452
189 Ga0068871_100003474 3300006358 Bacteria 10827
190 Ga0068871_100079338 3300006358 Bacteria 2716
191 Ga0079104_1000075 3300006946 Bacteria 148544
192 Ga0079104_1000111 3300006946 Bacteria 116796
193 Ga0079104_1000258 3300006946 Bacteria 70651
194 Ga0079104_1000667 3300006946 Bacteria 32312
195 Ga0079104_1000959 3300006946 Bacteria 22624
196 Ga0079104_1001574 3300006946 Bacteria 14933
197 Ga0079104_1002049 3300006946 Bacteria 11684
198 Ga0079104_1002639 3300006946 Bacteria 9346
199 Ga0099826_10000012 3300006948 Bacteria 283499
200 Ga0105251_10000738 3300009011 Bacteria 29954
201 Ga0105251_10001354 3300009011 Bacteria 21182
202 Ga0105251_10001810 3300009011 Bacteria 17702
203 Ga0105251_10003968 3300009011 Bacteria 10481
204 Ga0105251_10004288 3300009011 Bacteria 9793
205 Ga0105251_10005117 3300009011 Bacteria 8680
206 Ga0105251_10018972 3300009011 Bacteria 3643
207 Ga0105251_10041499 3300009011 Bacteria 2239
208 Ga0105244_10000090 3300009036 Bacteria 97171
209 Ga0105244_10000144 3300009036 Bacteria 73870
210 Ga0105244_10000149 3300009036 Bacteria 73409
211 Ga0105244_10000679 3300009036 Bacteria 29859
212 Ga0105244_10002219 3300009036 Bacteria 14802
213 Ga0105244_10003061 3300009036 Bacteria 12243
214 Ga0105244_10005707 3300009036 Bacteria 8216
215 Ga0105244_10007965 3300009036 Bacteria 6672
216 Ga0105244_10008326 3300009036 Bacteria 6485
217 Ga0105244_10030222 3300009036 Bacteria 2884
218 Ga0105244_10047079 3300009036 Bacteria 2213
219 Ga0105250_10000011 3300009092 Bacteria 276144
220 Ga0105250_10000105 3300009092 Bacteria 75608
221 Ga0105250_10000285 3300009092 Bacteria 40638
222 Ga0105250_10001428 3300009092 Bacteria 12896
223 Ga0105250_10019937 3300009092 Bacteria 2712
224 Ga0105250_10023443 3300009092 Bacteria 2486
225 Ga0105240_10002341 3300009093 Bacteria 30608
226 Ga0105240_10054612 3300009093 Bacteria 5006
227 Ga0105240_10212526 3300009093 Bacteria 2259
228 Ga0105240_10265739 3300009093 Bacteria 1977
229 Ga0105240_10284978 3300009093 Bacteria 1896
230 Ga0111539_10110214 3300009094 Bacteria 3230
231 Ga0111539_10333289 3300009094 Bacteria 1766
232 Ga0105245_10062771 3300009098 Bacteria 3353
233 Ga0105245_10073785 3300009098 Bacteria 3103
234 Ga0105243_10005488 3300009148 Bacteria 9889
235 Ga0105243_10027102 3300009148 Bacteria 4389
236 Ga0105241_10067401 3300009174 Bacteria 2770
237 Ga0105248_10007653 3300009177 Bacteria 11869
238 Ga0105248_10026509 3300009177 Bacteria 6447
239 Ga0105237_10018302 3300009545 Bacteria 7250
240 Ga0105237_10039588 3300009545 Bacteria 4759
241 Ga0105237_10173035 3300009545 Bacteria 2159
242 Ga0105238_10001497 3300009551 Bacteria 23442
243 Ga0105238_10010153 3300009551 Bacteria 9444
244 Ga0105239_10022568 3300010375 Bacteria 6939
245 Ga0105239_10068680 3300010375 Bacteria 3895
246 Ga0105246_10050782 3300011119 Bacteria 2845
247 Ga0157326_1000943 3300012513 Bacteria 3334
248 Ga0157373_10000788 3300013100 Bacteria 24425
249 Ga0157373_10009043 3300013100 Bacteria 7371
250 Ga0157373_10073707 3300013100 Bacteria 2409
251 Ga0157371_10000007 3300013102 Bacteria 401847
252 Ga0157371_10000068 3300013102 Bacteria 168110
253 Ga0157371_10000780 3300013102 Bacteria 36631
254 Ga0157371_10002606 3300013102 Bacteria 17116
255 Ga0157371_10013847 3300013102 Bacteria 6109
256 Ga0157371_10079796 3300013102 Bacteria 2318
257 Ga0157370_10000200 3300013104 Bacteria 75469
258 Ga0157370_10001346 3300013104 Bacteria 30508
259 Ga0157370_10003399 3300013104 Bacteria 18693
260 Ga0157370_10004165 3300013104 Bacteria 16733
261 Ga0157370_10094701 3300013104 Bacteria 2802
262 Ga0157369_10000511 3300013105 Bacteria 51116
263 Ga0157369_10000806 3300013105 Bacteria 40098
264 Ga0157369_10000979 3300013105 Bacteria 36209
265 Ga0157369_10005782 3300013105 Bacteria 14377
266 Ga0157369_10009691 3300013105 Bacteria 11016
267 Ga0157369_10022155 3300013105 Bacteria 7098
268 Ga0157369_10047494 3300013105 Bacteria 4660
269 Ga0157369_10419267 3300013105 Bacteria 1388
270 Ga0157374_10000107 3300013296 Bacteria 75925
271 Ga0157374_10052257 3300013296 Bacteria 3805
272 Ga0157374_10167192 3300013296 Bacteria 2144
273 Ga0163162_10008076 3300013306 Bacteria 10271
274 Ga0163162_10012861 3300013306 Bacteria 8175
275 Ga0163162_10051090 3300013306 Bacteria 4146
276 Ga0157372_10000142 3300013307 Bacteria 79172
277 Ga0157372_10001253 3300013307 Bacteria 27455
278 Ga0157372_10004539 3300013307 Bacteria 14782
279 Ga0157372_10012280 3300013307 Bacteria 9124
280 Ga0157372_10114919 3300013307 Bacteria 3085
281 Ga0157372_10144570 3300013307 Bacteria 2743
282 Ga0157372_10176345 3300013307 Bacteria 2474
283 Ga0157372_10193418 3300013307 Bacteria 2356
284 Ga0157375_10037300 3300013308 Bacteria 4656
285 Ga0157375_10617514 3300013308 Bacteria 1242
286 Ga0157380_10010968 3300014326 Bacteria 6535
287 Ga0157380_10038519 3300014326 Bacteria 3713
288 Ga0157377_10006681 3300014745 Bacteria 5520
289 Ga0157377_10145171 3300014745 Bacteria 1462
290 Ga0157379_10083111 3300014968 Bacteria 2870
291 Ga0157376_10006346 3300014969 Bacteria 8350
292 Ga0157376_10211793 3300014969 Bacteria 1789
293 Ga0182006_1000024 3300015261 Bacteria 257431
294 Ga0182006_1031181 3300015261 Bacteria 2150
295 Ga0182007_10000581 3300015262 Bacteria 21489
296 Ga0182007_10010832 3300015262 Bacteria 3581
297 Ga0183366_1001 3300015679 Bacteria 2743932
298 Ga0183370_1001 3300015680 Bacteria 2743932
299 Ga0183369_1001 3300015685 Bacteria 2743932
300 Ga0183368_1001 3300015687 Bacteria 2743932
301 Ga0183361_10006 3300016635 Bacteria 368532
302 Ga0163161_10020133 3300017792 Bacteria 4679
303 Ga0163161_10097655 3300017792 Bacteria 2182
304 Ga0163161_10206594 3300017792 Bacteria 1515
305 Ga0206351_10197686 3300020077 Bacteria 6596
306 Ga0154015_1570145 3300020610 Bacteria 20499
307 Ga0213872_10000090 3300021361 Bacteria 83813
308 Ga0213872_10001577 3300021361 Bacteria 14529
309 Ga0213876_10000079 3300021384 Bacteria 110609
310 Ga0213875_10001769 3300021388 Bacteria 13535
311 Ga0224712_10001924 3300022467 Bacteria 5002
312 Ga0209435_100001 3300025206 Bacteria 1424171
313 Ga0209435_104850 3300025206 Bacteria 1514
314 Ga0209760_100092 3300025207 Bacteria 71682
315 Ga0209784_100001 3300025224 Bacteria 3600592
316 Ga0209784_100003 3300025224 Bacteria 1379451
317 Ga0209784_100815 3300025224 Bacteria 7115
318 Ga0209784_101192 3300025224 Bacteria 4004
319 Ga0209566_100001 3300025225 Bacteria 3600765
320 Ga0209566_100002 3300025225 Bacteria 2614868
321 Ga0209566_100421 3300025225 Bacteria 32639
322 Ga0209566_100504 3300025225 Bacteria 27098
323 Ga0209566_102138 3300025225 Bacteria 4001
324 Ga0209674_100002 3300025226 Bacteria 3600592
325 Ga0209674_100005 3300025226 Bacteria 1708125
326 Ga0209674_100008 3300025226 Bacteria 1076909
327 Ga0209674_100161 3300025226 Bacteria 87684
328 Ga0209674_100267 3300025226 Bacteria 40569
329 Ga0209674_101381 3300025226 Bacteria 6524
330 Ga0209672_100001 3300025228 Bacteria 2828210
331 Ga0209672_100014 3300025228 Bacteria 546252
332 Ga0209672_100023 3300025228 Bacteria 371758
333 Ga0209672_100530 3300025228 Bacteria 20839
334 Ga0209672_100934 3300025228 Bacteria 13147
335 Ga0209672_100935 3300025228 Bacteria 13147
336 Ga0209147_100001 3300025229 Bacteria 2384371
337 Ga0209147_100002 3300025229 Bacteria 2158988
338 Ga0209147_100094 3300025229 Bacteria 167145
339 Ga0209147_100104 3300025229 Bacteria 158375
340 Ga0209147_101244 3300025229 Bacteria 10032
341 Ga0209563_100004 3300025230 Bacteria 1814108
342 Ga0209563_100008 3300025230 Bacteria 1554545
343 Ga0209563_100468 3300025230 Bacteria 13843
344 Ga0207427_100002 3300025231 Bacteria 1355321
345 Ga0207427_102517 3300025231 Bacteria 4857
346 Ga0209437_100007 3300025233 Bacteria 938377
347 Ga0209258_100001 3300025242 Bacteria 2384269
348 Ga0209258_100002 3300025242 Bacteria 2158988
349 Ga0209258_100040 3300025242 Bacteria 385401
350 Ga0209258_100142 3300025242 Bacteria 165865
351 Ga0209646_1000001 3300025246 Bacteria 3092932
352 Ga0209646_1000059 3300025246 Bacteria 256909
353 Ga0209026_1000003 3300025250 Bacteria 1060571
354 Ga0209677_100004 3300025253 Bacteria 1554545
355 Ga0209677_100009 3300025253 Bacteria 749530
356 Ga0209148_1000003 3300025254 Bacteria 2384288
357 Ga0209148_1000021 3300025254 Bacteria 714645
358 Ga0209148_1000035 3300025254 Bacteria 548413
359 Ga0209759_1000001 3300025256 Bacteria 2799452
360 Ga0209759_1000029 3300025256 Bacteria 286968
361 Ga0209759_1000030 3300025256 Bacteria 285649
362 Ga0209759_1000260 3300025256 Bacteria 76538
363 Ga0209759_1001844 3300025256 Bacteria 10606
364 Ga0209759_1003073 3300025256 Bacteria 6864
365 Ga0209759_1012730 3300025256 Bacteria 2315
366 Ga0209759_1020056 3300025256 Bacteria 1566
367 Ga0209129_1000104 3300025258 Bacteria 161264
368 Ga0209129_1000200 3300025258 Bacteria 77042
369 Ga0209129_1005824 3300025258 Bacteria 4201
370 Ga0209233_1000016 3300025261 Bacteria 907830
371 Ga0209233_1001979 3300025261 Bacteria 7778
372 Ga0209565_1000004 3300025263 Bacteria 983150
373 Ga0209565_1000021 3300025263 Bacteria 406281
374 Ga0209565_1011180 3300025263 Bacteria 2194
375 Ga0209455_1000001 3300025272 Bacteria 2384278
376 Ga0209455_1000021 3300025272 Bacteria 699993
377 Ga0209455_1000072 3300025272 Bacteria 293074
378 Ga0209673_1000140 3300025273 Bacteria 157575
379 Ga0209130_1000082 3300025284 Bacteria 164441
380 Ga0209130_1000094 3300025284 Bacteria 145569
381 Ga0209130_1007922 3300025284 Bacteria 3204
382 Ga0209675_1000061 3300025291 Bacteria 181096
383 Ga0209675_1000149 3300025291 Bacteria 93109
384 Ga0209675_1001200 3300025291 Bacteria 15715
385 Ga0209675_1002449 3300025291 Bacteria 9536
386 Ga0209676_1000014 3300025292 Bacteria 793514
387 Ga0209676_1000029 3300025292 Bacteria 520536
388 Ga0209676_1007000 3300025292 Bacteria 5419
389 Ga0209676_1008263 3300025292 Bacteria 4678
390 Ga0209025_1000522 3300025294 Bacteria 73140
391 Ga0209025_1001239 3300025294 Bacteria 35471
392 Ga0209025_1001542 3300025294 Bacteria 29365
393 Ga0209025_1005993 3300025294 Bacteria 9654
394 Ga0209025_1009504 3300025294 Bacteria 6757
395 Ga0209025_1024163 3300025294 Bacteria 3148
396 Ga0209564_1000003 3300025295 Bacteria 1585848
397 Ga0209564_1000046 3300025295 Bacteria 373787
398 Ga0209564_1000455 3300025295 Bacteria 69085
399 Ga0209564_1000979 3300025295 Bacteria 35983
400 Ga0209564_1001045 3300025295 Bacteria 33865
401 Ga0209564_1001145 3300025295 Bacteria 31078
402 Ga0209564_1002205 3300025295 Bacteria 16256
403 Ga0209564_1024894 3300025295 Bacteria 2032
404 Ga0209758_1000096 3300025297 Bacteria 231496
405 Ga0209758_1000285 3300025297 Bacteria 99959
406 Ga0209758_1011374 3300025297 Bacteria 5164
407 Ga0209758_1015813 3300025297 Bacteria 3879
408 Ga0209050_1000003 3300025298 Bacteria 1609245
409 Ga0209050_1003867 3300025298 Bacteria 10643
410 Ga0209050_1032394 3300025298 Bacteria 1608
411 Ga0209256_1000001 3300025299 Bacteria 2166974
412 Ga0209256_1000280 3300025299 Bacteria 89706
413 Ga0209256_1000625 3300025299 Bacteria 48667
414 Ga0207426_1000071 3300025302 Bacteria 329539
415 Ga0207426_1000125 3300025302 Bacteria 217504
416 Ga0207426_1005035 3300025302 Bacteria 6195
417 Ga0209051_1000003 3300025303 Bacteria 1609245
418 Ga0209257_1000018 3300025304 Bacteria 836016
419 Ga0209257_1005482 3300025304 Bacteria 8882
420 Ga0209257_1008179 3300025304 Bacteria 6051
421 Ga0207697_10018314 3300025315 Bacteria 2873
422 Ga0207656_10014406 3300025321 Bacteria 3045
423 Ga0207696_1000026 3300025711 Bacteria 418166
424 Ga0207696_1000035 3300025711 Bacteria 339626
425 Ga0207696_1000131 3300025711 Bacteria 132958
426 Ga0207696_1000166 3300025711 Bacteria 104368
427 Ga0207696_1001091 3300025711 Bacteria 15967
428 Ga0207696_1001841 3300025711 Bacteria 10888
429 Ga0207696_1006550 3300025711 Bacteria 4680
430 Ga0207696_1008073 3300025711 Bacteria 4063
431 Ga0207696_1020296 3300025711 Bacteria 2147
432 Ga0207655_1000002 3300025728 Bacteria 1148694
433 Ga0207655_1000004 3300025728 Bacteria 1021221
434 Ga0207655_1000007 3300025728 Bacteria 773492
435 Ga0207655_1000029 3300025728 Bacteria 432187
436 Ga0207655_1000062 3300025728 Bacteria 258054
437 Ga0207655_1000303 3300025728 Bacteria 73938
438 Ga0207655_1000621 3300025728 Bacteria 42638
439 Ga0207655_1000831 3300025728 Bacteria 33294
440 Ga0207655_1008564 3300025728 Bacteria 6474
441 Ga0207655_1010391 3300025728 Bacteria 5646
442 Ga0207655_1026057 3300025728 Bacteria 2817
443 Ga0207655_1035782 3300025728 Bacteria 2211
444 Ga0207713_1000052 3300025735 Bacteria 222663
445 Ga0207713_1000069 3300025735 Bacteria 191229
446 Ga0207713_1000084 3300025735 Bacteria 160822
447 Ga0207713_1000443 3300025735 Bacteria 43551
448 Ga0207713_1000864 3300025735 Bacteria 27722
449 Ga0207713_1002028 3300025735 Bacteria 15170
450 Ga0207713_1009216 3300025735 Bacteria 5590
451 Ga0207682_10000222 3300025893 Bacteria 25665
452 Ga0207682_10073981 3300025893 Bacteria 1448
453 Ga0207688_10079126 3300025901 Bacteria 1874
454 Ga0207680_10126860 3300025903 Bacteria 1676
455 Ga0207647_10000498 3300025904 Bacteria 31401
456 Ga0207647_10000605 3300025904 Bacteria 27980
457 Ga0207647_10025613 3300025904 Bacteria 3872
458 Ga0207645_10000759 3300025907 Bacteria 26825
459 Ga0207645_10035427 3300025907 Bacteria 3205
460 Ga0207645_10087465 3300025907 Bacteria 2002
461 Ga0207643_10056938 3300025908 Bacteria 2224
462 Ga0207643_10059306 3300025908 Bacteria 2183
463 Ga0207705_10004376 3300025909 Bacteria 10676
464 Ga0207705_10033405 3300025909 Bacteria 3675
465 Ga0207695_10000729 3300025913 Bacteria 63923
466 Ga0207695_10024266 3300025913 Bacteria 6828
467 Ga0207671_10042198 3300025914 Bacteria 3376
468 Ga0207671_10052362 3300025914 Bacteria 3025
469 Ga0207662_10105412 3300025918 Bacteria 1752
470 Ga0207657_10000004 3300025919 Bacteria 247179
471 Ga0207657_10004856 3300025919 Bacteria 14157
472 Ga0207657_10042471 3300025919 Bacteria 4011
473 Ga0207649_10000138 3300025920 Bacteria 61616
474 Ga0207649_10031701 3300025920 Bacteria 3144
475 Ga0207681_10001252 3300025923 Bacteria 16394
476 Ga0207681_10006080 3300025923 Bacteria 7404
477 Ga0207681_10021178 3300025923 Bacteria 4129
478 Ga0207650_10057624 3300025925 Bacteria 2890
479 Ga0207659_10001462 3300025926 Bacteria 14092
480 Ga0207659_10010366 3300025926 Bacteria 5855
481 Ga0207659_10043760 3300025926 Bacteria 3147
482 Ga0207687_10105337 3300025927 Bacteria 2083
483 Ga0207644_10034065 3300025931 Bacteria 3563
484 Ga0207690_10000102 3300025932 Bacteria 69683
485 Ga0207690_10001152 3300025932 Bacteria 16774
486 Ga0207706_10001019 3300025933 Bacteria 28600
487 Ga0207706_10032233 3300025933 Bacteria 4667
488 Ga0207709_10008663 3300025935 Bacteria 5614
489 Ga0207709_10021947 3300025935 Bacteria 3617
490 Ga0207669_10037250 3300025937 Bacteria 2788
491 Ga0207669_10137037 3300025937 Bacteria 1692
492 Ga0207704_10005743 3300025938 Bacteria 5737
493 Ga0207691_10001693 3300025940 Bacteria 21768
494 Ga0207691_10009952 3300025940 Bacteria 9131
495 Ga0207691_10039764 3300025940 Bacteria 4350
496 Ga0207691_10051960 3300025940 Bacteria 3744
497 Ga0207691_10287108 3300025940 Bacteria 1415
498 Ga0207689_10000267 3300025942 Bacteria 47185
499 Ga0207689_10054721 3300025942 Bacteria 3285
500 Ga0207661_10182666 3300025944 Bacteria 1833
501 Ga0207679_10000001 3300025945 Bacteria 777444
502 Ga0207679_10116150 3300025945 Bacteria 2121
503 Ga0207667_10001214 3300025949 Bacteria 32246
504 Ga0207667_10002775 3300025949 Bacteria 21673
505 Ga0207667_10011537 3300025949 Bacteria 10264
506 Ga0207667_10099085 3300025949 Bacteria 3007
507 Ga0207651_10012381 3300025960 Bacteria 4826
508 Ga0207651_10127341 3300025960 Bacteria 1943
509 Ga0207712_10109232 3300025961 Bacteria 2071
510 Ga0207640_10000088 3300025981 Bacteria 72802
511 Ga0207658_10001495 3300025986 Bacteria 18165
512 Ga0207658_10027495 3300025986 Bacteria 3997
513 Ga0207677_10030713 3300026023 Bacteria 3433
514 Ga0207677_10219457 3300026023 Bacteria 1524
515 Ga0207639_10047798 3300026041 Bacteria 3236
516 Ga0207678_10000001 3300026067 Bacteria 433184
517 Ga0207678_10000738 3300026067 Bacteria 29963
518 Ga0207678_10002867 3300026067 Bacteria 15651
519 Ga0207678_10126758 3300026067 Bacteria 2177
520 Ga0207708_10002428 3300026075 Bacteria 13686
521 Ga0207708_10031194 3300026075 Bacteria 4044
522 Ga0207708_10198009 3300026075 Bacteria 1602
523 Ga0207702_10000024 3300026078 Bacteria 187719
524 Ga0207648_10004977 3300026089 Bacteria 13507
525 Ga0207648_10012028 3300026089 Bacteria 8118
526 Ga0207648_10024696 3300026089 Bacteria 5361
527 Ga0207648_10194466 3300026089 Bacteria 1798
528 Ga0207648_10210298 3300026089 Bacteria 1727
529 Ga0207648_10286475 3300026089 Bacteria 1474
530 Ga0207674_10000214 3300026116 Bacteria 71833
531 Ga0207674_10016539 3300026116 Bacteria 8069
532 Ga0207674_10090360 3300026116 Bacteria 3054
533 Ga0207675_100000232 3300026118 Bacteria 52682
534 Ga0207675_100006634 3300026118 Bacteria 10945
535 Ga0207675_100100637 3300026118 Bacteria 2723
536 Ga0207675_100221991 3300026118 Bacteria 1821
537 Ga0207683_10065916 3300026121 Bacteria 3193
538 Ga0207683_10082750 3300026121 Bacteria 2852
539 Ga0207698_10005724 3300026142 Bacteria 7704
540 Ga0207698_10028347 3300026142 Bacteria 3992
541 Ga0207698_10084969 3300026142 Bacteria 2568
542 Ga0209281_1000004 3300027111 Bacteria 1253949
543 Ga0209281_1000014 3300027111 Bacteria 643021
544 Ga0209281_1000079 3300027111 Bacteria 261444
545 Ga0209281_1000142 3300027111 Bacteria 174280
546 Ga0209281_1000171 3300027111 Bacteria 153284
547 Ga0209281_1000698 3300027111 Bacteria 33996
548 Ga0209281_1000739 3300027111 Bacteria 31834
549 Ga0209281_1000906 3300027111 Bacteria 24781
550 Ga0209281_1001184 3300027111 Bacteria 17915
551 Ga0209281_1001659 3300027111 Bacteria 11808
552 Ga0209371_1000001 3300027312 Bacteria 2771503
553 Ga0209371_1000015 3300027312 Bacteria 659640
554 Ga0209371_1000079 3300027312 Bacteria 187621
555 Ga0209371_1000084 3300027312 Bacteria 180842
556 Ga0209371_1000190 3300027312 Bacteria 89981
557 Ga0209371_1000279 3300027312 Bacteria 58814
558 Ga0209371_1000407 3300027312 Bacteria 44809
559 Ga0209371_1000659 3300027312 Bacteria 30108
560 Ga0209371_1000855 3300027312 Bacteria 24645
561 Ga0209371_1001264 3300027312 Bacteria 17946
562 Ga0209371_1001382 3300027312 Bacteria 16693
563 Ga0209371_1001386 3300027312 Bacteria 16650
564 Ga0209371_1005670 3300027312 Bacteria 4884
565 Ga0209371_1006594 3300027312 Bacteria 4260
566 Ga0209371_1019801 3300027312 Bacteria 1671
567 Ga0209282_1000028 3300027666 Bacteria 159466
568 Ga0209966_1000004 3300027695 Bacteria 108133
569 Ga0209998_10010904 3300027717 Bacteria 1882
570 Ga0209974_10001532 3300027876 Bacteria 8385
571 Ga0207428_10075761 3300027907 Bacteria 2636
572 Ga0207428_10179220 3300027907 Bacteria 1602
573 Ga0268266_10000933 3300028379 Bacteria 37300
574 Ga0268266_10120795 3300028379 Bacteria 2331
575 Ga0268265_10004824 3300028380 Bacteria 9294
576 Ga0268264_10021745 3300028381 Bacteria 5237
577 Ga0268264_10149949 3300028381 Bacteria 2090
578 Ga0268264_10381187 3300028381 Bacteria 1350
579 Ga0307517_10003248 3300028786 Bacteria 25445
580 Ga0307515_10000041 3300028794 Bacteria 319110
581 Ga0307515_10025544 3300028794 Bacteria 10212
582 Ga0307515_10048148 3300028794 Bacteria 6454
583 Ga0307515_10088677 3300028794 Bacteria 3906
584 Ga0307515_10265181 3300028794 Bacteria 1447
585 Ga0265338_10000028 3300028800 Bacteria 279132
586 Ga0265338_10000741 3300028800 Bacteria 55680
587 Ga0265324_10048243 3300029957 Bacteria 1464
588 Ga0268256_1000001 3300030500 Bacteria 2771065
589 Ga0268256_1000018 3300030500 Bacteria 594572
590 Ga0268256_1000069 3300030500 Bacteria 195391
591 Ga0268256_1000075 3300030500 Bacteria 180814
592 Ga0268256_1000090 3300030500 Bacteria 153976
593 Ga0268256_1000183 3300030500 Bacteria 74143
594 Ga0268256_1000531 3300030500 Bacteria 31533
595 Ga0268256_1001062 3300030500 Bacteria 18284
596 Ga0268256_1001260 3300030500 Bacteria 15774
597 Ga0268256_1001426 3300030500 Bacteria 14431
598 Ga0268256_1005102 3300030500 Bacteria 5239
599 Ga0268256_1008862 3300030500 Bacteria 3403
600 Ga0268256_1012380 3300030500 Bacteria 2639
601 Ga0268256_1015612 3300030500 Bacteria 2208
602 Ga0307512_10097523 3300030522 Bacteria 2010
603 Ga0265332_10007434 3300031238 Bacteria 4952
604 Ga0265328_10000121 3300031239 Bacteria 37217
605 Ga0265331_10000055 3300031250 Bacteria 177693
606 Ga0265331_10087229 3300031250 Bacteria 1445
607 Ga0265327_10000045 3300031251 Bacteria 282880
608 Ga0265327_10003428 3300031251 Bacteria 15161
609 Ga0265327_10019994 3300031251 Bacteria 4097
610 Ga0307513_10018375 3300031456 Bacteria 8356
611 Ga0307513_10156513 3300031456 Bacteria 2178
612 Ga0307513_10221232 3300031456 Bacteria 1714
613 Ga0307509_10000092 3300031507 Bacteria 124019
614 Ga0307509_10002037 3300031507 Bacteria 33298
615 Ga0307509_10014105 3300031507 Bacteria 9424
616 Ga0307509_10053226 3300031507 Bacteria 4317
617 Ga0307408_100004785 3300031548 Bacteria 9121
618 Ga0307408_100005566 3300031548 Bacteria 8420
619 Ga0307408_100042193 3300031548 Bacteria 3239
620 Ga0307408_100138087 3300031548 Bacteria 1910
621 Ga0307508_10000594 3300031616 Bacteria 43299
622 Ga0307508_10007413 3300031616 Bacteria 10216
623 Ga0307508_10098622 3300031616 Bacteria 2515
624 Ga0307514_10098011 3300031649 Bacteria 2114
625 Ga0307514_10115888 3300031649 Bacteria 1884
626 Ga0316575_10025677 3300031665 Bacteria 2286
627 Ga0307405_10049022 3300031731 Bacteria 2608
628 Ga0307413_10016262 3300031824 Bacteria 3838
629 Ga0307413_10062062 3300031824 Bacteria 2310
630 Ga0307412_10000021 3300031911 Bacteria 250629
631 Ga0307412_10121659 3300031911 Bacteria 1880
632 Ga0307409_100012184 3300031995 Bacteria 5467
633 Ga0307416_100014376 3300032002 Bacteria 5422
634 Ga0307411_10055503 3300032005 Bacteria 2606
635 Ga0307415_100180022 3300032126 Bacteria 1657
636 Ga0307507_10053322 3300033179 Bacteria 3865
637 Ga0307510_10012482 3300033180 Bacteria 10079
638 Ga0307510_10045807 3300033180 Bacteria 4713
639 Ga0307510_10090271 3300033180 Bacteria 2911
640 Ga0373931_0001546 3300035691 Bacteria 9925
641 Ga0395899_0000007 3300037312 Bacteria 629129
642 Ga0395899_0057002 3300037312 Bacteria 2886
643 Ga0395899_0061163 3300037312 Bacteria 2774
644 Ga0395899_0076329 3300037312 Bacteria 2446
645 Ga0395900_0000026 3300037418 Bacteria 313470
646 Ga0395900_0001159 3300037418 Bacteria 33030
647 Ga0395900_0031653 3300037418 Bacteria 5437
648 Ga0395900_0069818 3300037418 Bacteria 3611
649 Ga0395900_0182491 3300037418 Bacteria 2132
650 Ga0395898_0000497 3300037466 Bacteria 76853
651 Ga0395898_0000784 3300037466 Bacteria 54539
652 Ga0395898_0124764 3300037466 Bacteria 2466
653 Ga0395905_0000459 3300037471 Bacteria 57003
654 Ga0395905_0003226 3300037471 Bacteria 17538
655 Ga0395905_0039423 3300037471 Bacteria 4432
656 Ga0395905_0069175 3300037471 Bacteria 3307
657 Ga0395905_0208172 3300037471 Bacteria 1833
658 Ga0436364_1329714 3300037853 Bacteria 45658
659 Ga0395901_0000077 3300038443 Bacteria 135073
660 Ga0395901_0000296 3300038443 Bacteria 61806
661 Ga0395901_0003986 3300038443 Bacteria 14860
662 Ga0436365_0181312 3300039437 Bacteria 1645
663 Ga0436365_0380661 3300039437 Bacteria 3746
664 Ga0436365_1091962 3300039437 Bacteria 109548
665 Ga0436365_1914962 3300039437 Bacteria 12322
666 Ga0436361_0624331 3300039447 Bacteria 6509
667 Ga0436361_0692684 3300039447 Bacteria 133303
668 Ga0436361_0734074 3300039447 Bacteria 42530
669 Ga0439438_001562 3300041405 Bacteria 10086
670 Ga0439438_002218 3300041405 Bacteria 8361
671 Ga0439447_003440 3300041407 Bacteria 5626
672 Ga0451789_1242607 3300041443 Bacteria 1884
673 Ga0451853_3442227 3300041512 Bacteria 9276
674 Ga0439448_0000988 3300042005 Bacteria 7068
675 Ga0439452_000002 3300042010 Bacteria 1377577
676 Ga0439452_000036 3300042010 Bacteria 158675
677 Ga0439452_000089 3300042010 Bacteria 79368
678 Ga0439452_000235 3300042010 Bacteria 38565
679 Ga0439452_000816 3300042010 Bacteria 14589
680 Ga0450900_006298 3300042136 Bacteria 1432
681 Ga0439435_0003906 3300042436 Bacteria 3156
682 Ga0439464_0003592 3300042439 Bacteria 3929
683 Ga0439464_0019621 3300042439 Bacteria 1847
684 Ga0451577_0010348 3300042876 Bacteria 8927
685 Ga0451577_0069143 3300042876 Bacteria 3149
686 Ga0466969_0007486 3300044656 Bacteria 5806
687 Ga0466969_0033304 3300044656 Bacteria 2617
688 Ga0466972_0036679 3300044658 Bacteria 2397
689 Ga0466972_0037298 3300044658 Bacteria 2376
690 Ga0466972_0052572 3300044658 Bacteria 1963
691 Ga0466981_0000019 3300044669 Bacteria 91861
692 Ga0453683_0143402 3300044673 Bacteria 1508
693 Ga0466965_0018895 3300044683 Bacteria 3307
694 Ga0466965_0048207 3300044683 Bacteria 2110
695 Ga0466966_0000084 3300044684 Bacteria 58535
696 Ga0466966_0000362 3300044684 Bacteria 29495
697 Ga0466966_0004483 3300044684 Bacteria 9210
698 Ga0466966_0005728 3300044684 Bacteria 8177
699 Ga0466961_0000427 3300044693 Bacteria 26808
700 Ga0466961_0000544 3300044693 Bacteria 23991
701 Ga0466961_0001445 3300044693 Bacteria 14751
702 Ga0466961_0023009 3300044693 Bacteria 4008
703 Ga0466961_0035146 3300044693 Bacteria 3218
704 Ga0466963_0005199 3300044694 Bacteria 7598
705 Ga0466963_0026351 3300044694 Bacteria 3717
706 Ga0466964_0002299 3300044706 Bacteria 6780
707 Ga0466964_0036045 3300044706 Bacteria 1981
708 Ga0453684_0001126 3300044712 Bacteria 83760
709 Ga0453684_0003805 3300044712 Bacteria 33295
710 Ga0453684_0320019 3300044712 Bacteria 1757
711 Ga0466971_0002907 3300044719 Bacteria 7267
712 Ga0466971_0083903 3300044719 Bacteria 1454
713 Ga0466970_0012108 3300044765 Bacteria 4405
714 Ga0466957_0009283 3300044842 Bacteria 5612
715 Ga0466957_0037239 3300044842 Bacteria 2928
716 Ga0466959_0006868 3300045049 Bacteria 7938
717 Ga0466959_0007452 3300045049 Bacteria 7678
718 Ga0466959_0013229 3300045049 Bacteria 5976
719 Ga0451576_0001379 3300045051 Bacteria 41763
720 Ga0451576_0015852 3300045051 Bacteria 8335
721 Ga0451576_0056029 3300045051 Bacteria 4124
722 Ga0451576_0324705 3300045051 Bacteria 1611
723 Ga0466958_0001681 3300045836 Bacteria 10674
724 Ga0466958_0005145 3300045836 Bacteria 6992
725 Ga0466958_0014545 3300045836 Bacteria 4492
726 Ga0466958_0107075 3300045836 Bacteria 1743
727 Ga0495592_0000413 3300046454 Bacteria 32677
728 Ga0495592_0010535 3300046454 Bacteria 6972
729 Ga0495603_0006170 3300046455 Bacteria 7166
730 Ga0495590_0005435 3300046457 Bacteria 5056
731 Ga0495591_000001 3300046458 Bacteria 503087
732 Ga0495591_000066 3300046458 Bacteria 121317
733 Ga0495591_006822 3300046458 Bacteria 4968
734 Ga0495591_008803 3300046458 Bacteria 4086
735 Ga0495629_0000172 3300046459 Bacteria 57319
736 Ga0495629_0000506 3300046459 Bacteria 32709
737 Ga0495629_0002744 3300046459 Bacteria 13472
738 Ga0495629_0057883 3300046459 Bacteria 2709
739 Ga0495629_0100044 3300046459 Bacteria 2023
740 Ga0495638_0000724 3300046460 Bacteria 35505
741 Ga0495638_0015989 3300046460 Bacteria 5029
742 Ga0495638_0157399 3300046460 Bacteria 1313
743 Ga0495651_0017252 3300046462 Bacteria 5593
744 Ga0495653_0019400 3300046463 Bacteria 5514
745 Ga0495653_0019791 3300046463 Bacteria 5456
746 Ga0495653_0022992 3300046463 Bacteria 5041
747 Ga0495653_0030155 3300046463 Bacteria 4323
748 Ga0495653_0043631 3300046463 Bacteria 3485
749 Ga0495653_0073444 3300046463 Bacteria 2552
750 Ga0495650_0000016 3300046471 Bacteria 554693
751 Ga0495650_0000282 3300046471 Bacteria 96956
752 Ga0495650_0006200 3300046471 Bacteria 7504
753 Ga0495650_0007870 3300046471 Bacteria 6330
754 Ga0495650_0011447 3300046471 Bacteria 4857
755 Ga0495650_0042066 3300046471 Bacteria 1949
756 Ga0495580_0002910 3300046472 Bacteria 14703
757 Ga0495580_0006463 3300046472 Bacteria 9538
758 Ga0495580_0018014 3300046472 Bacteria 5265
759 Ga0495580_0059891 3300046472 Bacteria 2675
760 Ga0495580_0093406 3300046472 Bacteria 2094
761 Ga0495582_0001714 3300046473 Bacteria 12364
762 Ga0495582_0115445 3300046473 Bacteria 1510
763 Ga0495582_0132145 3300046473 Bacteria 1411
764 Ga0495605_0002724 3300046474 Bacteria 10782
765 Ga0495605_0003771 3300046474 Bacteria 8993
766 Ga0495605_0011246 3300046474 Bacteria 4996
767 Ga0495605_0037059 3300046474 Bacteria 2455
768 Ga0495605_0064509 3300046474 Bacteria 1744
769 Ga0495664_0001580 3300046477 Bacteria 12085
770 Ga0495664_0021769 3300046477 Bacteria 3704
771 Ga0495664_0047901 3300046477 Bacteria 2537
772 Ga0495664_0049736 3300046477 Bacteria 2488
773 Ga0495594_0032831 3300046499 Bacteria 2819
774 Ga0495596_0000464 3300046500 Bacteria 25748
775 Ga0495596_0012405 3300046500 Bacteria 3649
776 Ga0495596_0013080 3300046500 Bacteria 3532
777 Ga0495596_0033012 3300046500 Bacteria 2061
778 Ga0495607_0036436 3300046501 Bacteria 2964
779 Ga0495583_0009682 3300046506 Bacteria 5726
780 Ga0495583_0012014 3300046506 Bacteria 4932
781 Ga0495606_0000318 3300046507 Bacteria 82802
782 Ga0495606_0003649 3300046507 Bacteria 16140
783 Ga0495606_0005502 3300046507 Bacteria 12113
784 Ga0495606_0006216 3300046507 Bacteria 11099
785 Ga0495606_0025325 3300046507 Bacteria 4251
786 Ga0495608_0000972 3300046511 Bacteria 20254
787 Ga0495608_0006938 3300046511 Bacteria 8021
788 Ga0495610_0001926 3300046512 Bacteria 17906
789 Ga0495610_0001938 3300046512 Bacteria 17830
790 Ga0495616_0003931 3300046513 Bacteria 9464
791 Ga0495616_0038228 3300046513 Bacteria 2465
792 Ga0495618_0003662 3300046514 Bacteria 9526
793 Ga0495618_0012834 3300046514 Bacteria 5092
794 Ga0495618_0043358 3300046514 Bacteria 2838
795 Ga0495620_0005352 3300046515 Bacteria 7176
796 Ga0495620_0008055 3300046515 Bacteria 5672
797 Ga0495628_0012653 3300046516 Bacteria 7109
798 Ga0495628_0063088 3300046516 Bacteria 2903
799 Ga0495630_0032279 3300046517 Bacteria 3901
800 Ga0495630_0066106 3300046517 Bacteria 2717
801 Ga0495631_0019888 3300046518 Bacteria 3143
802 Ga0495637_0003212 3300046520 Bacteria 8727
803 Ga0495643_0027330 3300046522 Bacteria 3209
804 Ga0495644_0008789 3300046523 Bacteria 3884
805 Ga0495648_0084740 3300046524 Bacteria 1792
806 Ga0495648_0086599 3300046524 Bacteria 1766
807 Ga0495666_0001321 3300046526 Bacteria 11998
808 Ga0495666_0004894 3300046526 Bacteria 6772
809 Ga0495642_0019634 3300046528 Bacteria 2650
810 Ga0495642_0065478 3300046528 Bacteria 1513
811 Ga0495652_0023493 3300046529 Bacteria 5465
812 Ga0495652_0043262 3300046529 Bacteria 3880
813 Ga0495652_0063919 3300046529 Bacteria 3098
814 Ga0495652_0068546 3300046529 Bacteria 2971
815 Ga0495652_0115701 3300046529 Bacteria 2148
816 Ga0495654_0000033 3300046530 Bacteria 201799
817 Ga0495654_0000055 3300046530 Bacteria 142121
818 Ga0495654_0003551 3300046530 Bacteria 9509
819 Ga0495654_0008618 3300046530 Bacteria 5622
820 Ga0495654_0035205 3300046530 Bacteria 2523
821 Ga0495654_0135188 3300046530 Bacteria 1103
822 Ga0495665_0003857 3300046531 Bacteria 8115
823 Ga0495665_0018084 3300046531 Bacteria 3789
824 Ga0495665_0046983 3300046531 Bacteria 2290
825 Ga0495665_0057008 3300046531 Bacteria 2062
826 Ga0495665_0124720 3300046531 Bacteria 1348
827 Ga0495640_0069191 3300046533 Bacteria 2374
828 Ga0495586_0004311 3300046535 Bacteria 7598
829 Ga0495586_0065834 3300046535 Bacteria 1975
830 Ga0495587_0019557 3300046536 Bacteria 4189
831 Ga0495609_0001831 3300046538 Bacteria 13621
832 Ga0495621_0045583 3300046539 Bacteria 1553
833 Ga0495597_0000112 3300046542 Bacteria 72402
834 Ga0495597_0000354 3300046542 Bacteria 40920
835 Ga0495597_0003154 3300046542 Bacteria 9868
836 Ga0495645_0000357 3300046543 Bacteria 31874
837 Ga0495645_0009233 3300046543 Bacteria 6891
838 Ga0495622_0000551 3300046557 Bacteria 22485
839 Ga0495622_0010729 3300046557 Bacteria 4227
840 Ga0495622_0036110 3300046557 Bacteria 2305
841 Ga0495667_0125064 3300046559 Bacteria 1660
842 Ga0495668_0020606 3300046616 Bacteria 3791
843 Ga0495668_0022906 3300046616 Bacteria 3567
844 Ga0495668_0067009 3300046616 Bacteria 1975
845 Ga0495634_0029934 3300046642 Bacteria 3764
846 Ga0495634_0055984 3300046642 Bacteria 2636
847 Ga0495625_0017124 3300046660 Bacteria 5680
848 Ga0495625_0041262 3300046660 Bacteria 3360
849 Ga0495625_0044735 3300046660 Bacteria 3203
850 Ga0495635_0005954 3300046663 Bacteria 8507
851 Ga0495635_0030228 3300046663 Bacteria 3764
852 Ga0495661_0008523 3300046665 Bacteria 7088
853 Ga0495661_0054035 3300046665 Bacteria 2413
854 Ga0495661_0093070 3300046665 Bacteria 1711
855 Ga0495588_0004132 3300046674 Bacteria 6393
856 Ga0495588_0013181 3300046674 Bacteria 3933
857 Ga0495588_0018457 3300046674 Bacteria 3402
858 Ga0495623_0008552 3300046679 Bacteria 6647
859 Ga0495623_0010914 3300046679 Bacteria 5881
860 Ga0495646_0025935 3300046680 Bacteria 3682
861 Ga0495646_0037729 3300046680 Bacteria 2987
862 Ga0495646_0054746 3300046680 Bacteria 2398
863 Ga0495646_0057937 3300046680 Bacteria 2317
864 Ga0495669_0026341 3300046684 Bacteria 2541
865 Ga0495613_0003580 3300046689 Bacteria 11638
866 Ga0495613_0013703 3300046689 Bacteria 6015
867 Ga0495613_0070594 3300046689 Bacteria 2547
868 Ga0495624_0013999 3300046690 Bacteria 5458
869 Ga0495624_0031318 3300046690 Bacteria 3459
870 Ga0495624_0054625 3300046690 Bacteria 2517
871 Ga0495670_0026371 3300046691 Bacteria 2876
872 Ga0495671_0007138 3300046692 Bacteria 6397
873 Ga0495671_0017632 3300046692 Bacteria 3798
874 Ga0495649_0006065 3300046694 Bacteria 7557
875 Ga0495649_0006663 3300046694 Bacteria 7169
876 Ga0495649_0028670 3300046694 Bacteria 3085
877 Ga0495589_0004533 3300046794 Bacteria 7387
878 Ga0495589_0011136 3300046794 Bacteria 4667
879 Ga0495589_0012497 3300046794 Bacteria 4397
880 Ga0495589_0013954 3300046794 Bacteria 4142
881 Ga0495600_0003827 3300046809 Bacteria 8915
882 Ga0495660_0000007 3300046810 Bacteria 485295
883 Ga0495660_0000017 3300046810 Bacteria 320655
884 Ga0495660_0047842 3300046810 Bacteria 2340
885 Ga0495660_0078528 3300046810 Bacteria 1735
886 Ga0495581_0005000 3300047315 Bacteria 7680
887 Ga0495581_0017429 3300047315 Bacteria 4171
888 Ga0495581_0022055 3300047315 Bacteria 3691
889 Ga0495581_0026657 3300047315 Bacteria 3350
890 Ga0495581_0032019 3300047315 Bacteria 3045
891 Ga0495581_0059180 3300047315 Bacteria 2213
892 Ga0495581_0087182 3300047315 Bacteria 1810
893 Ga0495604_0038131 3300047317 Bacteria 3781
894 Ga0495604_0051054 3300047317 Bacteria 3208
895 Ga0495604_0067973 3300047317 Bacteria 2706
896 Ga0495636_0033949 3300047318 Bacteria 2098
897 Ga0495636_0056849 3300047318 Bacteria 1647
898 Ga0495674_0003612 3300047319 Bacteria 15056
899 Ga0495674_0008069 3300047319 Bacteria 10052
900 Ga0495674_0048438 3300047319 Bacteria 3760
901 Ga0495674_0050490 3300047319 Bacteria 3670
902 Ga0495674_0092897 3300047319 Bacteria 2575
903 Ga0495674_0165473 3300047319 Bacteria 1848
904 Ga0495674_0181119 3300047319 Bacteria 1754
905 Ga0495672_0000001 3300047320 Bacteria 1458820
906 Ga0495672_0000009 3300047320 Bacteria 557755
907 Ga0495672_0003268 3300047320 Bacteria 14029
908 Ga0495676_0022958 3300047321 Bacteria 5421
909 Ga0495676_0052435 3300047321 Bacteria 3256
910 Ga0495680_0018438 3300047322 Bacteria 5926
911 Ga0495680_0024575 3300047322 Bacteria 4996
912 Ga0495680_0027463 3300047322 Bacteria 4675
913 Ga0495680_0101575 3300047322 Bacteria 2142
914 Ga0495683_0007379 3300047323 Bacteria 5958
915 Ga0495683_0025313 3300047323 Bacteria 3043
916 Ga0495683_0026851 3300047323 Bacteria 2946
917 Ga0495683_0073432 3300047323 Bacteria 1677
918 Ga0495687_000015 3300047443 Bacteria 365627
919 Ga0495687_000421 3300047443 Bacteria 52470
920 Ga0495687_008170 3300047443 Bacteria 6034
921 Ga0495687_011651 3300047443 Bacteria 4710
922 Ga0495687_034108 3300047443 Bacteria 2302
923 Ga0495687_039183 3300047443 Bacteria 2098
924 Ga0495687_065240 3300047443 Bacteria 1483
925 Ga0495675_0019316 3300047444 Bacteria 4328
926 Ga0495675_0023932 3300047444 Bacteria 3892
927 Ga0495679_000032 3300047446 Bacteria 171636
928 Ga0495679_000214 3300047446 Bacteria 49621
929 Ga0495679_002722 3300047446 Bacteria 8812
930 Ga0495679_011957 3300047446 Bacteria 3330
931 Ga0495685_017388 3300047447 Bacteria 2463
932 Ga0495673_0000019 3300047469 Bacteria 554389
933 Ga0495673_0000071 3300047469 Bacteria 217117
934 Ga0495673_0022497 3300047469 Bacteria 3087
935 Ga0495673_0055471 3300047469 Bacteria 1718
936 Ga0495686_0000002 3300047472 Bacteria 1050777
937 Ga0495593_0040336 3300047673 Bacteria 2513
938 Ga0495602_0016898 3300048088 Bacteria 7321
939 Ga0495602_0032598 3300048088 Bacteria 4903
940 Ga0495602_0059754 3300048088 Bacteria 3325
941 Ga0495614_0011687 3300048089 Bacteria 3859
942 Ga0495626_0004577 3300048091 Bacteria 8431
943 Ga0496100_0002406 3300048903 Bacteria 9478
944 Ga0496100_0030684 3300048903 Bacteria 3336
945 Ga0496100_0077293 3300048903 Bacteria 2237
946 Ga0496101_0001779 3300048904 Bacteria 12954
947 Ga0496101_0001970 3300048904 Bacteria 12441
948 Ga0496101_0003292 3300048904 Bacteria 10049
949 Ga0496102_0001049 3300048905 Bacteria 25567
950 Ga0496102_0005053 3300048905 Bacteria 11168
951 Ga0496102_0018370 3300048905 Bacteria 6143
952 Ga0496102_0056284 3300048905 Bacteria 3587
953 Ga0496102_0155584 3300048905 Bacteria 2149
954 Ga0496103_0002203 3300048906 Bacteria 12354
955 Ga0496103_0003261 3300048906 Bacteria 9943
956 Ga0496104_0000901 3300048907 Bacteria 25549
957 Ga0496104_0045619 3300048907 Bacteria 4123
958 Ga0496104_0120206 3300048907 Bacteria 2522
959 Ga0496105_0005680 3300048908 Bacteria 9494
960 Ga0496105_0019626 3300048908 Bacteria 5453
961 Ga0496105_0080533 3300048908 Bacteria 2690
962 Ga0496105_0109255 3300048908 Bacteria 2283
963 Ga0496105_0148506 3300048908 Bacteria 1927
964 Ga0496106_0000089 3300048909 Bacteria 72356
965 Ga0496106_0003051 3300048909 Bacteria 12482
966 Ga0496106_0010892 3300048909 Bacteria 6718
967 Ga0496106_0045700 3300048909 Bacteria 3290
968 Ga0496106_0139939 3300048909 Bacteria 1903
969 Ga0496107_0002731 3300048910 Bacteria 11588
970 Ga0496107_0123607 3300048910 Bacteria 1907
971 Ga0496108_0037533 3300048911 Bacteria 4036
972 Ga0496112_0011516 3300048915 Bacteria 8081
973 Ga0496112_0013309 3300048915 Bacteria 7595
974 Ga0496112_0016390 3300048915 Bacteria 6941
975 Ga0496113_0002808 3300048916 Bacteria 10255
976 Ga0496113_0074199 3300048916 Bacteria 2593
977 Ga0496113_0107728 3300048916 Bacteria 2165
978 Ga0496114_0003191 3300048917 Bacteria 12572
979 Ga0496115_0019931 3300048918 Bacteria 5168
980 Ga0496115_0028876 3300048918 Bacteria 4350
981 Ga0496116_0000054 3300048919 Bacteria 289010
982 Ga0496116_0000404 3300048919 Bacteria 62080
983 Ga0496116_0000563 3300048919 Bacteria 49675
984 Ga0496116_0000656 3300048919 Bacteria 45209
985 Ga0496116_0018056 3300048919 Bacteria 5452
986 Ga0496116_0020601 3300048919 Bacteria 5003
987 Ga0496116_0047659 3300048919 Bacteria 2883
988 Ga0496116_0083492 3300048919 Bacteria 1971
989 Ga0496117_0000589 3300048920 Bacteria 59852
990 Ga0496117_0002070 3300048920 Bacteria 26530
991 Ga0496117_0002132 3300048920 Bacteria 25882
992 Ga0496117_0004572 3300048920 Bacteria 15145
993 Ga0496117_0010642 3300048920 Bacteria 8342
994 Ga0496117_0017617 3300048920 Bacteria 5959
995 Ga0496117_0020400 3300048920 Bacteria 5403
996 Ga0496117_0028584 3300048920 Bacteria 4315
997 Ga0496117_0031106 3300048920 Bacteria 4081
998 Ga0496118_0000542 3300048921 Bacteria 62176
999 Ga0496118_0000760 3300048921 Bacteria 52060
1000 Ga0496118_0002012 3300048921 Bacteria 28785
1001 Ga0496118_0002453 3300048921 Bacteria 24974
1002 Ga0496118_0003100 3300048921 Bacteria 21318
1003 Ga0496118_0007960 3300048921 Bacteria 11083
1004 Ga0496118_0008138 3300048921 Bacteria 10919
1005 Ga0496118_0011717 3300048921 Bacteria 8523
1006 Ga0496118_0026170 3300048921 Bacteria 4977
1007 Ga0496118_0026741 3300048921 Bacteria 4905
1008 Ga0496118_0046051 3300048921 Bacteria 3397
1009 Ga0496118_0072634 3300048921 Bacteria 2470
1010 Ga0496118_0149331 3300048921 Bacteria 1465
1011 Ga0496119_0000013 3300048922 Bacteria 323820
1012 Ga0496119_0000487 3300048922 Bacteria 54233
1013 Ga0496119_0002421 3300048922 Bacteria 20486
1014 Ga0496119_0006876 3300048922 Bacteria 10387
1015 Ga0496119_0011580 3300048922 Bacteria 7277
1016 Ga0496119_0016388 3300048922 Bacteria 5642
1017 Ga0496119_0041896 3300048922 Bacteria 2909
1018 Ga0496120_0000127 3300048923 Bacteria 128189
1019 Ga0496120_0001247 3300048923 Bacteria 32027
1020 Ga0496120_0001743 3300048923 Bacteria 24718
1021 Ga0496120_0002433 3300048923 Bacteria 18837
1022 Ga0496120_0002439 3300048923 Bacteria 18822
1023 Ga0496120_0002997 3300048923 Bacteria 16036
1024 Ga0496120_0010817 3300048923 Bacteria 6322
1025 Ga0496120_0011643 3300048923 Bacteria 6036
1026 Ga0496120_0023862 3300048923 Bacteria 3823
1027 Ga0496121_0002823 3300048924 Bacteria 25686
1028 Ga0496121_0002856 3300048924 Bacteria 25463
1029 Ga0496121_0003030 3300048924 Bacteria 24396
1030 Ga0496121_0006525 3300048924 Bacteria 14424
1031 Ga0496121_0011222 3300048924 Bacteria 9983
1032 Ga0496121_0013134 3300048924 Bacteria 8933
1033 Ga0496121_0020308 3300048924 Bacteria 6585
1034 Ga0496121_0036376 3300048924 Bacteria 4388
1035 Ga0496121_0071177 3300048924 Bacteria 2798
1036 Ga0496121_0121576 3300048924 Bacteria 1971
1037 Ga0496121_0164691 3300048924 Bacteria 1617
1038 Ga0496122_0000003 3300048925 Bacteria 645810
1039 Ga0496122_0000013 3300048925 Bacteria 501039
1040 Ga0496122_0000531 3300048925 Bacteria 79144
1041 Ga0496122_0001786 3300048925 Bacteria 32964
1042 Ga0496122_0002190 3300048925 Bacteria 28574
1043 Ga0496122_0004133 3300048925 Bacteria 18347
1044 Ga0496122_0006638 3300048925 Bacteria 13197
1045 Ga0496122_0009302 3300048925 Bacteria 10386
1046 Ga0496122_0016118 3300048925 Bacteria 7099
1047 Ga0496123_0000010 3300048926 Bacteria 501039
1048 Ga0496123_0000012 3300048926 Bacteria 458760
1049 Ga0496123_0000108 3300048926 Bacteria 166102
1050 Ga0496123_0001302 3300048926 Bacteria 35523
1051 Ga0496123_0003521 3300048926 Bacteria 17440
1052 Ga0496123_0003666 3300048926 Bacteria 16946
1053 Ga0496123_0003877 3300048926 Bacteria 16271
1054 Ga0496123_0005221 3300048926 Bacteria 13197
1055 Ga0496123_0006294 3300048926 Bacteria 11543
1056 Ga0496123_0015896 3300048926 Bacteria 6141
1057 Ga0496124_0000010 3300048927 Bacteria 595157
1058 Ga0496124_0000060 3300048927 Bacteria 239933
1059 Ga0496124_0000086 3300048927 Bacteria 202844
1060 Ga0496124_0001326 3300048927 Bacteria 37257
1061 Ga0496124_0003926 3300048927 Bacteria 17760
1062 Ga0496124_0006620 3300048927 Bacteria 12580
1063 Ga0496124_0015626 3300048927 Bacteria 7266
1064 Ga0496124_0015885 3300048927 Bacteria 7191
1065 Ga0496124_0018274 3300048927 Bacteria 6571
1066 Ga0496124_0058546 3300048927 Bacteria 3239
1067 Ga0496124_0143629 3300048927 Bacteria 1880
1068 Ga0496125_0000019 3300048928 Bacteria 474989
1069 Ga0496125_0000580 3300048928 Bacteria 62643
1070 Ga0496125_0002767 3300048928 Bacteria 22197
1071 Ga0496125_0014233 3300048928 Bacteria 7756
1072 Ga0496125_0017865 3300048928 Bacteria 6749
1073 Ga0496125_0038117 3300048928 Bacteria 4166
1074 Ga0496125_0234540 3300048928 Bacteria 1170
1075 Ga0496126_0000031 3300048929 Bacteria 373371
1076 Ga0496126_0004481 3300048929 Bacteria 16666
1077 Ga0496126_0005728 3300048929 Bacteria 14067
1078 Ga0496126_0100890 3300048929 Bacteria 2525
1079 Ga0496126_0108480 3300048929 Bacteria 2420
1080 Ga0496126_0162075 3300048929 Bacteria 1910
1081 Ga0496126_0165372 3300048929 Bacteria 1888
1082 Ga0496126_0314450 3300048929 Bacteria 1289
1083 Ga0495678_000493 3300049459 Bacteria 39034
1084 Ga0495678_014271 3300049459 Bacteria 3700
1085 Ga0495678_024387 3300049459 Bacteria 2612
1086 Ga0495682_0000011 3300049460 Bacteria 278474
1087 Ga0501043_0000027 3300049579 Bacteria 144685
1088 Ga0501046_0000034 3300049580 Bacteria 173742
1089 Ga0501047_0000042 3300049581 Bacteria 176603
1090 Ga0501048_0013088 3300049582 Bacteria 6159
1091 Ga0501071_0250800 3300049587 Bacteria 1336
1092 Ga0501075_0116164 3300049591 Bacteria 2034
1093 Ga0501076_0027391 3300049592 Bacteria 4420
1094 Ga0501077_0049598 3300049593 Bacteria 2667
1095 Ga0501198_000015 3300049649 Bacteria 102945
1096 Ga0501222_000045 3300049662 Bacteria 46767
1097 Ga0501079_0032488 3300049741 Bacteria 4012
1098 Ga0501081_0003459 3300049743 Bacteria 10081
1099 Ga0501045_0095237 3300049824 Bacteria 2202
1100 nmdc:mga03683_45402_c1 3300050489 Bacteria 1818
1101 nmdc:mga03683_8078_c2 3300050489 Bacteria 2310
1102 nmdc:mga03n38_12496_c1 3300050490 Bacteria 3198
1103 nmdc:mga00v17_103309_c1 3300050491 Bacteria 1801
1104 nmdc:mga00v17_14361_c1 3300050491 Bacteria 4418
1105 nmdc:mga00v17_99563_c1 3300050491 Bacteria 1834
1106 nmdc:mga0yw44_60814_c1 3300050492 Bacteria 2315
1107 nmdc:mga0k408_1919_c1 3300050493 Bacteria 11132
1108 nmdc:mga0k408_22567_c1 3300050493 Bacteria 3544
1109 nmdc:mga0k408_27503_c1 3300050493 Bacteria 3230
1110 nmdc:mga0k408_4870_c1 3300050493 Bacteria 7118
1111 nmdc:mga0k408_62313_c1 3300050493 Bacteria 2169
1112 nmdc:mga0k408_654_c1 3300050493 Bacteria 18954
1113 nmdc:mga0k408_808_c1 3300050493 Bacteria 17249
1114 nmdc:mga07m45_14574_c1 3300050496 Bacteria 4192
1115 nmdc:mga07m45_3667_c1 3300050496 Bacteria 7421
1116 nmdc:mga07m45_37537_c1 3300050496 Bacteria 2702
1117 nmdc:mga07m45_6216_c1 3300050496 Bacteria 6028
1118 nmdc:mga08y16_94066_c1 3300050511 Bacteria 3122
1119 nmdc:mga0sz30_14199_c1 3300050516 Bacteria 3131
1120 Ga0500610_0029190 3300053079 Bacteria 2785
1121 Ga0500578_0000115 3300053086 Bacteria 95966
1122 Ga0500644_0007072 3300053088 Bacteria 2907
1123 Ga0500644_0011777 3300053088 Bacteria 2400
1124 Ga0500593_000286 3300053117 Bacteria 20561
1125 Ga0500593_013547 3300053117 Bacteria 3483
1126 Ga0500593_016746 3300053117 Bacteria 3178
1127 Ga0500618_010284 3300053125 Bacteria 2515
1128 Ga0500621_000005 3300053126 Bacteria 320383
1129 Ga0500628_014995 3300053129 Bacteria 1474
1130 Ga0500652_000329 3300053131 Bacteria 17029
1131 Ga0500652_000434 3300053131 Bacteria 14795
1132 Ga0500652_034037 3300053131 Bacteria 2017
1133 Ga0500658_0006032 3300053134 Bacteria 4504
1134 Ga0500559_0000017 3300053136 Bacteria 143646
1135 Ga0500568_0024978 3300053139 Bacteria 2525
1136 Ga0500590_024949 3300053148 Bacteria 3105
1137 Ga0500622_0000205 3300053156 Bacteria 62937
1138 Ga0500622_0001272 3300053156 Bacteria 20575
1139 Ga0500622_0002775 3300053156 Bacteria 12319
1140 Ga0500634_0025524 3300053161 Bacteria 3216
1141 Ga0501084_0045276 3300054114 Bacteria 3684
1142 Ga0590075_010397 3300059424 Bacteria 2240
1143 Ga0501082_0034504 3300060353 Bacteria 4361
1144 Ga0466962_0000311 3300061719 Bacteria 20821
1145 Ga0466962_0008657 3300061719 Bacteria 4879
1146 Ga0466962_0028734 3300061719 Bacteria 2663
1147 Ga0466962_0063885 3300061719 Bacteria 1758
1148 Ga0530510_0148123 3300061734 Bacteria 1732
1149 2501070268 2501025501 Bacteria 7768574
1150 2501080631 2501025502 Bacteria 9641094
1151 2501410654 2501025504 Bacteria 8008976
1152 2509131234 2508501125 Bacteria 7208311
1153 2510251397 2510065045 Bacteria 7761063
1154 2511086916 2510917013 Bacteria 9951648
1155 2511096884 2510917014 Bacteria 8296963
1156 2511103693 2510917015 Bacteria 7950052
1157 2511245904 2511231002 Bacteria 5042903
1158 2511247734 2511231003 Bacteria 5606035
1159 2511381713 2511231025 Bacteria 5324661
1160 2511432692 2511231035 Bacteria 5341610
1161 2512345666 2512047030 Bacteria 9031815
1162 2513553845 2513237082 Bacteria 8640282
1163 2513564792 2513237083 Bacteria 8410967
1164 2513961948 2513237151 Bacteria 6309801
1165 2514051839 2513237166 Bacteria 10373764
1166 2515680934 2515154122 Bacteria 8609520
1167 2515689924 2515154123 Bacteria 6387382
1168 2516019361 2515154189 Bacteria 9629850
1169 2519459077 2519103095 Bacteria 6629912
1170 2527075362 2526164713 Bacteria 6780608
1171 2538428412 2537561728 Bacteria 5149301
1172 2547697679 2547132181 Bacteria 4945084
1173 2555259993 2554235234 Bacteria 5762085
1174 2562463761 2561511199 Bacteria 5155034
1175 2563058723 2562617112 Bacteria 10918404
1176 2585291406 2582581311 Bacteria 6763856
1177 2585826825 2585427591 Bacteria 5482980
1178 2585831249 2585427592 Bacteria 5370892
1179 2587729186 2585428057 Bacteria 6737412
1180 2587734741 2585428058 Bacteria 6853932
1181 2588293529 2588253510 Bacteria 6901809
1182 2597028532 2596583598 Bacteria 5251611
1183 2599412626 2599185169 Bacteria 5441380
1184 2599444551 2599185178 Bacteria 5365746
1185 2599736679 2599185239 Bacteria 8686614
1186 2599744734 2599185240 Bacteria 7968121
1187 2600205905 2599185355 Bacteria 7968906
1188 2600809441 2600255067 Bacteria 6795583
1189 2601524142 2600255254 Bacteria 5281859
1190 2601529296 2600255255 Bacteria 5282785
1191 2601535337 2600255256 Bacteria 5597742
1192 2601539894 2600255257 Bacteria 5597196
1193 2601616130 2600255280 Bacteria 5292309
1194 2601620855 2600255281 Bacteria 5288753
1195 2601644197 2600255287 Bacteria 5210468
1196 2601649252 2600255288 Bacteria 5282738
1197 2601654179 2600255289 Bacteria 5281907
1198 2601659601 2600255290 Bacteria 5282218
1199 2601664022 2600255291 Bacteria 5217298
1200 2601696979 2600255298 Bacteria 5215185
1201 2601702028 2600255299 Bacteria 5218662
1202 2601706923 2600255300 Bacteria 5287774
1203 2601712126 2600255301 Bacteria 5280532
1204 2601717440 2600255302 Bacteria 5288235
1205 2601722292 2600255303 Bacteria 5219315
1206 2601727368 2600255304 Bacteria 5283973
1207 2601732567 2600255305 Bacteria 5282329
1208 2601736918 2600255306 Bacteria 5281613
1209 2601743129 2600255307 Bacteria 5439064
1210 2601753923 2600255309 Bacteria 5431045
1211 2601758518 2600255310 Bacteria 5600903
1212 2601764629 2600255311 Bacteria 5598766
1213 2602021017 2600255392 Bacteria 5437392
1214 2603636680 2602042046 Bacteria 5483348
1215 2603645526 2602042047 Bacteria 4697674
1216 2603662180 2602042052 Bacteria 5215873
1217 2603667079 2602042053 Bacteria 5214361
1218 2603699454 2602042066 Bacteria 4423871
1219 2603705503 2602042067 Bacteria 4863713
1220 2603839792 2602042103 Bacteria 5284714
1221 2603844866 2602042104 Bacteria 5281639
1222 2603850127 2602042105 Bacteria 5282303
1223 2603855009 2602042106 Bacteria 5282744
1224 2603867757 2602042109 Bacteria 5152801
1225 2603872585 2602042110 Bacteria 5283285
1226 2603877891 2602042111 Bacteria 5212080
1227 2606049954 2603880178 Bacteria 5283018
1228 2606071616 2603880184 Bacteria 5217896
1229 2606147453 2603880202 Bacteria 5284684
1230 2606177846 2603880211 Bacteria 5284226
1231 2609909482 2609459761 Bacteria 5513740
1232 2637223941 2636415599 Bacteria 5718434
1233 2643971622 2643221592 Bacteria 6608788
1234 2644141865 2643221625 Bacteria 6512927
1235 2644275799 2643221648 Bacteria 6521465
1236 2644305186 2643221654 Bacteria 5273570
1237 2644337905 2643221660 Bacteria 4208257
1238 2671105519 2667528172 Bacteria 5170840
1239 2671108340 2667528173 Bacteria 5375747
1240 2671588664 2671180115 Bacteria 5353919
1241 2676405369 2675903046 Bacteria 5451247
1242 2676742860 2675903129 Bacteria 7964495
1243 2681996087 2681812866 Bacteria 4552357
1244 2682006558 2681812869 Bacteria 5014465
1245 2707099893 2706794495 Bacteria 4536932
1246 2712472891 2711768156 Bacteria 4471618
1247 2713476628 2711768613 Bacteria 11048459
1248 2719640512 2718217991 Bacteria 7829542
1249 2738818427 2738541296 Bacteria 7285013
1250 2738831416 2738541298 Bacteria 7286732
1251 2738872944 2738541306 Bacteria 7284992
1252 2739184574 2738543002 Bacteria 7284546
1253 2739219543 2738543008 Bacteria 7282815
1254 2739612899 2739367655 Bacteria 4051151
1255 2746085787 2744054900 Bacteria 8399525
1256 2746096225 2744054901 Bacteria 8397047
1257 2753566564 2751185846 Bacteria 7242164
1258 2753857034 2751185917 Bacteria 4551186
1259 2765590137 2765235842 Bacteria 4799256
1260 2775541183 2775506706 Bacteria 4873073
1261 2777023257 2775507074 Bacteria 5532402
1262 2791922600 2791354903 Bacteria 4937680
1263 2792311868 2791355010 Bacteria 4864581
1264 2792835965 2791355137 Bacteria 9654227
1265 2793404650 2791355275 Bacteria 4429597
1266 2808972417 2808606384 Bacteria 8474373
1267 2809007246 2808606390 Bacteria 8476311
1268 2809014384 2808606391 Bacteria 8308166
1269 2813727689 2811995292 Bacteria 5303342
1270 2814695237 2814123068 Bacteria 5687681
1271 2817261365 2816332253 Bacteria 6764532
1272 2817279042 2816332256 Bacteria 6891714
1273 2817451234 2816332286 Bacteria 6853759
1274 2819622793 2818991450 Bacteria 6962147
1275 2819631163 2818991452 Bacteria 8442785
1276 2821121175 2821118458 Bacteria 4714306
1277 2823375790 2823373977 Bacteria 4779415
1278 2831869910 2831864461 Bacteria 6502356
1279 2834642752 2834641062 Bacteria 5559922
1280 2842327927 2842324504 Bacteria 9364110
1281 2842352244 2842348783 Bacteria 9002918
1282 2842458601 2842454564 Bacteria 8730687
1283 2844428479 2844425489 Bacteria 4854065
1284 2846037725 2846033681 Bacteria 4377894
1285 2846040515 2846037992 Bacteria 4526407
1286 2852107185 2852103415 Bacteria 5193810
1287 2854602728 2854601825 Bacteria 4797592
1288 2855197475 2855195626 Bacteria 4927512
1289 2856294320 2856287931 Bacteria 7223934
1290 2857367577 2857357740 Bacteria 9937880
1291 2858470025 2858466076 Bacteria 4722413
1292 2858699866 2858688981 Bacteria 8184122
1293 2863424735 2863421361 Bacteria 7300805
1294 2870070971 2870068957 Bacteria 8925310
1295 2871277250 2871272651 Bacteria 5042015
1296 2871286753 2871282230 Bacteria 4917173
1297 2876603114 2876601092 Bacteria 5114497
1298 2883092955 2883087390 Bacteria 9532701
1299 2884087720 2884086401 Bacteria 5005459
1300 2885267122 2885266251 Bacteria 4796748
1301 2885275448 2885270888 Bacteria 9831543
1302 2886854167 2886848708 Bacteria 5632523
1303 2891675377 2891670763 Bacteria 4967099
1304 2895514973 2895511927 Bacteria 6802080
1305 2900054163 2900051742 Bacteria 4985156
1306 2900055829 2900051742 Bacteria 4985156
1307 2900578692 2900577576 Bacteria 5438534
1308 2900634369 2900634093 Bacteria 10263517
1309 2902683610 2902682994 Bacteria 8951596
1310 2904474988 2904474040 Bacteria 5504324
1311 2904484680 2904483920 Bacteria 7545285
1312 2904506606 2904504865 Bacteria 5152820
1313 2904517810 2904513164 Bacteria 5476410
1314 2904571543 2904564687 Bacteria 7609577
1315 2904575986 2904571731 Bacteria 7608790
1316 2904624098 2904615490 Bacteria 10047340
1317 2919111109 2919108558 Bacteria 5897419
1318 2919151334 2919150387 Bacteria 5500879
1319 2919531358 2919527303 Bacteria 7718827
1320 2921649579 2921643360 Bacteria 11448031
1321 2923636032 2923634449 Bacteria 4753480
1322 2927146208 2927143783 Bacteria 5504251
1323 2927837476 2927833300 Bacteria 4923934
1324 2928062548 2928058823 Bacteria 5520022
1325 2928113319 2928108538 Bacteria 7360024
1326 2928140478 2928135762 Bacteria 7259641
1327 2928162995 2928157003 Bacteria 7522202
1328 2928169657 2928163908 Bacteria 7561269
1329 2928171719 2928170801 Bacteria 8785406
1330 2928507439 2928503688 Bacteria 7268108
1331 2928539875 2928536128 Bacteria 7657547
1332 2932409300 2932406140 Bacteria 5134491
1333 2935625562 2935625433 Bacteria 5042964
1334 2937542309 2937539931 Bacteria 4639830
1335 2939570149 2939568625 Bacteria 4542555
1336 2939575522 2939573065 Bacteria 4926053
1337 2939580754 2939577877 Bacteria 5132791
1338 2939604405 2939602548 Bacteria 4950493
1339 2939608552 2939607340 Bacteria 4719256
1340 2939618688 2939617950 Bacteria 4820956
1341 2939642808 2939642701 Bacteria 4475280
1342 2945876672 2945874760 Bacteria 5527237
1343 2945911684 2945909444 Bacteria 7065066
1344 2945937138 2945934425 Bacteria 7444609
1345 2945986020 2945984333 Bacteria 7358892
1346 2969080955 2969079654 Bacteria 5439582
1347 2971822357 2971820967 Bacteria 5823634
1348 2974310974 2974310843 Bacteria 4947816
1349 2974439498 2974435778 Bacteria 4876478
1350 2981994810 2981990288 Bacteria 7590678
1351 2984563422 2984559226 Bacteria 5683096
1352 2984596157 2984595703 Bacteria 5682994
1353 2990706127 2990703756 Bacteria 7715990
1354 3000378224 3000376612 Bacteria 4705565
1355 642427333 641736151 Bacteria 7477263
1356 642420215 641736154 Bacteria 7689995
1357 642593128 642555112 Bacteria 8676562
1358 642622023 642555113 Bacteria 8214658
1359 8002393928 8002392321 Bacteria 4159911
1360 8003961198 8003955200 Bacteria 8601927
1361 8016734911 8016733728 Bacteria 5274317
1362 8018222497 8018221730 Bacteria 4616064
1363 8018409124 8018405270 Bacteria 4978981
1364 8018851359 8018845410 Bacteria 8933938
1365 8019501603 8019499862 Bacteria 5169538
1366 8019504974 8019504834 Bacteria 4819156
1367 8020810209 8020807995 Bacteria 6801506
1368 8020945013 8020938398 Bacteria 7472757
1369 8020951407 8020945358 Bacteria 8467355
1370 8020956950 8020953355 Bacteria 7439080
1371 8021122196 8021120328 Bacteria 8782274
1372 8039102559 8039098773 Bacteria 6602928
1373 8040168786 8040167225 Bacteria 6542727
1374 8040174712 8040173305 Bacteria 6827067
1375 8054846772 8054844752 Bacteria 4450330
1376 8054852116 8054849141 Bacteria 5232694
1377 8055089933 8055087960 Bacteria 4784273
1378 8055095635 8055092621 Bacteria 4873875
1379 8055100325 8055097453 Bacteria 4865496
1380 8055267640 8055266321 Bacteria 7999742
1381 8055302203 8055301274 Bacteria 8587385
1382 8055697012 8055693939 Bacteria 4772047
1383 8057306648 8057304971 Bacteria 4649742
1384 Ga0495599_0040071
1385 SwRhRL2b_contig_704441
1386 JGI24741J21665_1002292
1387 JGI24740J21852_10000707
1388 JGI24740J21852_10001478
1389 JGI24739J22299_10009567
1390 JGI24739J22299_10019743
1391 JGI24735J21928_10000304
1392 JGI24735J21928_10000392
1393 JGI24735J21928_10000462
1394 JGI24735J21928_10003854
1395 JGI24735J21928_10028720
1396 JGI25155J39150_1000002
1397 JGI25156J39149_1000003
1398 JGI25156J39149_1000913
1399 JGI25156J39149_1001040
1400 JGI25156J39149_1001634
1401 JGI25156J39149_1010984
1402 JGI25154J39366_1000009
1403 JGI25154J39366_1000362
1404 JGI25157J39369_1000002
1405 JGI25163J39215_1000065
1406 JGI25164J39214_1000014
1407 JGI25152J39213_1006266
1408 JGI25150J39212_1003024
1409 JGI25159J45721_1000296
1410 JGI25159J45721_1003417
1411 JGI25151J46595_10011762
1412 JGI25151J46595_10013678
1413 JGI25151J46595_10032951
1414 JGI25165J46597_1002348
1415 JGI25153J46596_10000871
1416 JGI25153J46596_10003388
1417 rootL2_10011738
1418 rootL2_10113845
1419 JGI25160J50197_1000102
1420 JGI25160J50197_1000123
1421 JGI25161J50226_1000032
1422 Ga0055538_1000005
1423 Ga0055538_1001322
1424 Ga0055539_1000007
1425 Ga0055539_1000100
1426 Ga0055533_1000009
1427 Ga0055533_1000235
1428 Ga0055533_1001261
1429 Ga0055532_1000001
1430 Ga0055532_1000127
1431 Ga0055532_1000944
1432 Ga0055525_1000010
1433 Ga0055525_1000444
1434 Ga0055525_1000505
1435 Ga0055527_1000002
1436 Ga0055535_1000001
1437 Ga0055535_1000140
1438 Ga0055542_1000001
1439 Ga0055542_1001376
1440 Ga0055529_1000026
1441 Ga0055529_1000230
1442 Ga0055529_1001316
1443 Ga0055526_1001657
1444 Ga0055526_1022565
1445 Ga0055537_1000079
1446 Ga0055537_1006004
1447 Ga0055524_1000012
1448 Ga0055524_1001692
1449 Ga0055536_1000380
1450 Ga0055534_1000670
1451 Ga0055534_1001102
1452 Ga0055534_1001506
1453 Ga0055534_1002359
1454 Ga0055534_1005936
1455 Ga0055528_1000563
1456 Ga0055528_1003000
1457 Ga0055530_10000218
1458 Ga0055540_1000012
1459 Ga0055541_1000005
1460 Ga0055541_1003952
1461 Ga0058692_1000303
1462 Ga0058692_1000379
1463 Ga0058692_1007200
1464 Ga0055543_1000405
1465 Ga0055543_1004541
1466 Ga0065165_1000848
1467 Ga0065165_1000995
1468 Ga0065165_1001389
1469 Ga0065165_1002021
1470 Ga0065165_1009528
1471 Ga0065165_1023112
1472 Ga0065165_1024685
1473 Ga0065165_1041329
1474 Ga0065704_10000399
1475 Ga0065704_10001052
1476 Ga0065704_10001579
1477 Ga0065704_10076648
1478 Ga0065704_10083775
1479 Ga0065707_10124464
1480 Ga0070658_10003021
1481 Ga0070658_10003785
1482 Ga0070677_10020938
1483 Ga0068869_100047431
1484 Ga0070666_10026070
1485 Ga0070682_100069419
1486 Ga0068868_100051963
1487 Ga0070660_100000046
1488 Ga0070660_100010130
1489 Ga0070661_100000057
1490 Ga0070661_100113362
1491 Ga0070669_100009144
1492 Ga0070669_100012088
1493 Ga0070669_100014256
1494 Ga0070669_100017532
1495 Ga0070675_100001690
1496 Ga0070675_100094704
1497 Ga0070671_100005306
1498 Ga0070671_100025777
1499 Ga0070671_100036625
1500 Ga0070671_100150550
1501 Ga0070671_100203348
1502 Ga0070674_100164252
1503 Ga0070673_100002697
1504 Ga0070673_100005484
1505 Ga0070659_100000510
1506 Ga0070659_100020442
1507 Ga0070659_100030772
1508 Ga0070667_100000372
1509 Ga0070700_100001032
1510 Ga0070700_100006423
1511 Ga0070663_100000105
1512 Ga0070663_100002402
1513 Ga0070663_100005278
1514 Ga0070663_100156409
1515 Ga0070678_100053616
1516 Ga0070662_100001379
1517 Ga0070662_100020685
1518 Ga0068867_100003272
1519 Ga0068867_100003992
1520 Ga0068867_100006509
1521 Ga0068867_100090294
1522 Ga0068867_100163460
1523 Ga0068853_100025283
1524 Ga0070672_100000338
1525 Ga0070672_100001803
1526 Ga0070672_100122201
1527 Ga0070672_100292362
1528 Ga0070665_100000255
1529 Ga0070665_100026204
1530 Ga0068855_100003042
1531 Ga0068855_100007312
1532 Ga0068855_100039740
1533 Ga0070664_100000008
1534 Ga0070664_100072980
1535 Ga0070664_100204982
1536 Ga0068857_100135934
1537 Ga0068857_100187637
1538 Ga0068854_100000072
1539 Ga0068856_100000009
1540 Ga0068856_100031125
1541 Ga0068852_100289532
1542 Ga0068864_100021723
1543 Ga0068864_100155989
1544 Ga0068861_100008083
1545 Ga0068851_10028395
1546 Ga0068870_10083323
1547 Ga0068863_100059509
1548 Ga0068858_100308478
1549 Ga0068860_100207568
1550 Ga0068862_100021669
1551 Ga0068862_100064649
1552 Ga0075368_10003139
1553 Ga0075363_100006667
1554 Ga0075363_100130373
1555 Ga0075364_10020463
1556 Ga0075364_10050921
1557 Ga0075364_10082628
1558 Ga0075362_10022906
1559 Ga0075367_10007819
1560 Ga0075366_10000464
1561 Ga0075366_10001059
1562 Ga0075366_10008134
1563 Ga0075366_10010331
1564 Ga0075366_10018201
1565 Ga0075366_10097725
1566 Ga0097621_100020144
1567 Ga0097621_100040483
1568 Ga0075370_10017106
1569 Ga0075370_10023309
1570 Ga0075370_10077002
1571 Ga0075370_10133028
1572 Ga0068871_100003474
1573 Ga0068871_100079338
1574 Ga0079104_1000075
1575 Ga0079104_1000111
1576 Ga0079104_1000258
1577 Ga0079104_1000667
1578 Ga0079104_1000959
1579 Ga0079104_1001574
1580 Ga0079104_1002049
1581 Ga0079104_1002639
1582 Ga0099826_10000012
1583 Ga0105251_10000738
1584 Ga0105251_10001354
1585 Ga0105251_10001810
1586 Ga0105251_10003968
1587 Ga0105251_10004288
1588 Ga0105251_10005117
1589 Ga0105251_10018972
1590 Ga0105251_10041499
1591 Ga0105244_10000090
1592 Ga0105244_10000144
1593 Ga0105244_10000149
1594 Ga0105244_10000679
1595 Ga0105244_10002219
1596 Ga0105244_10003061
1597 Ga0105244_10005707
1598 Ga0105244_10007965
1599 Ga0105244_10008326
1600 Ga0105244_10030222
1601 Ga0105244_10047079
1602 Ga0105250_10000011
1603 Ga0105250_10000105
1604 Ga0105250_10000285
1605 Ga0105250_10001428
1606 Ga0105250_10019937
1607 Ga0105250_10023443
1608 Ga0105240_10002341
1609 Ga0105240_10054612
1610 Ga0105240_10212526
1611 Ga0105240_10265739
1612 Ga0105240_10284978
1613 Ga0111539_10110214
1614 Ga0111539_10333289
1615 Ga0105245_10062771
1616 Ga0105245_10073785
1617 Ga0105243_10005488
1618 Ga0105243_10027102
1619 Ga0105241_10067401
1620 Ga0105248_10007653
1621 Ga0105248_10026509
1622 Ga0105237_10018302
1623 Ga0105237_10039588
1624 Ga0105237_10173035
1625 Ga0105238_10001497
1626 Ga0105238_10010153
1627 Ga0105239_10022568
1628 Ga0105239_10068680
1629 Ga0105246_10050782
1630 Ga0157326_1000943
1631 Ga0157373_10000788
1632 Ga0157373_10009043
1633 Ga0157373_10073707
1634 Ga0157371_10000007
1635 Ga0157371_10000068
1636 Ga0157371_10000780
1637 Ga0157371_10002606
1638 Ga0157371_10013847
1639 Ga0157371_10079796
1640 Ga0157370_10000200
1641 Ga0157370_10001346
1642 Ga0157370_10003399
1643 Ga0157370_10004165
1644 Ga0157370_10094701
1645 Ga0157369_10000511
1646 Ga0157369_10000806
1647 Ga0157369_10000979
1648 Ga0157369_10005782
1649 Ga0157369_10009691
1650 Ga0157369_10022155
1651 Ga0157369_10047494
1652 Ga0157369_10419267
1653 Ga0157374_10000107
1654 Ga0157374_10052257
1655 Ga0157374_10167192
1656 Ga0163162_10008076
1657 Ga0163162_10012861
1658 Ga0163162_10051090
1659 Ga0157372_10000142
1660 Ga0157372_10001253
1661 Ga0157372_10004539
1662 Ga0157372_10012280
1663 Ga0157372_10114919
1664 Ga0157372_10144570
1665 Ga0157372_10176345
1666 Ga0157372_10193418
1667 Ga0157375_10037300
1668 Ga0157375_10617514
1669 Ga0157380_10010968
1670 Ga0157380_10038519
1671 Ga0157377_10006681
1672 Ga0157377_10145171
1673 Ga0157379_10083111
1674 Ga0157376_10006346
1675 Ga0157376_10211793
1676 Ga0182006_1000024
1677 Ga0182006_1031181
1678 Ga0182007_10000581
1679 Ga0182007_10010832
1680 Ga0183366_1001
1681 Ga0183370_1001
1682 Ga0183369_1001
1683 Ga0183368_1001
1684 Ga0183361_10006
1685 Ga0163161_10020133
1686 Ga0163161_10097655
1687 Ga0163161_10206594
1688 Ga0206351_10197686
1689 Ga0154015_1570145
1690 Ga0213872_10000090
1691 Ga0213872_10001577
1692 Ga0213876_10000079
1693 Ga0213875_10001769
1694 Ga0224712_10001924
1695 Ga0209435_100001
1696 Ga0209435_104850
1697 Ga0209760_100092
1698 Ga0209784_100001
1699 Ga0209784_100003
1700 Ga0209784_100815
1701 Ga0209784_101192
1702 Ga0209566_100001
1703 Ga0209566_100002
1704 Ga0209566_100421
1705 Ga0209566_100504
1706 Ga0209566_102138
1707 Ga0209674_100002
1708 Ga0209674_100005
1709 Ga0209674_100008
1710 Ga0209674_100161
1711 Ga0209674_100267
1712 Ga0209674_101381
1713 Ga0209672_100001
1714 Ga0209672_100014
1715 Ga0209672_100023
1716 Ga0209672_100530
1717 Ga0209672_100934
1718 Ga0209672_100935
1719 Ga0209147_100001
1720 Ga0209147_100002
1721 Ga0209147_100094
1722 Ga0209147_100104
1723 Ga0209147_101244
1724 Ga0209563_100004
1725 Ga0209563_100008
1726 Ga0209563_100468
1727 Ga0207427_100002
1728 Ga0207427_102517
1729 Ga0209437_100007
1730 Ga0209258_100001
1731 Ga0209258_100002
1732 Ga0209258_100040
1733 Ga0209258_100142
1734 Ga0209646_1000001
1735 Ga0209646_1000059
1736 Ga0209026_1000003
1737 Ga0209677_100004
1738 Ga0209677_100009
1739 Ga0209148_1000003
1740 Ga0209148_1000021
1741 Ga0209148_1000035
1742 Ga0209759_1000001
1743 Ga0209759_1000029
1744 Ga0209759_1000030
1745 Ga0209759_1000260
1746 Ga0209759_1001844
1747 Ga0209759_1003073
1748 Ga0209759_1012730
1749 Ga0209759_1020056
1750 Ga0209129_1000104
1751 Ga0209129_1000200
1752 Ga0209129_1005824
1753 Ga0209233_1000016
1754 Ga0209233_1001979
1755 Ga0209565_1000004
1756 Ga0209565_1000021
1757 Ga0209565_1011180
1758 Ga0209455_1000001
1759 Ga0209455_1000021
1760 Ga0209455_1000072
1761 Ga0209673_1000140
1762 Ga0209130_1000082
1763 Ga0209130_1000094
1764 Ga0209130_1007922
1765 Ga0209675_1000061
1766 Ga0209675_1000149
1767 Ga0209675_1001200
1768 Ga0209675_1002449
1769 Ga0209676_1000014
1770 Ga0209676_1000029
1771 Ga0209676_1007000
1772 Ga0209676_1008263
1773 Ga0209025_1000522
1774 Ga0209025_1001239
1775 Ga0209025_1001542
1776 Ga0209025_1005993
1777 Ga0209025_1009504
1778 Ga0209025_1024163
1779 Ga0209564_1000003
1780 Ga0209564_1000046
1781 Ga0209564_1000455
1782 Ga0209564_1000979
1783 Ga0209564_1001045
1784 Ga0209564_1001145
1785 Ga0209564_1002205
1786 Ga0209564_1024894
1787 Ga0209758_1000096
1788 Ga0209758_1000285
1789 Ga0209758_1011374
1790 Ga0209758_1015813
1791 Ga0209050_1000003
1792 Ga0209050_1003867
1793 Ga0209050_1032394
1794 Ga0209256_1000001
1795 Ga0209256_1000280
1796 Ga0209256_1000625
1797 Ga0207426_1000071
1798 Ga0207426_1000125
1799 Ga0207426_1005035
1800 Ga0209051_1000003
1801 Ga0209257_1000018
1802 Ga0209257_1005482
1803 Ga0209257_1008179
1804 Ga0207697_10018314
1805 Ga0207656_10014406
1806 Ga0207696_1000026
1807 Ga0207696_1000035
1808 Ga0207696_1000131
1809 Ga0207696_1000166
1810 Ga0207696_1001091
1811 Ga0207696_1001841
1812 Ga0207696_1006550
1813 Ga0207696_1008073
1814 Ga0207696_1020296
1815 Ga0207655_1000002
1816 Ga0207655_1000004
1817 Ga0207655_1000007
1818 Ga0207655_1000029
1819 Ga0207655_1000062
1820 Ga0207655_1000303
1821 Ga0207655_1000621
1822 Ga0207655_1000831
1823 Ga0207655_1008564
1824 Ga0207655_1010391
1825 Ga0207655_1026057
1826 Ga0207655_1035782
1827 Ga0207713_1000052
1828 Ga0207713_1000069
1829 Ga0207713_1000084
1830 Ga0207713_1000443
1831 Ga0207713_1000864
1832 Ga0207713_1002028
1833 Ga0207713_1009216
1834 Ga0207682_10000222
1835 Ga0207682_10073981
1836 Ga0207688_10079126
1837 Ga0207680_10126860
1838 Ga0207647_10000498
1839 Ga0207647_10000605
1840 Ga0207647_10025613
1841 Ga0207645_10000759
1842 Ga0207645_10035427
1843 Ga0207645_10087465
1844 Ga0207643_10056938
1845 Ga0207643_10059306
1846 Ga0207705_10004376
1847 Ga0207705_10033405
1848 Ga0207695_10000729
1849 Ga0207695_10024266
1850 Ga0207671_10042198
1851 Ga0207671_10052362
1852 Ga0207662_10105412
1853 Ga0207657_10000004
1854 Ga0207657_10004856
1855 Ga0207657_10042471
1856 Ga0207649_10000138
1857 Ga0207649_10031701
1858 Ga0207681_10001252
1859 Ga0207681_10006080
1860 Ga0207681_10021178
1861 Ga0207650_10057624
1862 Ga0207659_10001462
1863 Ga0207659_10010366
1864 Ga0207659_10043760
1865 Ga0207687_10105337
1866 Ga0207644_10034065
1867 Ga0207690_10000102
1868 Ga0207690_10001152
1869 Ga0207706_10001019
1870 Ga0207706_10032233
1871 Ga0207709_10008663
1872 Ga0207709_10021947
1873 Ga0207669_10037250
1874 Ga0207669_10137037
1875 Ga0207704_10005743
1876 Ga0207691_10001693
1877 Ga0207691_10009952
1878 Ga0207691_10039764
1879 Ga0207691_10051960
1880 Ga0207691_10287108
1881 Ga0207689_10000267
1882 Ga0207689_10054721
1883 Ga0207661_10182666
1884 Ga0207679_10000001
1885 Ga0207679_10116150
1886 Ga0207667_10001214
1887 Ga0207667_10002775
1888 Ga0207667_10011537
1889 Ga0207667_10099085
1890 Ga0207651_10012381
1891 Ga0207651_10127341
1892 Ga0207712_10109232
1893 Ga0207640_10000088
1894 Ga0207658_10001495
1895 Ga0207658_10027495
1896 Ga0207677_10030713
1897 Ga0207677_10219457
1898 Ga0207639_10047798
1899 Ga0207678_10000001
1900 Ga0207678_10000738
1901 Ga0207678_10002867
1902 Ga0207678_10126758
1903 Ga0207708_10002428
1904 Ga0207708_10031194
1905 Ga0207708_10198009
1906 Ga0207702_10000024
1907 Ga0207648_10004977
1908 Ga0207648_10012028
1909 Ga0207648_10024696
1910 Ga0207648_10194466
1911 Ga0207648_10210298
1912 Ga0207648_10286475
1913 Ga0207674_10000214
1914 Ga0207674_10016539
1915 Ga0207674_10090360
1916 Ga0207675_100000232
1917 Ga0207675_100006634
1918 Ga0207675_100100637
1919 Ga0207675_100221991
1920 Ga0207683_10065916
1921 Ga0207683_10082750
1922 Ga0207698_10005724
1923 Ga0207698_10028347
1924 Ga0207698_10084969
1925 Ga0209281_1000004
1926 Ga0209281_1000014
1927 Ga0209281_1000079
1928 Ga0209281_1000142
1929 Ga0209281_1000171
1930 Ga0209281_1000698
1931 Ga0209281_1000739
1932 Ga0209281_1000906
1933 Ga0209281_1001184
1934 Ga0209281_1001659
1935 Ga0209371_1000001
1936 Ga0209371_1000015
1937 Ga0209371_1000079
1938 Ga0209371_1000084
1939 Ga0209371_1000190
1940 Ga0209371_1000279
1941 Ga0209371_1000407
1942 Ga0209371_1000659
1943 Ga0209371_1000855
1944 Ga0209371_1001264
1945 Ga0209371_1001382
1946 Ga0209371_1001386
1947 Ga0209371_1005670
1948 Ga0209371_1006594
1949 Ga0209371_1019801
1950 Ga0209282_1000028
1951 Ga0209966_1000004
1952 Ga0209998_10010904
1953 Ga0209974_10001532
1954 Ga0207428_10075761
1955 Ga0207428_10179220
1956 Ga0268266_10000933
1957 Ga0268266_10120795
1958 Ga0268265_10004824
1959 Ga0268264_10021745
1960 Ga0268264_10149949
1961 Ga0268264_10381187
1962 Ga0307517_10003248
1963 Ga0307515_10000041
1964 Ga0307515_10025544
1965 Ga0307515_10048148
1966 Ga0307515_10088677
1967 Ga0307515_10265181
1968 Ga0265338_10000028
1969 Ga0265338_10000741
1970 Ga0265324_10048243
1971 Ga0268256_1000001
1972 Ga0268256_1000018
1973 Ga0268256_1000069
1974 Ga0268256_1000075
1975 Ga0268256_1000090
1976 Ga0268256_1000183
1977 Ga0268256_1000531
1978 Ga0268256_1001062
1979 Ga0268256_1001260
1980 Ga0268256_1001426
1981 Ga0268256_1005102
1982 Ga0268256_1008862
1983 Ga0268256_1012380
1984 Ga0268256_1015612
1985 Ga0307512_10097523
1986 Ga0265332_10007434
1987 Ga0265328_10000121
1988 Ga0265331_10000055
1989 Ga0265331_10087229
1990 Ga0265327_10000045
1991 Ga0265327_10003428
1992 Ga0265327_10019994
1993 Ga0307513_10018375
1994 Ga0307513_10156513
1995 Ga0307513_10221232
1996 Ga0307509_10000092
1997 Ga0307509_10002037
1998 Ga0307509_10014105
1999 Ga0307509_10053226
2000 Ga0307408_100004785
2001 Ga0307408_100005566
2002 Ga0307408_100042193
2003 Ga0307408_100138087
2004 Ga0307508_10000594
2005 Ga0307508_10007413
2006 Ga0307508_10098622
2007 Ga0307514_10098011
2008 Ga0307514_10115888
2009 Ga0316575_10025677
2010 Ga0307405_10049022
2011 Ga0307413_10016262
2012 Ga0307413_10062062
2013 Ga0307412_10000021
2014 Ga0307412_10121659
2015 Ga0307409_100012184
2016 Ga0307416_100014376
2017 Ga0307411_10055503
2018 Ga0307415_100180022
2019 Ga0307507_10053322
2020 Ga0307510_10012482
2021 Ga0307510_10045807
2022 Ga0307510_10090271
2023 Ga0373931_0001546
2024 Ga0395899_0000007
2025 Ga0395899_0057002
2026 Ga0395899_0061163
2027 Ga0395899_0076329
2028 Ga0395900_0000026
2029 Ga0395900_0001159
2030 Ga0395900_0031653
2031 Ga0395900_0069818
2032 Ga0395900_0182491
2033 Ga0395898_0000497
2034 Ga0395898_0000784
2035 Ga0395898_0124764
2036 Ga0395905_0000459
2037 Ga0395905_0003226
2038 Ga0395905_0039423
2039 Ga0395905_0069175
2040 Ga0395905_0208172
2041 Ga0436364_1329714
2042 Ga0395901_0000077
2043 Ga0395901_0000296
2044 Ga0395901_0003986
2045 Ga0436365_0181312
2046 Ga0436365_0380661
2047 Ga0436365_1091962
2048 Ga0436365_1914962
2049 Ga0436361_0624331
2050 Ga0436361_0692684
2051 Ga0436361_0734074
2052 Ga0439438_001562
2053 Ga0439438_002218
2054 Ga0439447_003440
2055 Ga0451789_1242607
2056 Ga0451853_3442227
2057 Ga0439448_0000988
2058 Ga0439452_000002
2059 Ga0439452_000036
2060 Ga0439452_000089
2061 Ga0439452_000235
2062 Ga0439452_000816
2063 Ga0450900_006298
2064 Ga0439435_0003906
2065 Ga0439464_0003592
2066 Ga0439464_0019621
2067 Ga0451577_0010348
2068 Ga0451577_0069143
2069 Ga0466969_0007486
2070 Ga0466969_0033304
2071 Ga0466972_0036679
2072 Ga0466972_0037298
2073 Ga0466972_0052572
2074 Ga0466981_0000019
2075 Ga0453683_0143402
2076 Ga0466965_0018895
2077 Ga0466965_0048207
2078 Ga0466966_0000084
2079 Ga0466966_0000362
2080 Ga0466966_0004483
2081 Ga0466966_0005728
2082 Ga0466961_0000427
2083 Ga0466961_0000544
2084 Ga0466961_0001445
2085 Ga0466961_0023009
2086 Ga0466961_0035146
2087 Ga0466963_0005199
2088 Ga0466963_0026351
2089 Ga0466964_0002299
2090 Ga0466964_0036045
2091 Ga0453684_0001126
2092 Ga0453684_0003805
2093 Ga0453684_0320019
2094 Ga0466971_0002907
2095 Ga0466971_0083903
2096 Ga0466970_0012108
2097 Ga0466957_0009283
2098 Ga0466957_0037239
2099 Ga0466959_0006868
2100 Ga0466959_0007452
2101 Ga0466959_0013229
2102 Ga0451576_0001379
2103 Ga0451576_0015852
2104 Ga0451576_0056029
2105 Ga0451576_0324705
2106 Ga0466958_0001681
2107 Ga0466958_0005145
2108 Ga0466958_0014545
2109 Ga0466958_0107075
2110 Ga0495592_0000413
2111 Ga0495592_0010535
2112 Ga0495603_0006170
2113 Ga0495590_0005435
2114 Ga0495591_000001
2115 Ga0495591_000066
2116 Ga0495591_006822
2117 Ga0495591_008803
2118 Ga0495629_0000172
2119 Ga0495629_0000506
2120 Ga0495629_0002744
2121 Ga0495629_0057883
2122 Ga0495629_0100044
2123 Ga0495638_0000724
2124 Ga0495638_0015989
2125 Ga0495638_0157399
2126 Ga0495651_0017252
2127 Ga0495653_0019400
2128 Ga0495653_0019791
2129 Ga0495653_0022992
2130 Ga0495653_0030155
2131 Ga0495653_0043631
2132 Ga0495653_0073444
2133 Ga0495650_0000016
2134 Ga0495650_0000282
2135 Ga0495650_0006200
2136 Ga0495650_0007870
2137 Ga0495650_0011447
2138 Ga0495650_0042066
2139 Ga0495580_0002910
2140 Ga0495580_0006463
2141 Ga0495580_0018014
2142 Ga0495580_0059891
2143 Ga0495580_0093406
2144 Ga0495582_0001714
2145 Ga0495582_0115445
2146 Ga0495582_0132145
2147 Ga0495605_0002724
2148 Ga0495605_0003771
2149 Ga0495605_0011246
2150 Ga0495605_0037059
2151 Ga0495605_0064509
2152 Ga0495664_0001580
2153 Ga0495664_0021769
2154 Ga0495664_0047901
2155 Ga0495664_0049736
2156 Ga0495594_0032831
2157 Ga0495596_0000464
2158 Ga0495596_0012405
2159 Ga0495596_0013080
2160 Ga0495596_0033012
2161 Ga0495607_0036436
2162 Ga0495583_0009682
2163 Ga0495583_0012014
2164 Ga0495606_0000318
2165 Ga0495606_0003649
2166 Ga0495606_0005502
2167 Ga0495606_0006216
2168 Ga0495606_0025325
2169 Ga0495608_0000972
2170 Ga0495608_0006938
2171 Ga0495610_0001926
2172 Ga0495610_0001938
2173 Ga0495616_0003931
2174 Ga0495616_0038228
2175 Ga0495618_0003662
2176 Ga0495618_0012834
2177 Ga0495618_0043358
2178 Ga0495620_0005352
2179 Ga0495620_0008055
2180 Ga0495628_0012653
2181 Ga0495628_0063088
2182 Ga0495630_0032279
2183 Ga0495630_0066106
2184 Ga0495631_0019888
2185 Ga0495637_0003212
2186 Ga0495643_0027330
2187 Ga0495644_0008789
2188 Ga0495648_0084740
2189 Ga0495648_0086599
2190 Ga0495666_0001321
2191 Ga0495666_0004894
2192 Ga0495642_0019634
2193 Ga0495642_0065478
2194 Ga0495652_0023493
2195 Ga0495652_0043262
2196 Ga0495652_0063919
2197 Ga0495652_0068546
2198 Ga0495652_0115701
2199 Ga0495654_0000033
2200 Ga0495654_0000055
2201 Ga0495654_0003551
2202 Ga0495654_0008618
2203 Ga0495654_0035205
2204 Ga0495654_0135188
2205 Ga0495665_0003857
2206 Ga0495665_0018084
2207 Ga0495665_0046983
2208 Ga0495665_0057008
2209 Ga0495665_0124720
2210 Ga0495640_0069191
2211 Ga0495586_0004311
2212 Ga0495586_0065834
2213 Ga0495587_0019557
2214 Ga0495609_0001831
2215 Ga0495621_0045583
2216 Ga0495597_0000112
2217 Ga0495597_0000354
2218 Ga0495597_0003154
2219 Ga0495645_0000357
2220 Ga0495645_0009233
2221 Ga0495622_0000551
2222 Ga0495622_0010729
2223 Ga0495622_0036110
2224 Ga0495667_0125064
2225 Ga0495668_0020606
2226 Ga0495668_0022906
2227 Ga0495668_0067009
2228 Ga0495634_0029934
2229 Ga0495634_0055984
2230 Ga0495625_0017124
2231 Ga0495625_0041262
2232 Ga0495625_0044735
2233 Ga0495635_0005954
2234 Ga0495635_0030228
2235 Ga0495661_0008523
2236 Ga0495661_0054035
2237 Ga0495661_0093070
2238 Ga0495588_0004132
2239 Ga0495588_0013181
2240 Ga0495588_0018457
2241 Ga0495623_0008552
2242 Ga0495623_0010914
2243 Ga0495646_0025935
2244 Ga0495646_0037729
2245 Ga0495646_0054746
2246 Ga0495646_0057937
2247 Ga0495669_0026341
2248 Ga0495613_0003580
2249 Ga0495613_0013703
2250 Ga0495613_0070594
2251 Ga0495624_0013999
2252 Ga0495624_0031318
2253 Ga0495624_0054625
2254 Ga0495670_0026371
2255 Ga0495671_0007138
2256 Ga0495671_0017632
2257 Ga0495649_0006065
2258 Ga0495649_0006663
2259 Ga0495649_0028670
2260 Ga0495589_0004533
2261 Ga0495589_0011136
2262 Ga0495589_0012497
2263 Ga0495589_0013954
2264 Ga0495600_0003827
2265 Ga0495660_0000007
2266 Ga0495660_0000017
2267 Ga0495660_0047842
2268 Ga0495660_0078528
2269 Ga0495581_0005000
2270 Ga0495581_0017429
2271 Ga0495581_0022055
2272 Ga0495581_0026657
2273 Ga0495581_0032019
2274 Ga0495581_0059180
2275 Ga0495581_0087182
2276 Ga0495604_0038131
2277 Ga0495604_0051054
2278 Ga0495604_0067973
2279 Ga0495636_0033949
2280 Ga0495636_0056849
2281 Ga0495674_0003612
2282 Ga0495674_0008069
2283 Ga0495674_0048438
2284 Ga0495674_0050490
2285 Ga0495674_0092897
2286 Ga0495674_0165473
2287 Ga0495674_0181119
2288 Ga0495672_0000001
2289 Ga0495672_0000009
2290 Ga0495672_0003268
2291 Ga0495676_0022958
2292 Ga0495676_0052435
2293 Ga0495680_0018438
2294 Ga0495680_0024575
2295 Ga0495680_0027463
2296 Ga0495680_0101575
2297 Ga0495683_0007379
2298 Ga0495683_0025313
2299 Ga0495683_0026851
2300 Ga0495683_0073432
2301 Ga0495687_000015
2302 Ga0495687_000421
2303 Ga0495687_008170
2304 Ga0495687_011651
2305 Ga0495687_034108
2306 Ga0495687_039183
2307 Ga0495687_065240
2308 Ga0495675_0019316
2309 Ga0495675_0023932
2310 Ga0495679_000032
2311 Ga0495679_000214
2312 Ga0495679_002722
2313 Ga0495679_011957
2314 Ga0495685_017388
2315 Ga0495673_0000019
2316 Ga0495673_0000071
2317 Ga0495673_0022497
2318 Ga0495673_0055471
2319 Ga0495686_0000002
2320 Ga0495593_0040336
2321 Ga0495602_0016898
2322 Ga0495602_0032598
2323 Ga0495602_0059754
2324 Ga0495614_0011687
2325 Ga0495626_0004577
2326 Ga0496100_0002406
2327 Ga0496100_0030684
2328 Ga0496100_0077293
2329 Ga0496101_0001779
2330 Ga0496101_0001970
2331 Ga0496101_0003292
2332 Ga0496102_0001049
2333 Ga0496102_0005053
2334 Ga0496102_0018370
2335 Ga0496102_0056284
2336 Ga0496102_0155584
2337 Ga0496103_0002203
2338 Ga0496103_0003261
2339 Ga0496104_0000901
2340 Ga0496104_0045619
2341 Ga0496104_0120206
2342 Ga0496105_0005680
2343 Ga0496105_0019626
2344 Ga0496105_0080533
2345 Ga0496105_0109255
2346 Ga0496105_0148506
2347 Ga0496106_0000089
2348 Ga0496106_0003051
2349 Ga0496106_0010892
2350 Ga0496106_0045700
2351 Ga0496106_0139939
2352 Ga0496107_0002731
2353 Ga0496107_0123607
2354 Ga0496108_0037533
2355 Ga0496112_0011516
2356 Ga0496112_0013309
2357 Ga0496112_0016390
2358 Ga0496113_0002808
2359 Ga0496113_0074199
2360 Ga0496113_0107728
2361 Ga0496114_0003191
2362 Ga0496115_0019931
2363 Ga0496115_0028876
2364 Ga0496116_0000054
2365 Ga0496116_0000404
2366 Ga0496116_0000563
2367 Ga0496116_0000656
2368 Ga0496116_0018056
2369 Ga0496116_0020601
2370 Ga0496116_0047659
2371 Ga0496116_0083492
2372 Ga0496117_0000589
2373 Ga0496117_0002070
2374 Ga0496117_0002132
2375 Ga0496117_0004572
2376 Ga0496117_0010642
2377 Ga0496117_0017617
2378 Ga0496117_0020400
2379 Ga0496117_0028584
2380 Ga0496117_0031106
2381 Ga0496118_0000542
2382 Ga0496118_0000760
2383 Ga0496118_0002012
2384 Ga0496118_0002453
2385 Ga0496118_0003100
2386 Ga0496118_0007960
2387 Ga0496118_0008138
2388 Ga0496118_0011717
2389 Ga0496118_0026170
2390 Ga0496118_0026741
2391 Ga0496118_0046051
2392 Ga0496118_0072634
2393 Ga0496118_0149331
2394 Ga0496119_0000013
2395 Ga0496119_0000487
2396 Ga0496119_0002421
2397 Ga0496119_0006876
2398 Ga0496119_0011580
2399 Ga0496119_0016388
2400 Ga0496119_0041896
2401 Ga0496120_0000127
2402 Ga0496120_0001247
2403 Ga0496120_0001743
2404 Ga0496120_0002433
2405 Ga0496120_0002439
2406 Ga0496120_0002997
2407 Ga0496120_0010817
2408 Ga0496120_0011643
2409 Ga0496120_0023862
2410 Ga0496121_0002823
2411 Ga0496121_0002856
2412 Ga0496121_0003030
2413 Ga0496121_0006525
2414 Ga0496121_0011222
2415 Ga0496121_0013134
2416 Ga0496121_0020308
2417 Ga0496121_0036376
2418 Ga0496121_0071177
2419 Ga0496121_0121576
2420 Ga0496121_0164691
2421 Ga0496122_0000003
2422 Ga0496122_0000013
2423 Ga0496122_0000531
2424 Ga0496122_0001786
2425 Ga0496122_0002190
2426 Ga0496122_0004133
2427 Ga0496122_0006638
2428 Ga0496122_0009302
2429 Ga0496122_0016118
2430 Ga0496123_0000010
2431 Ga0496123_0000012
2432 Ga0496123_0000108
2433 Ga0496123_0001302
2434 Ga0496123_0003521
2435 Ga0496123_0003666
2436 Ga0496123_0003877
2437 Ga0496123_0005221
2438 Ga0496123_0006294
2439 Ga0496123_0015896
2440 Ga0496124_0000010
2441 Ga0496124_0000060
2442 Ga0496124_0000086
2443 Ga0496124_0001326
2444 Ga0496124_0003926
2445 Ga0496124_0006620
2446 Ga0496124_0015626
2447 Ga0496124_0015885
2448 Ga0496124_0018274
2449 Ga0496124_0058546
2450 Ga0496124_0143629
2451 Ga0496125_0000019
2452 Ga0496125_0000580
2453 Ga0496125_0002767
2454 Ga0496125_0014233
2455 Ga0496125_0017865
2456 Ga0496125_0038117
2457 Ga0496125_0234540
2458 Ga0496126_0000031
2459 Ga0496126_0004481
2460 Ga0496126_0005728
2461 Ga0496126_0100890
2462 Ga0496126_0108480
2463 Ga0496126_0162075
2464 Ga0496126_0165372
2465 Ga0496126_0314450
2466 Ga0495678_000493
2467 Ga0495678_014271
2468 Ga0495678_024387
2469 Ga0495682_0000011
2470 Ga0501043_0000027
2471 Ga0501046_0000034
2472 Ga0501047_0000042
2473 Ga0501048_0013088
2474 Ga0501071_0250800
2475 Ga0501075_0116164
2476 Ga0501076_0027391
2477 Ga0501077_0049598
2478 Ga0501198_000015
2479 Ga0501222_000045
2480 Ga0501079_0032488
2481 Ga0501081_0003459
2482 Ga0501045_0095237
2483 nmdc:mga03683_45402_c1
2484 nmdc:mga03683_8078_c2
2485 nmdc:mga03n38_12496_c1
2486 nmdc:mga00v17_103309_c1
2487 nmdc:mga00v17_14361_c1
2488 nmdc:mga00v17_99563_c1
2489 nmdc:mga0yw44_60814_c1
2490 nmdc:mga0k408_1919_c1
2491 nmdc:mga0k408_22567_c1
2492 nmdc:mga0k408_27503_c1
2493 nmdc:mga0k408_4870_c1
2494 nmdc:mga0k408_62313_c1
2495 nmdc:mga0k408_654_c1
2496 nmdc:mga0k408_808_c1
2497 nmdc:mga07m45_14574_c1
2498 nmdc:mga07m45_3667_c1
2499 nmdc:mga07m45_37537_c1
2500 nmdc:mga07m45_6216_c1
2501 nmdc:mga08y16_94066_c1
2502 nmdc:mga0sz30_14199_c1
2503 Ga0500610_0029190
2504 Ga0500578_0000115
2505 Ga0500644_0007072
2506 Ga0500644_0011777
2507 Ga0500593_000286
2508 Ga0500593_013547
2509 Ga0500593_016746
2510 Ga0500618_010284
2511 Ga0500621_000005
2512 Ga0500628_014995
2513 Ga0500652_000329
2514 Ga0500652_000434
2515 Ga0500652_034037
2516 Ga0500658_0006032
2517 Ga0500559_0000017
2518 Ga0500568_0024978
2519 Ga0500590_024949
2520 Ga0500622_0000205
2521 Ga0500622_0001272
2522 Ga0500622_0002775
2523 Ga0500634_0025524
2524 Ga0501084_0045276
2525 Ga0590075_010397
2526 Ga0501082_0034504
2527 Ga0466962_0000311
2528 Ga0466962_0008657
2529 Ga0466962_0028734
2530 Ga0466962_0063885
2531 Ga0530510_0148123
2532 2501070268
2533 2501080631
2534 2501410654
2535 2509131234
2536 2510251397
2537 2511086916
2538 2511096884
2539 2511103693
2540 2511245904
2541 2511247734
2542 2511381713
2543 2511432692
2544 2512345666
2545 2513553845
2546 2513564792
2547 2513961948
2548 2514051839
2549 2515680934
2550 2515689924
2551 2516019361
2552 2519459077
2553 2527075362
2554 2538428412
2555 2547697679
2556 2555259993
2557 2562463761
2558 2563058723
2559 2585291406
2560 2585826825
2561 2585831249
2562 2587729186
2563 2587734741
2564 2588293529
2565 2597028532
2566 2599412626
2567 2599444551
2568 2599736679
2569 2599744734
2570 2600205905
2571 2600809441
2572 2601524142
2573 2601529296
2574 2601535337
2575 2601539894
2576 2601616130
2577 2601620855
2578 2601644197
2579 2601649252
2580 2601654179
2581 2601659601
2582 2601664022
2583 2601696979
2584 2601702028
2585 2601706923
2586 2601712126
2587 2601717440
2588 2601722292
2589 2601727368
2590 2601732567
2591 2601736918
2592 2601743129
2593 2601753923
2594 2601758518
2595 2601764629
2596 2602021017
2597 2603636680
2598 2603645526
2599 2603662180
2600 2603667079
2601 2603699454
2602 2603705503
2603 2603839792
2604 2603844866
2605 2603850127
2606 2603855009
2607 2603867757
2608 2603872585
2609 2603877891
2610 2606049954
2611 2606071616
2612 2606147453
2613 2606177846
2614 2609909482
2615 2637223941
2616 2643971622
2617 2644141865
2618 2644275799
2619 2644305186
2620 2644337905
2621 2671105519
2622 2671108340
2623 2671588664
2624 2676405369
2625 2676742860
2626 2681996087
2627 2682006558
2628 2707099893
2629 2712472891
2630 2713476628
2631 2719640512
2632 2738818427
2633 2738831416
2634 2738872944
2635 2739184574
2636 2739219543
2637 2739612899
2638 2746085787
2639 2746096225
2640 2753566564
2641 2753857034
2642 2765590137
2643 2775541183
2644 2777023257
2645 2791922600
2646 2792311868
2647 2792835965
2648 2793404650
2649 2808972417
2650 2809007246
2651 2809014384
2652 2813727689
2653 2814695237
2654 2817261365
2655 2817279042
2656 2817451234
2657 2819622793
2658 2819631163
2659 2821121175
2660 2823375790
2661 2831869910
2662 2834642752
2663 2842327927
2664 2842352244
2665 2842458601
2666 2844428479
2667 2846037725
2668 2846040515
2669 2852107185
2670 2854602728
2671 2855197475
2672 2856294320
2673 2857367577
2674 2858470025
2675 2858699866
2676 2863424735
2677 2870070971
2678 2871277250
2679 2871286753
2680 2876603114
2681 2883092955
2682 2884087720
2683 2885267122
2684 2885275448
2685 2886854167
2686 2891675377
2687 2895514973
2688 2900054163
2689 2900055829
2690 2900578692
2691 2900634369
2692 2902683610
2693 2904474988
2694 2904484680
2695 2904506606
2696 2904517810
2697 2904571543
2698 2904575986
2699 2904624098
2700 2919111109
2701 2919151334
2702 2919531358
2703 2921649579
2704 2923636032
2705 2927146208
2706 2927837476
2707 2928062548
2708 2928113319
2709 2928140478
2710 2928162995
2711 2928169657
2712 2928171719
2713 2928507439
2714 2928539875
2715 2932409300
2716 2935625562
2717 2937542309
2718 2939570149
2719 2939575522
2720 2939580754
2721 2939604405
2722 2939608552
2723 2939618688
2724 2939642808
2725 2945876672
2726 2945911684
2727 2945937138
2728 2945986020
2729 2969080955
2730 2971822357
2731 2974310974
2732 2974439498
2733 2981994810
2734 2984563422
2735 2984596157
2736 2990706127
2737 3000378224
2738 642427333
2739 642420215
2740 642593128
2741 642622023
2742 8002393928
2743 8003961198
2744 8016734911
2745 8018222497
2746 8018409124
2747 8018851359
2748 8019501603
2749 8019504974
2750 8020810209
2751 8020945013
2752 8020951407
2753 8020956950
2754 8021122196
2755 8039102559
2756 8040168786
2757 8040174712
2758 8054846772
2759 8054852116
2760 8055089933
2761 8055095635
2762 8055100325
2763 8055267640
2764 8055302203
2765 8055697012
2766 8057306648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

124

434

0.98

PF07687

M20_dimer

Peptidase dimerisation domain

237

345

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9784 4 375
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9697 4 373
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9631 4 375
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9611 2 375
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9586 2 375
ID Description Score Start End Superfamily
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9666 3 244 3.40.630.10
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9635 1 373 3.40.630.10
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9627 3 244 3.40.630.10
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9561 1 373 3.40.630.10
af_Q18621_173_267_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9069 184 276 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A3B9JVF5-F1-model_v4 deleted 0.9809 3 148
AF-A0A3B9JVF5-F1-model_v4 deleted 0.9677 3 148
AF-A0A3S4GHQ2-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9526 92 375 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0046872
AF-Q12C18-F1-model_v4 Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) 0.9503 3 373 GO:0006526
GO:0008270
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0050897
AF-A0A3T0L106-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9477 3 371 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0046872

Map