F493550

General Info

Members Datasets Scaffolds Average Seq Length
1385 421 1356 294

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10176385|Ga0307413_101763852
Length 329
Sequence MARIAFIGLGNMGGGMAANLAKAGHDVRAFDLSAEALDRAKERGCLVAGSAAEAVAEAEAVVTMLPAGKHVRDVYESSVIGTAPSSAILMDCSTIDVATAREEIEKARAAGYLMVDAPVSGGIAAAEGGTLTFMVGGTDEAFARAEPFLSLMGKAVIHAGNPGSGQAAKICNNMLLGASMVATCETFVLAQKLGLDPQTFFDIASKASGQCWSMTSYCPVPGVGPETPADRNYEGGFAAALMLKDLRLAMEAAQSVDAYTPMGAHAEELYTRFADRLGGAGKDFSGIIKMIDDSWKAPEGSNPAAPPPGMKIGYSNQMDTPGDPGDLDD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
13 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
14 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
17 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
18 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
19 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
20 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
21 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
22 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
23 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
24 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
25 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
26 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
145 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
231 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
273 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
274 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
279 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
282 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
285 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
286 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
287 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
288 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
368 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
388 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
401 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
406 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
410 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
415 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
416 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
421 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0.07
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 7.22
Nodule 0
Rhizoplane 4.77
Rhizosphere 82.82
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1386934 2162886007 Bacteria 6854
2 ARcpr5oldR_c001826 3300000041 Bacteria 2054
3 ARcpr5yngRDRAFT_c001227 3300000043 Bacteria 2878
4 JGI24736J21556_1015029 3300001904 Bacteria 1242
5 JGI24740J21852_10002361 3300001979 Bacteria 8581
6 JGI24740J21852_10009167 3300001979 Bacteria 3891
7 JGI24739J22299_10001688 3300001989 Bacteria 8381
8 JGI24737J22298_10000247 3300001990 Bacteria 17946
9 JGI24737J22298_10002108 3300001990 Bacteria 7093
10 JGI24737J22298_10003095 3300001990 Bacteria 5892
11 JGI24737J22298_10005774 3300001990 Bacteria 4262
12 JGI24737J22298_10017865 3300001990 Bacteria 2280
13 JGI24743J22301_10005983 3300001991 Bacteria 2053
14 JGI24735J21928_10003681 3300002067 Bacteria 5196
15 JGI24735J21928_10009981 3300002067 Bacteria 3039
16 JGI24735J21928_10010734 3300002067 Bacteria 2913
17 JGI24735J21928_10018728 3300002067 Bacteria 2134
18 JGI24735J21928_10019661 3300002067 Bacteria 2075
19 JGI24735J21928_10049907 3300002067 Bacteria 1208
20 JGI24738J21930_10001286 3300002075 Bacteria 7031
21 JGI24744J21845_10000353 3300002077 Bacteria 7785
22 JGI24033J26618_1004369 3300002155 Bacteria 1525
23 JGI25165J46597_1000095 3300003214 Bacteria 163883
24 JGI25153J46596_10000083 3300003215 Bacteria 112056
25 JGI25153J46596_10008742 3300003215 Bacteria 4798
26 JGI25153J46596_10010493 3300003215 Bacteria 4185
27 Ga0055525_1000037 3300003759 Bacteria 297990
28 Ga0055542_1000831 3300003762 Bacteria 22105
29 Ga0055542_1002655 3300003762 Bacteria 5580
30 Ga0055542_1015697 3300003762 Bacteria 1210
31 Ga0055529_1000207 3300003763 Bacteria 78124
32 Ga0055526_1001047 3300003771 Bacteria 20201
33 Ga0055537_1004046 3300003773 Bacteria 4302
34 Ga0055524_1000320 3300003775 Bacteria 45185
35 Ga0055524_1000341 3300003775 Bacteria 42723
36 Ga0055530_10000582 3300003791 Bacteria 31632
37 Ga0055530_10016010 3300003791 Bacteria 2418
38 Ga0055531_10000116 3300003794 Bacteria 88368
39 Ga0055531_10000498 3300003794 Bacteria 35916
40 Ga0055531_10007455 3300003794 Bacteria 5968
41 Ga0055531_10010657 3300003794 Bacteria 4540
42 Ga0065165_1000472 3300005262 Bacteria 62746
43 Ga0065165_1009580 3300005262 Bacteria 4320
44 Ga0065165_1026042 3300005262 Bacteria 1931
45 Ga0065704_10070605 3300005289 Bacteria 19245
46 Ga0065712_10070384 3300005290 Bacteria 6060
47 Ga0070658_10000001 3300005327 Bacteria 856789
48 Ga0070658_10001817 3300005327 Bacteria 17959
49 Ga0070658_10004771 3300005327 Bacteria 11026
50 Ga0070658_10005539 3300005327 Bacteria 10247
51 Ga0070658_10056028 3300005327 Bacteria 3203
52 Ga0070658_10134578 3300005327 Bacteria 2061
53 Ga0070658_10168355 3300005327 Bacteria 1840
54 Ga0070658_10364211 3300005327 Bacteria 1239
55 Ga0070658_10386666 3300005327 Bacteria 1201
56 Ga0070676_10006127 3300005328 Bacteria 6423
57 Ga0070676_10063310 3300005328 Bacteria 2203
58 Ga0070683_100188149 3300005329 Bacteria 1960
59 Ga0070683_100208182 3300005329 Bacteria 1857
60 Ga0070683_100377362 3300005329 Bacteria 1351
61 Ga0070683_100444882 3300005329 Bacteria 1236
62 Ga0070670_100014463 3300005331 Bacteria 6775
63 Ga0070670_100046613 3300005331 Bacteria 3728
64 Ga0070670_100402471 3300005331 Bacteria 1208
65 Ga0070677_10000133 3300005333 Bacteria 24786
66 Ga0068869_100001644 3300005334 Bacteria 13326
67 Ga0070666_10000273 3300005335 Bacteria 34295
68 Ga0070666_10003276 3300005335 Bacteria 9830
69 Ga0070666_10023293 3300005335 Bacteria 4031
70 Ga0070666_10026564 3300005335 Bacteria 3785
71 Ga0068868_100000164 3300005338 Bacteria 43406
72 Ga0068868_100008489 3300005338 Bacteria 7354
73 Ga0068868_100219278 3300005338 Bacteria 1592
74 Ga0068868_100316890 3300005338 Bacteria 1328
75 Ga0070660_100000139 3300005339 Bacteria 46729
76 Ga0070660_100001079 3300005339 Bacteria 18342
77 Ga0070660_100001588 3300005339 Bacteria 15632
78 Ga0070660_100004851 3300005339 Bacteria 9290
79 Ga0070660_100010447 3300005339 Bacteria 6561
80 Ga0070660_100010544 3300005339 Bacteria 6531
81 Ga0070660_100011548 3300005339 Bacteria 6285
82 Ga0070660_100015872 3300005339 Bacteria 5451
83 Ga0070660_100019982 3300005339 Bacteria 4915
84 Ga0070660_100032173 3300005339 Bacteria 3945
85 Ga0070660_100050818 3300005339 Bacteria 3190
86 Ga0070660_100098961 3300005339 Bacteria 2309
87 Ga0070660_100171862 3300005339 Bacteria 1750
88 Ga0070660_100222743 3300005339 Bacteria 1533
89 Ga0070661_100000028 3300005344 Bacteria 117932
90 Ga0070661_100004099 3300005344 Bacteria 10045
91 Ga0070661_100052487 3300005344 Bacteria 2984
92 Ga0070661_100279118 3300005344 Bacteria 1295
93 Ga0070661_100334083 3300005344 Bacteria 1186
94 Ga0070692_10001401 3300005345 Bacteria 8728
95 Ga0070692_10002252 3300005345 Bacteria 7402
96 Ga0070692_10002478 3300005345 Bacteria 7180
97 Ga0070668_100000019 3300005347 Bacteria 98356
98 Ga0070668_100000080 3300005347 Bacteria 60157
99 Ga0070668_100002144 3300005347 Bacteria 14448
100 Ga0070668_100017252 3300005347 Bacteria 5405
101 Ga0070668_100060576 3300005347 Bacteria 2931
102 Ga0070668_100070570 3300005347 Bacteria 2720
103 Ga0070668_100154446 3300005347 Bacteria 1859
104 Ga0070669_100000096 3300005353 Bacteria 86930
105 Ga0070669_100000451 3300005353 Bacteria 31335
106 Ga0070669_100002922 3300005353 Bacteria 12305
107 Ga0070669_100004755 3300005353 Bacteria 9792
108 Ga0070669_100022738 3300005353 Bacteria 4483
109 Ga0070669_100051871 3300005353 Bacteria 2999
110 Ga0070669_100079816 3300005353 Bacteria 2434
111 Ga0070669_100092210 3300005353 Bacteria 2273
112 Ga0070669_100110709 3300005353 Bacteria 2084
113 Ga0070675_100036440 3300005354 Bacteria 4003
114 Ga0070675_100082768 3300005354 Bacteria 2678
115 Ga0070671_100000169 3300005355 Bacteria 43010
116 Ga0070671_100000419 3300005355 Bacteria 29492
117 Ga0070671_100000629 3300005355 Bacteria 25165
118 Ga0070671_100007657 3300005355 Bacteria 8634
119 Ga0070671_100020066 3300005355 Bacteria 5445
120 Ga0070671_100022059 3300005355 Bacteria 5202
121 Ga0070671_100039955 3300005355 Bacteria 3895
122 Ga0070671_100075576 3300005355 Bacteria 2814
123 Ga0070671_100079107 3300005355 Bacteria 2748
124 Ga0070671_100083381 3300005355 Bacteria 2673
125 Ga0070671_100102644 3300005355 Bacteria 2399
126 Ga0070674_100001061 3300005356 Bacteria 14377
127 Ga0070674_100001978 3300005356 Bacteria 11211
128 Ga0070674_100043898 3300005356 Bacteria 3044
129 Ga0070674_100172131 3300005356 Bacteria 1652
130 Ga0070673_100000102 3300005364 Bacteria 38342
131 Ga0070673_100048499 3300005364 Bacteria 3311
132 Ga0070673_100116258 3300005364 Bacteria 2225
133 Ga0070673_100169957 3300005364 Bacteria 1860
134 Ga0070688_100184877 3300005365 Bacteria 1448
135 Ga0070659_100000021 3300005366 Bacteria 154212
136 Ga0070659_100001442 3300005366 Bacteria 17157
137 Ga0070659_100005959 3300005366 Bacteria 8788
138 Ga0070659_100006060 3300005366 Bacteria 8722
139 Ga0070659_100015671 3300005366 Bacteria 5678
140 Ga0070659_100018189 3300005366 Bacteria 5302
141 Ga0070659_100022605 3300005366 Bacteria 4801
142 Ga0070659_100027698 3300005366 Bacteria 4368
143 Ga0070659_100044477 3300005366 Bacteria 3477
144 Ga0070659_100055412 3300005366 Bacteria 3124
145 Ga0070659_100069749 3300005366 Bacteria 2791
146 Ga0070659_100079945 3300005366 Bacteria 2610
147 Ga0070659_100144143 3300005366 Bacteria 1940
148 Ga0070659_100177298 3300005366 Bacteria 1748
149 Ga0070659_100186938 3300005366 Bacteria 1702
150 Ga0070659_100284982 3300005366 Bacteria 1375
151 Ga0070667_100000094 3300005367 Bacteria 111140
152 Ga0070667_100008465 3300005367 Bacteria 8531
153 Ga0070667_100044768 3300005367 Bacteria 3718
154 Ga0070667_100049740 3300005367 Bacteria 3531
155 Ga0070667_100071859 3300005367 Bacteria 2947
156 Ga0070667_100220563 3300005367 Bacteria 1688
157 Ga0070713_100016076 3300005436 Bacteria 5619
158 Ga0070694_100052950 3300005444 Bacteria 2745
159 Ga0070708_100167354 3300005445 Bacteria 2051
160 Ga0070663_100005901 3300005455 Bacteria 7327
161 Ga0070663_100006997 3300005455 Bacteria 6831
162 Ga0070663_100008734 3300005455 Bacteria 6246
163 Ga0070663_100065167 3300005455 Bacteria 2636
164 Ga0070663_100173082 3300005455 Bacteria 1670
165 Ga0070678_100007011 3300005456 Bacteria 6658
166 Ga0070678_100097327 3300005456 Bacteria 2272
167 Ga0070662_100006773 3300005457 Bacteria 7408
168 Ga0070662_100044804 3300005457 Bacteria 3171
169 Ga0070662_100080697 3300005457 Bacteria 2422
170 Ga0070662_100086357 3300005457 Bacteria 2346
171 Ga0070662_100087520 3300005457 Bacteria 2332
172 Ga0070662_100153410 3300005457 Bacteria 1796
173 Ga0070662_100257104 3300005457 Bacteria 1406
174 Ga0070662_100537122 3300005457 Bacteria 978
175 Ga0070681_10044962 3300005458 Bacteria 4420
176 Ga0070681_10094832 3300005458 Bacteria 2932
177 Ga0068867_100002370 3300005459 Bacteria 13252
178 Ga0070707_100053775 3300005468 Bacteria 3861
179 Ga0070698_100006487 3300005471 Bacteria 12691
180 Ga0070679_100000010 3300005530 Bacteria 166632
181 Ga0070679_100181594 3300005530 Bacteria 2076
182 Ga0070679_100221166 3300005530 Bacteria 1854
183 Ga0070679_100522491 3300005530 Bacteria 1131
184 Ga0070684_100004118 3300005535 Bacteria 11002
185 Ga0070684_100023225 3300005535 Bacteria 5183
186 Ga0068853_100014001 3300005539 Bacteria 6562
187 Ga0068853_100053958 3300005539 Bacteria 3463
188 Ga0068853_100068854 3300005539 Bacteria 3077
189 Ga0068853_100093602 3300005539 Bacteria 2646
190 Ga0068853_100385359 3300005539 Bacteria 1310
191 Ga0068853_100468261 3300005539 Bacteria 1187
192 Ga0070672_100070086 3300005543 Bacteria 2785
193 Ga0070672_100102556 3300005543 Bacteria 2322
194 Ga0070686_100169932 3300005544 Bacteria 1541
195 Ga0070696_100007442 3300005546 Bacteria 7323
196 Ga0070693_100055350 3300005547 Bacteria 2285
197 Ga0070665_100000766 3300005548 Bacteria 42469
198 Ga0070665_100019141 3300005548 Bacteria 6870
199 Ga0070665_100041107 3300005548 Bacteria 4646
200 Ga0070665_100086833 3300005548 Bacteria 3133
201 Ga0070665_100089984 3300005548 Bacteria 3075
202 Ga0070665_100209201 3300005548 Bacteria 1951
203 Ga0070665_100252058 3300005548 Bacteria 1766
204 Ga0070665_100360321 3300005548 Bacteria 1460
205 Ga0068855_100000348 3300005563 Bacteria 57384
206 Ga0068855_100001799 3300005563 Bacteria 26812
207 Ga0068855_100003254 3300005563 Bacteria 19871
208 Ga0068855_100007660 3300005563 Bacteria 13055
209 Ga0068855_100220807 3300005563 Bacteria 2125
210 Ga0068855_100285695 3300005563 Bacteria 1830
211 Ga0068855_100469279 3300005563 Bacteria 1371
212 Ga0070664_100007788 3300005564 Bacteria 8649
213 Ga0070664_100022439 3300005564 Bacteria 5204
214 Ga0070664_100049310 3300005564 Bacteria 3561
215 Ga0070664_100058333 3300005564 Bacteria 3283
216 Ga0070664_100058477 3300005564 Bacteria 3279
217 Ga0070664_100192036 3300005564 Bacteria 1820
218 Ga0068857_100005769 3300005577 Bacteria 10584
219 Ga0068857_100014420 3300005577 Bacteria 6893
220 Ga0068857_100017653 3300005577 Bacteria 6257
221 Ga0068857_100044515 3300005577 Bacteria 3937
222 Ga0068857_100048254 3300005577 Bacteria 3781
223 Ga0068857_100065037 3300005577 Bacteria 3242
224 Ga0068857_100189037 3300005577 Bacteria 1875
225 Ga0068857_100282678 3300005577 Bacteria 1526
226 Ga0068857_100578940 3300005577 Bacteria 1059
227 Ga0068857_100637111 3300005577 Bacteria 1009
228 Ga0068854_100000922 3300005578 Bacteria 17670
229 Ga0068854_100038978 3300005578 Bacteria 3344
230 Ga0068854_100042797 3300005578 Bacteria 3207
231 Ga0068854_100097289 3300005578 Bacteria 2200
232 Ga0068854_100184744 3300005578 Bacteria 1630
233 Ga0068856_100009131 3300005614 Bacteria 9641
234 Ga0068856_100038229 3300005614 Bacteria 4711
235 Ga0068856_100123451 3300005614 Bacteria 2592
236 Ga0068856_100152380 3300005614 Bacteria 2321
237 Ga0068856_100241514 3300005614 Bacteria 1821
238 Ga0068856_100354697 3300005614 Bacteria 1485
239 Ga0068856_100356895 3300005614 Bacteria 1480
240 Ga0068856_100403414 3300005614 Bacteria 1387
241 Ga0068856_100461251 3300005614 Bacteria 1291
242 Ga0068856_100526237 3300005614 Bacteria 1203
243 Ga0068852_100001022 3300005616 Bacteria 18452
244 Ga0068852_100028953 3300005616 Bacteria 4542
245 Ga0068852_100087830 3300005616 Bacteria 2775
246 Ga0068852_100197714 3300005616 Bacteria 1901
247 Ga0068859_100003981 3300005617 Bacteria 15073
248 Ga0068859_100007890 3300005617 Bacteria 10800
249 Ga0068859_100039051 3300005617 Bacteria 4761
250 Ga0068859_100045752 3300005617 Bacteria 4396
251 Ga0068859_100094042 3300005617 Bacteria 3049
252 Ga0068859_100423982 3300005617 Bacteria 1427
253 Ga0068859_100788011 3300005617 Bacteria 1039
254 Ga0068864_100000858 3300005618 Bacteria 25592
255 Ga0068864_100000986 3300005618 Bacteria 23851
256 Ga0068864_100008878 3300005618 Bacteria 8288
257 Ga0068864_100009673 3300005618 Bacteria 7953
258 Ga0068864_100064173 3300005618 Bacteria 3184
259 Ga0068864_100098743 3300005618 Bacteria 2586
260 Ga0068864_100386637 3300005618 Bacteria 1327
261 Ga0068866_10318002 3300005718 Bacteria 978
262 Ga0068861_100002124 3300005719 Bacteria 12825
263 Ga0068861_100153455 3300005719 Bacteria 1892
264 Ga0068863_100000001 3300005841 Bacteria 581116
265 Ga0068863_100000057 3300005841 Bacteria 123606
266 Ga0068863_100005345 3300005841 Bacteria 12666
267 Ga0068863_100007161 3300005841 Bacteria 10943
268 Ga0068863_100018541 3300005841 Bacteria 6661
269 Ga0068863_100023817 3300005841 Bacteria 5844
270 Ga0068863_100034907 3300005841 Bacteria 4791
271 Ga0068863_100042528 3300005841 Bacteria 4317
272 Ga0068863_100147317 3300005841 Bacteria 2252
273 Ga0068863_100157704 3300005841 Bacteria 2173
274 Ga0068863_100175027 3300005841 Bacteria 2059
275 Ga0068858_100000901 3300005842 Bacteria 30779
276 Ga0068858_100000933 3300005842 Bacteria 30312
277 Ga0068858_100008352 3300005842 Bacteria 9962
278 Ga0068858_100011713 3300005842 Bacteria 8270
279 Ga0068858_100014125 3300005842 Bacteria 7531
280 Ga0068858_100019480 3300005842 Bacteria 6346
281 Ga0068860_100004802 3300005843 Bacteria 13762
282 Ga0068860_100012671 3300005843 Bacteria 8295
283 Ga0068860_100022645 3300005843 Bacteria 6073
284 Ga0068860_100025508 3300005843 Bacteria 5702
285 Ga0068860_100026016 3300005843 Bacteria 5645
286 Ga0068860_100027166 3300005843 Bacteria 5514
287 Ga0068860_100034230 3300005843 Bacteria 4871
288 Ga0068860_100034921 3300005843 Bacteria 4824
289 Ga0068860_100066349 3300005843 Bacteria 3428
290 Ga0068860_100137755 3300005843 Bacteria 2344
291 Ga0068860_100182144 3300005843 Bacteria 2030
292 Ga0068862_100000148 3300005844 Bacteria 79789
293 Ga0068862_100005517 3300005844 Bacteria 10569
294 Ga0068862_100031095 3300005844 Bacteria 4503
295 Ga0068862_100078001 3300005844 Bacteria 2869
296 Ga0068862_100170254 3300005844 Bacteria 1949
297 Ga0068862_100220347 3300005844 Bacteria 1717
298 Ga0081455_10000537 3300005937 Bacteria 49240
299 Ga0081540_1076812 3300005983 Bacteria 1520
300 Ga0081539_10004910 3300005985 Bacteria 14246
301 Ga0081539_10085536 3300005985 Bacteria 1644
302 Ga0075368_10000367 3300006042 Bacteria 13288
303 Ga0075363_100002220 3300006048 Bacteria 7844
304 Ga0070712_100094010 3300006175 Bacteria 2202
305 Ga0075362_10044516 3300006177 Bacteria 1969
306 Ga0075367_10005228 3300006178 Bacteria 6416
307 Ga0075367_10034944 3300006178 Bacteria 2906
308 Ga0075366_10172017 3300006195 Bacteria 1314
309 Ga0075366_10253820 3300006195 Bacteria 1073
310 Ga0075366_10317877 3300006195 Bacteria 953
311 Ga0097621_100006846 3300006237 Bacteria 8104
312 Ga0097621_100034267 3300006237 Bacteria 4049
313 Ga0097621_100055110 3300006237 Bacteria 3246
314 Ga0075370_10022094 3300006353 Bacteria 3490
315 Ga0075370_10039843 3300006353 Bacteria 2649
316 Ga0068871_100035768 3300006358 Bacteria 3949
317 Ga0068871_100076647 3300006358 Bacteria 2762
318 Ga0075430_100284139 3300006846 Bacteria 1369
319 Ga0068865_100001599 3300006881 Bacteria 13264
320 Ga0097620_100003981 3300006931 Bacteria 15073
321 Ga0097620_100007889 3300006931 Bacteria 10800
322 Ga0097620_100039051 3300006931 Bacteria 4761
323 Ga0097620_100045752 3300006931 Bacteria 4396
324 Ga0097620_100094045 3300006931 Bacteria 3049
325 Ga0097620_100424005 3300006931 Bacteria 1427
326 Ga0097620_100787996 3300006931 Bacteria 1039
327 Ga0105251_10019125 3300009011 Bacteria 3625
328 Ga0105240_10098496 3300009093 Bacteria 3560
329 Ga0105240_10221652 3300009093 Bacteria 2203
330 Ga0111539_10256670 3300009094 Bacteria 2035
331 Ga0105245_10003923 3300009098 Bacteria 13224
332 Ga0105243_10000278 3300009148 Bacteria 57245
333 Ga0105243_10003240 3300009148 Bacteria 13275
334 Ga0105243_10334929 3300009148 Bacteria 1384
335 Ga0105241_10000871 3300009174 Bacteria 22894
336 Ga0105242_10003140 3300009176 Bacteria 12901
337 Ga0105248_10002050 3300009177 Bacteria 22321
338 Ga0105248_10011743 3300009177 Bacteria 9661
339 Ga0105248_10013079 3300009177 Bacteria 9140
340 Ga0105248_10098092 3300009177 Bacteria 3301
341 Ga0105248_10111104 3300009177 Bacteria 3091
342 Ga0105248_10121858 3300009177 Bacteria 2942
343 Ga0105248_10130957 3300009177 Bacteria 2830
344 Ga0105248_10178901 3300009177 Bacteria 2390
345 Ga0105248_10194133 3300009177 Bacteria 2287
346 Ga0105248_10334412 3300009177 Bacteria 1706
347 Ga0105248_10380989 3300009177 Bacteria 1588
348 Ga0105237_10067334 3300009545 Bacteria 3575
349 Ga0105237_10104250 3300009545 Bacteria 2828
350 Ga0105237_10109750 3300009545 Bacteria 2751
351 Ga0105237_10121532 3300009545 Bacteria 2606
352 Ga0105238_10063020 3300009551 Bacteria 3708
353 Ga0105238_10122379 3300009551 Bacteria 2581
354 Ga0105238_10281811 3300009551 Bacteria 1643
355 Ga0105238_10437904 3300009551 Bacteria 1303
356 Ga0105238_10482012 3300009551 Bacteria 1240
357 Ga0105249_10000196 3300009553 Bacteria 69134
358 Ga0105249_10004132 3300009553 Bacteria 12539
359 Ga0105249_10011511 3300009553 Bacteria 7773
360 Ga0105249_10015545 3300009553 Bacteria 6737
361 Ga0105249_10020929 3300009553 Bacteria 5850
362 Ga0105249_10226401 3300009553 Bacteria 1843
363 Ga0105249_10266005 3300009553 Bacteria 1706
364 Ga0105249_10490996 3300009553 Bacteria 1272
365 Ga0105239_10067896 3300010375 Bacteria 3918
366 Ga0105239_10222388 3300010375 Bacteria 2117
367 Ga0105239_10436624 3300010375 Bacteria 1484
368 Ga0105246_10009362 3300011119 Bacteria 6035
369 Ga0105246_10103350 3300011119 Bacteria 2079
370 Ga0157373_10018912 3300013100 Bacteria 5014
371 Ga0157373_10034494 3300013100 Bacteria 3634
372 Ga0157373_10039522 3300013100 Bacteria 3377
373 Ga0157373_10042692 3300013100 Bacteria 3240
374 Ga0157373_10044714 3300013100 Bacteria 3161
375 Ga0157373_10116563 3300013100 Bacteria 1877
376 Ga0157373_10231245 3300013100 Bacteria 1306
377 Ga0157371_10000285 3300013102 Bacteria 68525
378 Ga0157371_10003605 3300013102 Bacteria 13952
379 Ga0157371_10010387 3300013102 Bacteria 7258
380 Ga0157371_10060034 3300013102 Bacteria 2696
381 Ga0157371_10067216 3300013102 Bacteria 2537
382 Ga0157371_10116813 3300013102 Bacteria 1896
383 Ga0157371_10331162 3300013102 Bacteria 1106
384 Ga0157371_10378217 3300013102 Bacteria 1034
385 Ga0157370_10001875 3300013104 Bacteria 25926
386 Ga0157370_10042639 3300013104 Bacteria 4371
387 Ga0157370_10044569 3300013104 Bacteria 4262
388 Ga0157370_10064736 3300013104 Bacteria 3460
389 Ga0157370_10136814 3300013104 Bacteria 2283
390 Ga0157370_10404310 3300013104 Bacteria 1256
391 Ga0157369_10000239 3300013105 Bacteria 76144
392 Ga0157369_10005943 3300013105 Bacteria 14172
393 Ga0157369_10022363 3300013105 Bacteria 7057
394 Ga0157369_10118547 3300013105 Bacteria 2809
395 Ga0157369_10282782 3300013105 Bacteria 1728
396 Ga0157369_10351558 3300013105 Bacteria 1531
397 Ga0157369_10395228 3300013105 Bacteria 1434
398 Ga0157369_10587267 3300013105 Bacteria 1150
399 Ga0157369_10717014 3300013105 Bacteria 1030
400 Ga0157374_10003484 3300013296 Bacteria 13229
401 Ga0157374_10005380 3300013296 Bacteria 10755
402 Ga0157374_10118103 3300013296 Bacteria 2557
403 Ga0157374_10460752 3300013296 Bacteria 1273
404 Ga0157378_10001779 3300013297 Bacteria 19352
405 Ga0157378_10012689 3300013297 Bacteria 7372
406 Ga0157378_10496414 3300013297 Bacteria 1218
407 Ga0163162_10005919 3300013306 Bacteria 11831
408 Ga0163162_10016652 3300013306 Bacteria 7185
409 Ga0163162_10134549 3300013306 Bacteria 2582
410 Ga0163162_10835787 3300013306 Bacteria 1037
411 Ga0157372_10089388 3300013307 Bacteria 3499
412 Ga0157372_10230894 3300013307 Bacteria 2145
413 Ga0157372_10254709 3300013307 Bacteria 2038
414 Ga0157372_10517264 3300013307 Bacteria 1391
415 Ga0157372_10538252 3300013307 Bacteria 1361
416 Ga0157372_10716487 3300013307 Bacteria 1164
417 Ga0157375_10003690 3300013308 Bacteria 13290
418 Ga0163163_10002274 3300014325 Bacteria 16195
419 Ga0163163_10061738 3300014325 Bacteria 3713
420 Ga0157380_10067769 3300014326 Bacteria 2875
421 Ga0182008_10029615 3300014497 Bacteria 2765
422 Ga0157377_10081080 3300014745 Bacteria 1897
423 Ga0157379_10002869 3300014968 Bacteria 14535
424 Ga0157379_10007825 3300014968 Bacteria 9254
425 Ga0157379_10012088 3300014968 Bacteria 7540
426 Ga0157379_10096668 3300014968 Bacteria 2651
427 Ga0157379_10292467 3300014968 Bacteria 1484
428 Ga0157376_10010893 3300014969 Bacteria 6679
429 Ga0183363_1007 3300015690 Bacteria 315687
430 Ga0183361_10078 3300016635 Bacteria 2971
431 Ga0163161_10062156 3300017792 Bacteria 2720
432 Ga0163161_10119156 3300017792 Bacteria 1982
433 Ga0163161_10248432 3300017792 Bacteria 1386
434 Ga0206353_12066425 3300020082 Bacteria 17326
435 Ga0213873_10000020 3300021358 Bacteria 119758
436 Ga0213876_10000004 3300021384 Bacteria 943822
437 Ga0213876_10000174 3300021384 Bacteria 66934
438 Ga0213871_10000096 3300021441 Bacteria 8013
439 Ga0209563_100105 3300025230 Bacteria 147936
440 Ga0207427_100897 3300025231 Bacteria 12903
441 Ga0209437_110277 3300025233 Bacteria 1435
442 Ga0207425_1004686 3300025245 Bacteria 4041
443 Ga0209026_1000440 3300025250 Bacteria 33927
444 Ga0209677_105892 3300025253 Bacteria 3064
445 Ga0209148_1000011 3300025254 Bacteria 1196503
446 Ga0209148_1000457 3300025254 Bacteria 44291
447 Ga0209148_1002517 3300025254 Bacteria 6156
448 Ga0209233_1000003 3300025261 Bacteria 1607366
449 Ga0209233_1000052 3300025261 Bacteria 445813
450 Ga0209233_1010964 3300025261 Bacteria 2687
451 Ga0209565_1000007 3300025263 Bacteria 784361
452 Ga0209455_1000006 3300025272 Bacteria 1196503
453 Ga0209455_1000974 3300025272 Bacteria 14469
454 Ga0209673_1003585 3300025273 Bacteria 9033
455 Ga0209675_1017249 3300025291 Bacteria 2067
456 Ga0209676_1000330 3300025292 Bacteria 91216
457 Ga0209564_1000335 3300025295 Bacteria 91079
458 Ga0209564_1029082 3300025295 Bacteria 1748
459 Ga0209758_1000023 3300025297 Bacteria 612453
460 Ga0209758_1020971 3300025297 Bacteria 3066
461 Ga0209050_1000113 3300025298 Bacteria 209222
462 Ga0209050_1000196 3300025298 Bacteria 135678
463 Ga0209050_1004893 3300025298 Bacteria 8772
464 Ga0209256_1000009 3300025299 Bacteria 922071
465 Ga0209256_1000010 3300025299 Bacteria 912110
466 Ga0209257_1000083 3300025304 Bacteria 296207
467 Ga0209257_1000126 3300025304 Bacteria 215705
468 Ga0209257_1000228 3300025304 Bacteria 133390
469 Ga0209257_1000340 3300025304 Bacteria 97492
470 Ga0209257_1003616 3300025304 Bacteria 13022
471 Ga0207697_10003428 3300025315 Bacteria 7849
472 Ga0207697_10022353 3300025315 Bacteria 2592
473 Ga0207656_10002728 3300025321 Bacteria 5994
474 Ga0207696_1003210 3300025711 Bacteria 7553
475 Ga0207713_1008865 3300025735 Bacteria 5731
476 Ga0207682_10000101 3300025893 Bacteria 38917
477 Ga0207682_10122517 3300025893 Bacteria 1154
478 Ga0207710_10068458 3300025900 Bacteria 1623
479 Ga0207680_10003271 3300025903 Bacteria 7628
480 Ga0207680_10003619 3300025903 Bacteria 7261
481 Ga0207680_10004789 3300025903 Bacteria 6443
482 Ga0207680_10010102 3300025903 Bacteria 4711
483 Ga0207680_10257132 3300025903 Bacteria 1208
484 Ga0207647_10000559 3300025904 Bacteria 29551
485 Ga0207647_10002875 3300025904 Bacteria 12973
486 Ga0207647_10003223 3300025904 Bacteria 12242
487 Ga0207647_10015034 3300025904 Bacteria 5320
488 Ga0207647_10025801 3300025904 Bacteria 3854
489 Ga0207647_10035499 3300025904 Bacteria 3177
490 Ga0207647_10058541 3300025904 Bacteria 2359
491 Ga0207645_10017964 3300025907 Bacteria 4664
492 Ga0207645_10032964 3300025907 Bacteria 3330
493 Ga0207645_10054960 3300025907 Bacteria 2542
494 Ga0207705_10000002 3300025909 Bacteria 2046852
495 Ga0207705_10000003 3300025909 Bacteria 709270
496 Ga0207705_10000042 3300025909 Bacteria 182120
497 Ga0207705_10000208 3300025909 Bacteria 59559
498 Ga0207705_10001333 3300025909 Bacteria 19773
499 Ga0207705_10008087 3300025909 Bacteria 7707
500 Ga0207705_10010224 3300025909 Bacteria 6826
501 Ga0207705_10020614 3300025909 Bacteria 4707
502 Ga0207705_10023460 3300025909 Bacteria 4400
503 Ga0207705_10047702 3300025909 Bacteria 3080
504 Ga0207705_10147603 3300025909 Bacteria 1760
505 Ga0207705_10155301 3300025909 Bacteria 1716
506 Ga0207705_10301708 3300025909 Bacteria 1229
507 Ga0207705_10378532 3300025909 Bacteria 1093
508 Ga0207654_10004325 3300025911 Bacteria 7160
509 Ga0207707_10021138 3300025912 Bacteria 5686
510 Ga0207707_10049419 3300025912 Bacteria 3664
511 Ga0207707_10198830 3300025912 Bacteria 1748
512 Ga0207695_10016024 3300025913 Bacteria 8797
513 Ga0207695_10018678 3300025913 Bacteria 8007
514 Ga0207695_10099802 3300025913 Bacteria 2900
515 Ga0207695_10142525 3300025913 Bacteria 2343
516 Ga0207695_10147760 3300025913 Bacteria 2292
517 Ga0207671_10108250 3300025914 Bacteria 2112
518 Ga0207671_10115815 3300025914 Bacteria 2044
519 Ga0207671_10177258 3300025914 Bacteria 1657
520 Ga0207693_10128225 3300025915 Bacteria 1994
521 Ga0207657_10000082 3300025919 Bacteria 89667
522 Ga0207657_10000228 3300025919 Bacteria 58838
523 Ga0207657_10000284 3300025919 Bacteria 53982
524 Ga0207657_10002637 3300025919 Bacteria 19364
525 Ga0207657_10004412 3300025919 Bacteria 14886
526 Ga0207657_10005847 3300025919 Bacteria 12819
527 Ga0207657_10005882 3300025919 Bacteria 12778
528 Ga0207657_10012642 3300025919 Bacteria 8321
529 Ga0207657_10014951 3300025919 Bacteria 7542
530 Ga0207657_10019845 3300025919 Bacteria 6369
531 Ga0207657_10022768 3300025919 Bacteria 5851
532 Ga0207657_10057435 3300025919 Bacteria 3353
533 Ga0207657_10099146 3300025919 Bacteria 2420
534 Ga0207657_10207854 3300025919 Bacteria 1572
535 Ga0207657_10266566 3300025919 Bacteria 1362
536 Ga0207657_10399415 3300025919 Bacteria 1081
537 Ga0207649_10000336 3300025920 Bacteria 35670
538 Ga0207649_10001475 3300025920 Bacteria 13801
539 Ga0207649_10003997 3300025920 Bacteria 8035
540 Ga0207649_10128536 3300025920 Bacteria 1718
541 Ga0207652_10000005 3300025921 Bacteria 343384
542 Ga0207652_10000006 3300025921 Bacteria 302991
543 Ga0207652_10000007 3300025921 Bacteria 301303
544 Ga0207652_10001766 3300025921 Bacteria 18870
545 Ga0207652_10185966 3300025921 Bacteria 1868
546 Ga0207652_10205845 3300025921 Bacteria 1771
547 Ga0207681_10000030 3300025923 Bacteria 173766
548 Ga0207681_10000049 3300025923 Bacteria 120296
549 Ga0207681_10000211 3300025923 Bacteria 46203
550 Ga0207681_10004608 3300025923 Bacteria 8476
551 Ga0207681_10017715 3300025923 Bacteria 4477
552 Ga0207694_10002464 3300025924 Bacteria 15081
553 Ga0207694_10068371 3300025924 Bacteria 2774
554 Ga0207694_10225943 3300025924 Bacteria 1528
555 Ga0207694_10309215 3300025924 Bacteria 1302
556 Ga0207650_10058856 3300025925 Bacteria 2862
557 Ga0207650_10062893 3300025925 Bacteria 2774
558 Ga0207650_10078528 3300025925 Bacteria 2497
559 Ga0207650_10084239 3300025925 Bacteria 2416
560 Ga0207650_10342413 3300025925 Bacteria 1228
561 Ga0207659_10025753 3300025926 Bacteria 3958
562 Ga0207659_10316036 3300025926 Bacteria 1287
563 Ga0207687_10030752 3300025927 Bacteria 3623
564 Ga0207687_10056888 3300025927 Bacteria 2745
565 Ga0207700_10009569 3300025928 Bacteria 6067
566 Ga0207700_10286445 3300025928 Bacteria 1419
567 Ga0207644_10000012 3300025931 Bacteria 186652
568 Ga0207644_10000017 3300025931 Bacteria 177818
569 Ga0207644_10000061 3300025931 Bacteria 79079
570 Ga0207644_10002156 3300025931 Bacteria 12763
571 Ga0207644_10003585 3300025931 Bacteria 10049
572 Ga0207644_10006010 3300025931 Bacteria 7913
573 Ga0207644_10010083 3300025931 Bacteria 6222
574 Ga0207644_10014224 3300025931 Bacteria 5321
575 Ga0207644_10020468 3300025931 Bacteria 4498
576 Ga0207644_10027275 3300025931 Bacteria 3945
577 Ga0207644_10031486 3300025931 Bacteria 3696
578 Ga0207644_10201576 3300025931 Bacteria 1570
579 Ga0207690_10000030 3300025932 Bacteria 156832
580 Ga0207690_10001614 3300025932 Bacteria 14047
581 Ga0207690_10002671 3300025932 Bacteria 10744
582 Ga0207690_10006603 3300025932 Bacteria 6871
583 Ga0207690_10007128 3300025932 Bacteria 6640
584 Ga0207690_10008219 3300025932 Bacteria 6190
585 Ga0207690_10011538 3300025932 Bacteria 5278
586 Ga0207690_10029732 3300025932 Bacteria 3477
587 Ga0207690_10033283 3300025932 Bacteria 3313
588 Ga0207690_10079576 3300025932 Bacteria 2284
589 Ga0207690_10112556 3300025932 Bacteria 1963
590 Ga0207690_10148558 3300025932 Bacteria 1735
591 Ga0207690_10167135 3300025932 Bacteria 1645
592 Ga0207690_10184317 3300025932 Bacteria 1574
593 Ga0207706_10011989 3300025933 Bacteria 7897
594 Ga0207706_10012700 3300025933 Bacteria 7667
595 Ga0207706_10013884 3300025933 Bacteria 7305
596 Ga0207706_10016878 3300025933 Bacteria 6586
597 Ga0207706_10021981 3300025933 Bacteria 5726
598 Ga0207706_10058767 3300025933 Bacteria 3387
599 Ga0207706_10083859 3300025933 Bacteria 2802
600 Ga0207706_10209323 3300025933 Bacteria 1710
601 Ga0207706_10386538 3300025933 Bacteria 1214
602 Ga0207686_10002013 3300025934 Bacteria 11211
603 Ga0207709_10000039 3300025935 Bacteria 260127
604 Ga0207709_10001407 3300025935 Bacteria 16832
605 Ga0207709_10217845 3300025935 Bacteria 1375
606 Ga0207670_10345113 3300025936 Bacteria 1178
607 Ga0207669_10000153 3300025937 Bacteria 32519
608 Ga0207669_10005885 3300025937 Bacteria 5548
609 Ga0207669_10117080 3300025937 Bacteria 1800
610 Ga0207669_10193094 3300025937 Bacteria 1471
611 Ga0207704_10000875 3300025938 Bacteria 13308
612 Ga0207704_10053543 3300025938 Bacteria 2454
613 Ga0207691_10048040 3300025940 Bacteria 3914
614 Ga0207691_10062600 3300025940 Bacteria 3375
615 Ga0207711_10000665 3300025941 Bacteria 34189
616 Ga0207711_10000990 3300025941 Bacteria 27231
617 Ga0207711_10007176 3300025941 Bacteria 9342
618 Ga0207711_10009676 3300025941 Bacteria 8031
619 Ga0207711_10091450 3300025941 Bacteria 2676
620 Ga0207711_10151481 3300025941 Bacteria 2093
621 Ga0207711_10224123 3300025941 Bacteria 1720
622 Ga0207711_10322717 3300025941 Bacteria 1427
623 Ga0207711_10439342 3300025941 Bacteria 1214
624 Ga0207711_10492820 3300025941 Bacteria 1142
625 Ga0207689_10004218 3300025942 Bacteria 13068
626 Ga0207689_10012928 3300025942 Bacteria 7127
627 Ga0207689_10040698 3300025942 Bacteria 3846
628 Ga0207689_10075002 3300025942 Bacteria 2780
629 Ga0207661_10010079 3300025944 Bacteria 6792
630 Ga0207661_10166107 3300025944 Bacteria 1918
631 Ga0207661_10166138 3300025944 Bacteria 1918
632 Ga0207661_10176640 3300025944 Bacteria 1862
633 Ga0207661_10211582 3300025944 Bacteria 1709
634 Ga0207661_10355102 3300025944 Bacteria 1323
635 Ga0207679_10005431 3300025945 Bacteria 7983
636 Ga0207679_10015997 3300025945 Bacteria 4972
637 Ga0207679_10024380 3300025945 Bacteria 4147
638 Ga0207679_10043601 3300025945 Bacteria 3231
639 Ga0207679_10068550 3300025945 Bacteria 2665
640 Ga0207679_10250630 3300025945 Bacteria 1505
641 Ga0207667_10000006 3300025949 Bacteria 679876
642 Ga0207667_10000017 3300025949 Bacteria 390654
643 Ga0207667_10004287 3300025949 Bacteria 17471
644 Ga0207667_10007898 3300025949 Bacteria 12707
645 Ga0207667_10027509 3300025949 Bacteria 6188
646 Ga0207667_10038393 3300025949 Bacteria 5115
647 Ga0207667_10136855 3300025949 Bacteria 2522
648 Ga0207667_10352110 3300025949 Bacteria 1502
649 Ga0207651_10000089 3300025960 Bacteria 40759
650 Ga0207651_10033661 3300025960 Bacteria 3308
651 Ga0207651_10514418 3300025960 Bacteria 1036
652 Ga0207712_10000015 3300025961 Bacteria 346689
653 Ga0207712_10000594 3300025961 Bacteria 28960
654 Ga0207712_10003474 3300025961 Bacteria 9950
655 Ga0207712_10007699 3300025961 Bacteria 6811
656 Ga0207712_10029716 3300025961 Bacteria 3669
657 Ga0207712_10087876 3300025961 Bacteria 2281
658 Ga0207668_10000059 3300025972 Bacteria 91172
659 Ga0207668_10000304 3300025972 Bacteria 32235
660 Ga0207668_10001720 3300025972 Bacteria 12814
661 Ga0207668_10005975 3300025972 Bacteria 7176
662 Ga0207668_10011285 3300025972 Bacteria 5423
663 Ga0207668_10257560 3300025972 Bacteria 1420
664 Ga0207668_10423756 3300025972 Bacteria 1130
665 Ga0207640_10000247 3300025981 Bacteria 36716
666 Ga0207640_10002234 3300025981 Bacteria 10419
667 Ga0207640_10002967 3300025981 Bacteria 9137
668 Ga0207640_10047165 3300025981 Bacteria 2777
669 Ga0207640_10057025 3300025981 Bacteria 2567
670 Ga0207640_10088872 3300025981 Bacteria 2134
671 Ga0207658_10000072 3300025986 Bacteria 112469
672 Ga0207658_10003763 3300025986 Bacteria 10682
673 Ga0207658_10015191 3300025986 Bacteria 5282
674 Ga0207658_10035632 3300025986 Bacteria 3565
675 Ga0207658_10107949 3300025986 Bacteria 2194
676 Ga0207658_10113107 3300025986 Bacteria 2150
677 Ga0207658_10179495 3300025986 Bacteria 1751
678 Ga0207658_10324851 3300025986 Bacteria 1333
679 Ga0207677_10000027 3300026023 Bacteria 125785
680 Ga0207677_10001280 3300026023 Bacteria 13499
681 Ga0207677_10205446 3300026023 Bacteria 1569
682 Ga0207703_10000964 3300026035 Bacteria 27813
683 Ga0207703_10001264 3300026035 Bacteria 23607
684 Ga0207703_10001747 3300026035 Bacteria 19445
685 Ga0207703_10002410 3300026035 Bacteria 16248
686 Ga0207703_10014893 3300026035 Bacteria 6069
687 Ga0207703_10019201 3300026035 Bacteria 5339
688 Ga0207703_10033936 3300026035 Bacteria 4047
689 Ga0207703_10108350 3300026035 Bacteria 2366
690 Ga0207639_10006337 3300026041 Bacteria 8034
691 Ga0207639_10012999 3300026041 Bacteria 5811
692 Ga0207639_10036101 3300026041 Bacteria 3661
693 Ga0207639_10148583 3300026041 Bacteria 1960
694 Ga0207639_10156905 3300026041 Bacteria 1913
695 Ga0207639_10480425 3300026041 Bacteria 1132
696 Ga0207678_10002834 3300026067 Bacteria 15715
697 Ga0207678_10004838 3300026067 Bacteria 12094
698 Ga0207678_10010223 3300026067 Bacteria 8237
699 Ga0207678_10024412 3300026067 Bacteria 5279
700 Ga0207678_10027162 3300026067 Bacteria 4992
701 Ga0207678_10044717 3300026067 Bacteria 3830
702 Ga0207678_10061891 3300026067 Bacteria 3219
703 Ga0207678_10137511 3300026067 Bacteria 2084
704 Ga0207678_10162701 3300026067 Bacteria 1906
705 Ga0207708_10445159 3300026075 Bacteria 1078
706 Ga0207702_10026879 3300026078 Bacteria 4778
707 Ga0207702_10041446 3300026078 Bacteria 3861
708 Ga0207702_10313415 3300026078 Bacteria 1492
709 Ga0207641_10000001 3300026088 Bacteria 1180841
710 Ga0207641_10000096 3300026088 Bacteria 123585
711 Ga0207641_10000908 3300026088 Bacteria 30712
712 Ga0207641_10006744 3300026088 Bacteria 9619
713 Ga0207641_10007252 3300026088 Bacteria 9238
714 Ga0207641_10011882 3300026088 Bacteria 7142
715 Ga0207641_10015144 3300026088 Bacteria 6319
716 Ga0207641_10042228 3300026088 Bacteria 3825
717 Ga0207641_10043210 3300026088 Bacteria 3783
718 Ga0207641_10074587 3300026088 Bacteria 2927
719 Ga0207641_10084621 3300026088 Bacteria 2761
720 Ga0207648_10000606 3300026089 Bacteria 40277
721 Ga0207676_10000504 3300026095 Bacteria 32958
722 Ga0207676_10001742 3300026095 Bacteria 15995
723 Ga0207676_10009345 3300026095 Bacteria 6976
724 Ga0207676_10079697 3300026095 Bacteria 2656
725 Ga0207676_10087092 3300026095 Bacteria 2553
726 Ga0207676_10317237 3300026095 Bacteria 1429
727 Ga0207674_10000271 3300026116 Bacteria 65366
728 Ga0207674_10000780 3300026116 Bacteria 41514
729 Ga0207674_10004321 3300026116 Bacteria 17130
730 Ga0207674_10005179 3300026116 Bacteria 15532
731 Ga0207674_10070662 3300026116 Bacteria 3510
732 Ga0207674_10251717 3300026116 Bacteria 1713
733 Ga0207674_10346568 3300026116 Bacteria 1436
734 Ga0207674_10346569 3300026116 Bacteria 1436
735 Ga0207675_100008088 3300026118 Bacteria 9907
736 Ga0207675_100210171 3300026118 Bacteria 1871
737 Ga0207675_100220285 3300026118 Bacteria 1828
738 Ga0207683_10000461 3300026121 Bacteria 37803
739 Ga0207683_10054242 3300026121 Bacteria 3515
740 Ga0207698_10001768 3300026142 Bacteria 12614
741 Ga0207698_10005561 3300026142 Bacteria 7792
742 Ga0207698_10006239 3300026142 Bacteria 7424
743 Ga0207698_10012244 3300026142 Bacteria 5604
744 Ga0207698_10297007 3300026142 Bacteria 1502
745 Ga0207698_10585488 3300026142 Bacteria 1098
746 Ga0209813_10000040 3300027866 Bacteria 53861
747 Ga0268266_10000002 3300028379 Bacteria 3059047
748 Ga0268266_10000058 3300028379 Bacteria 277346
749 Ga0268266_10014112 3300028379 Bacteria 6878
750 Ga0268266_10051270 3300028379 Bacteria 3542
751 Ga0268266_10138095 3300028379 Bacteria 2185
752 Ga0268266_10142860 3300028379 Bacteria 2149
753 Ga0268266_10167409 3300028379 Bacteria 1992
754 Ga0268266_10174767 3300028379 Bacteria 1952
755 Ga0268266_10357493 3300028379 Bacteria 1373
756 Ga0268266_10432113 3300028379 Bacteria 1249
757 Ga0268266_10593984 3300028379 Bacteria 1063
758 Ga0268265_10000168 3300028380 Bacteria 79798
759 Ga0268265_10001439 3300028380 Bacteria 20070
760 Ga0268265_10012399 3300028380 Bacteria 5776
761 Ga0268265_10023200 3300028380 Bacteria 4371
762 Ga0268265_10100646 3300028380 Bacteria 2333
763 Ga0268265_10261214 3300028380 Bacteria 1540
764 Ga0268265_10473190 3300028380 Bacteria 1175
765 Ga0268264_10000215 3300028381 Bacteria 113994
766 Ga0268264_10004182 3300028381 Bacteria 12331
767 Ga0268264_10004643 3300028381 Bacteria 11672
768 Ga0268264_10005115 3300028381 Bacteria 11117
769 Ga0268264_10006326 3300028381 Bacteria 9980
770 Ga0268264_10017264 3300028381 Bacteria 5912
771 Ga0268264_10018657 3300028381 Bacteria 5671
772 Ga0268264_10026820 3300028381 Bacteria 4707
773 Ga0268264_10130768 3300028381 Bacteria 2225
774 Ga0268264_10132428 3300028381 Bacteria 2212
775 Ga0268264_10432876 3300028381 Bacteria 1271
776 Ga0307517_10010748 3300028786 Bacteria 12762
777 Ga0307517_10029515 3300028786 Bacteria 6472
778 Ga0314311_1121879 3300030733 Bacteria 977
779 Ga0316180_1099107 3300030736 Bacteria 1709
780 Ga0265340_10032559 3300031247 Bacteria 2602
781 Ga0265331_10014701 3300031250 Bacteria 4159
782 Ga0307513_10103172 3300031456 Bacteria 2869
783 Ga0307513_10289885 3300031456 Bacteria 1409
784 Ga0307408_100111441 3300031548 Bacteria 2102
785 Ga0307408_100185095 3300031548 Bacteria 1673
786 Ga0307408_100266779 3300031548 Bacteria 1419
787 Ga0307408_100316641 3300031548 Bacteria 1313
788 Ga0307508_10024189 3300031616 Bacteria 5513
789 Ga0316579_10017681 3300031691 Bacteria 3130
790 Ga0307405_10090606 3300031731 Bacteria 2023
791 Ga0307405_10097473 3300031731 Bacteria 1963
792 Ga0307405_10101665 3300031731 Bacteria 1929
793 Ga0307405_10134220 3300031731 Bacteria 1716
794 Ga0307405_10380845 3300031731 Bacteria 1098
795 Ga0307405_10393632 3300031731 Bacteria 1082
796 Ga0307413_10001088 3300031824 Bacteria 9936
797 Ga0307413_10001468 3300031824 Bacteria 8960
798 Ga0307413_10019027 3300031824 Bacteria 3617
799 Ga0307413_10022623 3300031824 Bacteria 3391
800 Ga0307413_10026569 3300031824 Bacteria 3192
801 Ga0307413_10027214 3300031824 Bacteria 3165
802 Ga0307413_10040320 3300031824 Bacteria 2724
803 Ga0307413_10046517 3300031824 Bacteria 2580
804 Ga0307413_10079428 3300031824 Bacteria 2097
805 Ga0307413_10099336 3300031824 Bacteria 1918
806 Ga0307413_10176385 3300031824 Bacteria 1519
807 Ga0307410_10003712 3300031852 Bacteria 7728
808 Ga0307410_10008450 3300031852 Bacteria 5708
809 Ga0307410_10011027 3300031852 Bacteria 5151
810 Ga0307410_10023280 3300031852 Bacteria 3847
811 Ga0307410_10028537 3300031852 Bacteria 3542
812 Ga0307410_10051899 3300031852 Bacteria 2766
813 Ga0307410_10056814 3300031852 Bacteria 2662
814 Ga0307410_10064419 3300031852 Bacteria 2518
815 Ga0307410_10066835 3300031852 Bacteria 2478
816 Ga0307410_10068670 3300031852 Bacteria 2448
817 Ga0307410_10175246 3300031852 Bacteria 1619
818 Ga0307410_10275276 3300031852 Bacteria 1318
819 Ga0307410_10341130 3300031852 Bacteria 1194
820 Ga0307406_10175404 3300031901 Bacteria 1555
821 Ga0307406_10184910 3300031901 Bacteria 1520
822 Ga0307406_10196343 3300031901 Bacteria 1482
823 Ga0307407_10020842 3300031903 Bacteria 3367
824 Ga0307407_10043605 3300031903 Bacteria 2522
825 Ga0307407_10046661 3300031903 Bacteria 2454
826 Ga0307407_10052847 3300031903 Bacteria 2335
827 Ga0307407_10265083 3300031903 Bacteria 1183
828 Ga0307407_10386311 3300031903 Bacteria 1001
829 Ga0307412_10009146 3300031911 Bacteria 5677
830 Ga0307412_10015207 3300031911 Bacteria 4555
831 Ga0307412_10019559 3300031911 Bacteria 4104
832 Ga0307412_10021020 3300031911 Bacteria 3981
833 Ga0307412_10025145 3300031911 Bacteria 3684
834 Ga0307412_10027423 3300031911 Bacteria 3551
835 Ga0307412_10073959 3300031911 Bacteria 2333
836 Ga0307412_10087149 3300031911 Bacteria 2175
837 Ga0307409_100016259 3300031995 Bacteria 4916
838 Ga0307409_100044184 3300031995 Bacteria 3353
839 Ga0307409_100623889 3300031995 Bacteria 1068
840 Ga0307416_100017877 3300032002 Bacteria 4977
841 Ga0307416_100018741 3300032002 Bacteria 4886
842 Ga0307416_100023157 3300032002 Bacteria 4502
843 Ga0307416_100063263 3300032002 Bacteria 3029
844 Ga0307416_100161883 3300032002 Bacteria 2069
845 Ga0307416_100214232 3300032002 Bacteria 1840
846 Ga0307416_100244172 3300032002 Bacteria 1743
847 Ga0307416_100328841 3300032002 Bacteria 1535
848 Ga0307414_10003931 3300032004 Bacteria 8009
849 Ga0307414_10005249 3300032004 Bacteria 7121
850 Ga0307414_10023089 3300032004 Bacteria 3937
851 Ga0307414_10026742 3300032004 Bacteria 3718
852 Ga0307414_10047995 3300032004 Bacteria 2942
853 Ga0307414_10048782 3300032004 Bacteria 2923
854 Ga0307414_10066831 3300032004 Bacteria 2572
855 Ga0307414_10068246 3300032004 Bacteria 2550
856 Ga0307414_10074774 3300032004 Bacteria 2456
857 Ga0307414_10120721 3300032004 Bacteria 2014
858 Ga0307414_10161119 3300032004 Bacteria 1782
859 Ga0307414_10166867 3300032004 Bacteria 1755
860 Ga0307414_10213646 3300032004 Bacteria 1578
861 Ga0307414_10233542 3300032004 Bacteria 1518
862 Ga0307414_10234921 3300032004 Bacteria 1514
863 Ga0307414_10240655 3300032004 Bacteria 1498
864 Ga0307414_10369188 3300032004 Bacteria 1237
865 Ga0307414_10578171 3300032004 Bacteria 1005
866 Ga0307411_10011147 3300032005 Bacteria 4834
867 Ga0307411_10019072 3300032005 Bacteria 3952
868 Ga0307411_10028685 3300032005 Bacteria 3388
869 Ga0307411_10031019 3300032005 Bacteria 3283
870 Ga0307411_10062927 3300032005 Bacteria 2477
871 Ga0307411_10080384 3300032005 Bacteria 2241
872 Ga0307411_10087543 3300032005 Bacteria 2163
873 Ga0307411_10092324 3300032005 Bacteria 2117
874 Ga0307411_10095040 3300032005 Bacteria 2091
875 Ga0307411_10124870 3300032005 Bacteria 1869
876 Ga0307411_10132359 3300032005 Bacteria 1825
877 Ga0307411_10150097 3300032005 Bacteria 1731
878 Ga0307411_10218540 3300032005 Bacteria 1477
879 Ga0307411_10290483 3300032005 Bacteria 1306
880 Ga0307415_100001725 3300032126 Bacteria 10640
881 Ga0307415_100012724 3300032126 Bacteria 4877
882 Ga0307415_100026725 3300032126 Bacteria 3646
883 Ga0307415_100046632 3300032126 Bacteria 2912
884 Ga0307415_100085590 3300032126 Bacteria 2266
885 Ga0307415_100169979 3300032126 Bacteria 1699
886 Ga0307415_100391067 3300032126 Bacteria 1184
887 Ga0307415_100426869 3300032126 Bacteria 1139
888 Ga0316583_10001892 3300032133 Bacteria 7140
889 Ga0316583_10006442 3300032133 Bacteria 4216
890 Ga0307510_10003694 3300033180 Bacteria 17878
891 Ga0307510_10028981 3300033180 Bacteria 6309
892 Ga0307510_10076162 3300033180 Bacteria 3302
893 Ga0373928_0058278 3300035084 Bacteria 928
894 Ga0373960_0021613 3300035121 Bacteria 1713
895 Ga0373962_0018027 3300035242 Bacteria 1833
896 Ga0373927_0165678 3300035695 Bacteria 1448
897 Ga0373937_0018050 3300036401 Bacteria 6292
898 Ga0373937_0082332 3300036401 Bacteria 2978
899 Ga0316582_0083135 3300036647 Bacteria 2094
900 Ga0316582_0342637 3300036647 Bacteria 1028
901 Ga0373925_0264000 3300037068 Bacteria 1383
902 Ga0395899_0000162 3300037312 Bacteria 102362
903 Ga0395899_0000224 3300037312 Bacteria 76706
904 Ga0395899_0001939 3300037312 Bacteria 17035
905 Ga0395899_0001948 3300037312 Bacteria 16981
906 Ga0395899_0002805 3300037312 Bacteria 14039
907 Ga0395899_0008499 3300037312 Bacteria 7909
908 Ga0395899_0019306 3300037312 Bacteria 5179
909 Ga0395899_0024041 3300037312 Bacteria 4608
910 Ga0395899_0033871 3300037312 Bacteria 3836
911 Ga0395899_0035497 3300037312 Bacteria 3743
912 Ga0395899_0063807 3300037312 Bacteria 2709
913 Ga0395899_0125782 3300037312 Bacteria 1833
914 Ga0395899_0147127 3300037312 Bacteria 1672
915 Ga0395899_0193804 3300037312 Bacteria 1421
916 Ga0395899_0210424 3300037312 Bacteria 1351
917 Ga0395899_0215893 3300037312 Bacteria 1331
918 Ga0395900_0000129 3300037418 Bacteria 126281
919 Ga0395900_0000294 3300037418 Bacteria 75260
920 Ga0395900_0001134 3300037418 Bacteria 33662
921 Ga0395900_0001825 3300037418 Bacteria 24311
922 Ga0395900_0006995 3300037418 Bacteria 11687
923 Ga0395900_0007653 3300037418 Bacteria 11152
924 Ga0395900_0008760 3300037418 Bacteria 10394
925 Ga0395900_0009452 3300037418 Bacteria 9992
926 Ga0395900_0019610 3300037418 Bacteria 6895
927 Ga0395900_0023286 3300037418 Bacteria 6338
928 Ga0395900_0036445 3300037418 Bacteria 5071
929 Ga0395900_0063160 3300037418 Bacteria 3806
930 Ga0395900_0074997 3300037418 Bacteria 3477
931 Ga0395900_0083272 3300037418 Bacteria 3286
932 Ga0395900_0091020 3300037418 Bacteria 3135
933 Ga0395900_0104333 3300037418 Bacteria 2912
934 Ga0395900_0107768 3300037418 Bacteria 2862
935 Ga0395900_0126579 3300037418 Bacteria 2620
936 Ga0395900_0150009 3300037418 Bacteria 2382
937 Ga0395900_0170507 3300037418 Bacteria 2216
938 Ga0395900_0188788 3300037418 Bacteria 2091
939 Ga0395900_0190646 3300037418 Bacteria 2079
940 Ga0395900_0259655 3300037418 Bacteria 1735
941 Ga0395900_0282989 3300037418 Bacteria 1649
942 Ga0395900_0296070 3300037418 Bacteria 1606
943 Ga0395900_0338474 3300037418 Bacteria 1481
944 Ga0395900_0371103 3300037418 Bacteria 1401
945 Ga0395898_0000192 3300037466 Bacteria 156121
946 Ga0395898_0002761 3300037466 Bacteria 20224
947 Ga0395898_0012813 3300037466 Bacteria 8656
948 Ga0395898_0013378 3300037466 Bacteria 8452
949 Ga0395898_0021649 3300037466 Bacteria 6517
950 Ga0395898_0022572 3300037466 Bacteria 6372
951 Ga0395898_0048940 3300037466 Bacteria 4144
952 Ga0395898_0054560 3300037466 Bacteria 3899
953 Ga0395898_0087043 3300037466 Bacteria 3010
954 Ga0395898_0092716 3300037466 Bacteria 2904
955 Ga0395898_0135223 3300037466 Bacteria 2360
956 Ga0395898_0208227 3300037466 Bacteria 1866
957 Ga0395898_0231585 3300037466 Bacteria 1762
958 Ga0395898_0252856 3300037466 Bacteria 1680
959 Ga0395898_0294578 3300037466 Bacteria 1548
960 Ga0395898_0379531 3300037466 Bacteria 1348
961 Ga0395905_0000066 3300037471 Bacteria 183121
962 Ga0395905_0000128 3300037471 Bacteria 124305
963 Ga0395905_0001605 3300037471 Bacteria 26873
964 Ga0395905_0001734 3300037471 Bacteria 25503
965 Ga0395905_0001888 3300037471 Bacteria 24158
966 Ga0395905_0001997 3300037471 Bacteria 23312
967 Ga0395905_0022884 3300037471 Bacteria 5906
968 Ga0395905_0023006 3300037471 Bacteria 5890
969 Ga0395905_0027314 3300037471 Bacteria 5382
970 Ga0395905_0028944 3300037471 Bacteria 5221
971 Ga0395905_0042055 3300037471 Bacteria 4287
972 Ga0395905_0048295 3300037471 Bacteria 3989
973 Ga0395905_0061018 3300037471 Bacteria 3526
974 Ga0395905_0069419 3300037471 Bacteria 3300
975 Ga0395905_0083865 3300037471 Bacteria 2985
976 Ga0395905_0091575 3300037471 Bacteria 2851
977 Ga0395905_0100347 3300037471 Bacteria 2718
978 Ga0395905_0134488 3300037471 Bacteria 2326
979 Ga0395905_0199299 3300037471 Bacteria 1877
980 Ga0395905_0211160 3300037471 Bacteria 1818
981 Ga0395905_0213386 3300037471 Bacteria 1808
982 Ga0395905_0299394 3300037471 Bacteria 1496
983 Ga0395905_0412350 3300037471 Bacteria 1246
984 Ga0436364_0493604 3300037853 Bacteria 1886
985 Ga0436364_0511383 3300037853 Bacteria 2790
986 Ga0395901_0000111 3300038443 Bacteria 112522
987 Ga0395901_0000232 3300038443 Bacteria 69963
988 Ga0395901_0001486 3300038443 Bacteria 24389
989 Ga0395901_0002513 3300038443 Bacteria 18561
990 Ga0395901_0008904 3300038443 Bacteria 10165
991 Ga0395901_0009612 3300038443 Bacteria 9811
992 Ga0395901_0009785 3300038443 Bacteria 9723
993 Ga0395901_0028578 3300038443 Bacteria 5735
994 Ga0395901_0045088 3300038443 Bacteria 4575
995 Ga0395901_0053332 3300038443 Bacteria 4201
996 Ga0395901_0131181 3300038443 Bacteria 2633
997 Ga0395901_0197131 3300038443 Bacteria 2111
998 Ga0395901_0204862 3300038443 Bacteria 2067
999 Ga0395901_0229119 3300038443 Bacteria 1940
1000 Ga0395901_0263796 3300038443 Bacteria 1792
1001 Ga0395901_0352976 3300038443 Bacteria 1517
1002 Ga0395901_0393196 3300038443 Bacteria 1425
1003 Ga0395901_0594545 3300038443 Bacteria 1116
1004 Ga0436365_0231014 3300039437 Bacteria 2479
1005 Ga0436365_0893196 3300039437 Bacteria 2424
1006 Ga0436365_1036954 3300039437 Bacteria 1313
1007 Ga0436365_1205090 3300039437 Bacteria 128002
1008 Ga0436365_1216902 3300039437 Bacteria 6301
1009 Ga0436365_1460153 3300039437 Bacteria 77405
1010 Ga0436360_0381469 3300039438 Bacteria 12708
1011 Ga0436360_0635337 3300039438 Bacteria 3988
1012 Ga0436363_0994942 3300039450 Bacteria 1155
1013 Ga0436362_0634959 3300039453 Bacteria 65311
1014 Ga0439436_0002205 3300041404 Bacteria 5825
1015 Ga0439439_0014019 3300041406 Bacteria 1948
1016 Ga0439461_0001565 3300041410 Bacteria 3552
1017 Ga0439465_0004134 3300041413 Bacteria 4721
1018 Ga0439465_0017108 3300041413 Bacteria 2262
1019 Ga0439431_0000998 3300041997 Bacteria 6146
1020 Ga0439442_000707 3300042002 Bacteria 7026
1021 Ga0439443_018301 3300042003 Bacteria 1084
1022 Ga0439445_0006583 3300042004 Bacteria 2673
1023 Ga0439445_0024206 3300042004 Bacteria 1542
1024 Ga0439445_0024478 3300042004 Bacteria 1536
1025 Ga0439445_0030853 3300042004 Bacteria 1391
1026 Ga0439448_0002135 3300042005 Bacteria 5323
1027 Ga0439448_0004171 3300042005 Bacteria 4068
1028 Ga0439448_0014460 3300042005 Bacteria 2380
1029 Ga0439448_0014769 3300042005 Bacteria 2358
1030 Ga0439432_003066 3300042006 Bacteria 6223
1031 Ga0439432_012793 3300042006 Bacteria 2861
1032 Ga0439450_003529 3300042008 Bacteria 2594
1033 Ga0439455_0000079 3300042012 Bacteria 9004
1034 Ga0439455_0000382 3300042012 Bacteria 5819
1035 Ga0439455_0009079 3300042012 Bacteria 2149
1036 Ga0439455_0025260 3300042012 Bacteria 1443
1037 Ga0439462_0000506 3300042015 Bacteria 7675
1038 Ga0439462_0009457 3300042015 Bacteria 2466
1039 Ga0450912_000186 3300042116 Bacteria 2543
1040 Ga0450914_002118 3300042118 Bacteria 1371
1041 Ga0450890_001357 3300042127 Bacteria 3538
1042 Ga0450905_003605 3300042142 Bacteria 2037
1043 Ga0450889_001641 3300042144 Bacteria 2277
1044 Ga0439446_0011876 3300042156 Bacteria 2372
1045 Ga0439458_0000034 3300042157 Bacteria 21567
1046 Ga0439458_0000074 3300042157 Bacteria 18402
1047 Ga0439458_0000621 3300042157 Bacteria 9172
1048 Ga0439458_0000807 3300042157 Bacteria 8044
1049 Ga0439458_0000965 3300042157 Bacteria 7382
1050 Ga0450909_011686 3300042185 Bacteria 1287
1051 Ga0439434_0001116 3300042435 Bacteria 7760
1052 Ga0439434_0034378 3300042435 Bacteria 1547
1053 Ga0466969_0003255 3300044656 Bacteria 8636
1054 Ga0466969_0008227 3300044656 Bacteria 5533
1055 Ga0466969_0052308 3300044656 Bacteria 2007
1056 Ga0466972_0090715 3300044658 Bacteria 1449
1057 Ga0466965_0144659 3300044683 Bacteria 1240
1058 Ga0466966_0000939 3300044684 Bacteria 18614
1059 Ga0466966_0008259 3300044684 Bacteria 6904
1060 Ga0466961_0000685 3300044693 Bacteria 21410
1061 Ga0466961_0014522 3300044693 Bacteria 5060
1062 Ga0466961_0087796 3300044693 Bacteria 1965
1063 Ga0466961_0092444 3300044693 Bacteria 1909
1064 Ga0466963_0008262 3300044694 Bacteria 6237
1065 Ga0466963_0008742 3300044694 Bacteria 6081
1066 Ga0466963_0032333 3300044694 Bacteria 3387
1067 Ga0466963_0057470 3300044694 Bacteria 2590
1068 Ga0466963_0263933 3300044694 Bacteria 1209
1069 Ga0466964_0005651 3300044706 Bacteria 4649
1070 Ga0466964_0014389 3300044706 Bacteria 3008
1071 Ga0466971_0003486 3300044719 Bacteria 6718
1072 Ga0466971_0016214 3300044719 Bacteria 3283
1073 Ga0466971_0159790 3300044719 Bacteria 1055
1074 Ga0466968_0014627 3300044735 Bacteria 3103
1075 Ga0466957_0001326 3300044842 Bacteria 12924
1076 Ga0466957_0001949 3300044842 Bacteria 10963
1077 Ga0466957_0029015 3300044842 Bacteria 3296
1078 Ga0466957_0192672 3300044842 Bacteria 1336
1079 Ga0466957_0234466 3300044842 Bacteria 1216
1080 Ga0466960_0006025 3300044901 Bacteria 4841
1081 Ga0466960_0182746 3300044901 Bacteria 1137
1082 Ga0466959_0006389 3300045049 Bacteria 8159
1083 Ga0466959_0009532 3300045049 Bacteria 6909
1084 Ga0466959_0049315 3300045049 Bacteria 3093
1085 Ga0466959_0077272 3300045049 Bacteria 2403
1086 Ga0466959_0114812 3300045049 Bacteria 1918
1087 Ga0466958_0001249 3300045836 Bacteria 11903
1088 Ga0466958_0009859 3300045836 Bacteria 5332
1089 Ga0466958_0109623 3300045836 Bacteria 1723
1090 Ga0466958_0169671 3300045836 Bacteria 1381
1091 Ga0466967_0012464 3300045976 Bacteria 6505
1092 Ga0466967_0063792 3300045976 Bacteria 3275
1093 Ga0466967_0070428 3300045976 Bacteria 3129
1094 Ga0466967_0097888 3300045976 Bacteria 2678
1095 Ga0466967_0117056 3300045976 Bacteria 2456
1096 Ga0466967_0236075 3300045976 Bacteria 1742
1097 Ga0495617_003842 3300046452 Bacteria 5540
1098 Ga0495617_013158 3300046452 Bacteria 2818
1099 Ga0495627_000135 3300046453 Bacteria 87716
1100 Ga0495592_0315909 3300046454 Bacteria 1011
1101 Ga0495590_0080031 3300046457 Bacteria 1151
1102 Ga0495629_0222145 3300046459 Bacteria 1303
1103 Ga0495638_0010351 3300046460 Bacteria 6486
1104 Ga0495638_0098711 3300046460 Bacteria 1749
1105 Ga0495650_0000722 3300046471 Bacteria 41881
1106 Ga0495650_0001914 3300046471 Bacteria 18442
1107 Ga0495585_0000750 3300046492 Bacteria 28753
1108 Ga0495585_0022979 3300046492 Bacteria 3579
1109 Ga0495585_0030185 3300046492 Bacteria 3084
1110 Ga0495585_0096914 3300046492 Bacteria 1582
1111 Ga0495596_0020240 3300046500 Bacteria 2726
1112 Ga0495583_0000286 3300046506 Bacteria 80417
1113 Ga0495583_0000447 3300046506 Bacteria 61780
1114 Ga0495583_0013877 3300046506 Bacteria 4467
1115 Ga0495583_0018865 3300046506 Bacteria 3617
1116 Ga0495583_0031180 3300046506 Bacteria 2587
1117 Ga0495583_0066779 3300046506 Bacteria 1590
1118 Ga0495606_0002225 3300046507 Bacteria 23137
1119 Ga0495606_0024850 3300046507 Bacteria 4305
1120 Ga0495606_0060587 3300046507 Bacteria 2423
1121 Ga0495606_0129258 3300046507 Bacteria 1503
1122 Ga0495610_0000072 3300046512 Bacteria 120618
1123 Ga0495610_0038514 3300046512 Bacteria 2426
1124 Ga0495616_0000066 3300046513 Bacteria 90234
1125 Ga0495616_0017996 3300046513 Bacteria 3890
1126 Ga0495643_0000940 3300046522 Bacteria 30168
1127 Ga0495643_0003621 3300046522 Bacteria 11226
1128 Ga0495643_0026819 3300046522 Bacteria 3245
1129 Ga0495643_0033261 3300046522 Bacteria 2854
1130 Ga0495648_0000189 3300046524 Bacteria 70824
1131 Ga0495648_0012514 3300046524 Bacteria 6324
1132 Ga0495648_0113094 3300046524 Bacteria 1473
1133 Ga0495663_0000482 3300046525 Bacteria 14476
1134 Ga0495663_0079844 3300046525 Bacteria 1052
1135 Ga0495598_0002468 3300046537 Bacteria 3823
1136 Ga0495621_0007814 3300046539 Bacteria 3179
1137 Ga0495633_0000547 3300046558 Bacteria 37231
1138 Ga0495633_0014867 3300046558 Bacteria 4051
1139 Ga0495633_0148123 3300046558 Bacteria 1084
1140 Ga0495656_0169907 3300046615 Bacteria 1065
1141 Ga0495668_0000181 3300046616 Bacteria 94147
1142 Ga0495668_0021027 3300046616 Bacteria 3747
1143 Ga0495668_0187500 3300046616 Bacteria 1133
1144 Ga0495611_0004801 3300046648 Bacteria 5809
1145 Ga0495611_0148017 3300046648 Bacteria 1096
1146 Ga0495625_0000054 3300046660 Bacteria 187599
1147 Ga0495625_0001233 3300046660 Bacteria 32326
1148 Ga0495625_0005046 3300046660 Bacteria 12236
1149 Ga0495625_0150090 3300046660 Bacteria 1567
1150 Ga0495625_0294058 3300046660 Bacteria 1041
1151 Ga0495661_0019731 3300046665 Bacteria 4413
1152 Ga0495661_0060631 3300046665 Bacteria 2247
1153 Ga0495623_0118763 3300046679 Bacteria 1594
1154 Ga0495669_0000155 3300046684 Bacteria 43475
1155 Ga0495670_0002776 3300046691 Bacteria 8660
1156 Ga0495670_0009176 3300046691 Bacteria 4864
1157 Ga0495670_0031792 3300046691 Bacteria 2623
1158 Ga0495670_0083143 3300046691 Bacteria 1633
1159 Ga0495649_0050260 3300046694 Bacteria 2263
1160 Ga0495600_0005126 3300046809 Bacteria 7876
1161 Ga0495604_0274965 3300047317 Bacteria 1140
1162 Ga0495683_0095961 3300047323 Bacteria 1431
1163 Ga0495687_000109 3300047443 Bacteria 125648
1164 Ga0495687_001304 3300047443 Bacteria 23398
1165 Ga0495687_018678 3300047443 Bacteria 3421
1166 Ga0495677_0002113 3300047445 Bacteria 7876
1167 Ga0495677_0002115 3300047445 Bacteria 7874
1168 Ga0495677_0008339 3300047445 Bacteria 3852
1169 Ga0495681_0000043 3300047470 Bacteria 115514
1170 Ga0495681_0058476 3300047470 Bacteria 1786
1171 Ga0495686_0000733 3300047472 Bacteria 43762
1172 Ga0495686_0001070 3300047472 Bacteria 32619
1173 Ga0495686_0002694 3300047472 Bacteria 16296
1174 Ga0495686_0011612 3300047472 Bacteria 6201
1175 Ga0495686_0076030 3300047472 Bacteria 2058
1176 Ga0495602_0004945 3300048088 Bacteria 13964
1177 Ga0496100_0006118 3300048903 Bacteria 6542
1178 Ga0496100_0007024 3300048903 Bacteria 6177
1179 Ga0496101_0017196 3300048904 Bacteria 4901
1180 Ga0496101_0058550 3300048904 Bacteria 2790
1181 Ga0496101_0245378 3300048904 Bacteria 1394
1182 Ga0496102_0000126 3300048905 Bacteria 105053
1183 Ga0496102_0000372 3300048905 Bacteria 53776
1184 Ga0496102_0022268 3300048905 Bacteria 5614
1185 Ga0496102_0308113 3300048905 Bacteria 1492
1186 Ga0496103_0000021 3300048906 Bacteria 229062
1187 Ga0496103_0000089 3300048906 Bacteria 104353
1188 Ga0496103_0102180 3300048906 Bacteria 1815
1189 Ga0496104_0000128 3300048907 Bacteria 70094
1190 Ga0496104_0068640 3300048907 Bacteria 3368
1191 Ga0496105_0000064 3300048908 Bacteria 83935
1192 Ga0496105_0000162 3300048908 Bacteria 44507
1193 Ga0496105_0050705 3300048908 Bacteria 3428
1194 Ga0496105_0253672 3300048908 Bacteria 1425
1195 Ga0496106_0002666 3300048909 Bacteria 13286
1196 Ga0496106_0006171 3300048909 Bacteria 8861
1197 Ga0496106_0208569 3300048909 Bacteria 1556
1198 Ga0496107_0003281 3300048910 Bacteria 10795
1199 Ga0496107_0003647 3300048910 Bacteria 10348
1200 Ga0496107_0027689 3300048910 Bacteria 4025
1201 Ga0496107_0070176 3300048910 Bacteria 2543
1202 Ga0496107_0088850 3300048910 Bacteria 2256
1203 Ga0496107_0213743 3300048910 Bacteria 1434
1204 Ga0496108_0003009 3300048911 Bacteria 13547
1205 Ga0496108_0009470 3300048911 Bacteria 7887
1206 Ga0496108_0015697 3300048911 Bacteria 6178
1207 Ga0496109_0005102 3300048912 Bacteria 10966
1208 Ga0496109_0052130 3300048912 Bacteria 3728
1209 Ga0496109_0088767 3300048912 Bacteria 2857
1210 Ga0496109_0094208 3300048912 Bacteria 2772
1211 Ga0496109_0115774 3300048912 Bacteria 2494
1212 Ga0496109_0203310 3300048912 Bacteria 1862
1213 Ga0496109_0257539 3300048912 Bacteria 1643
1214 Ga0496110_0002141 3300048913 Bacteria 14760
1215 Ga0496110_0005678 3300048913 Bacteria 9796
1216 Ga0496110_0109260 3300048913 Bacteria 2484
1217 Ga0496111_0035457 3300048914 Bacteria 3565
1218 Ga0496111_0051334 3300048914 Bacteria 2977
1219 Ga0496111_0086805 3300048914 Bacteria 2289
1220 Ga0496111_0129127 3300048914 Bacteria 1870
1221 Ga0496111_0169847 3300048914 Bacteria 1620
1222 Ga0496111_0200750 3300048914 Bacteria 1482
1223 Ga0496112_0002308 3300048915 Bacteria 15292
1224 Ga0496112_0006215 3300048915 Bacteria 10459
1225 Ga0496112_0013295 3300048915 Bacteria 7599
1226 Ga0496112_0032315 3300048915 Bacteria 5080
1227 Ga0496112_0033885 3300048915 Bacteria 4967
1228 Ga0496112_0047978 3300048915 Bacteria 4189
1229 Ga0496112_0057220 3300048915 Bacteria 3838
1230 Ga0496112_0127237 3300048915 Bacteria 2518
1231 Ga0496112_0138910 3300048915 Bacteria 2399
1232 Ga0496113_0000044 3300048916 Bacteria 51909
1233 Ga0496113_0001455 3300048916 Bacteria 13176
1234 Ga0496113_0012992 3300048916 Bacteria 5618
1235 Ga0496113_0018901 3300048916 Bacteria 4810
1236 Ga0496113_0023601 3300048916 Bacteria 4362
1237 Ga0496113_0026826 3300048916 Bacteria 4123
1238 Ga0496113_0052006 3300048916 Bacteria 3058
1239 Ga0496114_0009856 3300048917 Bacteria 7593
1240 Ga0496114_0325344 3300048917 Bacteria 1359
1241 Ga0496115_0000147 3300048918 Bacteria 64872
1242 Ga0496115_0302380 3300048918 Bacteria 1311
1243 Ga0496116_0003598 3300048919 Bacteria 15242
1244 Ga0496116_0094763 3300048919 Bacteria 1803
1245 Ga0496117_0000329 3300048920 Bacteria 83691
1246 Ga0496117_0001310 3300048920 Bacteria 36602
1247 Ga0496118_0002303 3300048921 Bacteria 25934
1248 Ga0496118_0042458 3300048921 Bacteria 3586
1249 Ga0496119_0000077 3300048922 Bacteria 143108
1250 Ga0496119_0062558 3300048922 Bacteria 2217
1251 Ga0496120_0001801 3300048923 Bacteria 24031
1252 Ga0496121_0000061 3300048924 Bacteria 275757
1253 Ga0496121_0003147 3300048924 Bacteria 23806
1254 Ga0496121_0006414 3300048924 Bacteria 14621
1255 Ga0496121_0185320 3300048924 Bacteria 1497
1256 Ga0496121_0186642 3300048924 Bacteria 1491
1257 Ga0496121_0275239 3300048924 Bacteria 1155
1258 Ga0496122_0001435 3300048925 Bacteria 38534
1259 Ga0496122_0006634 3300048925 Bacteria 13199
1260 Ga0496122_0013697 3300048925 Bacteria 7912
1261 Ga0496122_0017561 3300048925 Bacteria 6680
1262 Ga0496123_0001103 3300048926 Bacteria 40498
1263 Ga0496123_0002758 3300048926 Bacteria 21026
1264 Ga0496123_0045102 3300048926 Bacteria 3007
1265 Ga0496123_0209215 3300048926 Bacteria 993
1266 Ga0496124_0000041 3300048927 Bacteria 303887
1267 Ga0496124_0314026 3300048927 Bacteria 1125
1268 Ga0496125_0000639 3300048928 Bacteria 58529
1269 Ga0496125_0001135 3300048928 Bacteria 40511
1270 Ga0496125_0110931 3300048928 Bacteria 1987
1271 Ga0496126_0000175 3300048929 Bacteria 146389
1272 Ga0496126_0000324 3300048929 Bacteria 101936
1273 Ga0496126_0012503 3300048929 Bacteria 8691
1274 Ga0495678_001148 3300049459 Bacteria 22016
1275 Ga0495682_0021691 3300049460 Bacteria 2405
1276 Ga0495682_0039747 3300049460 Bacteria 1727
1277 Ga0501031_0047929 3300049568 Bacteria 2785
1278 Ga0501032_0004373 3300049569 Bacteria 10660
1279 Ga0501032_0045265 3300049569 Bacteria 2977
1280 Ga0501033_0021376 3300049570 Bacteria 4881
1281 Ga0501034_0012663 3300049571 Bacteria 8702
1282 Ga0501034_0013383 3300049571 Bacteria 8445
1283 Ga0501034_0025028 3300049571 Bacteria 6073
1284 Ga0501034_0178574 3300049571 Bacteria 2088
1285 Ga0501036_0036879 3300049572 Bacteria 4136
1286 Ga0501037_0018395 3300049573 Bacteria 5150
1287 Ga0501037_0060766 3300049573 Bacteria 2756
1288 Ga0501038_0015639 3300049574 Bacteria 6897
1289 Ga0501038_0030604 3300049574 Bacteria 4760
1290 Ga0501038_0071197 3300049574 Bacteria 2950
1291 Ga0501039_0093415 3300049575 Bacteria 2344
1292 Ga0501043_0103704 3300049579 Bacteria 2234
1293 Ga0501047_0004362 3300049581 Bacteria 13313
1294 Ga0501047_0098866 3300049581 Bacteria 2796
1295 Ga0501047_0179544 3300049581 Bacteria 1983
1296 Ga0501048_0205688 3300049582 Bacteria 1396
1297 Ga0501067_0008234 3300049583 Bacteria 5789
1298 Ga0501068_0127629 3300049584 Bacteria 1589
1299 Ga0501070_0183047 3300049586 Bacteria 1724
1300 Ga0501071_0080137 3300049587 Bacteria 2387
1301 Ga0501073_0032581 3300049589 Bacteria 3715
1302 Ga0501080_0003050 3300049742 Bacteria 14785
1303 Ga0501080_0113121 3300049742 Bacteria 2516
1304 Ga0501083_0183872 3300049744 Bacteria 1364
1305 Ga0501268_012787 3300049765 Bacteria 1347
1306 Ga0501281_00823 3300049777 Bacteria 2660
1307 Ga0501035_0038425 3300049822 Bacteria 4334
1308 Ga0501035_0144629 3300049822 Bacteria 2065
1309 Ga0501044_0013696 3300049823 Bacteria 8765
1310 Ga0501044_0121284 3300049823 Bacteria 2615
1311 Ga0501044_0310223 3300049823 Bacteria 1504
1312 Ga0501044_0334402 3300049823 Bacteria 1437
1313 Ga0501045_0395393 3300049824 Bacteria 1029
1314 nmdc:mga03683_79164_c1 3300050489 Bacteria 1416
1315 nmdc:mga00v17_219625_c1 3300050491 Bacteria 1230
1316 nmdc:mga06z11_132_c1 3300050494 Bacteria 29648
1317 nmdc:mga06z11_277033_c1 3300050494 Bacteria 993
1318 nmdc:mga04h51_45_c1 3300050495 Bacteria 40312
1319 nmdc:mga07m45_94299_c1 3300050496 Bacteria 1716
1320 nmdc:mga05p37_756171_c1 3300050507 Bacteria 1070
1321 nmdc:mga0qj67_134471_c1 3300050509 Bacteria 2003
1322 nmdc:mga0n895_337393_c1 3300050512 Bacteria 1527
1323 Ga0500610_0000193 3300053079 Bacteria 18460
1324 Ga0500578_0000035 3300053086 Bacteria 136406
1325 Ga0500643_000004 3300053087 Bacteria 857484
1326 Ga0500643_000172 3300053087 Bacteria 63436
1327 Ga0500643_000419 3300053087 Bacteria 32299
1328 Ga0500643_003252 3300053087 Bacteria 7912
1329 Ga0500646_0020342 3300053090 Bacteria 1763
1330 Ga0500566_0001517 3300053094 Bacteria 13621
1331 Ga0500641_0006162 3300053096 Bacteria 4251
1332 Ga0500555_000197 3300053103 Bacteria 27950
1333 Ga0500594_0000238 3300053118 Bacteria 13288
1334 Ga0500595_012674 3300053119 Bacteria 3252
1335 Ga0500595_019369 3300053119 Bacteria 2470
1336 Ga0500595_027867 3300053119 Bacteria 1930
1337 Ga0500658_0007413 3300053134 Bacteria 4054
1338 Ga0500658_0014013 3300053134 Bacteria 2965
1339 Ga0500658_0025472 3300053134 Bacteria 2274
1340 Ga0500559_0003399 3300053136 Bacteria 7838
1341 Ga0500559_0063052 3300053136 Bacteria 1656
1342 Ga0500559_0071221 3300053136 Bacteria 1565
1343 Ga0500568_0002255 3300053139 Bacteria 11528
1344 Ga0500568_0064445 3300053139 Bacteria 1412
1345 Ga0500573_0000015 3300053140 Bacteria 192264
1346 Ga0500616_0002649 3300053153 Bacteria 14567
1347 Ga0500616_0004406 3300053153 Bacteria 10044
1348 Ga0500624_000041 3300053157 Bacteria 90321
1349 Ga0500636_0002216 3300053177 Bacteria 10762
1350 Ga0500637_0000072 3300053178 Bacteria 36044
1351 Ga0500645_000001 3300053730 Bacteria 455558
1352 Ga0500661_000324 3300055283 Bacteria 8754
1353 Ga0501082_0024476 3300060353 Bacteria 5204
1354 Ga0466962_0000330 3300061719 Bacteria 20297
1355 Ga0466962_0004914 3300061719 Bacteria 6427
1356 Ga0466962_0157110 3300061719 Bacteria 1105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1036954 Ga0436365_1036954_263_997 238
2 3300048918 Ga0496115_0302380 Ga0496115_0302380_487_1293 258
3 3300005347 Ga0070668_100017252 Ga0070668_1000172526 260
4 3300005353 Ga0070669_100051871 Ga0070669_1000518712 260
5 3300025972 Ga0207668_10011285 Ga0207668_100112855 260
6 3300016635 Ga0183361_10078 Ga0183361_100781 264
7 3300037312 Ga0395899_0215893 Ga0395899_0215893_15_842 264
8 3300037853 Ga0436364_0511383 Ga0436364_0511383_418_1401 264
9 3300037312 Ga0395899_0033871 Ga0395899_0033871_2564_3466 265
10 3300037466 Ga0395898_0379531 Ga0395898_0379531_69_971 265
11 3300037471 Ga0395905_0048295 Ga0395905_0048295_3038_3940 265
12 3300053730 Ga0500645_000001 Ga0500645_000001_342988_343875 265
13 3300037418 Ga0395900_0036445 Ga0395900_0036445_201_1103 266
14 3300005564 Ga0070664_100022439 Ga0070664_1000224392 267
15 3300013104 Ga0157370_10042639 Ga0157370_100426394 267
16 3300044901 Ga0466960_0182746 Ga0466960_0182746_102_1004 267
17 3300047472 Ga0495686_0001070 Ga0495686_0001070_29093_29977 267
18 3300005535 Ga0070684_100023225 Ga0070684_1000232253 268
19 3300005577 Ga0068857_100048254 Ga0068857_1000482546 268
20 3300005614 Ga0068856_100403414 Ga0068856_1004034142 268
21 3300009553 Ga0105249_10011511 Ga0105249_100115113 268
22 3300025904 Ga0207647_10015034 Ga0207647_100150342 268
23 3300025919 Ga0207657_10005882 Ga0207657_100058829 268
24 3300025944 Ga0207661_10010079 Ga0207661_100100796 268
25 3300025961 Ga0207712_10029716 Ga0207712_100297164 268
26 3300025981 Ga0207640_10047165 Ga0207640_100471652 268
27 3300026078 Ga0207702_10041446 Ga0207702_100414466 268
28 3300026116 Ga0207674_10004321 Ga0207674_100043218 268
29 3300026142 Ga0207698_10006239 Ga0207698_1000623910 268
30 3300045976 Ga0466967_0063792 Ga0466967_0063792_995_1894 268
31 3300049586 Ga0501070_0183047 Ga0501070_0183047_600_1487 268
32 3300049587 Ga0501071_0080137 Ga0501071_0080137_111_998 268
33 3300055283 Ga0500661_000324 Ga0500661_000324_3531_4409 268
34 3300005347 Ga0070668_100000080 Ga0070668_10000008043 269
35 3300005355 Ga0070671_100000169 Ga0070671_1000001694 269
36 3300005841 Ga0068863_100000001 Ga0068863_100000001334 269
37 3300005843 Ga0068860_100182144 Ga0068860_1001821442 269
38 3300025931 Ga0207644_10000012 Ga0207644_1000001284 269
39 3300025972 Ga0207668_10000304 Ga0207668_1000030443 269
40 3300026088 Ga0207641_10000001 Ga0207641_10000001670 269
41 3300028381 Ga0268264_10006326 Ga0268264_100063262 269
42 3300046513 Ga0495616_0000066 Ga0495616_0000066_36494_37378 269
43 3300046616 Ga0495668_0021027 Ga0495668_0021027_2138_3022 269
44 3300026035 Ga0207703_10108350 Ga0207703_101083502 270
45 3300044693 Ga0466961_0092444 Ga0466961_0092444_492_1391 270
46 3300047445 Ga0495677_0008339 Ga0495677_0008339_53_952 270
47 3300061719 Ga0466962_0004914 Ga0466962_0004914_381_1280 270
48 3300005333 Ga0070677_10000133 Ga0070677_1000013315 271
49 3300025893 Ga0207682_10000101 Ga0207682_1000010133 271
50 3300032004 Ga0307414_10066831 Ga0307414_100668314 271
51 3300032005 Ga0307411_10290483 Ga0307411_102904831 271
52 3300044656 Ga0466969_0008227 Ga0466969_0008227_1232_2131 271
53 3300044684 Ga0466966_0000939 Ga0466966_0000939_13125_14024 271
54 3300044693 Ga0466961_0014522 Ga0466961_0014522_300_1199 271
55 3300044694 Ga0466963_0008262 Ga0466963_0008262_1901_2800 271
56 3300044719 Ga0466971_0016214 Ga0466971_0016214_122_1021 271
57 3300044842 Ga0466957_0001326 Ga0466957_0001326_6800_7699 271
58 3300045049 Ga0466959_0009532 Ga0466959_0009532_2279_3178 271
59 3300045836 Ga0466958_0001249 Ga0466958_0001249_4591_5490 271
60 3300046460 Ga0495638_0010351 Ga0495638_0010351_3247_4134 271
61 3300046506 Ga0495583_0000286 Ga0495583_0000286_40457_41344 271
62 3300046665 Ga0495661_0019731 Ga0495661_0019731_1254_2141 271
63 3300046691 Ga0495670_0009176 Ga0495670_0009176_2362_3249 271
64 3300053103 Ga0500555_000197 Ga0500555_000197_24261_25148 271
65 3300038443 Ga0395901_0045088 Ga0395901_0045088_2515_3402 272
66 3300005339 Ga0070660_100019982 Ga0070660_1000199823 273
67 3300005455 Ga0070663_100173082 Ga0070663_1001730821 273
68 3300025919 Ga0207657_10057435 Ga0207657_100574351 273
69 3300026067 Ga0207678_10027162 Ga0207678_100271624 273
70 3300037418 Ga0395900_0126579 Ga0395900_0126579_440_1339 273
71 3300037466 Ga0395898_0252856 Ga0395898_0252856_440_1339 273
72 3300037471 Ga0395905_0027314 Ga0395905_0027314_4429_5328 273
73 3300039437 Ga0436365_1216902 Ga0436365_1216902_4902_5780 273
74 3300048924 Ga0496121_0186642 Ga0496121_0186642_337_1179 273
75 3300005356 Ga0070674_100001061 Ga0070674_1000010614 274
76 3300005364 Ga0070673_100116258 Ga0070673_1001162583 274
77 3300005456 Ga0070678_100007011 Ga0070678_1000070113 274
78 3300005614 Ga0068856_100009131 Ga0068856_10000913112 274
79 3300006195 Ga0075366_10317877 Ga0075366_103178771 274
80 3300006237 Ga0097621_100055110 Ga0097621_1000551103 274
81 3300025937 Ga0207669_10000153 Ga0207669_1000015315 274
82 3300025938 Ga0207704_10053543 Ga0207704_100535432 274
83 3300025960 Ga0207651_10033661 Ga0207651_100336613 274
84 3300026121 Ga0207683_10000461 Ga0207683_1000046115 274
85 3300037418 Ga0395900_0091020 Ga0395900_0091020_482_1384 274
86 3300005365 Ga0070688_100184877 Ga0070688_1001848771 275
87 3300005457 Ga0070662_100044804 Ga0070662_1000448042 275
88 3300005546 Ga0070696_100007442 Ga0070696_1000074424 275
89 3300005547 Ga0070693_100055350 Ga0070693_1000553501 275
90 3300005578 Ga0068854_100042797 Ga0068854_1000427972 275
91 3300013100 Ga0157373_10018912 Ga0157373_100189126 275
92 3300013104 Ga0157370_10404310 Ga0157370_104043102 275
93 3300025926 Ga0207659_10316036 Ga0207659_103160362 275
94 3300025933 Ga0207706_10021981 Ga0207706_100219818 275
95 3300028380 Ga0268265_10261214 Ga0268265_102612142 275
96 3300037418 Ga0395900_0150009 Ga0395900_0150009_517_1371 275
97 3300037471 Ga0395905_0134488 Ga0395905_0134488_206_1063 275
98 3300045976 Ga0466967_0236075 Ga0466967_0236075_851_1708 275
99 3300046453 Ga0495627_000135 Ga0495627_000135_34740_35651 275
100 3300046524 Ga0495648_0012514 Ga0495648_0012514_3543_4454 275
101 3300049571 Ga0501034_0178574 Ga0501034_0178574_864_1739 275
102 3300049573 Ga0501037_0060766 Ga0501037_0060766_29_904 275
103 3300049574 Ga0501038_0030604 Ga0501038_0030604_3843_4718 275
104 3300049579 Ga0501043_0103704 Ga0501043_0103704_1134_2009 275
105 3300053096 Ga0500641_0006162 Ga0500641_0006162_1105_1986 275
106 3300005331 Ga0070670_100046613 Ga0070670_1000466131 276
107 3300005347 Ga0070668_100000019 Ga0070668_10000001952 276
108 3300005353 Ga0070669_100004755 Ga0070669_1000047555 276
109 3300005367 Ga0070667_100000094 Ga0070667_10000009468 276
110 3300005617 Ga0068859_100423982 Ga0068859_1004239822 276
111 3300005841 Ga0068863_100000057 Ga0068863_10000005768 276
112 3300005843 Ga0068860_100004802 Ga0068860_1000048028 276
113 3300005844 Ga0068862_100000148 Ga0068862_10000014817 276
114 3300006931 Ga0097620_100424005 Ga0097620_1004240051 276
115 3300009177 Ga0105248_10011743 Ga0105248_100117433 276
116 3300009177 Ga0105248_10130957 Ga0105248_101309573 276
117 3300009553 Ga0105249_10000196 Ga0105249_1000019658 276
118 3300013104 Ga0157370_10136814 Ga0157370_101368142 276
119 3300025903 Ga0207680_10004789 Ga0207680_100047892 276
120 3300025923 Ga0207681_10004608 Ga0207681_100046085 276
121 3300025925 Ga0207650_10062893 Ga0207650_100628932 276
122 3300025941 Ga0207711_10091450 Ga0207711_100914501 276
123 3300025961 Ga0207712_10000015 Ga0207712_10000015307 276
124 3300025972 Ga0207668_10000059 Ga0207668_1000005925 276
125 3300025986 Ga0207658_10000072 Ga0207658_1000007250 276
126 3300026088 Ga0207641_10000096 Ga0207641_1000009667 276
127 3300028380 Ga0268265_10000168 Ga0268265_1000016863 276
128 3300028381 Ga0268264_10005115 Ga0268264_1000511510 276
129 3300044694 Ga0466963_0008742 Ga0466963_0008742_5115_6005 276
130 3300044719 Ga0466971_0003486 Ga0466971_0003486_90_980 276
131 3300045836 Ga0466958_0009859 Ga0466958_0009859_2480_3370 276
132 3300046471 Ga0495650_0001914 Ga0495650_0001914_14786_15664 276
133 3300061719 Ga0466962_0000330 Ga0466962_0000330_5120_6010 276
134 3300005329 Ga0070683_100444882 Ga0070683_1004448821 277
135 3300005548 Ga0070665_100086833 Ga0070665_1000868333 277
136 3300009551 Ga0105238_10437904 Ga0105238_104379042 277
137 3300021441 Ga0213871_10000096 Ga0213871_1000009610 277
138 3300025944 Ga0207661_10166107 Ga0207661_101661073 277
139 3300028379 Ga0268266_10167409 Ga0268266_101674092 277
140 3300037312 Ga0395899_0063807 Ga0395899_0063807_1044_1937 277
141 3300038443 Ga0395901_0001486 Ga0395901_0001486_1160_2053 277
142 3300039438 Ga0436360_0381469 Ga0436360_0381469_764_1645 277
143 3300046522 Ga0495643_0033261 Ga0495643_0033261_634_1521 277
144 3300046694 Ga0495649_0050260 Ga0495649_0050260_329_1207 277
145 3300047443 Ga0495687_018678 Ga0495687_018678_247_1143 277
146 3300005539 Ga0068853_100093602 Ga0068853_1000936022 278
147 3300005563 Ga0068855_100003254 Ga0068855_10000325428 278
148 3300005937 Ga0081455_10000537 Ga0081455_1000053751 278
149 3300009093 Ga0105240_10098496 Ga0105240_100984962 278
150 3300009551 Ga0105238_10122379 Ga0105238_101223792 278
151 3300013306 Ga0163162_10835787 Ga0163162_108357871 278
152 3300025912 Ga0207707_10049419 Ga0207707_100494193 278
153 3300025913 Ga0207695_10099802 Ga0207695_100998022 278
154 3300025921 Ga0207652_10205845 Ga0207652_102058452 278
155 3300025949 Ga0207667_10027509 Ga0207667_100275091 278
156 3300026041 Ga0207639_10156905 Ga0207639_101569052 278
157 3300026142 Ga0207698_10297007 Ga0207698_102970072 278
158 3300037418 Ga0395900_0008760 Ga0395900_0008760_2712_3608 278
159 3300037466 Ga0395898_0054560 Ga0395898_0054560_1543_2439 278
160 3300038443 Ga0395901_0197131 Ga0395901_0197131_1049_1945 278
161 3300044656 Ga0466969_0052308 Ga0466969_0052308_59_958 278
162 3300045049 Ga0466959_0006389 Ga0466959_0006389_5217_6116 278
163 3300001979 JGI24740J21852_10002361 JGI24740J21852_100023618 279
164 3300001990 JGI24737J22298_10002108 JGI24737J22298_100021083 279
165 3300003759 Ga0055525_1000037 Ga0055525_100003751 279
166 3300003794 Ga0055531_10007455 Ga0055531_100074551 279
167 3300005328 Ga0070676_10063310 Ga0070676_100633103 279
168 3300005329 Ga0070683_100377362 Ga0070683_1003773622 279
169 3300005339 Ga0070660_100050818 Ga0070660_1000508182 279
170 3300005356 Ga0070674_100001978 Ga0070674_1000019788 279
171 3300005366 Ga0070659_100015671 Ga0070659_1000156715 279
172 3300005455 Ga0070663_100005901 Ga0070663_1000059013 279
173 3300005456 Ga0070678_100097327 Ga0070678_1000973273 279
174 3300005457 Ga0070662_100086357 Ga0070662_1000863572 279
175 3300005548 Ga0070665_100000766 Ga0070665_10000076625 279
176 3300005548 Ga0070665_100209201 Ga0070665_1002092012 279
177 3300005564 Ga0070664_100007788 Ga0070664_1000077885 279
178 3300005577 Ga0068857_100189037 Ga0068857_1001890372 279
179 3300005578 Ga0068854_100184744 Ga0068854_1001847443 279
180 3300005614 Ga0068856_100526237 Ga0068856_1005262371 279
181 3300005842 Ga0068858_100000933 Ga0068858_1000009332 279
182 3300009174 Ga0105241_10000871 Ga0105241_1000087111 279
183 3300009551 Ga0105238_10482012 Ga0105238_104820121 279
184 3300013307 Ga0157372_10254709 Ga0157372_102547092 279
185 3300021358 Ga0213873_10000020 Ga0213873_1000002055 279
186 3300021384 Ga0213876_10000004 Ga0213876_10000004451 279
187 3300025230 Ga0209563_100105 Ga0209563_10010583 279
188 3300025304 Ga0209257_1000340 Ga0209257_100034016 279
189 3300025321 Ga0207656_10002728 Ga0207656_100027283 279
190 3300025907 Ga0207645_10054960 Ga0207645_100549601 279
191 3300025911 Ga0207654_10004325 Ga0207654_100043254 279
192 3300025919 Ga0207657_10012642 Ga0207657_100126422 279
193 3300025920 Ga0207649_10001475 Ga0207649_100014758 279
194 3300025924 Ga0207694_10002464 Ga0207694_100024646 279
195 3300025932 Ga0207690_10002671 Ga0207690_100026715 279
196 3300025933 Ga0207706_10083859 Ga0207706_100838592 279
197 3300025937 Ga0207669_10005885 Ga0207669_100058855 279
198 3300025941 Ga0207711_10322717 Ga0207711_103227172 279
199 3300025944 Ga0207661_10166138 Ga0207661_101661383 279
200 3300025945 Ga0207679_10250630 Ga0207679_102506301 279
201 3300025981 Ga0207640_10002234 Ga0207640_100022349 279
202 3300026035 Ga0207703_10000964 Ga0207703_100009642 279
203 3300026041 Ga0207639_10006337 Ga0207639_100063371 279
204 3300026067 Ga0207678_10010223 Ga0207678_100102237 279
205 3300026078 Ga0207702_10313415 Ga0207702_103134151 279
206 3300026116 Ga0207674_10346569 Ga0207674_103465691 279
207 3300026121 Ga0207683_10054242 Ga0207683_100542423 279
208 3300026142 Ga0207698_10001768 Ga0207698_100017686 279
209 3300028379 Ga0268266_10000002 Ga0268266_100000021071 279
210 3300028379 Ga0268266_10138095 Ga0268266_101380952 279
211 3300033180 Ga0307510_10028981 Ga0307510_100289816 279
212 3300035084 Ga0373928_0058278 Ga0373928_0058278_28_900 279
213 3300039437 Ga0436365_1460153 Ga0436365_1460153_18487_19350 279
214 3300039453 Ga0436362_0634959 Ga0436362_0634959_6393_7256 279
215 3300042004 Ga0439445_0024206 Ga0439445_0024206_216_1118 279
216 3300042006 Ga0439432_012793 Ga0439432_012793_1439_2341 279
217 3300042116 Ga0450912_000186 Ga0450912_000186_1156_2058 279
218 3300044656 Ga0466969_0003255 Ga0466969_0003255_5265_6131 279
219 3300044684 Ga0466966_0008259 Ga0466966_0008259_1370_2236 279
220 3300044706 Ga0466964_0014389 Ga0466964_0014389_20_889 279
221 3300045049 Ga0466959_0077272 Ga0466959_0077272_1358_2224 279
222 3300045976 Ga0466967_0070428 Ga0466967_0070428_934_1836 279
223 3300046452 Ga0495617_013158 Ga0495617_013158_342_1229 279
224 3300046454 Ga0495592_0315909 Ga0495592_0315909_113_1000 279
225 3300046459 Ga0495629_0222145 Ga0495629_0222145_336_1223 279
226 3300046471 Ga0495650_0000722 Ga0495650_0000722_17606_18493 279
227 3300046506 Ga0495583_0000447 Ga0495583_0000447_43307_44194 279
228 3300046506 Ga0495583_0013877 Ga0495583_0013877_2195_3082 279
229 3300046507 Ga0495606_0002225 Ga0495606_0002225_20119_21006 279
230 3300046524 Ga0495648_0000189 Ga0495648_0000189_38137_39024 279
231 3300046558 Ga0495633_0000547 Ga0495633_0000547_17088_17975 279
232 3300046558 Ga0495633_0148123 Ga0495633_0148123_174_1061 279
233 3300046616 Ga0495668_0000181 Ga0495668_0000181_41999_42886 279
234 3300046691 Ga0495670_0083143 Ga0495670_0083143_503_1390 279
235 3300046809 Ga0495600_0005126 Ga0495600_0005126_930_1817 279
236 3300047317 Ga0495604_0274965 Ga0495604_0274965_239_1126 279
237 3300048909 Ga0496106_0208569 Ga0496106_0208569_656_1525 279
238 3300048910 Ga0496107_0213743 Ga0496107_0213743_566_1420 279
239 3300048928 Ga0496125_0110931 Ga0496125_0110931_612_1490 279
240 3300049584 Ga0501068_0127629 Ga0501068_0127629_31_900 279
241 3300049823 Ga0501044_0310223 Ga0501044_0310223_637_1482 279
242 3300053079 Ga0500610_0000193 Ga0500610_0000193_10922_11809 279
243 3300053119 Ga0500595_019369 Ga0500595_019369_1550_2437 279
244 3300053136 Ga0500559_0063052 Ga0500559_0063052_12_872 279
245 3300053177 Ga0500636_0002216 Ga0500636_0002216_6569_7456 279
246 3300003214 JGI25165J46597_1000095 JGI25165J46597_1000095141 280
247 3300003762 Ga0055542_1000831 Ga0055542_100083119 280
248 3300003763 Ga0055529_1000207 Ga0055529_100020772 280
249 3300005539 Ga0068853_100053958 Ga0068853_1000539582 280
250 3300006178 Ga0075367_10034944 Ga0075367_100349444 280
251 3300025254 Ga0209148_1000011 Ga0209148_10000111120 280
252 3300025261 Ga0209233_1000052 Ga0209233_100005216 280
253 3300025272 Ga0209455_1000006 Ga0209455_100000672 280
254 3300025907 Ga0207645_10017964 Ga0207645_100179642 280
255 3300046506 Ga0495583_0031180 Ga0495583_0031180_197_1084 280
256 3300046507 Ga0495606_0060587 Ga0495606_0060587_789_1673 280
257 3300047443 Ga0495687_000109 Ga0495687_000109_109256_110143 280
258 3300049571 Ga0501034_0013383 Ga0501034_0013383_3834_4715 280
259 3300050494 nmdc:mga06z11_277033_c1 nmdc:mga06z11_277033_c1_50_931 280
260 3300053153 Ga0500616_0002649 Ga0500616_0002649_1661_2542 280
261 3300005548 Ga0070665_100041107 Ga0070665_1000411074 281
262 3300028379 Ga0268266_10357493 Ga0268266_103574932 281
263 3300031731 Ga0307405_10134220 Ga0307405_101342201 281
264 3300031852 Ga0307410_10028537 Ga0307410_100285374 281
265 3300032004 Ga0307414_10005249 Ga0307414_100052497 281
266 3300032126 Ga0307415_100169979 Ga0307415_1001699792 281
267 3300044683 Ga0466965_0144659 Ga0466965_0144659_205_1101 281
268 3300006177 Ga0075362_10044516 Ga0075362_100445162 282
269 3300006195 Ga0075366_10172017 Ga0075366_101720172 282
270 3300046522 Ga0495643_0026819 Ga0495643_0026819_2331_3218 282
271 3300047445 Ga0495677_0002113 Ga0495677_0002113_6848_7735 282
272 3300049824 Ga0501045_0395393 Ga0501045_0395393_41_916 282
273 3300050489 nmdc:mga03683_79164_c1 nmdc:mga03683_79164_c1_313_1194 282
274 3300031903 Ga0307407_10386311 Ga0307407_103863111 283
275 3300031911 Ga0307412_10019559 Ga0307412_100195593 283
276 3300037418 Ga0395900_0107768 Ga0395900_0107768_564_1463 283
277 3300037466 Ga0395898_0048940 Ga0395898_0048940_2546_3445 283
278 3300038443 Ga0395901_0131181 Ga0395901_0131181_1272_2171 283
279 3300046648 Ga0495611_0148017 Ga0495611_0148017_179_1066 283
280 3300046660 Ga0495625_0005046 Ga0495625_0005046_1143_2030 283
281 3300046684 Ga0495669_0000155 Ga0495669_0000155_904_1791 283
282 3300005344 Ga0070661_100279118 Ga0070661_1002791181 284
283 3300005614 Ga0068856_100123451 Ga0068856_1001234512 284
284 3300025920 Ga0207649_10128536 Ga0207649_101285361 284
285 3300026067 Ga0207678_10024412 Ga0207678_100244124 284
286 3300046460 Ga0495638_0098711 Ga0495638_0098711_787_1674 284
287 3300047472 Ga0495686_0002694 Ga0495686_0002694_11404_12291 284
288 iso_pu_bacteria 2882806704 2882808873 284
289 iso_pu_bacteria 2738541275 2738712990 285
290 iso_pu_bacteria 2738541301 2738851414 285
291 iso_pu_bacteria 2738541304 2738867144 285
292 iso_pu_bacteria 2738543022 2739299661 285
293 iso_pu_bacteria 2738543033 2739361340 285
294 iso_pu_bacteria 2852680915 2852683169 285
295 iso_pu_bacteria 2919138771 2919140819 285
296 iso_pu_bacteria 2946787523 2946789631 285
297 iso_pu_bacteria 2990265787 2990265900 285
298 iso_pu_bacteria 2993693658 2993696309 285
299 3300039438 Ga0436360_0635337 Ga0436360_0635337_1913_2815 286
300 iso_pu_bacteria 2512564014 2512644236 286
301 iso_pu_bacteria 2643221622 2644125919 286
302 iso_pu_bacteria 2738541275 2738711024 286
303 iso_pu_bacteria 2738541301 2738849449 286
304 iso_pu_bacteria 2738541304 2738865178 286
305 iso_pu_bacteria 2738543022 2739297696 286
306 iso_pu_bacteria 2738543033 2739359374 286
307 iso_pu_bacteria 2739367664 2739649030 286
308 iso_pu_bacteria 2739367865 2740027503 286
309 iso_pu_bacteria 2751185897 2753763657 286
310 iso_pu_bacteria 2885429604 2885431740 286
311 iso_pu_bacteria 2928027323 2928029100 286
312 iso_pu_bacteria 2928100450 2928103637 286
313 iso_pu_bacteria 2928959182 2928961354 286
314 iso_pu_bacteria 2984555340 2984556062 286
315 iso_pu_bacteria 2984564862 2984565831 286
316 iso_pu_bacteria 2993356040 2993356841 286
317 iso_pu_bacteria 8057101203 8057105430 286
318 3300001904 JGI24736J21556_1015029 JGI24736J21556_10150291 288
319 3300001989 JGI24739J22299_10001688 JGI24739J22299_100016887 288
320 3300002067 JGI24735J21928_10003681 JGI24735J21928_100036814 288
321 3300002067 JGI24735J21928_10009981 JGI24735J21928_100099812 288
322 3300002067 JGI24735J21928_10010734 JGI24735J21928_100107343 288
323 3300002067 JGI24735J21928_10019661 JGI24735J21928_100196612 288
324 3300002067 JGI24735J21928_10049907 JGI24735J21928_100499072 288
325 3300002075 JGI24738J21930_10001286 JGI24738J21930_100012863 288
326 3300002077 JGI24744J21845_10000353 JGI24744J21845_100003536 288
327 3300003762 Ga0055542_1002655 Ga0055542_10026556 288
328 3300003762 Ga0055542_1015697 Ga0055542_10156971 288
329 3300003794 Ga0055531_10000498 Ga0055531_1000049814 288
330 3300005327 Ga0070658_10001817 Ga0070658_100018178 288
331 3300005327 Ga0070658_10168355 Ga0070658_101683552 288
332 3300005328 Ga0070676_10006127 Ga0070676_100061278 288
333 3300005334 Ga0068869_100001644 Ga0068869_1000016447 288
334 3300005338 Ga0068868_100008489 Ga0068868_1000084893 288
335 3300005339 Ga0070660_100010447 Ga0070660_1000104472 288
336 3300005339 Ga0070660_100015872 Ga0070660_1000158727 288
337 3300005339 Ga0070660_100032173 Ga0070660_1000321734 288
338 3300005339 Ga0070660_100098961 Ga0070660_1000989612 288
339 3300005354 Ga0070675_100082768 Ga0070675_1000827683 288
340 3300005364 Ga0070673_100000102 Ga0070673_10000010237 288
341 3300005366 Ga0070659_100005959 Ga0070659_1000059597 288
342 3300005366 Ga0070659_100186938 Ga0070659_1001869382 288
343 3300005459 Ga0068867_100002370 Ga0068867_1000023707 288
344 3300005539 Ga0068853_100068854 Ga0068853_1000688542 288
345 3300005539 Ga0068853_100385359 Ga0068853_1003853592 288
346 3300005543 Ga0070672_100102556 Ga0070672_1001025563 288
347 3300005563 Ga0068855_100001799 Ga0068855_1000017997 288
348 3300005563 Ga0068855_100285695 Ga0068855_1002856952 288
349 3300005614 Ga0068856_100038229 Ga0068856_1000382295 288
350 3300005614 Ga0068856_100354697 Ga0068856_1003546972 288
351 3300005614 Ga0068856_100461251 Ga0068856_1004612511 288
352 3300005616 Ga0068852_100001022 Ga0068852_10000102210 288
353 3300005718 Ga0068866_10318002 Ga0068866_103180021 288
354 3300006353 Ga0075370_10039843 Ga0075370_100398433 288
355 3300006881 Ga0068865_100001599 Ga0068865_1000015997 288
356 3300009098 Ga0105245_10003923 Ga0105245_100039237 288
357 3300009148 Ga0105243_10003240 Ga0105243_100032407 288
358 3300009176 Ga0105242_10003140 Ga0105242_100031407 288
359 3300009545 Ga0105237_10104250 Ga0105237_101042503 288
360 3300009553 Ga0105249_10266005 Ga0105249_102660052 288
361 3300010375 Ga0105239_10222388 Ga0105239_102223882 288
362 3300011119 Ga0105246_10009362 Ga0105246_100093623 288
363 3300013102 Ga0157371_10378217 Ga0157371_103782171 288
364 3300013105 Ga0157369_10005943 Ga0157369_100059437 288
365 3300013105 Ga0157369_10395228 Ga0157369_103952282 288
366 3300013296 Ga0157374_10003484 Ga0157374_100034847 288
367 3300013297 Ga0157378_10001779 Ga0157378_1000177917 288
368 3300013307 Ga0157372_10089388 Ga0157372_100893883 288
369 3300013308 Ga0157375_10003690 Ga0157375_100036907 288
370 3300014745 Ga0157377_10081080 Ga0157377_100810802 288
371 3300014968 Ga0157379_10292467 Ga0157379_102924671 288
372 3300014969 Ga0157376_10010893 Ga0157376_100108937 288
373 3300017792 Ga0163161_10062156 Ga0163161_100621562 288
374 3300025231 Ga0207427_100897 Ga0207427_10089713 288
375 3300025233 Ga0209437_110277 Ga0209437_1102772 288
376 3300025250 Ga0209026_1000440 Ga0209026_100044012 288
377 3300025254 Ga0209148_1000457 Ga0209148_100045746 288
378 3300025254 Ga0209148_1002517 Ga0209148_10025174 288
379 3300025261 Ga0209233_1000003 Ga0209233_1000003442 288
380 3300025272 Ga0209455_1000974 Ga0209455_10009748 288
381 3300025292 Ga0209676_1000330 Ga0209676_100033028 288
382 3300025298 Ga0209050_1000113 Ga0209050_1000113145 288
383 3300025304 Ga0209257_1000083 Ga0209257_1000083154 288
384 3300025304 Ga0209257_1000126 Ga0209257_1000126128 288
385 3300025904 Ga0207647_10003223 Ga0207647_100032237 288
386 3300025904 Ga0207647_10025801 Ga0207647_100258012 288
387 3300025904 Ga0207647_10035499 Ga0207647_100354992 288
388 3300025907 Ga0207645_10032964 Ga0207645_100329642 288
389 3300025909 Ga0207705_10000042 Ga0207705_10000042149 288
390 3300025909 Ga0207705_10010224 Ga0207705_100102246 288
391 3300025913 Ga0207695_10142525 Ga0207695_101425253 288
392 3300025914 Ga0207671_10177258 Ga0207671_101772582 288
393 3300025919 Ga0207657_10005847 Ga0207657_100058477 288
394 3300025919 Ga0207657_10022768 Ga0207657_100227682 288
395 3300025926 Ga0207659_10025753 Ga0207659_100257534 288
396 3300025927 Ga0207687_10056888 Ga0207687_100568881 288
397 3300025932 Ga0207690_10001614 Ga0207690_1000161416 288
398 3300025932 Ga0207690_10148558 Ga0207690_101485582 288
399 3300025933 Ga0207706_10011989 Ga0207706_100119894 288
400 3300025933 Ga0207706_10209323 Ga0207706_102093233 288
401 3300025933 Ga0207706_10386538 Ga0207706_103865382 288
402 3300025934 Ga0207686_10002013 Ga0207686_100020136 288
403 3300025935 Ga0207709_10001407 Ga0207709_100014077 288
404 3300025938 Ga0207704_10000875 Ga0207704_100008757 288
405 3300025940 Ga0207691_10062600 Ga0207691_100626002 288
406 3300025942 Ga0207689_10004218 Ga0207689_100042187 288
407 3300025949 Ga0207667_10000017 Ga0207667_10000017352 288
408 3300025949 Ga0207667_10136855 Ga0207667_101368553 288
409 3300025949 Ga0207667_10352110 Ga0207667_103521101 288
410 3300025960 Ga0207651_10000089 Ga0207651_1000008940 288
411 3300026023 Ga0207677_10001280 Ga0207677_100012808 288
412 3300026041 Ga0207639_10036101 Ga0207639_100361013 288
413 3300026078 Ga0207702_10026879 Ga0207702_100268792 288
414 3300026089 Ga0207648_10000606 Ga0207648_1000060640 288
415 3300026142 Ga0207698_10005561 Ga0207698_100055615 288
416 3300028379 Ga0268266_10593984 Ga0268266_105939841 288
417 3300031691 Ga0316579_10017681 Ga0316579_100176812 288
418 3300031731 Ga0307405_10101665 Ga0307405_101016652 288
419 3300032002 Ga0307416_100244172 Ga0307416_1002441723 288
420 3300032004 Ga0307414_10161119 Ga0307414_101611192 288
421 3300032005 Ga0307411_10095040 Ga0307411_100950401 288
422 3300032005 Ga0307411_10132359 Ga0307411_101323591 288
423 3300032133 Ga0316583_10001892 Ga0316583_100018927 288
424 3300033180 Ga0307510_10076162 Ga0307510_100761623 288
425 3300035121 Ga0373960_0021613 Ga0373960_0021613_320_1201 288
426 3300035242 Ga0373962_0018027 Ga0373962_0018027_401_1282 288
427 3300036647 Ga0316582_0083135 Ga0316582_0083135_224_1090 288
428 3300037312 Ga0395899_0002805 Ga0395899_0002805_5257_6147 288
429 3300037418 Ga0395900_0338474 Ga0395900_0338474_466_1362 288
430 3300037466 Ga0395898_0294578 Ga0395898_0294578_507_1397 288
431 3300037471 Ga0395905_0213386 Ga0395905_0213386_675_1553 288
432 3300037471 Ga0395905_0412350 Ga0395905_0412350_202_1086 288
433 3300042005 Ga0439448_0004171 Ga0439448_0004171_1701_2597 288
434 3300042005 Ga0439448_0014769 Ga0439448_0014769_189_1076 288
435 3300042008 Ga0439450_003529 Ga0439450_003529_1342_2229 288
436 3300042012 Ga0439455_0000382 Ga0439455_0000382_3757_4668 288
437 3300042157 Ga0439458_0000621 Ga0439458_0000621_4074_4985 288
438 3300042157 Ga0439458_0000965 Ga0439458_0000965_5886_6782 288
439 3300044693 Ga0466961_0000685 Ga0466961_0000685_16182_17069 288
440 3300044706 Ga0466964_0005651 Ga0466964_0005651_2113_2997 288
441 3300044735 Ga0466968_0014627 Ga0466968_0014627_110_994 288
442 3300044842 Ga0466957_0234466 Ga0466957_0234466_141_1025 288
443 3300044901 Ga0466960_0006025 Ga0466960_0006025_3040_3924 288
444 3300045049 Ga0466959_0114812 Ga0466959_0114812_556_1440 288
445 3300046507 Ga0495606_0024850 Ga0495606_0024850_557_1444 288
446 3300048914 Ga0496111_0035457 Ga0496111_0035457_2367_3248 288
447 3300048925 Ga0496122_0001435 Ga0496122_0001435_14925_15806 288
448 3300048925 Ga0496122_0017561 Ga0496122_0017561_3053_3943 288
449 3300048926 Ga0496123_0002758 Ga0496123_0002758_1928_2809 288
450 3300049568 Ga0501031_0047929 Ga0501031_0047929_1403_2278 288
451 3300049569 Ga0501032_0004373 Ga0501032_0004373_7099_7974 288
452 3300049570 Ga0501033_0021376 Ga0501033_0021376_2887_3762 288
453 3300049572 Ga0501036_0036879 Ga0501036_0036879_568_1443 288
454 3300049575 Ga0501039_0093415 Ga0501039_0093415_1153_2028 288
455 3300049581 Ga0501047_0098866 Ga0501047_0098866_176_1051 288
456 3300049582 Ga0501048_0205688 Ga0501048_0205688_86_961 288
457 3300049822 Ga0501035_0144629 Ga0501035_0144629_1176_2051 288
458 3300053087 Ga0500643_000004 Ga0500643_000004_6035_6901 288
459 3300053090 Ga0500646_0020342 Ga0500646_0020342_96_977 288
460 3300053140 Ga0500573_0000015 Ga0500573_0000015_106713_107606 288
461 3300061719 Ga0466962_0157110 Ga0466962_0157110_74_958 288
462 3300000041 ARcpr5oldR_c001826 ARcpr5oldR_0018262 289
463 3300000043 ARcpr5yngRDRAFT_c001227 ARcpr5yngRDRAFT_0012273 289
464 3300001979 JGI24740J21852_10009167 JGI24740J21852_100091674 289
465 3300001990 JGI24737J22298_10000247 JGI24737J22298_1000024716 289
466 3300001990 JGI24737J22298_10003095 JGI24737J22298_100030954 289
467 3300001990 JGI24737J22298_10005774 JGI24737J22298_100057742 289
468 3300001990 JGI24737J22298_10017865 JGI24737J22298_100178653 289
469 3300001991 JGI24743J22301_10005983 JGI24743J22301_100059832 289
470 3300002067 JGI24735J21928_10018728 JGI24735J21928_100187282 289
471 3300002155 JGI24033J26618_1004369 JGI24033J26618_10043692 289
472 3300003215 JGI25153J46596_10000083 JGI25153J46596_1000008318 289
473 3300003215 JGI25153J46596_10008742 JGI25153J46596_100087422 289
474 3300003215 JGI25153J46596_10010493 JGI25153J46596_100104933 289
475 3300003771 Ga0055526_1001047 Ga0055526_100104711 289
476 3300003773 Ga0055537_1004046 Ga0055537_10040464 289
477 3300003775 Ga0055524_1000320 Ga0055524_100032012 289
478 3300003775 Ga0055524_1000341 Ga0055524_100034142 289
479 3300003791 Ga0055530_10000582 Ga0055530_1000058220 289
480 3300003791 Ga0055530_10016010 Ga0055530_100160102 289
481 3300003794 Ga0055531_10000116 Ga0055531_1000011675 289
482 3300003794 Ga0055531_10010657 Ga0055531_100106573 289
483 3300005262 Ga0065165_1000472 Ga0065165_10004723 289
484 3300005262 Ga0065165_1009580 Ga0065165_10095802 289
485 3300005262 Ga0065165_1026042 Ga0065165_10260422 289
486 3300005290 Ga0065712_10070384 Ga0065712_100703844 289
487 3300005327 Ga0070658_10000001 Ga0070658_10000001364 289
488 3300005327 Ga0070658_10004771 Ga0070658_100047719 289
489 3300005327 Ga0070658_10005539 Ga0070658_100055394 289
490 3300005327 Ga0070658_10056028 Ga0070658_100560282 289
491 3300005327 Ga0070658_10134578 Ga0070658_101345782 289
492 3300005327 Ga0070658_10364211 Ga0070658_103642112 289
493 3300005327 Ga0070658_10386666 Ga0070658_103866661 289
494 3300005329 Ga0070683_100188149 Ga0070683_1001881493 289
495 3300005329 Ga0070683_100208182 Ga0070683_1002081821 289
496 3300005331 Ga0070670_100014463 Ga0070670_1000144639 289
497 3300005331 Ga0070670_100402471 Ga0070670_1004024711 289
498 3300005335 Ga0070666_10000273 Ga0070666_1000027334 289
499 3300005335 Ga0070666_10003276 Ga0070666_1000327611 289
500 3300005335 Ga0070666_10023293 Ga0070666_100232934 289
501 3300005335 Ga0070666_10026564 Ga0070666_100265641 289
502 3300005338 Ga0068868_100000164 Ga0068868_10000016424 289
503 3300005338 Ga0068868_100219278 Ga0068868_1002192781 289
504 3300005338 Ga0068868_100316890 Ga0068868_1003168902 289
505 3300005339 Ga0070660_100000139 Ga0070660_10000013915 289
506 3300005339 Ga0070660_100001079 Ga0070660_10000107922 289
507 3300005339 Ga0070660_100001588 Ga0070660_1000015889 289
508 3300005339 Ga0070660_100004851 Ga0070660_10000485112 289
509 3300005339 Ga0070660_100010544 Ga0070660_1000105443 289
510 3300005339 Ga0070660_100011548 Ga0070660_1000115483 289
511 3300005339 Ga0070660_100171862 Ga0070660_1001718622 289
512 3300005339 Ga0070660_100222743 Ga0070660_1002227432 289
513 3300005344 Ga0070661_100000028 Ga0070661_10000002815 289
514 3300005344 Ga0070661_100004099 Ga0070661_10000409911 289
515 3300005344 Ga0070661_100052487 Ga0070661_1000524874 289
516 3300005344 Ga0070661_100334083 Ga0070661_1003340832 289
517 3300005345 Ga0070692_10001401 Ga0070692_100014016 289
518 3300005345 Ga0070692_10002252 Ga0070692_1000225210 289
519 3300005345 Ga0070692_10002478 Ga0070692_1000247810 289
520 3300005347 Ga0070668_100060576 Ga0070668_1000605761 289
521 3300005347 Ga0070668_100070570 Ga0070668_1000705703 289
522 3300005347 Ga0070668_100154446 Ga0070668_1001544463 289
523 3300005353 Ga0070669_100000096 Ga0070669_1000000968 289
524 3300005353 Ga0070669_100000451 Ga0070669_10000045128 289
525 3300005353 Ga0070669_100022738 Ga0070669_1000227385 289
526 3300005353 Ga0070669_100079816 Ga0070669_1000798162 289
527 3300005353 Ga0070669_100092210 Ga0070669_1000922102 289
528 3300005353 Ga0070669_100110709 Ga0070669_1001107093 289
529 3300005354 Ga0070675_100036440 Ga0070675_1000364401 289
530 3300005355 Ga0070671_100000629 Ga0070671_1000006291 289
531 3300005355 Ga0070671_100007657 Ga0070671_10000765710 289
532 3300005355 Ga0070671_100020066 Ga0070671_1000200666 289
533 3300005355 Ga0070671_100022059 Ga0070671_1000220595 289
534 3300005355 Ga0070671_100039955 Ga0070671_1000399552 289
535 3300005355 Ga0070671_100075576 Ga0070671_1000755763 289
536 3300005355 Ga0070671_100079107 Ga0070671_1000791072 289
537 3300005355 Ga0070671_100083381 Ga0070671_1000833812 289
538 3300005355 Ga0070671_100102644 Ga0070671_1001026442 289
539 3300005356 Ga0070674_100043898 Ga0070674_1000438984 289
540 3300005356 Ga0070674_100172131 Ga0070674_1001721312 289
541 3300005364 Ga0070673_100048499 Ga0070673_1000484993 289
542 3300005364 Ga0070673_100169957 Ga0070673_1001699571 289
543 3300005366 Ga0070659_100000021 Ga0070659_10000002181 289
544 3300005366 Ga0070659_100001442 Ga0070659_1000014422 289
545 3300005366 Ga0070659_100006060 Ga0070659_1000060608 289
546 3300005366 Ga0070659_100018189 Ga0070659_1000181894 289
547 3300005366 Ga0070659_100022605 Ga0070659_1000226057 289
548 3300005366 Ga0070659_100027698 Ga0070659_1000276985 289
549 3300005366 Ga0070659_100044477 Ga0070659_1000444772 289
550 3300005366 Ga0070659_100055412 Ga0070659_1000554124 289
551 3300005366 Ga0070659_100069749 Ga0070659_1000697492 289
552 3300005366 Ga0070659_100079945 Ga0070659_1000799453 289
553 3300005366 Ga0070659_100144143 Ga0070659_1001441431 289
554 3300005366 Ga0070659_100177298 Ga0070659_1001772982 289
555 3300005366 Ga0070659_100284982 Ga0070659_1002849822 289
556 3300005367 Ga0070667_100008465 Ga0070667_1000084653 289
557 3300005367 Ga0070667_100044768 Ga0070667_1000447684 289
558 3300005367 Ga0070667_100071859 Ga0070667_1000718592 289
559 3300005367 Ga0070667_100220563 Ga0070667_1002205632 289
560 3300005436 Ga0070713_100016076 Ga0070713_1000160768 289
561 3300005444 Ga0070694_100052950 Ga0070694_1000529503 289
562 3300005445 Ga0070708_100167354 Ga0070708_1001673542 289
563 3300005455 Ga0070663_100006997 Ga0070663_1000069977 289
564 3300005455 Ga0070663_100008734 Ga0070663_1000087343 289
565 3300005455 Ga0070663_100065167 Ga0070663_1000651673 289
566 3300005457 Ga0070662_100006773 Ga0070662_1000067736 289
567 3300005457 Ga0070662_100080697 Ga0070662_1000806972 289
568 3300005457 Ga0070662_100087520 Ga0070662_1000875202 289
569 3300005457 Ga0070662_100153410 Ga0070662_1001534102 289
570 3300005457 Ga0070662_100257104 Ga0070662_1002571042 289
571 3300005457 Ga0070662_100537122 Ga0070662_1005371221 289
572 3300005458 Ga0070681_10044962 Ga0070681_100449622 289
573 3300005458 Ga0070681_10094832 Ga0070681_100948323 289
574 3300005468 Ga0070707_100053775 Ga0070707_1000537753 289
575 3300005471 Ga0070698_100006487 Ga0070698_10000648714 289
576 3300005530 Ga0070679_100000010 Ga0070679_100000010141 289
577 3300005530 Ga0070679_100181594 Ga0070679_1001815941 289
578 3300005530 Ga0070679_100221166 Ga0070679_1002211662 289
579 3300005530 Ga0070679_100522491 Ga0070679_1005224912 289
580 3300005535 Ga0070684_100004118 Ga0070684_1000041184 289
581 3300005539 Ga0068853_100014001 Ga0068853_1000140017 289
582 3300005539 Ga0068853_100468261 Ga0068853_1004682612 289
583 3300005543 Ga0070672_100070086 Ga0070672_1000700864 289
584 3300005544 Ga0070686_100169932 Ga0070686_1001699323 289
585 3300005548 Ga0070665_100089984 Ga0070665_1000899843 289
586 3300005548 Ga0070665_100252058 Ga0070665_1002520582 289
587 3300005548 Ga0070665_100360321 Ga0070665_1003603212 289
588 3300005563 Ga0068855_100000348 Ga0068855_1000003486 289
589 3300005563 Ga0068855_100007660 Ga0068855_1000076601 289
590 3300005563 Ga0068855_100220807 Ga0068855_1002208072 289
591 3300005563 Ga0068855_100469279 Ga0068855_1004692791 289
592 3300005564 Ga0070664_100049310 Ga0070664_1000493104 289
593 3300005564 Ga0070664_100058333 Ga0070664_1000583334 289
594 3300005564 Ga0070664_100058477 Ga0070664_1000584772 289
595 3300005564 Ga0070664_100192036 Ga0070664_1001920362 289
596 3300005577 Ga0068857_100005769 Ga0068857_1000057693 289
597 3300005577 Ga0068857_100014420 Ga0068857_1000144203 289
598 3300005577 Ga0068857_100017653 Ga0068857_1000176536 289
599 3300005577 Ga0068857_100044515 Ga0068857_1000445153 289
600 3300005577 Ga0068857_100065037 Ga0068857_1000650372 289
601 3300005577 Ga0068857_100282678 Ga0068857_1002826782 289
602 3300005577 Ga0068857_100578940 Ga0068857_1005789401 289
603 3300005577 Ga0068857_100637111 Ga0068857_1006371111 289
604 3300005578 Ga0068854_100000922 Ga0068854_1000009226 289
605 3300005578 Ga0068854_100038978 Ga0068854_1000389782 289
606 3300005578 Ga0068854_100097289 Ga0068854_1000972892 289
607 3300005614 Ga0068856_100152380 Ga0068856_1001523802 289
608 3300005614 Ga0068856_100241514 Ga0068856_1002415142 289
609 3300005614 Ga0068856_100356895 Ga0068856_1003568952 289
610 3300005616 Ga0068852_100028953 Ga0068852_1000289534 289
611 3300005616 Ga0068852_100087830 Ga0068852_1000878301 289
612 3300005616 Ga0068852_100197714 Ga0068852_1001977143 289
613 3300005617 Ga0068859_100003981 Ga0068859_10000398118 289
614 3300005617 Ga0068859_100007890 Ga0068859_10000789011 289
615 3300005617 Ga0068859_100039051 Ga0068859_1000390515 289
616 3300005617 Ga0068859_100045752 Ga0068859_1000457523 289
617 3300005617 Ga0068859_100094042 Ga0068859_1000940423 289
618 3300005617 Ga0068859_100788011 Ga0068859_1007880111 289
619 3300005618 Ga0068864_100000858 Ga0068864_10000085813 289
620 3300005618 Ga0068864_100000986 Ga0068864_10000098611 289
621 3300005618 Ga0068864_100008878 Ga0068864_1000088784 289
622 3300005618 Ga0068864_100009673 Ga0068864_1000096734 289
623 3300005618 Ga0068864_100064173 Ga0068864_1000641733 289
624 3300005618 Ga0068864_100098743 Ga0068864_1000987434 289
625 3300005618 Ga0068864_100386637 Ga0068864_1003866372 289
626 3300005719 Ga0068861_100002124 Ga0068861_1000021248 289
627 3300005719 Ga0068861_100153455 Ga0068861_1001534552 289
628 3300005841 Ga0068863_100005345 Ga0068863_10000534510 289
629 3300005841 Ga0068863_100007161 Ga0068863_1000071618 289
630 3300005841 Ga0068863_100018541 Ga0068863_1000185415 289
631 3300005841 Ga0068863_100023817 Ga0068863_1000238172 289
632 3300005841 Ga0068863_100034907 Ga0068863_1000349077 289
633 3300005841 Ga0068863_100042528 Ga0068863_1000425282 289
634 3300005841 Ga0068863_100157704 Ga0068863_1001577043 289
635 3300005841 Ga0068863_100175027 Ga0068863_1001750273 289
636 3300005842 Ga0068858_100000901 Ga0068858_10000090129 289
637 3300005842 Ga0068858_100008352 Ga0068858_10000835210 289
638 3300005842 Ga0068858_100011713 Ga0068858_1000117133 289
639 3300005842 Ga0068858_100014125 Ga0068858_1000141259 289
640 3300005842 Ga0068858_100019480 Ga0068858_1000194803 289
641 3300005843 Ga0068860_100012671 Ga0068860_1000126712 289
642 3300005843 Ga0068860_100022645 Ga0068860_1000226452 289
643 3300005843 Ga0068860_100025508 Ga0068860_1000255084 289
644 3300005843 Ga0068860_100027166 Ga0068860_1000271663 289
645 3300005843 Ga0068860_100034230 Ga0068860_1000342308 289
646 3300005843 Ga0068860_100034921 Ga0068860_1000349214 289
647 3300005843 Ga0068860_100066349 Ga0068860_1000663493 289
648 3300005843 Ga0068860_100137755 Ga0068860_1001377552 289
649 3300005844 Ga0068862_100005517 Ga0068862_1000055178 289
650 3300005844 Ga0068862_100031095 Ga0068862_1000310953 289
651 3300005844 Ga0068862_100170254 Ga0068862_1001702542 289
652 3300005844 Ga0068862_100220347 Ga0068862_1002203472 289
653 3300005983 Ga0081540_1076812 Ga0081540_10768122 289
654 3300005985 Ga0081539_10004910 Ga0081539_1000491011 289
655 3300005985 Ga0081539_10085536 Ga0081539_100855362 289
656 3300006042 Ga0075368_10000367 Ga0075368_1000036713 289
657 3300006048 Ga0075363_100002220 Ga0075363_1000022201 289
658 3300006175 Ga0070712_100094010 Ga0070712_1000940102 289
659 3300006178 Ga0075367_10005228 Ga0075367_100052283 289
660 3300006195 Ga0075366_10253820 Ga0075366_102538201 289
661 3300006237 Ga0097621_100006846 Ga0097621_1000068462 289
662 3300006237 Ga0097621_100034267 Ga0097621_1000342674 289
663 3300006353 Ga0075370_10022094 Ga0075370_100220944 289
664 3300006358 Ga0068871_100035768 Ga0068871_1000357684 289
665 3300006358 Ga0068871_100076647 Ga0068871_1000766472 289
666 3300006846 Ga0075430_100284139 Ga0075430_1002841392 289
667 3300006931 Ga0097620_100003981 Ga0097620_10000398118 289
668 3300006931 Ga0097620_100007889 Ga0097620_10000788911 289
669 3300006931 Ga0097620_100039051 Ga0097620_1000390515 289
670 3300006931 Ga0097620_100045752 Ga0097620_1000457524 289
671 3300006931 Ga0097620_100094045 Ga0097620_1000940452 289
672 3300006931 Ga0097620_100787996 Ga0097620_1007879961 289
673 3300009093 Ga0105240_10221652 Ga0105240_102216522 289
674 3300009094 Ga0111539_10256670 Ga0111539_102566702 289
675 3300009148 Ga0105243_10000278 Ga0105243_1000027851 289
676 3300009177 Ga0105248_10002050 Ga0105248_1000205022 289
677 3300009177 Ga0105248_10013079 Ga0105248_100130798 289
678 3300009177 Ga0105248_10111104 Ga0105248_101111042 289
679 3300009177 Ga0105248_10121858 Ga0105248_101218582 289
680 3300009177 Ga0105248_10178901 Ga0105248_101789012 289
681 3300009177 Ga0105248_10194133 Ga0105248_101941332 289
682 3300009177 Ga0105248_10334412 Ga0105248_103344122 289
683 3300009545 Ga0105237_10067334 Ga0105237_100673345 289
684 3300009545 Ga0105237_10121532 Ga0105237_101215323 289
685 3300009551 Ga0105238_10063020 Ga0105238_100630201 289
686 3300009551 Ga0105238_10281811 Ga0105238_102818112 289
687 3300009553 Ga0105249_10015545 Ga0105249_100155458 289
688 3300009553 Ga0105249_10020929 Ga0105249_100209294 289
689 3300009553 Ga0105249_10226401 Ga0105249_102264012 289
690 3300009553 Ga0105249_10490996 Ga0105249_104909962 289
691 3300010375 Ga0105239_10067896 Ga0105239_100678963 289
692 3300010375 Ga0105239_10436624 Ga0105239_104366242 289
693 3300011119 Ga0105246_10103350 Ga0105246_101033503 289
694 3300013100 Ga0157373_10034494 Ga0157373_100344943 289
695 3300013100 Ga0157373_10039522 Ga0157373_100395223 289
696 3300013100 Ga0157373_10042692 Ga0157373_100426922 289
697 3300013100 Ga0157373_10044714 Ga0157373_100447145 289
698 3300013100 Ga0157373_10116563 Ga0157373_101165632 289
699 3300013100 Ga0157373_10231245 Ga0157373_102312452 289
700 3300013102 Ga0157371_10000285 Ga0157371_1000028543 289
701 3300013102 Ga0157371_10003605 Ga0157371_1000360511 289
702 3300013102 Ga0157371_10010387 Ga0157371_100103871 289
703 3300013102 Ga0157371_10060034 Ga0157371_100600342 289
704 3300013102 Ga0157371_10067216 Ga0157371_100672163 289
705 3300013102 Ga0157371_10116813 Ga0157371_101168133 289
706 3300013102 Ga0157371_10331162 Ga0157371_103311622 289
707 3300013104 Ga0157370_10001875 Ga0157370_1000187519 289
708 3300013104 Ga0157370_10044569 Ga0157370_100445693 289
709 3300013104 Ga0157370_10064736 Ga0157370_100647364 289
710 3300013105 Ga0157369_10000239 Ga0157369_1000023924 289
711 3300013105 Ga0157369_10022363 Ga0157369_100223634 289
712 3300013105 Ga0157369_10118547 Ga0157369_101185473 289
713 3300013105 Ga0157369_10282782 Ga0157369_102827822 289
714 3300013105 Ga0157369_10351558 Ga0157369_103515581 289
715 3300013105 Ga0157369_10587267 Ga0157369_105872671 289
716 3300013105 Ga0157369_10717014 Ga0157369_107170141 289
717 3300013296 Ga0157374_10005380 Ga0157374_100053805 289
718 3300013296 Ga0157374_10118103 Ga0157374_101181032 289
719 3300013296 Ga0157374_10460752 Ga0157374_104607522 289
720 3300013297 Ga0157378_10012689 Ga0157378_100126892 289
721 3300013297 Ga0157378_10496414 Ga0157378_104964141 289
722 3300013306 Ga0163162_10016652 Ga0163162_100166522 289
723 3300013306 Ga0163162_10134549 Ga0163162_101345492 289
724 3300013307 Ga0157372_10230894 Ga0157372_102308941 289
725 3300013307 Ga0157372_10517264 Ga0157372_105172642 289
726 3300013307 Ga0157372_10538252 Ga0157372_105382521 289
727 3300013307 Ga0157372_10716487 Ga0157372_107164871 289
728 3300014325 Ga0163163_10002274 Ga0163163_1000227418 289
729 3300014325 Ga0163163_10061738 Ga0163163_100617383 289
730 3300014326 Ga0157380_10067769 Ga0157380_100677692 289
731 3300014497 Ga0182008_10029615 Ga0182008_100296151 289
732 3300014968 Ga0157379_10002869 Ga0157379_100028699 289
733 3300014968 Ga0157379_10007825 Ga0157379_100078253 289
734 3300014968 Ga0157379_10012088 Ga0157379_100120885 289
735 3300014968 Ga0157379_10096668 Ga0157379_100966682 289
736 3300015690 Ga0183363_1007 Ga0183363_100788 289
737 3300017792 Ga0163161_10119156 Ga0163161_101191562 289
738 3300017792 Ga0163161_10248432 Ga0163161_102484322 289
739 3300020082 Ga0206353_12066425 Ga0206353_1206642513 289
740 3300021384 Ga0213876_10000174 Ga0213876_1000017418 289
741 3300025245 Ga0207425_1004686 Ga0207425_10046862 289
742 3300025253 Ga0209677_105892 Ga0209677_1058922 289
743 3300025261 Ga0209233_1010964 Ga0209233_10109642 289
744 3300025263 Ga0209565_1000007 Ga0209565_100000721 289
745 3300025273 Ga0209673_1003585 Ga0209673_10035857 289
746 3300025291 Ga0209675_1017249 Ga0209675_10172491 289
747 3300025295 Ga0209564_1000335 Ga0209564_100033534 289
748 3300025295 Ga0209564_1029082 Ga0209564_10290821 289
749 3300025297 Ga0209758_1000023 Ga0209758_1000023510 289
750 3300025297 Ga0209758_1020971 Ga0209758_10209713 289
751 3300025298 Ga0209050_1000196 Ga0209050_1000196123 289
752 3300025298 Ga0209050_1004893 Ga0209050_10048935 289
753 3300025299 Ga0209256_1000009 Ga0209256_1000009137 289
754 3300025299 Ga0209256_1000010 Ga0209256_100001061 289
755 3300025304 Ga0209257_1000228 Ga0209257_1000228123 289
756 3300025304 Ga0209257_1003616 Ga0209257_10036164 289
757 3300025315 Ga0207697_10003428 Ga0207697_100034283 289
758 3300025315 Ga0207697_10022353 Ga0207697_100223533 289
759 3300025893 Ga0207682_10122517 Ga0207682_101225172 289
760 3300025903 Ga0207680_10003271 Ga0207680_100032718 289
761 3300025903 Ga0207680_10003619 Ga0207680_100036194 289
762 3300025903 Ga0207680_10010102 Ga0207680_100101024 289
763 3300025903 Ga0207680_10257132 Ga0207680_102571322 289
764 3300025904 Ga0207647_10000559 Ga0207647_100005595 289
765 3300025904 Ga0207647_10002875 Ga0207647_100028752 289
766 3300025904 Ga0207647_10058541 Ga0207647_100585412 289
767 3300025909 Ga0207705_10000002 Ga0207705_100000021516 289
768 3300025909 Ga0207705_10000003 Ga0207705_10000003603 289
769 3300025909 Ga0207705_10000208 Ga0207705_1000020823 289
770 3300025909 Ga0207705_10001333 Ga0207705_100013336 289
771 3300025909 Ga0207705_10008087 Ga0207705_1000808711 289
772 3300025909 Ga0207705_10020614 Ga0207705_100206143 289
773 3300025909 Ga0207705_10023460 Ga0207705_100234602 289
774 3300025909 Ga0207705_10047702 Ga0207705_100477022 289
775 3300025909 Ga0207705_10147603 Ga0207705_101476033 289
776 3300025909 Ga0207705_10155301 Ga0207705_101553012 289
777 3300025909 Ga0207705_10301708 Ga0207705_103017081 289
778 3300025909 Ga0207705_10378532 Ga0207705_103785322 289
779 3300025912 Ga0207707_10021138 Ga0207707_100211384 289
780 3300025912 Ga0207707_10198830 Ga0207707_101988302 289
781 3300025913 Ga0207695_10016024 Ga0207695_100160249 289
782 3300025913 Ga0207695_10018678 Ga0207695_100186782 289
783 3300025913 Ga0207695_10147760 Ga0207695_101477602 289
784 3300025914 Ga0207671_10115815 Ga0207671_101158152 289
785 3300025915 Ga0207693_10128225 Ga0207693_101282252 289
786 3300025919 Ga0207657_10000082 Ga0207657_1000008248 289
787 3300025919 Ga0207657_10000228 Ga0207657_1000022834 289
788 3300025919 Ga0207657_10000284 Ga0207657_1000028413 289
789 3300025919 Ga0207657_10002637 Ga0207657_100026379 289
790 3300025919 Ga0207657_10004412 Ga0207657_1000441215 289
791 3300025919 Ga0207657_10014951 Ga0207657_100149517 289
792 3300025919 Ga0207657_10019845 Ga0207657_100198454 289
793 3300025919 Ga0207657_10099146 Ga0207657_100991462 289
794 3300025919 Ga0207657_10207854 Ga0207657_102078542 289
795 3300025919 Ga0207657_10266566 Ga0207657_102665662 289
796 3300025919 Ga0207657_10399415 Ga0207657_103994152 289
797 3300025920 Ga0207649_10000336 Ga0207649_1000033614 289
798 3300025920 Ga0207649_10003997 Ga0207649_1000399711 289
799 3300025921 Ga0207652_10000005 Ga0207652_10000005264 289
800 3300025921 Ga0207652_10000006 Ga0207652_1000000617 289
801 3300025921 Ga0207652_10000007 Ga0207652_1000000718 289
802 3300025921 Ga0207652_10001766 Ga0207652_1000176612 289
803 3300025921 Ga0207652_10185966 Ga0207652_101859662 289
804 3300025923 Ga0207681_10000030 Ga0207681_10000030193 289
805 3300025923 Ga0207681_10000211 Ga0207681_1000021126 289
806 3300025923 Ga0207681_10017715 Ga0207681_100177154 289
807 3300025924 Ga0207694_10068371 Ga0207694_100683713 289
808 3300025924 Ga0207694_10225943 Ga0207694_102259432 289
809 3300025924 Ga0207694_10309215 Ga0207694_103092152 289
810 3300025925 Ga0207650_10058856 Ga0207650_100588563 289
811 3300025925 Ga0207650_10084239 Ga0207650_100842392 289
812 3300025925 Ga0207650_10342413 Ga0207650_103424131 289
813 3300025927 Ga0207687_10030752 Ga0207687_100307525 289
814 3300025928 Ga0207700_10009569 Ga0207700_100095692 289
815 3300025928 Ga0207700_10286445 Ga0207700_102864452 289
816 3300025931 Ga0207644_10000017 Ga0207644_10000017193 289
817 3300025931 Ga0207644_10000061 Ga0207644_1000006176 289
818 3300025931 Ga0207644_10003585 Ga0207644_100035851 289
819 3300025931 Ga0207644_10010083 Ga0207644_100100834 289
820 3300025931 Ga0207644_10014224 Ga0207644_100142245 289
821 3300025931 Ga0207644_10020468 Ga0207644_100204685 289
822 3300025931 Ga0207644_10027275 Ga0207644_100272752 289
823 3300025931 Ga0207644_10031486 Ga0207644_100314863 289
824 3300025931 Ga0207644_10201576 Ga0207644_102015762 289
825 3300025932 Ga0207690_10000030 Ga0207690_1000003084 289
826 3300025932 Ga0207690_10006603 Ga0207690_100066037 289
827 3300025932 Ga0207690_10007128 Ga0207690_100071284 289
828 3300025932 Ga0207690_10008219 Ga0207690_100082196 289
829 3300025932 Ga0207690_10011538 Ga0207690_100115382 289
830 3300025932 Ga0207690_10029732 Ga0207690_100297323 289
831 3300025932 Ga0207690_10033283 Ga0207690_100332831 289
832 3300025932 Ga0207690_10079576 Ga0207690_100795762 289
833 3300025932 Ga0207690_10112556 Ga0207690_101125562 289
834 3300025932 Ga0207690_10167135 Ga0207690_101671351 289
835 3300025932 Ga0207690_10184317 Ga0207690_101843172 289
836 3300025933 Ga0207706_10012700 Ga0207706_100127004 289
837 3300025933 Ga0207706_10013884 Ga0207706_1001388410 289
838 3300025933 Ga0207706_10016878 Ga0207706_100168788 289
839 3300025933 Ga0207706_10058767 Ga0207706_100587675 289
840 3300025935 Ga0207709_10000039 Ga0207709_1000003973 289
841 3300025935 Ga0207709_10217845 Ga0207709_102178452 289
842 3300025936 Ga0207670_10345113 Ga0207670_103451131 289
843 3300025937 Ga0207669_10117080 Ga0207669_101170802 289
844 3300025937 Ga0207669_10193094 Ga0207669_101930942 289
845 3300025940 Ga0207691_10048040 Ga0207691_100480402 289
846 3300025941 Ga0207711_10000665 Ga0207711_1000066522 289
847 3300025941 Ga0207711_10000990 Ga0207711_100009906 289
848 3300025941 Ga0207711_10007176 Ga0207711_1000717613 289
849 3300025941 Ga0207711_10009676 Ga0207711_100096766 289
850 3300025941 Ga0207711_10224123 Ga0207711_102241232 289
851 3300025941 Ga0207711_10492820 Ga0207711_104928202 289
852 3300025942 Ga0207689_10012928 Ga0207689_100129283 289
853 3300025942 Ga0207689_10040698 Ga0207689_100406986 289
854 3300025942 Ga0207689_10075002 Ga0207689_100750023 289
855 3300025944 Ga0207661_10176640 Ga0207661_101766402 289
856 3300025944 Ga0207661_10211582 Ga0207661_102115822 289
857 3300025944 Ga0207661_10355102 Ga0207661_103551022 289
858 3300025945 Ga0207679_10005431 Ga0207679_100054312 289
859 3300025945 Ga0207679_10015997 Ga0207679_100159974 289
860 3300025945 Ga0207679_10024380 Ga0207679_100243806 289
861 3300025945 Ga0207679_10043601 Ga0207679_100436013 289
862 3300025945 Ga0207679_10068550 Ga0207679_100685504 289
863 3300025949 Ga0207667_10000006 Ga0207667_10000006535 289
864 3300025949 Ga0207667_10004287 Ga0207667_1000428710 289
865 3300025949 Ga0207667_10007898 Ga0207667_100078985 289
866 3300025949 Ga0207667_10038393 Ga0207667_100383934 289
867 3300025960 Ga0207651_10514418 Ga0207651_105144181 289
868 3300025961 Ga0207712_10000594 Ga0207712_1000059416 289
869 3300025961 Ga0207712_10003474 Ga0207712_100034744 289
870 3300025961 Ga0207712_10007699 Ga0207712_100076999 289
871 3300025961 Ga0207712_10087876 Ga0207712_100878763 289
872 3300025972 Ga0207668_10005975 Ga0207668_100059752 289
873 3300025972 Ga0207668_10257560 Ga0207668_102575602 289
874 3300025972 Ga0207668_10423756 Ga0207668_104237562 289
875 3300025981 Ga0207640_10000247 Ga0207640_1000024728 289
876 3300025981 Ga0207640_10002967 Ga0207640_100029673 289
877 3300025981 Ga0207640_10057025 Ga0207640_100570252 289
878 3300025981 Ga0207640_10088872 Ga0207640_100888722 289
879 3300025986 Ga0207658_10003763 Ga0207658_100037638 289
880 3300025986 Ga0207658_10015191 Ga0207658_100151915 289
881 3300025986 Ga0207658_10107949 Ga0207658_101079492 289
882 3300025986 Ga0207658_10113107 Ga0207658_101131072 289
883 3300025986 Ga0207658_10324851 Ga0207658_103248511 289
884 3300026023 Ga0207677_10000027 Ga0207677_1000002777 289
885 3300026023 Ga0207677_10205446 Ga0207677_102054462 289
886 3300026035 Ga0207703_10001264 Ga0207703_1000126410 289
887 3300026035 Ga0207703_10001747 Ga0207703_100017473 289
888 3300026035 Ga0207703_10002410 Ga0207703_1000241011 289
889 3300026035 Ga0207703_10014893 Ga0207703_100148933 289
890 3300026035 Ga0207703_10019201 Ga0207703_100192014 289
891 3300026035 Ga0207703_10033936 Ga0207703_100339366 289
892 3300026041 Ga0207639_10012999 Ga0207639_100129992 289
893 3300026041 Ga0207639_10148583 Ga0207639_101485833 289
894 3300026041 Ga0207639_10480425 Ga0207639_104804251 289
895 3300026067 Ga0207678_10002834 Ga0207678_100028343 289
896 3300026067 Ga0207678_10004838 Ga0207678_1000483812 289
897 3300026067 Ga0207678_10044717 Ga0207678_100447173 289
898 3300026067 Ga0207678_10061891 Ga0207678_100618913 289
899 3300026067 Ga0207678_10137511 Ga0207678_101375112 289
900 3300026067 Ga0207678_10162701 Ga0207678_101627012 289
901 3300026075 Ga0207708_10445159 Ga0207708_104451591 289
902 3300026088 Ga0207641_10000908 Ga0207641_100009084 289
903 3300026088 Ga0207641_10006744 Ga0207641_100067447 289
904 3300026088 Ga0207641_10007252 Ga0207641_100072522 289
905 3300026088 Ga0207641_10011882 Ga0207641_100118822 289
906 3300026088 Ga0207641_10015144 Ga0207641_100151445 289
907 3300026088 Ga0207641_10043210 Ga0207641_100432104 289
908 3300026088 Ga0207641_10074587 Ga0207641_100745874 289
909 3300026088 Ga0207641_10084621 Ga0207641_100846212 289
910 3300026095 Ga0207676_10000504 Ga0207676_1000050413 289
911 3300026095 Ga0207676_10001742 Ga0207676_100017423 289
912 3300026095 Ga0207676_10009345 Ga0207676_100093455 289
913 3300026095 Ga0207676_10079697 Ga0207676_100796972 289
914 3300026095 Ga0207676_10087092 Ga0207676_100870922 289
915 3300026095 Ga0207676_10317237 Ga0207676_103172373 289
916 3300026116 Ga0207674_10000271 Ga0207674_1000027139 289
917 3300026116 Ga0207674_10000780 Ga0207674_1000078029 289
918 3300026116 Ga0207674_10005179 Ga0207674_1000517910 289
919 3300026116 Ga0207674_10070662 Ga0207674_100706625 289
920 3300026116 Ga0207674_10251717 Ga0207674_102517172 289
921 3300026116 Ga0207674_10346568 Ga0207674_103465681 289
922 3300026118 Ga0207675_100008088 Ga0207675_1000080888 289
923 3300026118 Ga0207675_100210171 Ga0207675_1002101712 289
924 3300026118 Ga0207675_100220285 Ga0207675_1002202852 289
925 3300026142 Ga0207698_10012244 Ga0207698_100122442 289
926 3300026142 Ga0207698_10585488 Ga0207698_105854881 289
927 3300027866 Ga0209813_10000040 Ga0209813_1000004036 289
928 3300028379 Ga0268266_10000058 Ga0268266_10000058129 289
929 3300028379 Ga0268266_10051270 Ga0268266_100512704 289
930 3300028379 Ga0268266_10142860 Ga0268266_101428602 289
931 3300028379 Ga0268266_10174767 Ga0268266_101747672 289
932 3300028379 Ga0268266_10432113 Ga0268266_104321132 289
933 3300028380 Ga0268265_10001439 Ga0268265_100014398 289
934 3300028380 Ga0268265_10012399 Ga0268265_100123993 289
935 3300028380 Ga0268265_10023200 Ga0268265_100232004 289
936 3300028380 Ga0268265_10100646 Ga0268265_101006463 289
937 3300028380 Ga0268265_10473190 Ga0268265_104731901 289
938 3300028381 Ga0268264_10000215 Ga0268264_10000215129 289
939 3300028381 Ga0268264_10004182 Ga0268264_100041824 289
940 3300028381 Ga0268264_10004643 Ga0268264_100046434 289
941 3300028381 Ga0268264_10017264 Ga0268264_100172642 289
942 3300028381 Ga0268264_10026820 Ga0268264_100268204 289
943 3300028381 Ga0268264_10130768 Ga0268264_101307682 289
944 3300028381 Ga0268264_10132428 Ga0268264_101324283 289
945 3300028381 Ga0268264_10432876 Ga0268264_104328761 289
946 3300028786 Ga0307517_10010748 Ga0307517_100107482 289
947 3300028786 Ga0307517_10029515 Ga0307517_100295154 289
948 3300030733 Ga0314311_1121879 Ga0314311_11218791 289
949 3300030736 Ga0316180_1099107 Ga0316180_10991073 289
950 3300031247 Ga0265340_10032559 Ga0265340_100325593 289
951 3300031250 Ga0265331_10014701 Ga0265331_100147014 289
952 3300031456 Ga0307513_10103172 Ga0307513_101031723 289
953 3300031456 Ga0307513_10289885 Ga0307513_102898852 289
954 3300031548 Ga0307408_100111441 Ga0307408_1001114413 289
955 3300031548 Ga0307408_100185095 Ga0307408_1001850952 289
956 3300031548 Ga0307408_100266779 Ga0307408_1002667792 289
957 3300031548 Ga0307408_100316641 Ga0307408_1003166412 289
958 3300031616 Ga0307508_10024189 Ga0307508_100241894 289
959 3300031731 Ga0307405_10090606 Ga0307405_100906063 289
960 3300031731 Ga0307405_10097473 Ga0307405_100974732 289
961 3300031731 Ga0307405_10380845 Ga0307405_103808451 289
962 3300031731 Ga0307405_10393632 Ga0307405_103936321 289
963 3300031824 Ga0307413_10001088 Ga0307413_100010886 289
964 3300031824 Ga0307413_10001468 Ga0307413_100014682 289
965 3300031824 Ga0307413_10019027 Ga0307413_100190276 289
966 3300031824 Ga0307413_10022623 Ga0307413_100226232 289
967 3300031824 Ga0307413_10026569 Ga0307413_100265692 289
968 3300031824 Ga0307413_10027214 Ga0307413_100272142 289
969 3300031824 Ga0307413_10040320 Ga0307413_100403203 289
970 3300031824 Ga0307413_10046517 Ga0307413_100465172 289
971 3300031824 Ga0307413_10079428 Ga0307413_100794282 289
972 3300031824 Ga0307413_10099336 Ga0307413_100993362 289
973 3300031824 Ga0307413_10176385 Ga0307413_101763852 289
974 3300031852 Ga0307410_10003712 Ga0307410_100037128 289
975 3300031852 Ga0307410_10008450 Ga0307410_100084503 289
976 3300031852 Ga0307410_10011027 Ga0307410_100110271 289
977 3300031852 Ga0307410_10023280 Ga0307410_100232805 289
978 3300031852 Ga0307410_10051899 Ga0307410_100518992 289
979 3300031852 Ga0307410_10056814 Ga0307410_100568143 289
980 3300031852 Ga0307410_10066835 Ga0307410_100668352 289
981 3300031852 Ga0307410_10068670 Ga0307410_100686703 289
982 3300031852 Ga0307410_10175246 Ga0307410_101752462 289
983 3300031852 Ga0307410_10275276 Ga0307410_102752761 289
984 3300031852 Ga0307410_10341130 Ga0307410_103411302 289
985 3300031901 Ga0307406_10175404 Ga0307406_101754042 289
986 3300031901 Ga0307406_10184910 Ga0307406_101849102 289
987 3300031901 Ga0307406_10196343 Ga0307406_101963432 289
988 3300031903 Ga0307407_10020842 Ga0307407_100208423 289
989 3300031903 Ga0307407_10043605 Ga0307407_100436053 289
990 3300031903 Ga0307407_10046661 Ga0307407_100466612 289
991 3300031903 Ga0307407_10265083 Ga0307407_102650832 289
992 3300031911 Ga0307412_10009146 Ga0307412_100091462 289
993 3300031911 Ga0307412_10015207 Ga0307412_100152072 289
994 3300031911 Ga0307412_10021020 Ga0307412_100210201 289
995 3300031911 Ga0307412_10025145 Ga0307412_100251453 289
996 3300031911 Ga0307412_10027423 Ga0307412_100274235 289
997 3300031911 Ga0307412_10073959 Ga0307412_100739592 289
998 3300031911 Ga0307412_10087149 Ga0307412_100871493 289
999 3300031995 Ga0307409_100016259 Ga0307409_1000162592 289
1000 3300031995 Ga0307409_100044184 Ga0307409_1000441843 289
1001 3300031995 Ga0307409_100623889 Ga0307409_1006238892 289
1002 3300032002 Ga0307416_100017877 Ga0307416_1000178772 289
1003 3300032002 Ga0307416_100018741 Ga0307416_1000187417 289
1004 3300032002 Ga0307416_100023157 Ga0307416_1000231574 289
1005 3300032002 Ga0307416_100063263 Ga0307416_1000632633 289
1006 3300032002 Ga0307416_100161883 Ga0307416_1001618832 289
1007 3300032002 Ga0307416_100214232 Ga0307416_1002142322 289
1008 3300032002 Ga0307416_100328841 Ga0307416_1003288412 289
1009 3300032004 Ga0307414_10003931 Ga0307414_100039314 289
1010 3300032004 Ga0307414_10023089 Ga0307414_100230895 289
1011 3300032004 Ga0307414_10026742 Ga0307414_100267426 289
1012 3300032004 Ga0307414_10047995 Ga0307414_100479952 289
1013 3300032004 Ga0307414_10048782 Ga0307414_100487823 289
1014 3300032004 Ga0307414_10068246 Ga0307414_100682463 289
1015 3300032004 Ga0307414_10074774 Ga0307414_100747742 289
1016 3300032004 Ga0307414_10120721 Ga0307414_101207213 289
1017 3300032004 Ga0307414_10166867 Ga0307414_101668672 289
1018 3300032004 Ga0307414_10213646 Ga0307414_102136462 289
1019 3300032004 Ga0307414_10233542 Ga0307414_102335422 289
1020 3300032004 Ga0307414_10234921 Ga0307414_102349211 289
1021 3300032004 Ga0307414_10240655 Ga0307414_102406552 289
1022 3300032004 Ga0307414_10369188 Ga0307414_103691882 289
1023 3300032004 Ga0307414_10578171 Ga0307414_105781712 289
1024 3300032005 Ga0307411_10011147 Ga0307411_100111474 289
1025 3300032005 Ga0307411_10019072 Ga0307411_100190722 289
1026 3300032005 Ga0307411_10028685 Ga0307411_100286852 289
1027 3300032005 Ga0307411_10031019 Ga0307411_100310192 289
1028 3300032005 Ga0307411_10062927 Ga0307411_100629272 289
1029 3300032005 Ga0307411_10087543 Ga0307411_100875433 289
1030 3300032005 Ga0307411_10092324 Ga0307411_100923242 289
1031 3300032005 Ga0307411_10124870 Ga0307411_101248703 289
1032 3300032005 Ga0307411_10150097 Ga0307411_101500972 289
1033 3300032005 Ga0307411_10218540 Ga0307411_102185402 289
1034 3300032126 Ga0307415_100001725 Ga0307415_10000172514 289
1035 3300032126 Ga0307415_100012724 Ga0307415_1000127244 289
1036 3300032126 Ga0307415_100026725 Ga0307415_1000267253 289
1037 3300032126 Ga0307415_100046632 Ga0307415_1000466322 289
1038 3300032126 Ga0307415_100085590 Ga0307415_1000855903 289
1039 3300032126 Ga0307415_100391067 Ga0307415_1003910672 289
1040 3300032126 Ga0307415_100426869 Ga0307415_1004268691 289
1041 3300032133 Ga0316583_10006442 Ga0316583_100064422 289
1042 3300033180 Ga0307510_10003694 Ga0307510_100036944 289
1043 3300035695 Ga0373927_0165678 Ga0373927_0165678_501_1382 289
1044 3300036401 Ga0373937_0018050 Ga0373937_0018050_2248_3150 289
1045 3300036401 Ga0373937_0082332 Ga0373937_0082332_986_1867 289
1046 3300036647 Ga0316582_0342637 Ga0316582_0342637_118_987 289
1047 3300037068 Ga0373925_0264000 Ga0373925_0264000_417_1298 289
1048 3300037312 Ga0395899_0000162 Ga0395899_0000162_86921_87814 289
1049 3300037312 Ga0395899_0000224 Ga0395899_0000224_53218_54120 289
1050 3300037312 Ga0395899_0001939 Ga0395899_0001939_4211_5113 289
1051 3300037312 Ga0395899_0001948 Ga0395899_0001948_5500_6402 289
1052 3300037312 Ga0395899_0008499 Ga0395899_0008499_5000_5899 289
1053 3300037312 Ga0395899_0019306 Ga0395899_0019306_2833_3714 289
1054 3300037312 Ga0395899_0024041 Ga0395899_0024041_2019_2921 289
1055 3300037312 Ga0395899_0035497 Ga0395899_0035497_2836_3723 289
1056 3300037312 Ga0395899_0125782 Ga0395899_0125782_875_1768 289
1057 3300037312 Ga0395899_0147127 Ga0395899_0147127_214_1116 289
1058 3300037312 Ga0395899_0193804 Ga0395899_0193804_22_921 289
1059 3300037312 Ga0395899_0210424 Ga0395899_0210424_409_1311 289
1060 3300037418 Ga0395900_0000129 Ga0395900_0000129_38492_39385 289
1061 3300037418 Ga0395900_0000294 Ga0395900_0000294_66006_66908 289
1062 3300037418 Ga0395900_0001134 Ga0395900_0001134_19661_20563 289
1063 3300037418 Ga0395900_0001825 Ga0395900_0001825_7146_8048 289
1064 3300037418 Ga0395900_0006995 Ga0395900_0006995_868_1770 289
1065 3300037418 Ga0395900_0007653 Ga0395900_0007653_1309_2208 289
1066 3300037418 Ga0395900_0009452 Ga0395900_0009452_8090_8992 289
1067 3300037418 Ga0395900_0019610 Ga0395900_0019610_4839_5720 289
1068 3300037418 Ga0395900_0023286 Ga0395900_0023286_916_1809 289
1069 3300037418 Ga0395900_0063160 Ga0395900_0063160_41_943 289
1070 3300037418 Ga0395900_0083272 Ga0395900_0083272_347_1246 289
1071 3300037418 Ga0395900_0104333 Ga0395900_0104333_25_906 289
1072 3300037418 Ga0395900_0190646 Ga0395900_0190646_1106_2005 289
1073 3300037418 Ga0395900_0259655 Ga0395900_0259655_14_907 289
1074 3300037418 Ga0395900_0282989 Ga0395900_0282989_309_1211 289
1075 3300037418 Ga0395900_0296070 Ga0395900_0296070_28_927 289
1076 3300037418 Ga0395900_0371103 Ga0395900_0371103_484_1389 289
1077 3300037466 Ga0395898_0000192 Ga0395898_0000192_116170_117072 289
1078 3300037466 Ga0395898_0002761 Ga0395898_0002761_17370_18272 289
1079 3300037466 Ga0395898_0012813 Ga0395898_0012813_5735_6628 289
1080 3300037466 Ga0395898_0013378 Ga0395898_0013378_5767_6648 289
1081 3300037466 Ga0395898_0021649 Ga0395898_0021649_3860_4762 289
1082 3300037466 Ga0395898_0022572 Ga0395898_0022572_204_1103 289
1083 3300037466 Ga0395898_0087043 Ga0395898_0087043_862_1761 289
1084 3300037466 Ga0395898_0092716 Ga0395898_0092716_1763_2662 289
1085 3300037466 Ga0395898_0135223 Ga0395898_0135223_771_1673 289
1086 3300037466 Ga0395898_0208227 Ga0395898_0208227_710_1609 289
1087 3300037466 Ga0395898_0231585 Ga0395898_0231585_114_1019 289
1088 3300037471 Ga0395905_0000066 Ga0395905_0000066_116214_117116 289
1089 3300037471 Ga0395905_0000128 Ga0395905_0000128_90395_91297 289
1090 3300037471 Ga0395905_0001605 Ga0395905_0001605_10420_11319 289
1091 3300037471 Ga0395905_0001734 Ga0395905_0001734_22987_23889 289
1092 3300037471 Ga0395905_0001888 Ga0395905_0001888_18218_19120 289
1093 3300037471 Ga0395905_0001997 Ga0395905_0001997_16129_17028 289
1094 3300037471 Ga0395905_0022884 Ga0395905_0022884_4059_4961 289
1095 3300037471 Ga0395905_0023006 Ga0395905_0023006_3827_4726 289
1096 3300037471 Ga0395905_0028944 Ga0395905_0028944_3724_4617 289
1097 3300037471 Ga0395905_0061018 Ga0395905_0061018_1823_2725 289
1098 3300037471 Ga0395905_0069419 Ga0395905_0069419_2328_3227 289
1099 3300037471 Ga0395905_0083865 Ga0395905_0083865_26_919 289
1100 3300037471 Ga0395905_0091575 Ga0395905_0091575_1794_2693 289
1101 3300037471 Ga0395905_0100347 Ga0395905_0100347_1779_2672 289
1102 3300037471 Ga0395905_0199299 Ga0395905_0199299_736_1632 289
1103 3300037471 Ga0395905_0211160 Ga0395905_0211160_875_1774 289
1104 3300037471 Ga0395905_0299394 Ga0395905_0299394_599_1483 289
1105 3300037853 Ga0436364_0493604 Ga0436364_0493604_486_1373 289
1106 3300038443 Ga0395901_0000111 Ga0395901_0000111_24717_25610 289
1107 3300038443 Ga0395901_0000232 Ga0395901_0000232_22_924 289
1108 3300038443 Ga0395901_0008904 Ga0395901_0008904_8090_8989 289
1109 3300038443 Ga0395901_0009612 Ga0395901_0009612_1189_2070 289
1110 3300038443 Ga0395901_0009785 Ga0395901_0009785_7647_8549 289
1111 3300038443 Ga0395901_0028578 Ga0395901_0028578_1001_1903 289
1112 3300038443 Ga0395901_0053332 Ga0395901_0053332_1509_2411 289
1113 3300038443 Ga0395901_0204862 Ga0395901_0204862_250_1155 289
1114 3300038443 Ga0395901_0229119 Ga0395901_0229119_149_1048 289
1115 3300038443 Ga0395901_0352976 Ga0395901_0352976_263_1165 289
1116 3300038443 Ga0395901_0393196 Ga0395901_0393196_499_1383 289
1117 3300038443 Ga0395901_0594545 Ga0395901_0594545_19_918 289
1118 3300039437 Ga0436365_0231014 Ga0436365_0231014_745_1629 289
1119 3300039437 Ga0436365_0893196 Ga0436365_0893196_763_1659 289
1120 3300039437 Ga0436365_1205090 Ga0436365_1205090_83896_84801 289
1121 3300039450 Ga0436363_0994942 Ga0436363_0994942_77_994 289
1122 3300041404 Ga0439436_0002205 Ga0439436_0002205_4442_5323 289
1123 3300041406 Ga0439439_0014019 Ga0439439_0014019_283_1164 289
1124 3300041410 Ga0439461_0001565 Ga0439461_0001565_2415_3296 289
1125 3300041413 Ga0439465_0004134 Ga0439465_0004134_973_1854 289
1126 3300041997 Ga0439431_0000998 Ga0439431_0000998_2868_3749 289
1127 3300042002 Ga0439442_000707 Ga0439442_000707_169_1050 289
1128 3300042003 Ga0439443_018301 Ga0439443_018301_69_1010 289
1129 3300042004 Ga0439445_0006583 Ga0439445_0006583_1190_2071 289
1130 3300042004 Ga0439445_0024478 Ga0439445_0024478_613_1503 289
1131 3300042004 Ga0439445_0030853 Ga0439445_0030853_438_1328 289
1132 3300042005 Ga0439448_0002135 Ga0439448_0002135_2439_3326 289
1133 3300042005 Ga0439448_0014460 Ga0439448_0014460_1014_1901 289
1134 3300042006 Ga0439432_003066 Ga0439432_003066_249_1130 289
1135 3300042012 Ga0439455_0000079 Ga0439455_0000079_4242_5135 289
1136 3300042012 Ga0439455_0009079 Ga0439455_0009079_1059_1946 289
1137 3300042015 Ga0439462_0000506 Ga0439462_0000506_5892_6773 289
1138 3300042015 Ga0439462_0009457 Ga0439462_0009457_462_1340 289
1139 3300042118 Ga0450914_002118 Ga0450914_002118_275_1171 289
1140 3300042127 Ga0450890_001357 Ga0450890_001357_555_1451 289
1141 3300042142 Ga0450905_003605 Ga0450905_003605_198_1094 289
1142 3300042144 Ga0450889_001641 Ga0450889_001641_565_1461 289
1143 3300042156 Ga0439446_0011876 Ga0439446_0011876_920_1801 289
1144 3300042157 Ga0439458_0000034 Ga0439458_0000034_4485_5378 289
1145 3300042157 Ga0439458_0000074 Ga0439458_0000074_8165_9064 289
1146 3300042157 Ga0439458_0000807 Ga0439458_0000807_2578_3465 289
1147 3300042185 Ga0450909_011686 Ga0450909_011686_332_1210 289
1148 3300042435 Ga0439434_0001116 Ga0439434_0001116_350_1231 289
1149 3300042435 Ga0439434_0034378 Ga0439434_0034378_302_1180 289
1150 3300044658 Ga0466972_0090715 Ga0466972_0090715_502_1404 289
1151 3300044693 Ga0466961_0087796 Ga0466961_0087796_688_1590 289
1152 3300044694 Ga0466963_0032333 Ga0466963_0032333_1204_2103 289
1153 3300044694 Ga0466963_0057470 Ga0466963_0057470_55_954 289
1154 3300044694 Ga0466963_0263933 Ga0466963_0263933_260_1162 289
1155 3300044719 Ga0466971_0159790 Ga0466971_0159790_120_1022 289
1156 3300044842 Ga0466957_0001949 Ga0466957_0001949_8559_9461 289
1157 3300044842 Ga0466957_0029015 Ga0466957_0029015_208_1110 289
1158 3300044842 Ga0466957_0192672 Ga0466957_0192672_187_1089 289
1159 3300045049 Ga0466959_0049315 Ga0466959_0049315_615_1517 289
1160 3300045836 Ga0466958_0109623 Ga0466958_0109623_754_1653 289
1161 3300045836 Ga0466958_0169671 Ga0466958_0169671_231_1133 289
1162 3300045976 Ga0466967_0012464 Ga0466967_0012464_2022_2924 289
1163 3300045976 Ga0466967_0097888 Ga0466967_0097888_177_1079 289
1164 3300045976 Ga0466967_0117056 Ga0466967_0117056_966_1868 289
1165 3300046457 Ga0495590_0080031 Ga0495590_0080031_210_1109 289
1166 3300046492 Ga0495585_0000750 Ga0495585_0000750_5141_6028 289
1167 3300046492 Ga0495585_0022979 Ga0495585_0022979_2504_3403 289
1168 3300046492 Ga0495585_0030185 Ga0495585_0030185_1493_2380 289
1169 3300046492 Ga0495585_0096914 Ga0495585_0096914_128_1015 289
1170 3300046500 Ga0495596_0020240 Ga0495596_0020240_501_1388 289
1171 3300046506 Ga0495583_0018865 Ga0495583_0018865_695_1588 289
1172 3300046506 Ga0495583_0066779 Ga0495583_0066779_50_937 289
1173 3300046507 Ga0495606_0129258 Ga0495606_0129258_183_1070 289
1174 3300046512 Ga0495610_0038514 Ga0495610_0038514_668_1564 289
1175 3300046513 Ga0495616_0017996 Ga0495616_0017996_1029_1916 289
1176 3300046522 Ga0495643_0000940 Ga0495643_0000940_13783_14670 289
1177 3300046522 Ga0495643_0003621 Ga0495643_0003621_2320_3207 289
1178 3300046524 Ga0495648_0113094 Ga0495648_0113094_53_940 289
1179 3300046525 Ga0495663_0000482 Ga0495663_0000482_6832_7719 289
1180 3300046525 Ga0495663_0079844 Ga0495663_0079844_59_958 289
1181 3300046537 Ga0495598_0002468 Ga0495598_0002468_858_1757 289
1182 3300046539 Ga0495621_0007814 Ga0495621_0007814_2201_3100 289
1183 3300046558 Ga0495633_0014867 Ga0495633_0014867_3108_4007 289
1184 3300046615 Ga0495656_0169907 Ga0495656_0169907_62_961 289
1185 3300046616 Ga0495668_0187500 Ga0495668_0187500_207_1082 289
1186 3300046648 Ga0495611_0004801 Ga0495611_0004801_4371_5261 289
1187 3300046660 Ga0495625_0000054 Ga0495625_0000054_104454_105335 289
1188 3300046660 Ga0495625_0001233 Ga0495625_0001233_20657_21541 289
1189 3300046660 Ga0495625_0150090 Ga0495625_0150090_126_1013 289
1190 3300046660 Ga0495625_0294058 Ga0495625_0294058_144_1019 289
1191 3300046679 Ga0495623_0118763 Ga0495623_0118763_397_1299 289
1192 3300046691 Ga0495670_0002776 Ga0495670_0002776_2642_3523 289
1193 3300046691 Ga0495670_0031792 Ga0495670_0031792_1039_1938 289
1194 3300047323 Ga0495683_0095961 Ga0495683_0095961_299_1186 289
1195 3300047443 Ga0495687_001304 Ga0495687_001304_75_962 289
1196 3300047445 Ga0495677_0002115 Ga0495677_0002115_6045_6938 289
1197 3300047470 Ga0495681_0058476 Ga0495681_0058476_380_1258 289
1198 3300047472 Ga0495686_0000733 Ga0495686_0000733_32768_33652 289
1199 3300047472 Ga0495686_0076030 Ga0495686_0076030_361_1242 289
1200 3300048088 Ga0495602_0004945 Ga0495602_0004945_5357_6259 289
1201 3300048903 Ga0496100_0007024 Ga0496100_0007024_3601_4503 289
1202 3300048904 Ga0496101_0017196 Ga0496101_0017196_1867_2769 289
1203 3300048904 Ga0496101_0245378 Ga0496101_0245378_78_965 289
1204 3300048905 Ga0496102_0000126 Ga0496102_0000126_18926_19813 289
1205 3300048905 Ga0496102_0022268 Ga0496102_0022268_2033_2935 289
1206 3300048905 Ga0496102_0308113 Ga0496102_0308113_420_1334 289
1207 3300048906 Ga0496103_0000089 Ga0496103_0000089_84444_85331 289
1208 3300048906 Ga0496103_0102180 Ga0496103_0102180_655_1557 289
1209 3300048908 Ga0496105_0000162 Ga0496105_0000162_19001_19888 289
1210 3300048908 Ga0496105_0253672 Ga0496105_0253672_397_1299 289
1211 3300048909 Ga0496106_0006171 Ga0496106_0006171_5603_6505 289
1212 3300048910 Ga0496107_0003281 Ga0496107_0003281_4512_5414 289
1213 3300048910 Ga0496107_0070176 Ga0496107_0070176_301_1203 289
1214 3300048910 Ga0496107_0088850 Ga0496107_0088850_68_967 289
1215 3300048911 Ga0496108_0003009 Ga0496108_0003009_7575_8477 289
1216 3300048911 Ga0496108_0009470 Ga0496108_0009470_6914_7822 289
1217 3300048911 Ga0496108_0015697 Ga0496108_0015697_2135_3037 289
1218 3300048912 Ga0496109_0005102 Ga0496109_0005102_2333_3235 289
1219 3300048912 Ga0496109_0088767 Ga0496109_0088767_524_1426 289
1220 3300048912 Ga0496109_0094208 Ga0496109_0094208_1292_2161 289
1221 3300048912 Ga0496109_0115774 Ga0496109_0115774_11_913 289
1222 3300048912 Ga0496109_0203310 Ga0496109_0203310_920_1822 289
1223 3300048912 Ga0496109_0257539 Ga0496109_0257539_30_914 289
1224 3300048913 Ga0496110_0002141 Ga0496110_0002141_8653_9555 289
1225 3300048913 Ga0496110_0005678 Ga0496110_0005678_2582_3484 289
1226 3300048913 Ga0496110_0109260 Ga0496110_0109260_1156_2025 289
1227 3300048914 Ga0496111_0086805 Ga0496111_0086805_656_1558 289
1228 3300048914 Ga0496111_0129127 Ga0496111_0129127_829_1731 289
1229 3300048914 Ga0496111_0169847 Ga0496111_0169847_670_1572 289
1230 3300048914 Ga0496111_0200750 Ga0496111_0200750_525_1412 289
1231 3300048915 Ga0496112_0002308 Ga0496112_0002308_13585_14454 289
1232 3300048915 Ga0496112_0006215 Ga0496112_0006215_5011_5913 289
1233 3300048915 Ga0496112_0013295 Ga0496112_0013295_1573_2475 289
1234 3300048915 Ga0496112_0032315 Ga0496112_0032315_2553_3455 289
1235 3300048915 Ga0496112_0033885 Ga0496112_0033885_3865_4767 289
1236 3300048915 Ga0496112_0127237 Ga0496112_0127237_238_1140 289
1237 3300048916 Ga0496113_0012992 Ga0496113_0012992_2598_3500 289
1238 3300048916 Ga0496113_0018901 Ga0496113_0018901_1833_2735 289
1239 3300048916 Ga0496113_0026826 Ga0496113_0026826_1875_2777 289
1240 3300048916 Ga0496113_0052006 Ga0496113_0052006_1335_2237 289
1241 3300048917 Ga0496114_0009856 Ga0496114_0009856_6283_7170 289
1242 3300048918 Ga0496115_0000147 Ga0496115_0000147_18926_19813 289
1243 3300048919 Ga0496116_0003598 Ga0496116_0003598_76_963 289
1244 3300048920 Ga0496117_0000329 Ga0496117_0000329_82260_83147 289
1245 3300048921 Ga0496118_0002303 Ga0496118_0002303_56_943 289
1246 3300048922 Ga0496119_0062558 Ga0496119_0062558_939_1826 289
1247 3300048924 Ga0496121_0000061 Ga0496121_0000061_33531_34400 289
1248 3300048924 Ga0496121_0003147 Ga0496121_0003147_1570_2442 289
1249 3300048924 Ga0496121_0185320 Ga0496121_0185320_544_1431 289
1250 3300048924 Ga0496121_0275239 Ga0496121_0275239_248_1138 289
1251 3300048925 Ga0496122_0013697 Ga0496122_0013697_6352_7236 289
1252 3300048926 Ga0496123_0045102 Ga0496123_0045102_382_1266 289
1253 3300048926 Ga0496123_0209215 Ga0496123_0209215_45_944 289
1254 3300048927 Ga0496124_0000041 Ga0496124_0000041_220973_221860 289
1255 3300048927 Ga0496124_0314026 Ga0496124_0314026_181_1071 289
1256 3300048928 Ga0496125_0000639 Ga0496125_0000639_22654_23538 289
1257 3300048929 Ga0496126_0000324 Ga0496126_0000324_82110_82997 289
1258 3300048929 Ga0496126_0012503 Ga0496126_0012503_1184_2062 289
1259 3300049459 Ga0495678_001148 Ga0495678_001148_10233_11129 289
1260 3300049460 Ga0495682_0021691 Ga0495682_0021691_46_933 289
1261 3300049569 Ga0501032_0045265 Ga0501032_0045265_300_1199 289
1262 3300049571 Ga0501034_0012663 Ga0501034_0012663_1713_2594 289
1263 3300049571 Ga0501034_0025028 Ga0501034_0025028_4362_5261 289
1264 3300049573 Ga0501037_0018395 Ga0501037_0018395_3535_4434 289
1265 3300049574 Ga0501038_0015639 Ga0501038_0015639_2605_3504 289
1266 3300049574 Ga0501038_0071197 Ga0501038_0071197_1231_2100 289
1267 3300049581 Ga0501047_0004362 Ga0501047_0004362_12221_13105 289
1268 3300049581 Ga0501047_0179544 Ga0501047_0179544_308_1207 289
1269 3300049583 Ga0501067_0008234 Ga0501067_0008234_2739_3638 289
1270 3300049589 Ga0501073_0032581 Ga0501073_0032581_1285_2184 289
1271 3300049742 Ga0501080_0003050 Ga0501080_0003050_4430_5329 289
1272 3300049742 Ga0501080_0113121 Ga0501080_0113121_341_1243 289
1273 3300049744 Ga0501083_0183872 Ga0501083_0183872_152_1051 289
1274 3300049765 Ga0501268_012787 Ga0501268_012787_361_1296 289
1275 3300049777 Ga0501281_00823 Ga0501281_00823_539_1429 289
1276 3300049822 Ga0501035_0038425 Ga0501035_0038425_2780_3679 289
1277 3300049823 Ga0501044_0013696 Ga0501044_0013696_6720_7601 289
1278 3300049823 Ga0501044_0121284 Ga0501044_0121284_1296_2165 289
1279 3300049823 Ga0501044_0334402 Ga0501044_0334402_130_1029 289
1280 3300050491 nmdc:mga00v17_219625_c1 nmdc:mga00v17_219625_c1_100_981 289
1281 3300050507 nmdc:mga05p37_756171_c1 nmdc:mga05p37_756171_c1_14_949 289
1282 3300050509 nmdc:mga0qj67_134471_c1 nmdc:mga0qj67_134471_c1_447_1355 289
1283 3300050512 nmdc:mga0n895_337393_c1 nmdc:mga0n895_337393_c1_277_1215 289
1284 3300053086 Ga0500578_0000035 Ga0500578_0000035_25207_26103 289
1285 3300053087 Ga0500643_000419 Ga0500643_000419_22493_23380 289
1286 3300053087 Ga0500643_003252 Ga0500643_003252_5875_6768 289
1287 3300053094 Ga0500566_0001517 Ga0500566_0001517_6896_7774 289
1288 3300053118 Ga0500594_0000238 Ga0500594_0000238_4424_5320 289
1289 3300053119 Ga0500595_012674 Ga0500595_012674_441_1313 289
1290 3300053119 Ga0500595_027867 Ga0500595_027867_382_1281 289
1291 3300053134 Ga0500658_0007413 Ga0500658_0007413_69_947 289
1292 3300053134 Ga0500658_0014013 Ga0500658_0014013_1496_2374 289
1293 3300053134 Ga0500658_0025472 Ga0500658_0025472_1289_2173 289
1294 3300053136 Ga0500559_0071221 Ga0500559_0071221_278_1165 289
1295 3300053139 Ga0500568_0064445 Ga0500568_0064445_485_1363 289
1296 3300053157 Ga0500624_000041 Ga0500624_000041_41321_42223 289
1297 3300053178 Ga0500637_0000072 Ga0500637_0000072_2288_3190 289
1298 3300060353 Ga0501082_0024476 Ga0501082_0024476_4081_4980 289
1299 2162886007 SwRhRL2b_contig_1386934 SwRhRL2b_0336.00009450 290
1300 3300005289 Ga0065704_10070605 Ga0065704_100706056 290
1301 3300005347 Ga0070668_100002144 Ga0070668_1000021447 290
1302 3300005353 Ga0070669_100002922 Ga0070669_1000029226 290
1303 3300005355 Ga0070671_100000419 Ga0070671_10000041911 290
1304 3300005367 Ga0070667_100049740 Ga0070667_1000497404 290
1305 3300005548 Ga0070665_100019141 Ga0070665_1000191413 290
1306 3300005841 Ga0068863_100147317 Ga0068863_1001473173 290
1307 3300005843 Ga0068860_100026016 Ga0068860_1000260163 290
1308 3300005844 Ga0068862_100078001 Ga0068862_1000780012 290
1309 3300009011 Ga0105251_10019125 Ga0105251_100191253 290
1310 3300009148 Ga0105243_10334929 Ga0105243_103349292 290
1311 3300009177 Ga0105248_10098092 Ga0105248_100980925 290
1312 3300009177 Ga0105248_10380989 Ga0105248_103809892 290
1313 3300009545 Ga0105237_10109750 Ga0105237_101097503 290
1314 3300009553 Ga0105249_10004132 Ga0105249_100041329 290
1315 3300013306 Ga0163162_10005919 Ga0163162_100059194 290
1316 3300025711 Ga0207696_1003210 Ga0207696_10032103 290
1317 3300025735 Ga0207713_1008865 Ga0207713_10088654 290
1318 3300025900 Ga0207710_10068458 Ga0207710_100684582 290
1319 3300025914 Ga0207671_10108250 Ga0207671_101082502 290
1320 3300025923 Ga0207681_10000049 Ga0207681_1000004917 290
1321 3300025925 Ga0207650_10078528 Ga0207650_100785282 290
1322 3300025931 Ga0207644_10002156 Ga0207644_100021563 290
1323 3300025931 Ga0207644_10006010 Ga0207644_100060103 290
1324 3300025941 Ga0207711_10151481 Ga0207711_101514812 290
1325 3300025941 Ga0207711_10439342 Ga0207711_104393422 290
1326 3300025972 Ga0207668_10001720 Ga0207668_100017207 290
1327 3300025986 Ga0207658_10035632 Ga0207658_100356322 290
1328 3300025986 Ga0207658_10179495 Ga0207658_101794953 290
1329 3300026088 Ga0207641_10042228 Ga0207641_100422283 290
1330 3300028379 Ga0268266_10014112 Ga0268266_100141124 290
1331 3300028381 Ga0268264_10018657 Ga0268264_100186573 290
1332 3300031852 Ga0307410_10064419 Ga0307410_100644194 290
1333 3300031903 Ga0307407_10052847 Ga0307407_100528472 290
1334 3300032005 Ga0307411_10080384 Ga0307411_100803843 290
1335 3300037418 Ga0395900_0074997 Ga0395900_0074997_2509_3420 290
1336 3300037418 Ga0395900_0170507 Ga0395900_0170507_1181_2083 290
1337 3300037418 Ga0395900_0188788 Ga0395900_0188788_841_1785 290
1338 3300037471 Ga0395905_0042055 Ga0395905_0042055_3255_4157 290
1339 3300038443 Ga0395901_0002513 Ga0395901_0002513_17200_18102 290
1340 3300038443 Ga0395901_0263796 Ga0395901_0263796_243_1154 290
1341 3300041413 Ga0439465_0017108 Ga0439465_0017108_668_1567 290
1342 3300042012 Ga0439455_0025260 Ga0439455_0025260_223_1122 290
1343 3300046452 Ga0495617_003842 Ga0495617_003842_1965_2849 290
1344 3300046512 Ga0495610_0000072 Ga0495610_0000072_34281_35165 290
1345 3300046665 Ga0495661_0060631 Ga0495661_0060631_189_1073 290
1346 3300047470 Ga0495681_0000043 Ga0495681_0000043_43220_44104 290
1347 3300047472 Ga0495686_0011612 Ga0495686_0011612_3604_4488 290
1348 3300048903 Ga0496100_0006118 Ga0496100_0006118_4365_5246 290
1349 3300048904 Ga0496101_0058550 Ga0496101_0058550_1871_2743 290
1350 3300048905 Ga0496102_0000372 Ga0496102_0000372_13052_13924 290
1351 3300048906 Ga0496103_0000021 Ga0496103_0000021_209476_210348 290
1352 3300048907 Ga0496104_0000128 Ga0496104_0000128_22956_23828 290
1353 3300048907 Ga0496104_0068640 Ga0496104_0068640_1242_2123 290
1354 3300048908 Ga0496105_0000064 Ga0496105_0000064_45216_46088 290
1355 3300048908 Ga0496105_0050705 Ga0496105_0050705_2193_3074 290
1356 3300048909 Ga0496106_0002666 Ga0496106_0002666_9863_10744 290
1357 3300048910 Ga0496107_0003647 Ga0496107_0003647_7118_7999 290
1358 3300048910 Ga0496107_0027689 Ga0496107_0027689_2107_2979 290
1359 3300048912 Ga0496109_0052130 Ga0496109_0052130_973_1857 290
1360 3300048914 Ga0496111_0051334 Ga0496111_0051334_2058_2942 290
1361 3300048915 Ga0496112_0047978 Ga0496112_0047978_2549_3421 290
1362 3300048915 Ga0496112_0057220 Ga0496112_0057220_403_1284 290
1363 3300048915 Ga0496112_0138910 Ga0496112_0138910_972_1853 290
1364 3300048916 Ga0496113_0000044 Ga0496113_0000044_23617_24489 290
1365 3300048916 Ga0496113_0001455 Ga0496113_0001455_11905_12786 290
1366 3300048916 Ga0496113_0023601 Ga0496113_0023601_2769_3653 290
1367 3300048917 Ga0496114_0325344 Ga0496114_0325344_269_1150 290
1368 3300048919 Ga0496116_0094763 Ga0496116_0094763_378_1250 290
1369 3300048920 Ga0496117_0001310 Ga0496117_0001310_6566_7438 290
1370 3300048921 Ga0496118_0042458 Ga0496118_0042458_1108_1980 290
1371 3300048922 Ga0496119_0000077 Ga0496119_0000077_51825_52697 290
1372 3300048923 Ga0496120_0001801 Ga0496120_0001801_18747_19619 290
1373 3300048924 Ga0496121_0006414 Ga0496121_0006414_6858_7730 290
1374 3300048925 Ga0496122_0006634 Ga0496122_0006634_7469_8341 290
1375 3300048926 Ga0496123_0001103 Ga0496123_0001103_20754_21626 290
1376 3300048928 Ga0496125_0001135 Ga0496125_0001135_21966_22838 290
1377 3300048929 Ga0496126_0000175 Ga0496126_0000175_18766_19638 290
1378 3300049460 Ga0495682_0039747 Ga0495682_0039747_576_1475 290
1379 3300050494 nmdc:mga06z11_132_c1 nmdc:mga06z11_132_c1_15988_16881 290
1380 3300050495 nmdc:mga04h51_45_c1 nmdc:mga04h51_45_c1_36980_37873 290
1381 3300050496 nmdc:mga07m45_94299_c1 nmdc:mga07m45_94299_c1_800_1693 290
1382 3300053087 Ga0500643_000172 Ga0500643_000172_18170_19048 290
1383 3300053136 Ga0500559_0003399 Ga0500559_0003399_4017_4895 290
1384 3300053139 Ga0500568_0002255 Ga0500568_0002255_6239_7165 290
1385 3300053153 Ga0500616_0004406 Ga0500616_0004406_6283_7209 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

3

160

0.98

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

1

109

0.95

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

163

291

0.93

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

4

105

0.89

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

3

80

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

3

94

0.82

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

1

127

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9766 3 289
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9634 3 289
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9575 1 289
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.955 4 289
5y8g-assembly1.cif.gz_A mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) 0.9535 3 289
ID Description Score Start End Superfamily
af_F1QE62_196_329_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9859 165 289 1.10.1040.10
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9849 1 160 3.40.50.720
af_Q653U8_207_338_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9814 162 288 1.10.1040.10
5y8iA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9709 162 289 1.10.1040.10
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9688 3 157 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Z1FBE2-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) 0.9972 3 290 GO:0006574
GO:0008442
GO:0050661
GO:0051287
AF-A0A4Q2ZRT3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9966 119 289 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A3B9ULD9-F1-model_v4 deleted 0.9953 3 150
AF-A0A117S6P7-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) 0.9943 3 290 GO:0006574
GO:0008442
GO:0050661
GO:0051287
AF-A0A4V1TGG6-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) 0.9911 1 287 GO:0006574
GO:0008442
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
97.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map