F493554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1386 | 479 | 2772 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300005834|Ga0068851_10121186|Ga0068851_101211863 |
| Length | 144 |
| Sequence | MGLKPGTDGFHPPCHDIAVGRRSVVNAPKPRDIEALCTAKGMRMTEQRRVIARVLAAADDHPDVEELYAGIIERHDFRNGRARYEQIPDSHHDHLINLRTGEVIEFQSEDIERLQAEVARRLGYRLIDHRLELYAVPLDDKPKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 127 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 244 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 252 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 267 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 275 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 279 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 281 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 283 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 293 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 294 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 295 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 296 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 397 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 430 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 431 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 433 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 434 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 436 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 454 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 456 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 457 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 458 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 462 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 463 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 464 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 466 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 467 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 470 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 473 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 478 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 479 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.43 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.31 |
| Nodule | 0 |
| Rhizoplane | 7.36 |
| Rhizosphere | 81.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068851_10121186 | 3300005834 | Bacteria | 1405 |
| 2 | JGI24746J21847_1001422 | 3300001977 | Bacteria | 3808 |
| 3 | JGI24743J22301_10000943 | 3300001991 | Bacteria | 3751 |
| 4 | JGI24743J22301_10001063 | 3300001991 | Bacteria | 3631 |
| 5 | JGI24735J21928_10122033 | 3300002067 | Bacteria | 750 |
| 6 | JGI24750J21931_1001324 | 3300002070 | Bacteria | 3116 |
| 7 | JGI24745J21846_1024265 | 3300002073 | Bacteria | 719 |
| 8 | JGI24738J21930_10017677 | 3300002075 | Bacteria | 1497 |
| 9 | JGI24749J21850_1006538 | 3300002076 | Bacteria | 1624 |
| 10 | JGI24744J21845_10001216 | 3300002077 | Bacteria | 5049 |
| 11 | JGI24033J26618_1023504 | 3300002155 | Bacteria | 802 |
| 12 | JGI24742J22300_10012337 | 3300002244 | Bacteria | 1424 |
| 13 | JGI24751J29686_10004135 | 3300002459 | Bacteria | 2942 |
| 14 | JGI25405J52794_10007754 | 3300003911 | Bacteria | 1988 |
| 15 | Ga0058859_11818714 | 3300004798 | Bacteria | 666 |
| 16 | Ga0065715_10767562 | 3300005293 | Bacteria | 623 |
| 17 | Ga0065707_10046659 | 3300005295 | Bacteria | 827 |
| 18 | Ga0065707_10139584 | 3300005295 | Bacteria | 1791 |
| 19 | Ga0065707_10163520 | 3300005295 | Bacteria | 1542 |
| 20 | Ga0070658_10025964 | 3300005327 | Bacteria | 4699 |
| 21 | Ga0070658_10146995 | 3300005327 | Bacteria | 1971 |
| 22 | Ga0070658_10279641 | 3300005327 | Bacteria | 1420 |
| 23 | Ga0070676_10024250 | 3300005328 | Bacteria | 3416 |
| 24 | Ga0070676_10274875 | 3300005328 | Bacteria | 1133 |
| 25 | Ga0070683_100092767 | 3300005329 | Bacteria | 2836 |
| 26 | Ga0070683_100483370 | 3300005329 | Bacteria | 1182 |
| 27 | Ga0070683_101318005 | 3300005329 | Bacteria | 694 |
| 28 | Ga0070690_100002546 | 3300005330 | Bacteria | 9809 |
| 29 | Ga0070690_100777856 | 3300005330 | Bacteria | 741 |
| 30 | Ga0070670_100005236 | 3300005331 | Bacteria | 10920 |
| 31 | Ga0070670_100048292 | 3300005331 | Bacteria | 3663 |
| 32 | Ga0068869_100016497 | 3300005334 | Bacteria | 4979 |
| 33 | Ga0068869_100056415 | 3300005334 | Bacteria | 2865 |
| 34 | Ga0068869_100432580 | 3300005334 | Bacteria | 1088 |
| 35 | Ga0068869_100693738 | 3300005334 | Bacteria | 868 |
| 36 | Ga0070666_10046576 | 3300005335 | Bacteria | 2909 |
| 37 | Ga0070680_100043520 | 3300005336 | Bacteria | 3648 |
| 38 | Ga0070680_100066652 | 3300005336 | Bacteria | 2952 |
| 39 | Ga0070680_100261566 | 3300005336 | Bacteria | 1464 |
| 40 | Ga0070680_100310594 | 3300005336 | Bacteria | 1338 |
| 41 | Ga0070680_100407083 | 3300005336 | Bacteria | 1160 |
| 42 | Ga0070680_100496378 | 3300005336 | Bacteria | 1044 |
| 43 | Ga0070680_100514255 | 3300005336 | Bacteria | 1025 |
| 44 | Ga0070680_100571215 | 3300005336 | Bacteria | 970 |
| 45 | Ga0070682_100034178 | 3300005337 | Bacteria | 3094 |
| 46 | Ga0070682_100126832 | 3300005337 | Bacteria | 1721 |
| 47 | Ga0070682_100720667 | 3300005337 | Bacteria | 802 |
| 48 | Ga0068868_100003086 | 3300005338 | Bacteria | 11592 |
| 49 | Ga0068868_100020299 | 3300005338 | Bacteria | 4988 |
| 50 | Ga0068868_100087352 | 3300005338 | Bacteria | 2507 |
| 51 | Ga0068868_100526545 | 3300005338 | Bacteria | 1038 |
| 52 | Ga0070660_100010850 | 3300005339 | Bacteria | 6450 |
| 53 | Ga0070660_100409712 | 3300005339 | Bacteria | 1122 |
| 54 | Ga0070689_100003434 | 3300005340 | Bacteria | 10545 |
| 55 | Ga0070689_100029697 | 3300005340 | Bacteria | 4141 |
| 56 | Ga0070689_100215663 | 3300005340 | Bacteria | 1573 |
| 57 | Ga0070687_100034735 | 3300005343 | Bacteria | 2498 |
| 58 | Ga0070687_100043598 | 3300005343 | Bacteria | 2281 |
| 59 | Ga0070661_100047641 | 3300005344 | Bacteria | 3137 |
| 60 | Ga0070661_100047671 | 3300005344 | Bacteria | 3136 |
| 61 | Ga0070661_100256635 | 3300005344 | Bacteria | 1350 |
| 62 | Ga0070692_10008804 | 3300005345 | Bacteria | 4517 |
| 63 | Ga0070669_100127010 | 3300005353 | Bacteria | 1952 |
| 64 | Ga0070669_100492346 | 3300005353 | Bacteria | 1016 |
| 65 | Ga0070669_101065855 | 3300005353 | Bacteria | 695 |
| 66 | Ga0070675_100039707 | 3300005354 | Bacteria | 3841 |
| 67 | Ga0070675_100375302 | 3300005354 | Bacteria | 1265 |
| 68 | Ga0070675_100468279 | 3300005354 | Bacteria | 1132 |
| 69 | Ga0070675_100915966 | 3300005354 | Bacteria | 804 |
| 70 | Ga0070671_100066484 | 3300005355 | Bacteria | 3004 |
| 71 | Ga0070671_100091145 | 3300005355 | Bacteria | 2552 |
| 72 | Ga0070671_100279237 | 3300005355 | Bacteria | 1420 |
| 73 | Ga0070674_100050261 | 3300005356 | Bacteria | 2870 |
| 74 | Ga0070674_100176129 | 3300005356 | Bacteria | 1634 |
| 75 | Ga0070674_100917551 | 3300005356 | Bacteria | 764 |
| 76 | Ga0070673_100061221 | 3300005364 | Bacteria | 2986 |
| 77 | Ga0070673_100189697 | 3300005364 | Bacteria | 1765 |
| 78 | Ga0070673_100588719 | 3300005364 | Bacteria | 1014 |
| 79 | Ga0070688_100005196 | 3300005365 | Bacteria | 6837 |
| 80 | Ga0070688_100050977 | 3300005365 | Bacteria | 2580 |
| 81 | Ga0070688_100414492 | 3300005365 | Bacteria | 1000 |
| 82 | Ga0070659_100032102 | 3300005366 | Bacteria | 4070 |
| 83 | Ga0070659_100042897 | 3300005366 | Bacteria | 3537 |
| 84 | Ga0070659_100083017 | 3300005366 | Bacteria | 2560 |
| 85 | Ga0070659_100559234 | 3300005366 | Bacteria | 980 |
| 86 | Ga0070659_100678522 | 3300005366 | Bacteria | 890 |
| 87 | Ga0070667_100099728 | 3300005367 | Bacteria | 2507 |
| 88 | Ga0070709_10283637 | 3300005434 | Bacteria | 1204 |
| 89 | Ga0070709_10586636 | 3300005434 | Bacteria | 857 |
| 90 | Ga0070709_10771220 | 3300005434 | Bacteria | 753 |
| 91 | Ga0070714_100035153 | 3300005435 | Bacteria | 4198 |
| 92 | Ga0070714_100066297 | 3300005435 | Bacteria | 3111 |
| 93 | Ga0070714_100310702 | 3300005435 | Bacteria | 1472 |
| 94 | Ga0070713_100010421 | 3300005436 | Bacteria | 6712 |
| 95 | Ga0070713_100021777 | 3300005436 | Bacteria | 4940 |
| 96 | Ga0070713_100162501 | 3300005436 | Bacteria | 1994 |
| 97 | Ga0070710_10014806 | 3300005437 | Bacteria | 3931 |
| 98 | Ga0070710_10035879 | 3300005437 | Bacteria | 2707 |
| 99 | Ga0070710_10081214 | 3300005437 | Bacteria | 1893 |
| 100 | Ga0070710_10263827 | 3300005437 | Bacteria | 1111 |
| 101 | Ga0070701_10001300 | 3300005438 | Bacteria | 9184 |
| 102 | Ga0070701_10140015 | 3300005438 | Bacteria | 1383 |
| 103 | Ga0070711_100084187 | 3300005439 | Bacteria | 2274 |
| 104 | Ga0070711_100247468 | 3300005439 | Bacteria | 1397 |
| 105 | Ga0070711_100414205 | 3300005439 | Bacteria | 1096 |
| 106 | Ga0070711_100433901 | 3300005439 | Bacteria | 1073 |
| 107 | Ga0070711_100572298 | 3300005439 | Bacteria | 939 |
| 108 | Ga0070705_100149675 | 3300005440 | Bacteria | 1547 |
| 109 | Ga0070700_100011750 | 3300005441 | Bacteria | 4860 |
| 110 | Ga0070700_100220337 | 3300005441 | Bacteria | 1344 |
| 111 | Ga0070708_100273033 | 3300005445 | Bacteria | 1590 |
| 112 | Ga0070708_100651795 | 3300005445 | Bacteria | 992 |
| 113 | Ga0070663_100028875 | 3300005455 | Bacteria | 3782 |
| 114 | Ga0070663_100293346 | 3300005455 | Bacteria | 1299 |
| 115 | Ga0070663_101557402 | 3300005455 | Bacteria | 588 |
| 116 | Ga0070678_100048644 | 3300005456 | Bacteria | 3055 |
| 117 | Ga0070678_100055189 | 3300005456 | Bacteria | 2899 |
| 118 | Ga0070678_100200529 | 3300005456 | Bacteria | 1646 |
| 119 | Ga0070678_100205458 | 3300005456 | Bacteria | 1628 |
| 120 | Ga0070678_100315879 | 3300005456 | Bacteria | 1333 |
| 121 | Ga0070662_100034665 | 3300005457 | Bacteria | 3560 |
| 122 | Ga0070662_100103951 | 3300005457 | Bacteria | 2154 |
| 123 | Ga0070662_100232464 | 3300005457 | Bacteria | 1475 |
| 124 | Ga0070662_100581643 | 3300005457 | Bacteria | 941 |
| 125 | Ga0070662_100637882 | 3300005457 | Bacteria | 898 |
| 126 | Ga0070681_10016513 | 3300005458 | Bacteria | 7372 |
| 127 | Ga0070681_10396383 | 3300005458 | Bacteria | 1291 |
| 128 | Ga0070681_10503935 | 3300005458 | Bacteria | 1124 |
| 129 | Ga0068867_100031738 | 3300005459 | Bacteria | 3816 |
| 130 | Ga0068867_100381106 | 3300005459 | Bacteria | 1184 |
| 131 | Ga0068867_100979031 | 3300005459 | Bacteria | 766 |
| 132 | Ga0068867_101065547 | 3300005459 | Bacteria | 736 |
| 133 | Ga0070685_10011992 | 3300005466 | Bacteria | 4544 |
| 134 | Ga0070685_10233939 | 3300005466 | Bacteria | 1210 |
| 135 | Ga0070679_100033661 | 3300005530 | Bacteria | 5074 |
| 136 | Ga0070679_100063548 | 3300005530 | Bacteria | 3679 |
| 137 | Ga0070679_100182104 | 3300005530 | Bacteria | 2073 |
| 138 | Ga0070679_100190909 | 3300005530 | Bacteria | 2018 |
| 139 | Ga0070679_100198143 | 3300005530 | Bacteria | 1975 |
| 140 | Ga0070679_100222283 | 3300005530 | Bacteria | 1849 |
| 141 | Ga0070684_100076754 | 3300005535 | Bacteria | 2950 |
| 142 | Ga0070684_100163107 | 3300005535 | Bacteria | 2022 |
| 143 | Ga0070684_100174253 | 3300005535 | Bacteria | 1954 |
| 144 | Ga0070697_100071761 | 3300005536 | Bacteria | 2841 |
| 145 | Ga0070697_101135207 | 3300005536 | Bacteria | 696 |
| 146 | Ga0068853_100232868 | 3300005539 | Bacteria | 1685 |
| 147 | Ga0068853_100239340 | 3300005539 | Bacteria | 1663 |
| 148 | Ga0068853_100395245 | 3300005539 | Bacteria | 1293 |
| 149 | Ga0068853_100630884 | 3300005539 | Bacteria | 1019 |
| 150 | Ga0070672_100215685 | 3300005543 | Bacteria | 1608 |
| 151 | Ga0070672_100357537 | 3300005543 | Bacteria | 1246 |
| 152 | Ga0070686_100009403 | 3300005544 | Bacteria | 5495 |
| 153 | Ga0070686_100036878 | 3300005544 | Bacteria | 3030 |
| 154 | Ga0070686_100059554 | 3300005544 | Bacteria | 2460 |
| 155 | Ga0070686_100313887 | 3300005544 | Bacteria | 1167 |
| 156 | Ga0070695_100033983 | 3300005545 | Bacteria | 3193 |
| 157 | Ga0070695_100441454 | 3300005545 | Bacteria | 995 |
| 158 | Ga0070693_100082579 | 3300005547 | Bacteria | 1919 |
| 159 | Ga0070693_100142215 | 3300005547 | Bacteria | 1511 |
| 160 | Ga0070665_100043641 | 3300005548 | Bacteria | 4505 |
| 161 | Ga0070704_100002201 | 3300005549 | Bacteria | 10864 |
| 162 | Ga0070704_100058274 | 3300005549 | Bacteria | 2750 |
| 163 | Ga0068855_100033639 | 3300005563 | Bacteria | 6116 |
| 164 | Ga0068855_100095264 | 3300005563 | Bacteria | 3431 |
| 165 | Ga0068855_100384545 | 3300005563 | Bacteria | 1540 |
| 166 | Ga0068855_100912698 | 3300005563 | Bacteria | 927 |
| 167 | Ga0068855_100988370 | 3300005563 | Bacteria | 885 |
| 168 | Ga0070664_100130899 | 3300005564 | Bacteria | 2204 |
| 169 | Ga0070664_100539966 | 3300005564 | Bacteria | 1077 |
| 170 | Ga0068857_100079852 | 3300005577 | Bacteria | 2920 |
| 171 | Ga0068857_100519577 | 3300005577 | Bacteria | 1119 |
| 172 | Ga0068856_100251766 | 3300005614 | Bacteria | 1781 |
| 173 | Ga0068856_100354130 | 3300005614 | Bacteria | 1487 |
| 174 | Ga0068856_101145474 | 3300005614 | Bacteria | 795 |
| 175 | Ga0068856_101411532 | 3300005614 | Bacteria | 711 |
| 176 | Ga0070702_100002073 | 3300005615 | Bacteria | 8492 |
| 177 | Ga0070702_100064308 | 3300005615 | Bacteria | 2146 |
| 178 | Ga0070702_100112578 | 3300005615 | Bacteria | 1690 |
| 179 | Ga0070702_100180227 | 3300005615 | Bacteria | 1382 |
| 180 | Ga0068852_100017739 | 3300005616 | Bacteria | 5592 |
| 181 | Ga0068852_100032297 | 3300005616 | Bacteria | 4333 |
| 182 | Ga0068852_100055851 | 3300005616 | Bacteria | 3410 |
| 183 | Ga0068852_100109132 | 3300005616 | Bacteria | 2512 |
| 184 | Ga0068852_101076701 | 3300005616 | Bacteria | 824 |
| 185 | Ga0068859_100014564 | 3300005617 | Bacteria | 7899 |
| 186 | Ga0068859_100228480 | 3300005617 | Bacteria | 1949 |
| 187 | Ga0068864_100005707 | 3300005618 | Bacteria | 10206 |
| 188 | Ga0068864_100146517 | 3300005618 | Bacteria | 2135 |
| 189 | Ga0068864_100180677 | 3300005618 | Bacteria | 1929 |
| 190 | Ga0068864_100196550 | 3300005618 | Bacteria | 1851 |
| 191 | Ga0068864_100241964 | 3300005618 | Bacteria | 1672 |
| 192 | Ga0068864_101324956 | 3300005618 | Bacteria | 721 |
| 193 | Ga0068866_10101073 | 3300005718 | Bacteria | 1591 |
| 194 | Ga0068866_10254189 | 3300005718 | Bacteria | 1077 |
| 195 | Ga0068866_10333805 | 3300005718 | Bacteria | 958 |
| 196 | Ga0068861_100005727 | 3300005719 | Bacteria | 8423 |
| 197 | Ga0068861_100674542 | 3300005719 | Bacteria | 958 |
| 198 | Ga0068870_10002924 | 3300005840 | Bacteria | 7197 |
| 199 | Ga0068863_100047412 | 3300005841 | Bacteria | 4075 |
| 200 | Ga0068863_100424857 | 3300005841 | Bacteria | 1302 |
| 201 | Ga0068863_100475979 | 3300005841 | Bacteria | 1227 |
| 202 | Ga0068863_101108543 | 3300005841 | Bacteria | 796 |
| 203 | Ga0068863_101124962 | 3300005841 | Bacteria | 790 |
| 204 | Ga0068858_100014295 | 3300005842 | Bacteria | 7485 |
| 205 | Ga0068858_100120659 | 3300005842 | Bacteria | 2451 |
| 206 | Ga0068858_100264879 | 3300005842 | Bacteria | 1634 |
| 207 | Ga0068860_100059288 | 3300005843 | Bacteria | 3639 |
| 208 | Ga0068860_100420949 | 3300005843 | Bacteria | 1324 |
| 209 | Ga0068860_100453279 | 3300005843 | Bacteria | 1276 |
| 210 | Ga0068860_101013167 | 3300005843 | Bacteria | 849 |
| 211 | Ga0068862_100003247 | 3300005844 | Bacteria | 14065 |
| 212 | Ga0068862_100098160 | 3300005844 | Bacteria | 2558 |
| 213 | Ga0068862_100801179 | 3300005844 | Bacteria | 920 |
| 214 | Ga0081455_10007598 | 3300005937 | Bacteria | 11395 |
| 215 | Ga0081455_10011036 | 3300005937 | Bacteria | 9099 |
| 216 | Ga0081455_10011972 | 3300005937 | Bacteria | 8683 |
| 217 | Ga0081455_10145108 | 3300005937 | Bacteria | 1837 |
| 218 | Ga0081538_10066339 | 3300005981 | Bacteria | 2024 |
| 219 | Ga0081538_10095102 | 3300005981 | Bacteria | 1523 |
| 220 | Ga0081540_1010582 | 3300005983 | Bacteria | 6231 |
| 221 | Ga0081540_1054952 | 3300005983 | Bacteria | 1942 |
| 222 | Ga0081540_1060030 | 3300005983 | Bacteria | 1822 |
| 223 | Ga0081539_10001661 | 3300005985 | Bacteria | 36064 |
| 224 | Ga0070717_10004108 | 3300006028 | Bacteria | 10499 |
| 225 | Ga0070717_10029876 | 3300006028 | Bacteria | 4378 |
| 226 | Ga0070717_10159237 | 3300006028 | Bacteria | 1958 |
| 227 | Ga0070717_10226271 | 3300006028 | Bacteria | 1646 |
| 228 | Ga0075365_10014447 | 3300006038 | Bacteria | 4752 |
| 229 | Ga0075365_10020051 | 3300006038 | Bacteria | 4138 |
| 230 | Ga0075365_10037653 | 3300006038 | Bacteria | 3141 |
| 231 | Ga0075365_10121452 | 3300006038 | Bacteria | 1802 |
| 232 | Ga0075365_10237213 | 3300006038 | Bacteria | 1281 |
| 233 | Ga0075365_10452463 | 3300006038 | Bacteria | 907 |
| 234 | Ga0075368_10020274 | 3300006042 | Bacteria | 2516 |
| 235 | Ga0075368_10192590 | 3300006042 | Bacteria | 861 |
| 236 | Ga0075368_10276328 | 3300006042 | Bacteria | 721 |
| 237 | Ga0075368_10419524 | 3300006042 | Bacteria | 590 |
| 238 | Ga0075363_100026782 | 3300006048 | Bacteria | 2951 |
| 239 | Ga0075363_100061239 | 3300006048 | Bacteria | 2028 |
| 240 | Ga0075363_100067201 | 3300006048 | Bacteria | 1942 |
| 241 | Ga0075363_100135950 | 3300006048 | Bacteria | 1381 |
| 242 | Ga0075363_100212868 | 3300006048 | Bacteria | 1106 |
| 243 | Ga0075363_100231472 | 3300006048 | Bacteria | 1061 |
| 244 | Ga0075363_100357059 | 3300006048 | Bacteria | 854 |
| 245 | Ga0075363_100371148 | 3300006048 | Bacteria | 838 |
| 246 | Ga0075364_10018301 | 3300006051 | Bacteria | 4383 |
| 247 | Ga0075364_10038276 | 3300006051 | Bacteria | 3107 |
| 248 | Ga0075364_10377523 | 3300006051 | Bacteria | 967 |
| 249 | Ga0075364_10397650 | 3300006051 | Bacteria | 940 |
| 250 | Ga0075364_10669778 | 3300006051 | Bacteria | 708 |
| 251 | Ga0075432_10264905 | 3300006058 | Bacteria | 702 |
| 252 | Ga0070715_10000720 | 3300006163 | Bacteria | 8912 |
| 253 | Ga0070715_10063278 | 3300006163 | Bacteria | 1630 |
| 254 | Ga0070715_10097752 | 3300006163 | Bacteria | 1363 |
| 255 | Ga0070715_10116932 | 3300006163 | Bacteria | 1266 |
| 256 | Ga0070716_100001889 | 3300006173 | Bacteria | 9507 |
| 257 | Ga0070716_100010508 | 3300006173 | Bacteria | 4642 |
| 258 | Ga0070716_100145713 | 3300006173 | Bacteria | 1517 |
| 259 | Ga0070716_100389665 | 3300006173 | Bacteria | 998 |
| 260 | Ga0070712_100004033 | 3300006175 | Bacteria | 9009 |
| 261 | Ga0070712_100061863 | 3300006175 | Bacteria | 2646 |
| 262 | Ga0070712_100374650 | 3300006175 | Bacteria | 1170 |
| 263 | Ga0070712_100409988 | 3300006175 | Bacteria | 1121 |
| 264 | Ga0075362_10039557 | 3300006177 | Bacteria | 2074 |
| 265 | Ga0075362_10045310 | 3300006177 | Bacteria | 1953 |
| 266 | Ga0075362_10069781 | 3300006177 | Bacteria | 1603 |
| 267 | Ga0075367_10001316 | 3300006178 | Bacteria | 10529 |
| 268 | Ga0075367_10002916 | 3300006178 | Bacteria | 7973 |
| 269 | Ga0075367_10063008 | 3300006178 | Bacteria | 2216 |
| 270 | Ga0075367_10103936 | 3300006178 | Bacteria | 1738 |
| 271 | Ga0075367_10294336 | 3300006178 | Bacteria | 1021 |
| 272 | Ga0075367_10434289 | 3300006178 | Bacteria | 832 |
| 273 | Ga0075367_10458801 | 3300006178 | Bacteria | 808 |
| 274 | Ga0075367_10807620 | 3300006178 | Bacteria | 597 |
| 275 | Ga0075369_10018330 | 3300006186 | Bacteria | 2849 |
| 276 | Ga0075369_10033265 | 3300006186 | Bacteria | 2184 |
| 277 | Ga0075369_10050752 | 3300006186 | Bacteria | 1795 |
| 278 | Ga0075369_10511074 | 3300006186 | Bacteria | 571 |
| 279 | Ga0075366_10012444 | 3300006195 | Bacteria | 4826 |
| 280 | Ga0075366_10023107 | 3300006195 | Bacteria | 3622 |
| 281 | Ga0075366_10051353 | 3300006195 | Bacteria | 2450 |
| 282 | Ga0075366_10119067 | 3300006195 | Bacteria | 1591 |
| 283 | Ga0075366_10264575 | 3300006195 | Bacteria | 1050 |
| 284 | Ga0075366_10524970 | 3300006195 | Bacteria | 732 |
| 285 | Ga0097621_100059823 | 3300006237 | Bacteria | 3120 |
| 286 | Ga0097621_100191505 | 3300006237 | Bacteria | 1771 |
| 287 | Ga0097621_100334205 | 3300006237 | Bacteria | 1344 |
| 288 | Ga0097621_101074706 | 3300006237 | Bacteria | 755 |
| 289 | Ga0075370_10047361 | 3300006353 | Bacteria | 2434 |
| 290 | Ga0075370_10079080 | 3300006353 | Bacteria | 1889 |
| 291 | Ga0075370_10191128 | 3300006353 | Bacteria | 1206 |
| 292 | Ga0075370_10364188 | 3300006353 | Bacteria | 865 |
| 293 | Ga0075370_10605688 | 3300006353 | Bacteria | 664 |
| 294 | Ga0068871_100005491 | 3300006358 | Bacteria | 8893 |
| 295 | Ga0068871_100093724 | 3300006358 | Bacteria | 2506 |
| 296 | Ga0068871_100119621 | 3300006358 | Bacteria | 2224 |
| 297 | Ga0068871_100139509 | 3300006358 | Bacteria | 2061 |
| 298 | Ga0068871_100162960 | 3300006358 | Bacteria | 1908 |
| 299 | Ga0068871_100183445 | 3300006358 | Bacteria | 1799 |
| 300 | Ga0075428_100030184 | 3300006844 | Bacteria | 5997 |
| 301 | Ga0075428_100650920 | 3300006844 | Bacteria | 1124 |
| 302 | Ga0075428_102434721 | 3300006844 | Bacteria | 537 |
| 303 | Ga0075431_100659652 | 3300006847 | Bacteria | 1026 |
| 304 | Ga0075431_100898433 | 3300006847 | Bacteria | 855 |
| 305 | Ga0075433_10698076 | 3300006852 | Bacteria | 889 |
| 306 | Ga0075434_100085876 | 3300006871 | Bacteria | 3146 |
| 307 | Ga0075434_100103939 | 3300006871 | Bacteria | 2849 |
| 308 | Ga0075434_100156042 | 3300006871 | Bacteria | 2302 |
| 309 | Ga0075434_100187475 | 3300006871 | Bacteria | 2089 |
| 310 | Ga0075434_100405874 | 3300006871 | Bacteria | 1384 |
| 311 | Ga0075429_100530133 | 3300006880 | Bacteria | 1032 |
| 312 | Ga0068865_100069839 | 3300006881 | Bacteria | 2487 |
| 313 | Ga0068865_100265917 | 3300006881 | Bacteria | 1360 |
| 314 | Ga0068865_100278061 | 3300006881 | Bacteria | 1332 |
| 315 | Ga0075436_100029917 | 3300006914 | Bacteria | 3746 |
| 316 | Ga0075436_100301414 | 3300006914 | Bacteria | 1149 |
| 317 | Ga0097620_100014563 | 3300006931 | Bacteria | 7899 |
| 318 | Ga0097620_100228484 | 3300006931 | Bacteria | 1949 |
| 319 | Ga0075435_100006092 | 3300007076 | Bacteria | 8497 |
| 320 | Ga0075435_100102310 | 3300007076 | Bacteria | 2374 |
| 321 | Ga0075435_100290415 | 3300007076 | Bacteria | 1397 |
| 322 | Ga0099795_10009154 | 3300007788 | Bacteria | 2860 |
| 323 | Ga0105250_10065204 | 3300009092 | Bacteria | 1468 |
| 324 | Ga0105240_10056226 | 3300009093 | Bacteria | 4924 |
| 325 | Ga0105240_10117882 | 3300009093 | Bacteria | 3200 |
| 326 | Ga0105240_10274810 | 3300009093 | Bacteria | 1938 |
| 327 | Ga0105240_11096065 | 3300009093 | Bacteria | 847 |
| 328 | Ga0105240_11778359 | 3300009093 | Bacteria | 642 |
| 329 | Ga0111539_10183045 | 3300009094 | Bacteria | 2447 |
| 330 | Ga0111539_10381342 | 3300009094 | Bacteria | 1641 |
| 331 | Ga0111539_11259560 | 3300009094 | Bacteria | 858 |
| 332 | Ga0105245_10278620 | 3300009098 | Bacteria | 1634 |
| 333 | Ga0105245_10326187 | 3300009098 | Bacteria | 1514 |
| 334 | Ga0105245_10921301 | 3300009098 | Bacteria | 916 |
| 335 | Ga0105247_10004828 | 3300009101 | Bacteria | 8579 |
| 336 | Ga0105247_10198780 | 3300009101 | Bacteria | 1346 |
| 337 | Ga0105247_10392558 | 3300009101 | Bacteria | 986 |
| 338 | Ga0114129_10061242 | 3300009147 | Bacteria | 5259 |
| 339 | Ga0114129_10095382 | 3300009147 | Bacteria | 4120 |
| 340 | Ga0114129_10197097 | 3300009147 | Bacteria | 2730 |
| 341 | Ga0114129_10208543 | 3300009147 | Bacteria | 2643 |
| 342 | Ga0114129_10652695 | 3300009147 | Bacteria | 1358 |
| 343 | Ga0105243_10047635 | 3300009148 | Bacteria | 3376 |
| 344 | Ga0105243_10146727 | 3300009148 | Bacteria | 2019 |
| 345 | Ga0105243_10244089 | 3300009148 | Bacteria | 1600 |
| 346 | Ga0105243_10498700 | 3300009148 | Bacteria | 1153 |
| 347 | Ga0105243_10575201 | 3300009148 | Bacteria | 1080 |
| 348 | Ga0105243_11398543 | 3300009148 | Bacteria | 720 |
| 349 | Ga0105241_10257903 | 3300009174 | Bacteria | 1481 |
| 350 | Ga0105241_10402151 | 3300009174 | Bacteria | 1201 |
| 351 | Ga0105242_10027348 | 3300009176 | Bacteria | 4527 |
| 352 | Ga0105242_10048559 | 3300009176 | Bacteria | 3450 |
| 353 | Ga0105242_10068809 | 3300009176 | Bacteria | 2930 |
| 354 | Ga0105242_10200080 | 3300009176 | Bacteria | 1774 |
| 355 | Ga0105248_10012305 | 3300009177 | Bacteria | 9437 |
| 356 | Ga0105248_10074998 | 3300009177 | Bacteria | 3801 |
| 357 | Ga0105248_10097925 | 3300009177 | Bacteria | 3305 |
| 358 | Ga0105248_10404753 | 3300009177 | Bacteria | 1536 |
| 359 | Ga0105248_12532992 | 3300009177 | Bacteria | 585 |
| 360 | Ga0105237_10063614 | 3300009545 | Bacteria | 3687 |
| 361 | Ga0105237_10103380 | 3300009545 | Bacteria | 2841 |
| 362 | Ga0105238_10113642 | 3300009551 | Bacteria | 2687 |
| 363 | Ga0105238_10171734 | 3300009551 | Bacteria | 2144 |
| 364 | Ga0105238_10342858 | 3300009551 | Bacteria | 1482 |
| 365 | Ga0105238_11044904 | 3300009551 | Bacteria | 838 |
| 366 | Ga0105249_10000366 | 3300009553 | Bacteria | 44857 |
| 367 | Ga0105249_10032153 | 3300009553 | Bacteria | 4745 |
| 368 | Ga0105249_10055253 | 3300009553 | Bacteria | 3631 |
| 369 | Ga0105249_10421066 | 3300009553 | Bacteria | 1369 |
| 370 | Ga0105249_10677854 | 3300009553 | Bacteria | 1090 |
| 371 | Ga0105249_13268909 | 3300009553 | Bacteria | 521 |
| 372 | Ga0099796_10161233 | 3300010159 | Bacteria | 889 |
| 373 | Ga0105239_10082645 | 3300010375 | Bacteria | 3537 |
| 374 | Ga0105239_10163984 | 3300010375 | Bacteria | 2484 |
| 375 | Ga0105239_10822535 | 3300010375 | Bacteria | 1064 |
| 376 | Ga0105239_11234049 | 3300010375 | Bacteria | 862 |
| 377 | Ga0105239_11791739 | 3300010375 | Bacteria | 711 |
| 378 | Ga0105246_10054178 | 3300011119 | Bacteria | 2763 |
| 379 | Ga0105246_10105727 | 3300011119 | Bacteria | 2058 |
| 380 | Ga0105246_10765605 | 3300011119 | Bacteria | 853 |
| 381 | Ga0105246_11515320 | 3300011119 | Bacteria | 630 |
| 382 | Ga0157346_1001067 | 3300012480 | Bacteria | 1262 |
| 383 | Ga0157315_1017040 | 3300012508 | Bacteria | 726 |
| 384 | Ga0157373_10085737 | 3300013100 | Bacteria | 2220 |
| 385 | Ga0157371_10059021 | 3300013102 | Bacteria | 2721 |
| 386 | Ga0157371_10582183 | 3300013102 | Bacteria | 831 |
| 387 | Ga0157370_10116838 | 3300013104 | Bacteria | 2492 |
| 388 | Ga0157370_10124689 | 3300013104 | Bacteria | 2404 |
| 389 | Ga0157370_10637614 | 3300013104 | Bacteria | 974 |
| 390 | Ga0157370_10712379 | 3300013104 | Bacteria | 916 |
| 391 | Ga0157369_10229201 | 3300013105 | Bacteria | 1942 |
| 392 | Ga0157369_10335996 | 3300013105 | Bacteria | 1569 |
| 393 | Ga0157369_10802702 | 3300013105 | Bacteria | 967 |
| 394 | Ga0157374_10091851 | 3300013296 | Bacteria | 2895 |
| 395 | Ga0157374_10397952 | 3300013296 | Bacteria | 1374 |
| 396 | Ga0157374_11510137 | 3300013296 | Bacteria | 695 |
| 397 | Ga0157378_10080426 | 3300013297 | Bacteria | 2944 |
| 398 | Ga0157378_10093499 | 3300013297 | Bacteria | 2737 |
| 399 | Ga0157378_10687797 | 3300013297 | Bacteria | 1041 |
| 400 | Ga0157372_10116237 | 3300013307 | Bacteria | 3067 |
| 401 | Ga0157375_10022311 | 3300013308 | Bacteria | 5825 |
| 402 | Ga0157375_10990293 | 3300013308 | Bacteria | 981 |
| 403 | Ga0163163_10126580 | 3300014325 | Bacteria | 2593 |
| 404 | Ga0163163_10183790 | 3300014325 | Bacteria | 2138 |
| 405 | Ga0163163_10246684 | 3300014325 | Bacteria | 1836 |
| 406 | Ga0163163_10878867 | 3300014325 | Bacteria | 960 |
| 407 | Ga0157380_10077598 | 3300014326 | Bacteria | 2707 |
| 408 | Ga0157380_10147233 | 3300014326 | Bacteria | 2031 |
| 409 | Ga0157380_11009929 | 3300014326 | Bacteria | 866 |
| 410 | Ga0182008_10032425 | 3300014497 | Bacteria | 2625 |
| 411 | Ga0157377_10015614 | 3300014745 | Bacteria | 3891 |
| 412 | Ga0157377_10091494 | 3300014745 | Bacteria | 1797 |
| 413 | Ga0157377_10113348 | 3300014745 | Bacteria | 1633 |
| 414 | Ga0157379_10010974 | 3300014968 | Bacteria | 7901 |
| 415 | Ga0157379_10324966 | 3300014968 | Bacteria | 1405 |
| 416 | Ga0157379_10465813 | 3300014968 | Bacteria | 1168 |
| 417 | Ga0157379_10602530 | 3300014968 | Bacteria | 1026 |
| 418 | Ga0157376_10282950 | 3300014969 | Bacteria | 1563 |
| 419 | Ga0157376_11244548 | 3300014969 | Bacteria | 773 |
| 420 | Ga0182007_10234096 | 3300015262 | Bacteria | 653 |
| 421 | Ga0182005_1133320 | 3300015265 | Bacteria | 714 |
| 422 | Ga0163161_10197530 | 3300017792 | Bacteria | 1549 |
| 423 | Ga0163161_10314456 | 3300017792 | Bacteria | 1236 |
| 424 | Ga0206356_11118909 | 3300020070 | Bacteria | 622 |
| 425 | Ga0206354_10212022 | 3300020081 | Bacteria | 910 |
| 426 | Ga0206353_10376412 | 3300020082 | Bacteria | 3399 |
| 427 | Ga0206353_10853757 | 3300020082 | Bacteria | 1123 |
| 428 | Ga0206353_11627131 | 3300020082 | Bacteria | 645 |
| 429 | Ga0213872_10060323 | 3300021361 | Bacteria | 1716 |
| 430 | Ga0213872_10135485 | 3300021361 | Bacteria | 1083 |
| 431 | Ga0213876_10008421 | 3300021384 | Bacteria | 5581 |
| 432 | Ga0213876_10393722 | 3300021384 | Bacteria | 737 |
| 433 | Ga0213875_10000031 | 3300021388 | Bacteria | 176367 |
| 434 | Ga0213875_10120279 | 3300021388 | Bacteria | 1227 |
| 435 | Ga0213875_10127419 | 3300021388 | Bacteria | 1190 |
| 436 | Ga0209233_1014532 | 3300025261 | Bacteria | 2215 |
| 437 | Ga0207682_10055792 | 3300025893 | Bacteria | 1644 |
| 438 | Ga0207692_10002654 | 3300025898 | Bacteria | 6883 |
| 439 | Ga0207692_10033904 | 3300025898 | Bacteria | 2468 |
| 440 | Ga0207692_10047511 | 3300025898 | Bacteria | 2155 |
| 441 | Ga0207692_10068942 | 3300025898 | Bacteria | 1857 |
| 442 | Ga0207692_10097832 | 3300025898 | Bacteria | 1605 |
| 443 | Ga0207710_10059418 | 3300025900 | Bacteria | 1731 |
| 444 | Ga0207688_10002814 | 3300025901 | Bacteria | 9448 |
| 445 | Ga0207688_10045009 | 3300025901 | Bacteria | 2461 |
| 446 | Ga0207688_10096148 | 3300025901 | Bacteria | 1706 |
| 447 | Ga0207680_10028876 | 3300025903 | Bacteria | 3108 |
| 448 | Ga0207680_10853700 | 3300025903 | Bacteria | 653 |
| 449 | Ga0207647_10046289 | 3300025904 | Bacteria | 2711 |
| 450 | Ga0207685_10035901 | 3300025905 | Bacteria | 1813 |
| 451 | Ga0207685_10061390 | 3300025905 | Bacteria | 1490 |
| 452 | Ga0207685_10125559 | 3300025905 | Bacteria | 1132 |
| 453 | Ga0207685_10152884 | 3300025905 | Bacteria | 1046 |
| 454 | Ga0207685_10174019 | 3300025905 | Bacteria | 993 |
| 455 | Ga0207699_10036496 | 3300025906 | Bacteria | 2802 |
| 456 | Ga0207699_10045331 | 3300025906 | Bacteria | 2566 |
| 457 | Ga0207699_10203490 | 3300025906 | Bacteria | 1343 |
| 458 | Ga0207699_10371678 | 3300025906 | Bacteria | 1013 |
| 459 | Ga0207699_10710092 | 3300025906 | Bacteria | 736 |
| 460 | Ga0207699_11129440 | 3300025906 | Bacteria | 580 |
| 461 | Ga0207645_10002945 | 3300025907 | Bacteria | 13153 |
| 462 | Ga0207645_10025104 | 3300025907 | Bacteria | 3859 |
| 463 | Ga0207643_10002845 | 3300025908 | Bacteria | 9348 |
| 464 | Ga0207643_10161260 | 3300025908 | Bacteria | 1349 |
| 465 | Ga0207705_10049781 | 3300025909 | Bacteria | 3016 |
| 466 | Ga0207705_10143820 | 3300025909 | Bacteria | 1783 |
| 467 | Ga0207705_10379135 | 3300025909 | Bacteria | 1092 |
| 468 | Ga0207684_10002963 | 3300025910 | Bacteria | 16822 |
| 469 | Ga0207654_10011794 | 3300025911 | Bacteria | 4463 |
| 470 | Ga0207654_10027072 | 3300025911 | Bacteria | 3113 |
| 471 | Ga0207654_10910837 | 3300025911 | Bacteria | 638 |
| 472 | Ga0207707_10045230 | 3300025912 | Bacteria | 3837 |
| 473 | Ga0207707_10119083 | 3300025912 | Bacteria | 2308 |
| 474 | Ga0207707_10505509 | 3300025912 | Bacteria | 1030 |
| 475 | Ga0207707_10658336 | 3300025912 | Bacteria | 882 |
| 476 | Ga0207695_10235929 | 3300025913 | Bacteria | 1732 |
| 477 | Ga0207695_10623058 | 3300025913 | Bacteria | 960 |
| 478 | Ga0207695_10718183 | 3300025913 | Bacteria | 880 |
| 479 | Ga0207695_11105559 | 3300025913 | Bacteria | 672 |
| 480 | Ga0207671_10219760 | 3300025914 | Bacteria | 1488 |
| 481 | Ga0207671_10469263 | 3300025914 | Bacteria | 1003 |
| 482 | Ga0207693_10000825 | 3300025915 | Bacteria | 27536 |
| 483 | Ga0207693_10004273 | 3300025915 | Bacteria | 12116 |
| 484 | Ga0207693_10007085 | 3300025915 | Bacteria | 9254 |
| 485 | Ga0207693_10009090 | 3300025915 | Bacteria | 8110 |
| 486 | Ga0207693_10053018 | 3300025915 | Bacteria | 3182 |
| 487 | Ga0207693_10082455 | 3300025915 | Bacteria | 2519 |
| 488 | Ga0207693_10135084 | 3300025915 | Bacteria | 1939 |
| 489 | Ga0207693_10172403 | 3300025915 | Bacteria | 1703 |
| 490 | Ga0207663_10059104 | 3300025916 | Bacteria | 2424 |
| 491 | Ga0207663_10105854 | 3300025916 | Bacteria | 1900 |
| 492 | Ga0207663_10109082 | 3300025916 | Bacteria | 1875 |
| 493 | Ga0207663_10207397 | 3300025916 | Bacteria | 1418 |
| 494 | Ga0207663_10225145 | 3300025916 | Bacteria | 1367 |
| 495 | Ga0207663_10370903 | 3300025916 | Bacteria | 1088 |
| 496 | Ga0207663_10379286 | 3300025916 | Bacteria | 1077 |
| 497 | Ga0207663_10557903 | 3300025916 | Bacteria | 896 |
| 498 | Ga0207663_11077550 | 3300025916 | Bacteria | 646 |
| 499 | Ga0207660_10087246 | 3300025917 | Bacteria | 2305 |
| 500 | Ga0207660_10105093 | 3300025917 | Bacteria | 2115 |
| 501 | Ga0207660_10409140 | 3300025917 | Bacteria | 1093 |
| 502 | Ga0207660_10691008 | 3300025917 | Bacteria | 832 |
| 503 | Ga0207660_11117308 | 3300025917 | Bacteria | 642 |
| 504 | Ga0207662_10008927 | 3300025918 | Bacteria | 5499 |
| 505 | Ga0207662_10051522 | 3300025918 | Bacteria | 2449 |
| 506 | Ga0207662_10509100 | 3300025918 | Bacteria | 830 |
| 507 | Ga0207657_10028698 | 3300025919 | Bacteria | 5072 |
| 508 | Ga0207657_10045555 | 3300025919 | Bacteria | 3848 |
| 509 | Ga0207657_10093700 | 3300025919 | Bacteria | 2501 |
| 510 | Ga0207649_10038210 | 3300025920 | Bacteria | 2905 |
| 511 | Ga0207649_10251877 | 3300025920 | Bacteria | 1272 |
| 512 | Ga0207649_10706584 | 3300025920 | Bacteria | 782 |
| 513 | Ga0207652_10102361 | 3300025921 | Bacteria | 2531 |
| 514 | Ga0207652_10151429 | 3300025921 | Bacteria | 2077 |
| 515 | Ga0207652_10208051 | 3300025921 | Bacteria | 1761 |
| 516 | Ga0207652_10218154 | 3300025921 | Bacteria | 1719 |
| 517 | Ga0207652_10225012 | 3300025921 | Bacteria | 1690 |
| 518 | Ga0207652_10864760 | 3300025921 | Bacteria | 800 |
| 519 | Ga0207681_10084122 | 3300025923 | Bacteria | 2254 |
| 520 | Ga0207681_10324738 | 3300025923 | Bacteria | 1225 |
| 521 | Ga0207694_10134797 | 3300025924 | Bacteria | 1982 |
| 522 | Ga0207694_10549584 | 3300025924 | Bacteria | 969 |
| 523 | Ga0207694_10609454 | 3300025924 | Bacteria | 918 |
| 524 | Ga0207650_10002572 | 3300025925 | Bacteria | 12563 |
| 525 | Ga0207650_10033447 | 3300025925 | Bacteria | 3724 |
| 526 | Ga0207650_10473508 | 3300025925 | Bacteria | 1044 |
| 527 | Ga0207659_10018147 | 3300025926 | Bacteria | 4608 |
| 528 | Ga0207687_10005621 | 3300025927 | Bacteria | 8288 |
| 529 | Ga0207687_10111414 | 3300025927 | Bacteria | 2032 |
| 530 | Ga0207687_10121271 | 3300025927 | Bacteria | 1956 |
| 531 | Ga0207700_10068719 | 3300025928 | Bacteria | 2716 |
| 532 | Ga0207700_10127513 | 3300025928 | Bacteria | 2072 |
| 533 | Ga0207700_10151584 | 3300025928 | Bacteria | 1916 |
| 534 | Ga0207700_10185594 | 3300025928 | Bacteria | 1744 |
| 535 | Ga0207700_10213529 | 3300025928 | Bacteria | 1632 |
| 536 | Ga0207700_10364038 | 3300025928 | Bacteria | 1261 |
| 537 | Ga0207700_11033398 | 3300025928 | Bacteria | 735 |
| 538 | Ga0207700_11387789 | 3300025928 | Bacteria | 625 |
| 539 | Ga0207664_10007232 | 3300025929 | Bacteria | 7689 |
| 540 | Ga0207664_10023737 | 3300025929 | Bacteria | 4599 |
| 541 | Ga0207664_10066940 | 3300025929 | Bacteria | 2881 |
| 542 | Ga0207664_10070473 | 3300025929 | Bacteria | 2814 |
| 543 | Ga0207664_10076974 | 3300025929 | Bacteria | 2702 |
| 544 | Ga0207664_10196941 | 3300025929 | Bacteria | 1737 |
| 545 | Ga0207644_10029417 | 3300025931 | Bacteria | 3811 |
| 546 | Ga0207644_10038563 | 3300025931 | Bacteria | 3367 |
| 547 | Ga0207644_10097299 | 3300025931 | Bacteria | 2204 |
| 548 | Ga0207644_10338694 | 3300025931 | Bacteria | 1219 |
| 549 | Ga0207644_11883285 | 3300025931 | Bacteria | 500 |
| 550 | Ga0207690_10158979 | 3300025932 | Bacteria | 1683 |
| 551 | Ga0207706_10001336 | 3300025933 | Bacteria | 24661 |
| 552 | Ga0207706_10108352 | 3300025933 | Bacteria | 2445 |
| 553 | Ga0207706_10255971 | 3300025933 | Bacteria | 1528 |
| 554 | Ga0207706_10268663 | 3300025933 | Bacteria | 1488 |
| 555 | Ga0207706_10878002 | 3300025933 | Bacteria | 758 |
| 556 | Ga0207686_10023636 | 3300025934 | Bacteria | 3553 |
| 557 | Ga0207686_10056288 | 3300025934 | Bacteria | 2471 |
| 558 | Ga0207686_10392290 | 3300025934 | Bacteria | 1055 |
| 559 | Ga0207686_10625514 | 3300025934 | Bacteria | 849 |
| 560 | Ga0207709_10003540 | 3300025935 | Bacteria | 9237 |
| 561 | Ga0207709_10124088 | 3300025935 | Bacteria | 1749 |
| 562 | Ga0207670_10035722 | 3300025936 | Bacteria | 3225 |
| 563 | Ga0207670_10160451 | 3300025936 | Bacteria | 1678 |
| 564 | Ga0207669_10029074 | 3300025937 | Bacteria | 3051 |
| 565 | Ga0207669_10160665 | 3300025937 | Bacteria | 1587 |
| 566 | Ga0207704_10052137 | 3300025938 | Bacteria | 2478 |
| 567 | Ga0207704_10173913 | 3300025938 | Bacteria | 1548 |
| 568 | Ga0207704_10202384 | 3300025938 | Bacteria | 1454 |
| 569 | Ga0207665_10001068 | 3300025939 | Bacteria | 18420 |
| 570 | Ga0207665_10003817 | 3300025939 | Bacteria | 10071 |
| 571 | Ga0207665_10040571 | 3300025939 | Bacteria | 3107 |
| 572 | Ga0207665_10130207 | 3300025939 | Bacteria | 1785 |
| 573 | Ga0207665_10291151 | 3300025939 | Bacteria | 1218 |
| 574 | Ga0207691_10000635 | 3300025940 | Bacteria | 34764 |
| 575 | Ga0207711_10010280 | 3300025941 | Bacteria | 7772 |
| 576 | Ga0207711_10036737 | 3300025941 | Bacteria | 4158 |
| 577 | Ga0207711_10069609 | 3300025941 | Bacteria | 3051 |
| 578 | Ga0207711_10602185 | 3300025941 | Bacteria | 1025 |
| 579 | Ga0207689_10003641 | 3300025942 | Bacteria | 14070 |
| 580 | Ga0207689_10024648 | 3300025942 | Bacteria | 5045 |
| 581 | Ga0207689_10046276 | 3300025942 | Bacteria | 3596 |
| 582 | Ga0207661_10035883 | 3300025944 | Bacteria | 3867 |
| 583 | Ga0207661_10131898 | 3300025944 | Bacteria | 2141 |
| 584 | Ga0207661_10412446 | 3300025944 | Bacteria | 1226 |
| 585 | Ga0207679_10014282 | 3300025945 | Bacteria | 5216 |
| 586 | Ga0207679_10652239 | 3300025945 | Bacteria | 952 |
| 587 | Ga0207679_10816047 | 3300025945 | Bacteria | 851 |
| 588 | Ga0207667_10036413 | 3300025949 | Bacteria | 5274 |
| 589 | Ga0207667_10072960 | 3300025949 | Bacteria | 3567 |
| 590 | Ga0207667_10151081 | 3300025949 | Bacteria | 2390 |
| 591 | Ga0207667_10762693 | 3300025949 | Bacteria | 966 |
| 592 | Ga0207667_11455545 | 3300025949 | Bacteria | 657 |
| 593 | Ga0207651_10048486 | 3300025960 | Bacteria | 2872 |
| 594 | Ga0207712_10002399 | 3300025961 | Bacteria | 12137 |
| 595 | Ga0207668_10031104 | 3300025972 | Bacteria | 3512 |
| 596 | Ga0207668_10473718 | 3300025972 | Bacteria | 1073 |
| 597 | Ga0207668_11580275 | 3300025972 | Bacteria | 592 |
| 598 | Ga0207640_10041977 | 3300025981 | Bacteria | 2913 |
| 599 | Ga0207640_10379314 | 3300025981 | Bacteria | 1145 |
| 600 | Ga0207640_11008770 | 3300025981 | Bacteria | 733 |
| 601 | Ga0207658_10046077 | 3300025986 | Bacteria | 3182 |
| 602 | Ga0207677_10004734 | 3300026023 | Bacteria | 7334 |
| 603 | Ga0207677_10041256 | 3300026023 | Bacteria | 3050 |
| 604 | Ga0207677_11304936 | 3300026023 | Bacteria | 667 |
| 605 | Ga0207703_10012768 | 3300026035 | Bacteria | 6549 |
| 606 | Ga0207703_10287925 | 3300026035 | Bacteria | 1494 |
| 607 | Ga0207703_11426111 | 3300026035 | Bacteria | 666 |
| 608 | Ga0207639_10342757 | 3300026041 | Bacteria | 1333 |
| 609 | Ga0207639_10419380 | 3300026041 | Bacteria | 1210 |
| 610 | Ga0207639_10442090 | 3300026041 | Bacteria | 1179 |
| 611 | Ga0207678_10004902 | 3300026067 | Bacteria | 12024 |
| 612 | Ga0207678_10010341 | 3300026067 | Bacteria | 8190 |
| 613 | Ga0207678_10551135 | 3300026067 | Bacteria | 1008 |
| 614 | Ga0207708_10001330 | 3300026075 | Bacteria | 18590 |
| 615 | Ga0207708_10162321 | 3300026075 | Bacteria | 1765 |
| 616 | Ga0207702_10039530 | 3300026078 | Bacteria | 3953 |
| 617 | Ga0207702_10069314 | 3300026078 | Bacteria | 3032 |
| 618 | Ga0207702_10536090 | 3300026078 | Bacteria | 1144 |
| 619 | Ga0207641_10019656 | 3300026088 | Bacteria | 5546 |
| 620 | Ga0207641_10189502 | 3300026088 | Bacteria | 1889 |
| 621 | Ga0207641_11079858 | 3300026088 | Bacteria | 801 |
| 622 | Ga0207641_11141361 | 3300026088 | Bacteria | 778 |
| 623 | Ga0207648_10003105 | 3300026089 | Bacteria | 17542 |
| 624 | Ga0207648_10302535 | 3300026089 | Bacteria | 1434 |
| 625 | Ga0207648_11378156 | 3300026089 | Bacteria | 663 |
| 626 | Ga0207676_10024382 | 3300026095 | Bacteria | 4475 |
| 627 | Ga0207676_10042058 | 3300026095 | Bacteria | 3513 |
| 628 | Ga0207676_10137329 | 3300026095 | Bacteria | 2088 |
| 629 | Ga0207676_11481023 | 3300026095 | Bacteria | 675 |
| 630 | Ga0207674_10333373 | 3300026116 | Bacteria | 1467 |
| 631 | Ga0207675_100004255 | 3300026118 | Bacteria | 13848 |
| 632 | Ga0207675_100238194 | 3300026118 | Bacteria | 1758 |
| 633 | Ga0207675_100400593 | 3300026118 | Bacteria | 1352 |
| 634 | Ga0207683_10004806 | 3300026121 | Bacteria | 11633 |
| 635 | Ga0207683_10007077 | 3300026121 | Bacteria | 9617 |
| 636 | Ga0207683_10023723 | 3300026121 | Bacteria | 5278 |
| 637 | Ga0207683_10065336 | 3300026121 | Bacteria | 3208 |
| 638 | Ga0207683_10156650 | 3300026121 | Bacteria | 2057 |
| 639 | Ga0207698_10014590 | 3300026142 | Bacteria | 5230 |
| 640 | Ga0207698_10019033 | 3300026142 | Bacteria | 4691 |
| 641 | Ga0207698_10408090 | 3300026142 | Bacteria | 1300 |
| 642 | Ga0209179_1005113 | 3300027512 | Bacteria | 2029 |
| 643 | Ga0209813_10010282 | 3300027866 | Bacteria | 2416 |
| 644 | Ga0209813_10022000 | 3300027866 | Bacteria | 1798 |
| 645 | Ga0209813_10185473 | 3300027866 | Bacteria | 763 |
| 646 | Ga0207428_10212984 | 3300027907 | Bacteria | 1451 |
| 647 | Ga0207428_10268096 | 3300027907 | Bacteria | 1270 |
| 648 | Ga0268266_10026518 | 3300028379 | Bacteria | 4930 |
| 649 | Ga0268266_10137663 | 3300028379 | Bacteria | 2188 |
| 650 | Ga0268266_10681102 | 3300028379 | Bacteria | 990 |
| 651 | Ga0268265_10003591 | 3300028380 | Bacteria | 11076 |
| 652 | Ga0268265_10678934 | 3300028380 | Bacteria | 993 |
| 653 | Ga0268264_10005325 | 3300028381 | Bacteria | 10898 |
| 654 | Ga0265337_1018778 | 3300028556 | Bacteria | 2189 |
| 655 | Ga0265318_10004032 | 3300028577 | Bacteria | 7212 |
| 656 | Ga0265330_10007771 | 3300031235 | Bacteria | 5206 |
| 657 | Ga0265330_10034373 | 3300031235 | Bacteria | 2264 |
| 658 | Ga0265332_10002695 | 3300031238 | Bacteria | 8873 |
| 659 | Ga0265332_10012389 | 3300031238 | Bacteria | 3785 |
| 660 | Ga0265328_10050582 | 3300031239 | Bacteria | 1526 |
| 661 | Ga0265320_10018493 | 3300031240 | Bacteria | 3834 |
| 662 | Ga0265325_10004992 | 3300031241 | Bacteria | 8267 |
| 663 | Ga0265325_10016894 | 3300031241 | Bacteria | 4068 |
| 664 | Ga0265325_10025118 | 3300031241 | Bacteria | 3237 |
| 665 | Ga0265325_10025624 | 3300031241 | Bacteria | 3201 |
| 666 | Ga0265325_10036101 | 3300031241 | Bacteria | 2621 |
| 667 | Ga0265329_10012587 | 3300031242 | Bacteria | 3036 |
| 668 | Ga0265329_10031690 | 3300031242 | Bacteria | 1716 |
| 669 | Ga0265340_10004865 | 3300031247 | Bacteria | 7472 |
| 670 | Ga0265340_10063523 | 3300031247 | Bacteria | 1761 |
| 671 | Ga0265340_10122473 | 3300031247 | Bacteria | 1196 |
| 672 | Ga0265340_10168967 | 3300031247 | Bacteria | 991 |
| 673 | Ga0265339_10004645 | 3300031249 | Bacteria | 9336 |
| 674 | Ga0265339_10010159 | 3300031249 | Bacteria | 5859 |
| 675 | Ga0265339_10013807 | 3300031249 | Bacteria | 4887 |
| 676 | Ga0265331_10007949 | 3300031250 | Bacteria | 6074 |
| 677 | Ga0265331_10012924 | 3300031250 | Bacteria | 4501 |
| 678 | Ga0265316_10017769 | 3300031344 | Bacteria | 6132 |
| 679 | Ga0265316_10025046 | 3300031344 | Bacteria | 4984 |
| 680 | Ga0265316_10034592 | 3300031344 | Bacteria | 4103 |
| 681 | Ga0265316_10094403 | 3300031344 | Bacteria | 2279 |
| 682 | Ga0307513_10115927 | 3300031456 | Bacteria | 2660 |
| 683 | Ga0307513_10402560 | 3300031456 | Bacteria | 1103 |
| 684 | Ga0265313_10002478 | 3300031595 | Bacteria | 15910 |
| 685 | Ga0265313_10022841 | 3300031595 | Bacteria | 3383 |
| 686 | Ga0265313_10035654 | 3300031595 | Bacteria | 2503 |
| 687 | Ga0265313_10068739 | 3300031595 | Bacteria | 1636 |
| 688 | Ga0265313_10187543 | 3300031595 | Bacteria | 866 |
| 689 | Ga0316575_10043017 | 3300031665 | Bacteria | 1789 |
| 690 | Ga0316579_10146555 | 3300031691 | Bacteria | 1138 |
| 691 | Ga0265314_10060775 | 3300031711 | Bacteria | 2577 |
| 692 | Ga0265314_10087405 | 3300031711 | Bacteria | 2038 |
| 693 | Ga0265314_10142508 | 3300031711 | Bacteria | 1480 |
| 694 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 695 | Ga0265342_10000983 | 3300031712 | Bacteria | 28114 |
| 696 | Ga0265342_10014308 | 3300031712 | Bacteria | 5271 |
| 697 | Ga0316576_10182607 | 3300031727 | Bacteria | 1582 |
| 698 | Ga0316578_10015600 | 3300031728 | Bacteria | 4089 |
| 699 | Ga0316578_10337639 | 3300031728 | Bacteria | 898 |
| 700 | Ga0307405_11398694 | 3300031731 | Bacteria | 612 |
| 701 | Ga0307409_100480786 | 3300031995 | Bacteria | 1205 |
| 702 | Ga0316583_10193944 | 3300032133 | Bacteria | 705 |
| 703 | Ga0373930_0014853 | 3300034816 | Bacteria | 1456 |
| 704 | Ga0373948_0001761 | 3300034817 | Bacteria | 3079 |
| 705 | Ga0373950_0050463 | 3300034818 | Bacteria | 816 |
| 706 | Ga0373950_0051664 | 3300034818 | Bacteria | 809 |
| 707 | Ga0373958_0006709 | 3300034819 | Bacteria | 1806 |
| 708 | Ga0373959_0002292 | 3300034820 | Bacteria | 3042 |
| 709 | Ga0373938_0014292 | 3300034957 | Bacteria | 1521 |
| 710 | Ga0373926_0021500 | 3300035083 | Bacteria | 2234 |
| 711 | Ga0373926_0023001 | 3300035083 | Bacteria | 2162 |
| 712 | Ga0373926_0122552 | 3300035083 | Bacteria | 981 |
| 713 | Ga0373929_0017613 | 3300035085 | Bacteria | 1411 |
| 714 | Ga0373929_0020957 | 3300035085 | Bacteria | 1322 |
| 715 | Ga0373929_0179757 | 3300035085 | Bacteria | 583 |
| 716 | Ga0373940_0019255 | 3300035088 | Bacteria | 1722 |
| 717 | Ga0373944_0003559 | 3300035089 | Bacteria | 4028 |
| 718 | Ga0373944_0005088 | 3300035089 | Bacteria | 3453 |
| 719 | Ga0373944_0308046 | 3300035089 | Bacteria | 596 |
| 720 | Ga0373949_0096076 | 3300035090 | Bacteria | 807 |
| 721 | Ga0373951_0001694 | 3300035091 | Bacteria | 5757 |
| 722 | Ga0373951_0075012 | 3300035091 | Bacteria | 867 |
| 723 | Ga0373952_0003947 | 3300035092 | Bacteria | 2683 |
| 724 | Ga0373923_0033073 | 3300035111 | Bacteria | 2092 |
| 725 | Ga0373923_0257390 | 3300035111 | Bacteria | 818 |
| 726 | Ga0373932_0114190 | 3300035112 | Bacteria | 893 |
| 727 | Ga0373936_0005473 | 3300035113 | Bacteria | 4790 |
| 728 | Ga0373939_0096441 | 3300035114 | Bacteria | 1008 |
| 729 | Ga0373941_0017500 | 3300035115 | Bacteria | 1965 |
| 730 | Ga0373941_0130301 | 3300035115 | Bacteria | 905 |
| 731 | Ga0373945_0018914 | 3300035116 | Bacteria | 2347 |
| 732 | Ga0373945_0029086 | 3300035116 | Bacteria | 1939 |
| 733 | Ga0373945_0033872 | 3300035116 | Bacteria | 1818 |
| 734 | Ga0373945_0326891 | 3300035116 | Bacteria | 661 |
| 735 | Ga0373953_0007986 | 3300035117 | Bacteria | 3573 |
| 736 | Ga0373953_0014564 | 3300035117 | Bacteria | 2832 |
| 737 | Ga0373954_0006853 | 3300035118 | Bacteria | 4973 |
| 738 | Ga0373954_0117790 | 3300035118 | Bacteria | 1288 |
| 739 | Ga0373954_0130238 | 3300035118 | Bacteria | 1224 |
| 740 | Ga0373956_0018386 | 3300035119 | Bacteria | 2959 |
| 741 | Ga0373956_0043454 | 3300035119 | Bacteria | 2001 |
| 742 | Ga0373956_0062504 | 3300035119 | Bacteria | 1688 |
| 743 | Ga0373956_0216390 | 3300035119 | Bacteria | 909 |
| 744 | Ga0373957_0006573 | 3300035120 | Bacteria | 3671 |
| 745 | Ga0373957_0006843 | 3300035120 | Bacteria | 3614 |
| 746 | Ga0373957_0147333 | 3300035120 | Bacteria | 965 |
| 747 | Ga0373960_0044241 | 3300035121 | Bacteria | 1300 |
| 748 | Ga0373960_0184427 | 3300035121 | Bacteria | 730 |
| 749 | Ga0373943_0002330 | 3300035170 | Bacteria | 8635 |
| 750 | Ga0373943_0280058 | 3300035170 | Bacteria | 943 |
| 751 | Ga0373946_0007021 | 3300035171 | Bacteria | 4106 |
| 752 | Ga0373946_0008539 | 3300035171 | Bacteria | 3759 |
| 753 | Ga0373946_0011321 | 3300035171 | Bacteria | 3325 |
| 754 | Ga0373946_0394515 | 3300035171 | Bacteria | 698 |
| 755 | Ga0373946_0544091 | 3300035171 | Bacteria | 598 |
| 756 | Ga0373955_0001883 | 3300035172 | Bacteria | 9050 |
| 757 | Ga0373955_0471865 | 3300035172 | Bacteria | 765 |
| 758 | Ga0373942_0322324 | 3300035207 | Bacteria | 540 |
| 759 | Ga0373961_0002014 | 3300035241 | Bacteria | 5447 |
| 760 | Ga0373961_0019548 | 3300035241 | Bacteria | 1781 |
| 761 | Ga0373961_0034548 | 3300035241 | Bacteria | 1430 |
| 762 | Ga0373961_0314726 | 3300035241 | Bacteria | 582 |
| 763 | Ga0373962_0001403 | 3300035242 | Bacteria | 5685 |
| 764 | Ga0316574_0060391 | 3300035398 | Bacteria | 2379 |
| 765 | Ga0373924_0117763 | 3300035410 | Bacteria | 1151 |
| 766 | Ga0373924_0147059 | 3300035410 | Bacteria | 1030 |
| 767 | Ga0373931_0001882 | 3300035691 | Bacteria | 9166 |
| 768 | Ga0373931_0008995 | 3300035691 | Bacteria | 4761 |
| 769 | Ga0373931_0027332 | 3300035691 | Bacteria | 2912 |
| 770 | Ga0373935_0002676 | 3300035692 | Bacteria | 10246 |
| 771 | Ga0373935_0047198 | 3300035692 | Bacteria | 2722 |
| 772 | Ga0373935_0128655 | 3300035692 | Bacteria | 1699 |
| 773 | Ga0373935_0159944 | 3300035692 | Bacteria | 1534 |
| 774 | Ga0373927_0010750 | 3300035695 | Bacteria | 6096 |
| 775 | Ga0373927_0023475 | 3300035695 | Bacteria | 4039 |
| 776 | Ga0373927_0119628 | 3300035695 | Bacteria | 1719 |
| 777 | Ga0373927_0217060 | 3300035695 | Bacteria | 1256 |
| 778 | Ga0373927_0355443 | 3300035695 | Bacteria | 965 |
| 779 | Ga0373933_0002112 | 3300035724 | Bacteria | 11410 |
| 780 | Ga0373933_0010711 | 3300035724 | Bacteria | 5029 |
| 781 | Ga0373947_0001553 | 3300035725 | Bacteria | 14063 |
| 782 | Ga0373947_0098441 | 3300035725 | Bacteria | 1835 |
| 783 | Ga0373947_0144790 | 3300035725 | Bacteria | 1527 |
| 784 | Ga0373947_0276995 | 3300035725 | Bacteria | 1114 |
| 785 | Ga0373947_0393855 | 3300035725 | Bacteria | 933 |
| 786 | Ga0373947_0596989 | 3300035725 | Bacteria | 752 |
| 787 | Ga0373937_0002048 | 3300036401 | Bacteria | 16856 |
| 788 | Ga0373937_0007361 | 3300036401 | Bacteria | 9530 |
| 789 | Ga0373937_0050920 | 3300036401 | Bacteria | 3795 |
| 790 | Ga0373937_0118279 | 3300036401 | Bacteria | 2468 |
| 791 | Ga0373937_1003849 | 3300036401 | Bacteria | 783 |
| 792 | Ga0316582_0047745 | 3300036647 | Bacteria | 2704 |
| 793 | Ga0316582_0365261 | 3300036647 | Bacteria | 993 |
| 794 | Ga0316584_0026489 | 3300036712 | Bacteria | 4262 |
| 795 | Ga0373925_0008896 | 3300037068 | Bacteria | 7316 |
| 796 | Ga0373925_0189534 | 3300037068 | Bacteria | 1631 |
| 797 | Ga0373925_0309072 | 3300037068 | Bacteria | 1277 |
| 798 | Ga0373925_0355153 | 3300037068 | Bacteria | 1190 |
| 799 | Ga0395899_0013226 | 3300037312 | Bacteria | 6313 |
| 800 | Ga0395899_0053827 | 3300037312 | Bacteria | 2979 |
| 801 | Ga0395900_0006301 | 3300037418 | Bacteria | 12376 |
| 802 | Ga0395900_0007225 | 3300037418 | Bacteria | 11505 |
| 803 | Ga0395900_0042502 | 3300037418 | Bacteria | 4684 |
| 804 | Ga0395898_0037430 | 3300037466 | Bacteria | 4813 |
| 805 | Ga0395898_0063745 | 3300037466 | Bacteria | 3576 |
| 806 | Ga0395898_0235150 | 3300037466 | Bacteria | 1747 |
| 807 | Ga0316581_0037028 | 3300037588 | Bacteria | 1482 |
| 808 | Ga0436364_0793438 | 3300037853 | Bacteria | 64960 |
| 809 | Ga0436364_1132027 | 3300037853 | Bacteria | 593 |
| 810 | Ga0395901_0028459 | 3300038443 | Bacteria | 5746 |
| 811 | Ga0395901_0036482 | 3300038443 | Bacteria | 5082 |
| 812 | Ga0395901_0070801 | 3300038443 | Bacteria | 3634 |
| 813 | Ga0436365_0030899 | 3300039437 | Bacteria | 1068 |
| 814 | Ga0436365_0589402 | 3300039437 | Bacteria | 973 |
| 815 | Ga0436365_1138630 | 3300039437 | Bacteria | 9502 |
| 816 | Ga0436365_1500007 | 3300039437 | Bacteria | 880 |
| 817 | Ga0436365_1653395 | 3300039437 | Bacteria | 4904 |
| 818 | Ga0436365_1701023 | 3300039437 | Bacteria | 878 |
| 819 | Ga0436360_0004969 | 3300039438 | Bacteria | 1028 |
| 820 | Ga0436360_0167135 | 3300039438 | Bacteria | 697 |
| 821 | Ga0436361_0889648 | 3300039447 | Bacteria | 2943 |
| 822 | Ga0436361_0986695 | 3300039447 | Bacteria | 2102 |
| 823 | Ga0436361_1183143 | 3300039447 | Bacteria | 1403 |
| 824 | Ga0436363_0535034 | 3300039450 | Bacteria | 888 |
| 825 | Ga0436362_0367554 | 3300039453 | Bacteria | 541 |
| 826 | Ga0436362_0381093 | 3300039453 | Bacteria | 1368 |
| 827 | Ga0436362_0550311 | 3300039453 | Bacteria | 582 |
| 828 | Ga0451793_0823115 | 3300041452 | Bacteria | 682 |
| 829 | Ga0466966_0834581 | 3300044684 | Bacteria | 556 |
| 830 | Ga0466963_0399849 | 3300044694 | Bacteria | 969 |
| 831 | Ga0466971_0121780 | 3300044719 | Bacteria | 1208 |
| 832 | Ga0466957_0225911 | 3300044842 | Bacteria | 1238 |
| 833 | Ga0466957_0264244 | 3300044842 | Bacteria | 1147 |
| 834 | Ga0466957_0268110 | 3300044842 | Bacteria | 1139 |
| 835 | Ga0466957_1165514 | 3300044842 | Bacteria | 557 |
| 836 | Ga0466959_0411348 | 3300045049 | Bacteria | 919 |
| 837 | Ga0466958_0094962 | 3300045836 | Bacteria | 1848 |
| 838 | Ga0466958_0331628 | 3300045836 | Bacteria | 978 |
| 839 | Ga0466958_0632706 | 3300045836 | Bacteria | 696 |
| 840 | Ga0466967_0211963 | 3300045976 | Bacteria | 1837 |
| 841 | Ga0466967_1646740 | 3300045976 | Bacteria | 639 |
| 842 | Ga0495617_058596 | 3300046452 | Bacteria | 1276 |
| 843 | Ga0495592_0004699 | 3300046454 | Bacteria | 10018 |
| 844 | Ga0495592_0014796 | 3300046454 | Bacteria | 5923 |
| 845 | Ga0495592_0041714 | 3300046454 | Bacteria | 3439 |
| 846 | Ga0495592_0347945 | 3300046454 | Bacteria | 951 |
| 847 | Ga0495603_0025855 | 3300046455 | Bacteria | 3548 |
| 848 | Ga0495603_0033915 | 3300046455 | Bacteria | 3071 |
| 849 | Ga0495603_0221869 | 3300046455 | Bacteria | 1090 |
| 850 | Ga0495590_0348954 | 3300046457 | Bacteria | 562 |
| 851 | Ga0495629_0003044 | 3300046459 | Bacteria | 12743 |
| 852 | Ga0495629_0177976 | 3300046459 | Bacteria | 1474 |
| 853 | Ga0495638_0006650 | 3300046460 | Bacteria | 8391 |
| 854 | Ga0495638_0046393 | 3300046460 | Bacteria | 2729 |
| 855 | Ga0495641_0016811 | 3300046461 | Bacteria | 3839 |
| 856 | Ga0495641_0039453 | 3300046461 | Bacteria | 2202 |
| 857 | Ga0495651_0002035 | 3300046462 | Bacteria | 15618 |
| 858 | Ga0495651_0010719 | 3300046462 | Bacteria | 7049 |
| 859 | Ga0495651_0279307 | 3300046462 | Bacteria | 1129 |
| 860 | Ga0495653_0065475 | 3300046463 | Bacteria | 2735 |
| 861 | Ga0495653_0089810 | 3300046463 | Bacteria | 2250 |
| 862 | Ga0495580_0222311 | 3300046472 | Bacteria | 1297 |
| 863 | Ga0495580_0375312 | 3300046472 | Bacteria | 961 |
| 864 | Ga0495580_0429890 | 3300046472 | Bacteria | 887 |
| 865 | Ga0495582_0003239 | 3300046473 | Bacteria | 9143 |
| 866 | Ga0495582_0103214 | 3300046473 | Bacteria | 1597 |
| 867 | Ga0495605_0097627 | 3300046474 | Bacteria | 1354 |
| 868 | Ga0495662_0018960 | 3300046476 | Bacteria | 3330 |
| 869 | Ga0495662_0349252 | 3300046476 | Bacteria | 727 |
| 870 | Ga0495664_0030072 | 3300046477 | Bacteria | 3180 |
| 871 | Ga0495584_0142625 | 3300046491 | Bacteria | 1216 |
| 872 | Ga0495584_0198472 | 3300046491 | Bacteria | 1020 |
| 873 | Ga0495584_0219334 | 3300046491 | Bacteria | 967 |
| 874 | Ga0495585_0000856 | 3300046492 | Bacteria | 26041 |
| 875 | Ga0495585_0028456 | 3300046492 | Bacteria | 3188 |
| 876 | Ga0495594_0231035 | 3300046499 | Bacteria | 1054 |
| 877 | Ga0495608_0000915 | 3300046511 | Bacteria | 20676 |
| 878 | Ga0495616_0000405 | 3300046513 | Bacteria | 33255 |
| 879 | Ga0495616_0254436 | 3300046513 | Bacteria | 753 |
| 880 | Ga0495618_0009502 | 3300046514 | Bacteria | 5873 |
| 881 | Ga0495618_0544478 | 3300046514 | Bacteria | 695 |
| 882 | Ga0495620_0278241 | 3300046515 | Bacteria | 637 |
| 883 | Ga0495628_0008958 | 3300046516 | Bacteria | 8558 |
| 884 | Ga0495628_0083828 | 3300046516 | Bacteria | 2474 |
| 885 | Ga0495630_0009867 | 3300046517 | Bacteria | 6876 |
| 886 | Ga0495630_0430163 | 3300046517 | Bacteria | 1011 |
| 887 | Ga0495632_0071653 | 3300046519 | Bacteria | 1664 |
| 888 | Ga0495637_0070180 | 3300046520 | Bacteria | 1416 |
| 889 | Ga0495643_0229787 | 3300046522 | Bacteria | 875 |
| 890 | Ga0495644_0033593 | 3300046523 | Bacteria | 1937 |
| 891 | Ga0495663_0402127 | 3300046525 | Bacteria | 504 |
| 892 | Ga0495666_0028495 | 3300046526 | Bacteria | 2747 |
| 893 | Ga0495666_0120708 | 3300046526 | Bacteria | 1228 |
| 894 | Ga0495666_0467390 | 3300046526 | Bacteria | 565 |
| 895 | Ga0495642_0227908 | 3300046528 | Bacteria | 814 |
| 896 | Ga0495652_0005789 | 3300046529 | Bacteria | 11570 |
| 897 | Ga0495652_0053448 | 3300046529 | Bacteria | 3442 |
| 898 | Ga0495652_0150117 | 3300046529 | Bacteria | 1822 |
| 899 | Ga0495652_0192140 | 3300046529 | Bacteria | 1557 |
| 900 | Ga0495652_0356333 | 3300046529 | Bacteria | 1047 |
| 901 | Ga0495665_0019335 | 3300046531 | Bacteria | 3662 |
| 902 | Ga0495665_0113061 | 3300046531 | Bacteria | 1423 |
| 903 | Ga0495665_0132447 | 3300046531 | Bacteria | 1305 |
| 904 | Ga0495665_0153177 | 3300046531 | Bacteria | 1203 |
| 905 | Ga0495640_0071044 | 3300046533 | Bacteria | 2336 |
| 906 | Ga0495640_0256964 | 3300046533 | Bacteria | 1092 |
| 907 | Ga0495640_0270213 | 3300046533 | Bacteria | 1060 |
| 908 | Ga0495640_0296216 | 3300046533 | Bacteria | 1005 |
| 909 | Ga0495640_0432324 | 3300046533 | Bacteria | 805 |
| 910 | Ga0495640_0787677 | 3300046533 | Bacteria | 567 |
| 911 | Ga0495586_0085835 | 3300046535 | Bacteria | 1734 |
| 912 | Ga0495586_0404665 | 3300046535 | Bacteria | 785 |
| 913 | Ga0495587_0001734 | 3300046536 | Bacteria | 14559 |
| 914 | Ga0495598_0010894 | 3300046537 | Bacteria | 2190 |
| 915 | Ga0495609_0416845 | 3300046538 | Bacteria | 536 |
| 916 | Ga0495621_0074061 | 3300046539 | Bacteria | 1259 |
| 917 | Ga0495645_0011672 | 3300046543 | Bacteria | 6184 |
| 918 | Ga0495645_0086453 | 3300046543 | Bacteria | 2244 |
| 919 | Ga0495622_0018384 | 3300046557 | Bacteria | 3254 |
| 920 | Ga0495633_0017034 | 3300046558 | Bacteria | 3727 |
| 921 | Ga0495667_0000259 | 3300046559 | Bacteria | 34280 |
| 922 | Ga0495667_0014619 | 3300046559 | Bacteria | 5302 |
| 923 | Ga0495656_0000215 | 3300046615 | Bacteria | 20636 |
| 924 | Ga0495656_0217611 | 3300046615 | Bacteria | 954 |
| 925 | Ga0495668_0106370 | 3300046616 | Bacteria | 1534 |
| 926 | Ga0495668_0225302 | 3300046616 | Bacteria | 1027 |
| 927 | Ga0495634_0008814 | 3300046642 | Bacteria | 7480 |
| 928 | Ga0495634_0451287 | 3300046642 | Bacteria | 758 |
| 929 | Ga0495611_0010807 | 3300046648 | Bacteria | 3867 |
| 930 | Ga0495635_0010301 | 3300046663 | Bacteria | 6538 |
| 931 | Ga0495635_0028478 | 3300046663 | Bacteria | 3883 |
| 932 | Ga0495635_0460497 | 3300046663 | Bacteria | 840 |
| 933 | Ga0495659_0002574 | 3300046664 | Bacteria | 5848 |
| 934 | Ga0495659_0346154 | 3300046664 | Bacteria | 634 |
| 935 | Ga0495661_0364002 | 3300046665 | Bacteria | 709 |
| 936 | Ga0495657_0003179 | 3300046675 | Bacteria | 13534 |
| 937 | Ga0495657_0125454 | 3300046675 | Bacteria | 1613 |
| 938 | Ga0495599_0002681 | 3300046678 | Bacteria | 10394 |
| 939 | Ga0495646_0010194 | 3300046680 | Bacteria | 5975 |
| 940 | Ga0495646_0026632 | 3300046680 | Bacteria | 3629 |
| 941 | Ga0495647_0003634 | 3300046681 | Bacteria | 4952 |
| 942 | Ga0495647_0072747 | 3300046681 | Bacteria | 1379 |
| 943 | Ga0495647_0178586 | 3300046681 | Bacteria | 923 |
| 944 | Ga0495658_0000360 | 3300046683 | Bacteria | 25675 |
| 945 | Ga0495658_0005781 | 3300046683 | Bacteria | 6071 |
| 946 | Ga0495658_0114114 | 3300046683 | Bacteria | 1627 |
| 947 | Ga0495669_0167915 | 3300046684 | Bacteria | 1043 |
| 948 | Ga0495613_0006693 | 3300046689 | Bacteria | 8606 |
| 949 | Ga0495613_0027827 | 3300046689 | Bacteria | 4207 |
| 950 | Ga0495613_0033307 | 3300046689 | Bacteria | 3829 |
| 951 | Ga0495613_0447219 | 3300046689 | Bacteria | 876 |
| 952 | Ga0495624_0026537 | 3300046690 | Bacteria | 3796 |
| 953 | Ga0495624_0041895 | 3300046690 | Bacteria | 2926 |
| 954 | Ga0495624_0083331 | 3300046690 | Bacteria | 1977 |
| 955 | Ga0495624_0211509 | 3300046690 | Bacteria | 1176 |
| 956 | Ga0495670_0000213 | 3300046691 | Bacteria | 26531 |
| 957 | Ga0495671_0081284 | 3300046692 | Bacteria | 1588 |
| 958 | Ga0495671_0095482 | 3300046692 | Bacteria | 1455 |
| 959 | Ga0495671_0095485 | 3300046692 | Bacteria | 1455 |
| 960 | Ga0495600_0006046 | 3300046809 | Bacteria | 7331 |
| 961 | Ga0495600_0034222 | 3300046809 | Bacteria | 3298 |
| 962 | Ga0495581_0057033 | 3300047315 | Bacteria | 2254 |
| 963 | Ga0495581_0059837 | 3300047315 | Bacteria | 2201 |
| 964 | Ga0495581_0064661 | 3300047315 | Bacteria | 2114 |
| 965 | Ga0495581_0249409 | 3300047315 | Bacteria | 1038 |
| 966 | Ga0495604_0006070 | 3300047317 | Bacteria | 9587 |
| 967 | Ga0495604_0009049 | 3300047317 | Bacteria | 7879 |
| 968 | Ga0495604_0209491 | 3300047317 | Bacteria | 1348 |
| 969 | Ga0495604_0465148 | 3300047317 | Bacteria | 824 |
| 970 | Ga0495636_0108984 | 3300047318 | Bacteria | 1217 |
| 971 | Ga0495674_0092171 | 3300047319 | Bacteria | 2587 |
| 972 | Ga0495674_0110713 | 3300047319 | Bacteria | 2328 |
| 973 | Ga0495674_0138581 | 3300047319 | Bacteria | 2046 |
| 974 | Ga0495674_0176434 | 3300047319 | Bacteria | 1780 |
| 975 | Ga0495672_0280589 | 3300047320 | Bacteria | 796 |
| 976 | Ga0495676_0067235 | 3300047321 | Bacteria | 2773 |
| 977 | Ga0495676_0098466 | 3300047321 | Bacteria | 2169 |
| 978 | Ga0495676_0103110 | 3300047321 | Bacteria | 2107 |
| 979 | Ga0495680_0002446 | 3300047322 | Bacteria | 19009 |
| 980 | Ga0495680_0004222 | 3300047322 | Bacteria | 13790 |
| 981 | Ga0495680_0012206 | 3300047322 | Bacteria | 7577 |
| 982 | Ga0495680_0092425 | 3300047322 | Bacteria | 2266 |
| 983 | Ga0495680_0320898 | 3300047322 | Bacteria | 1084 |
| 984 | Ga0495675_0000147 | 3300047444 | Bacteria | 49274 |
| 985 | Ga0495675_0066110 | 3300047444 | Bacteria | 2286 |
| 986 | Ga0495675_0301904 | 3300047444 | Bacteria | 951 |
| 987 | Ga0495677_0115500 | 3300047445 | Bacteria | 1022 |
| 988 | Ga0495679_020691 | 3300047446 | Bacteria | 2287 |
| 989 | Ga0495681_0027851 | 3300047470 | Bacteria | 2918 |
| 990 | Ga0495684_0028528 | 3300047471 | Bacteria | 4284 |
| 991 | Ga0495684_0047645 | 3300047471 | Bacteria | 3278 |
| 992 | Ga0495684_0066900 | 3300047471 | Bacteria | 2732 |
| 993 | Ga0495684_0127008 | 3300047471 | Bacteria | 1918 |
| 994 | Ga0495684_0336106 | 3300047471 | Bacteria | 1076 |
| 995 | Ga0495593_0014970 | 3300047673 | Bacteria | 4403 |
| 996 | Ga0495593_0110428 | 3300047673 | Bacteria | 1404 |
| 997 | Ga0495602_0017376 | 3300048088 | Bacteria | 7212 |
| 998 | Ga0495602_0095091 | 3300048088 | Bacteria | 2461 |
| 999 | Ga0495602_0302117 | 3300048088 | Bacteria | 1171 |
| 1000 | Ga0495602_0809023 | 3300048088 | Bacteria | 629 |
| 1001 | Ga0495614_0016270 | 3300048089 | Bacteria | 3239 |
| 1002 | Ga0495615_0285013 | 3300048090 | Bacteria | 532 |
| 1003 | Ga0496100_0014640 | 3300048903 | Bacteria | 4559 |
| 1004 | Ga0496100_0019150 | 3300048903 | Bacteria | 4077 |
| 1005 | Ga0496100_0055392 | 3300048903 | Bacteria | 2590 |
| 1006 | Ga0496100_0670068 | 3300048903 | Bacteria | 808 |
| 1007 | Ga0496101_0005701 | 3300048904 | Bacteria | 7949 |
| 1008 | Ga0496101_0030810 | 3300048904 | Bacteria | 3765 |
| 1009 | Ga0496101_0038396 | 3300048904 | Bacteria | 3401 |
| 1010 | Ga0496101_0040176 | 3300048904 | Bacteria | 3331 |
| 1011 | Ga0496101_0118220 | 3300048904 | Bacteria | 2002 |
| 1012 | Ga0496101_0347426 | 3300048904 | Bacteria | 1165 |
| 1013 | Ga0496101_0718694 | 3300048904 | Bacteria | 788 |
| 1014 | Ga0496102_0005090 | 3300048905 | Bacteria | 11137 |
| 1015 | Ga0496102_0008860 | 3300048905 | Bacteria | 8634 |
| 1016 | Ga0496102_0058807 | 3300048905 | Bacteria | 3513 |
| 1017 | Ga0496102_0062689 | 3300048905 | Bacteria | 3404 |
| 1018 | Ga0496102_0313371 | 3300048905 | Bacteria | 1478 |
| 1019 | Ga0496102_0476294 | 3300048905 | Bacteria | 1169 |
| 1020 | Ga0496102_0563766 | 3300048905 | Bacteria | 1061 |
| 1021 | Ga0496103_0003997 | 3300048906 | Bacteria | 8957 |
| 1022 | Ga0496103_0049774 | 3300048906 | Bacteria | 2591 |
| 1023 | Ga0496103_0077497 | 3300048906 | Bacteria | 2086 |
| 1024 | Ga0496103_0089875 | 3300048906 | Bacteria | 1937 |
| 1025 | Ga0496103_0223957 | 3300048906 | Bacteria | 1209 |
| 1026 | Ga0496104_0000431 | 3300048907 | Bacteria | 36365 |
| 1027 | Ga0496104_0004143 | 3300048907 | Bacteria | 12587 |
| 1028 | Ga0496104_0026643 | 3300048907 | Bacteria | 5341 |
| 1029 | Ga0496104_0119489 | 3300048907 | Bacteria | 2530 |
| 1030 | Ga0496104_0151649 | 3300048907 | Bacteria | 2224 |
| 1031 | Ga0496104_0319108 | 3300048907 | Bacteria | 1466 |
| 1032 | Ga0496104_0347710 | 3300048907 | Bacteria | 1395 |
| 1033 | Ga0496104_0372043 | 3300048907 | Bacteria | 1341 |
| 1034 | Ga0496104_1730800 | 3300048907 | Bacteria | 527 |
| 1035 | Ga0496105_0003143 | 3300048908 | Bacteria | 12154 |
| 1036 | Ga0496105_0011647 | 3300048908 | Bacteria | 6959 |
| 1037 | Ga0496105_0030941 | 3300048908 | Bacteria | 4387 |
| 1038 | Ga0496105_0035148 | 3300048908 | Bacteria | 4124 |
| 1039 | Ga0496105_0052050 | 3300048908 | Bacteria | 3381 |
| 1040 | Ga0496105_0092739 | 3300048908 | Bacteria | 2493 |
| 1041 | Ga0496105_0341832 | 3300048908 | Bacteria | 1196 |
| 1042 | Ga0496105_0403622 | 3300048908 | Bacteria | 1084 |
| 1043 | Ga0496105_0539243 | 3300048908 | Bacteria | 912 |
| 1044 | Ga0496105_0765951 | 3300048908 | Bacteria | 736 |
| 1045 | Ga0496106_0006510 | 3300048909 | Bacteria | 8646 |
| 1046 | Ga0496106_0006633 | 3300048909 | Bacteria | 8570 |
| 1047 | Ga0496106_0025322 | 3300048909 | Bacteria | 4415 |
| 1048 | Ga0496106_0028566 | 3300048909 | Bacteria | 4154 |
| 1049 | Ga0496107_0015236 | 3300048910 | Bacteria | 5387 |
| 1050 | Ga0496107_0016151 | 3300048910 | Bacteria | 5238 |
| 1051 | Ga0496107_0031502 | 3300048910 | Bacteria | 3784 |
| 1052 | Ga0496107_0034286 | 3300048910 | Bacteria | 3635 |
| 1053 | Ga0496107_0286681 | 3300048910 | Bacteria | 1226 |
| 1054 | Ga0496107_0509417 | 3300048910 | Bacteria | 892 |
| 1055 | Ga0496107_0875251 | 3300048910 | Bacteria | 656 |
| 1056 | Ga0496108_0004006 | 3300048911 | Bacteria | 11815 |
| 1057 | Ga0496108_0029590 | 3300048911 | Bacteria | 4537 |
| 1058 | Ga0496108_0049594 | 3300048911 | Bacteria | 3511 |
| 1059 | Ga0496108_0188822 | 3300048911 | Bacteria | 1785 |
| 1060 | Ga0496108_0496022 | 3300048911 | Bacteria | 1066 |
| 1061 | Ga0496109_0000404 | 3300048912 | Bacteria | 38842 |
| 1062 | Ga0496109_0032437 | 3300048912 | Bacteria | 4695 |
| 1063 | Ga0496109_0062763 | 3300048912 | Bacteria | 3398 |
| 1064 | Ga0496109_0111595 | 3300048912 | Bacteria | 2542 |
| 1065 | Ga0496109_0160862 | 3300048912 | Bacteria | 2104 |
| 1066 | Ga0496109_0276439 | 3300048912 | Bacteria | 1582 |
| 1067 | Ga0496109_0582501 | 3300048912 | Bacteria | 1054 |
| 1068 | Ga0496110_0001910 | 3300048913 | Bacteria | 15419 |
| 1069 | Ga0496110_0035366 | 3300048913 | Bacteria | 4333 |
| 1070 | Ga0496110_0144583 | 3300048913 | Bacteria | 2150 |
| 1071 | Ga0496110_0153551 | 3300048913 | Bacteria | 2085 |
| 1072 | Ga0496110_0156603 | 3300048913 | Bacteria | 2064 |
| 1073 | Ga0496110_0179451 | 3300048913 | Bacteria | 1922 |
| 1074 | Ga0496110_0756182 | 3300048913 | Bacteria | 875 |
| 1075 | Ga0496111_0002312 | 3300048914 | Bacteria | 11466 |
| 1076 | Ga0496111_0021244 | 3300048914 | Bacteria | 4530 |
| 1077 | Ga0496111_0052032 | 3300048914 | Bacteria | 2957 |
| 1078 | Ga0496111_0101642 | 3300048914 | Bacteria | 2112 |
| 1079 | Ga0496111_0230705 | 3300048914 | Bacteria | 1375 |
| 1080 | Ga0496112_0002963 | 3300048915 | Bacteria | 13850 |
| 1081 | Ga0496112_0033447 | 3300048915 | Bacteria | 4998 |
| 1082 | Ga0496112_0038890 | 3300048915 | Bacteria | 4647 |
| 1083 | Ga0496112_0163683 | 3300048915 | Bacteria | 2190 |
| 1084 | Ga0496112_0191834 | 3300048915 | Bacteria | 2005 |
| 1085 | Ga0496112_0214013 | 3300048915 | Bacteria | 1884 |
| 1086 | Ga0496112_0227988 | 3300048915 | Bacteria | 1818 |
| 1087 | Ga0496112_0344731 | 3300048915 | Bacteria | 1433 |
| 1088 | Ga0496112_0375277 | 3300048915 | Bacteria | 1363 |
| 1089 | Ga0496112_0509676 | 3300048915 | Bacteria | 1138 |
| 1090 | Ga0496113_0001735 | 3300048916 | Bacteria | 12339 |
| 1091 | Ga0496113_0023714 | 3300048916 | Bacteria | 4353 |
| 1092 | Ga0496113_0038693 | 3300048916 | Bacteria | 3508 |
| 1093 | Ga0496113_0055173 | 3300048916 | Bacteria | 2977 |
| 1094 | Ga0496114_0007969 | 3300048917 | Bacteria | 8384 |
| 1095 | Ga0496114_0011998 | 3300048917 | Bacteria | 6930 |
| 1096 | Ga0496114_0026647 | 3300048917 | Bacteria | 4734 |
| 1097 | Ga0496114_0193555 | 3300048917 | Bacteria | 1780 |
| 1098 | Ga0496115_0005562 | 3300048918 | Bacteria | 9168 |
| 1099 | Ga0496115_0030415 | 3300048918 | Bacteria | 4248 |
| 1100 | Ga0496115_0090149 | 3300048918 | Bacteria | 2504 |
| 1101 | Ga0496115_0126837 | 3300048918 | Bacteria | 2102 |
| 1102 | Ga0496115_0127301 | 3300048918 | Bacteria | 2098 |
| 1103 | Ga0496115_0549087 | 3300048918 | Bacteria | 924 |
| 1104 | Ga0496119_0361203 | 3300048922 | Bacteria | 701 |
| 1105 | Ga0496126_0227298 | 3300048929 | Bacteria | 1565 |
| 1106 | Ga0501032_0055099 | 3300049569 | Bacteria | 2675 |
| 1107 | Ga0501032_0210740 | 3300049569 | Bacteria | 1267 |
| 1108 | Ga0501032_0230049 | 3300049569 | Bacteria | 1205 |
| 1109 | Ga0501032_0310667 | 3300049569 | Bacteria | 1018 |
| 1110 | Ga0501033_0056452 | 3300049570 | Bacteria | 2902 |
| 1111 | Ga0501033_0076983 | 3300049570 | Bacteria | 2448 |
| 1112 | Ga0501033_0213753 | 3300049570 | Bacteria | 1374 |
| 1113 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 1114 | Ga0501034_0001928 | 3300049571 | Bacteria | 26276 |
| 1115 | Ga0501034_0013803 | 3300049571 | Bacteria | 8313 |
| 1116 | Ga0501034_0062587 | 3300049571 | Bacteria | 3737 |
| 1117 | Ga0501034_0079663 | 3300049571 | Bacteria | 3279 |
| 1118 | Ga0501034_0094307 | 3300049571 | Bacteria | 2989 |
| 1119 | Ga0501034_0115064 | 3300049571 | Bacteria | 2678 |
| 1120 | Ga0501034_0155648 | 3300049571 | Bacteria | 2259 |
| 1121 | Ga0501034_0204376 | 3300049571 | Bacteria | 1932 |
| 1122 | Ga0501034_0383137 | 3300049571 | Bacteria | 1331 |
| 1123 | Ga0501034_1105629 | 3300049571 | Bacteria | 673 |
| 1124 | Ga0501034_1342534 | 3300049571 | Bacteria | 591 |
| 1125 | Ga0501036_0000939 | 3300049572 | Bacteria | 21877 |
| 1126 | Ga0501036_0027820 | 3300049572 | Bacteria | 4779 |
| 1127 | Ga0501036_0065300 | 3300049572 | Bacteria | 3080 |
| 1128 | Ga0501036_0596290 | 3300049572 | Bacteria | 916 |
| 1129 | Ga0501036_0803273 | 3300049572 | Bacteria | 775 |
| 1130 | Ga0501037_0006892 | 3300049573 | Bacteria | 8299 |
| 1131 | Ga0501037_0007211 | 3300049573 | Bacteria | 8123 |
| 1132 | Ga0501037_0032070 | 3300049573 | Bacteria | 3879 |
| 1133 | Ga0501037_0070788 | 3300049573 | Bacteria | 2537 |
| 1134 | Ga0501037_0130420 | 3300049573 | Bacteria | 1803 |
| 1135 | Ga0501037_0366637 | 3300049573 | Bacteria | 991 |
| 1136 | Ga0501038_0011084 | 3300049574 | Bacteria | 8232 |
| 1137 | Ga0501038_0020694 | 3300049574 | Bacteria | 5914 |
| 1138 | Ga0501038_0093602 | 3300049574 | Bacteria | 2513 |
| 1139 | Ga0501038_0163069 | 3300049574 | Bacteria | 1810 |
| 1140 | Ga0501038_0180645 | 3300049574 | Bacteria | 1702 |
| 1141 | Ga0501038_0186334 | 3300049574 | Bacteria | 1672 |
| 1142 | Ga0501038_0256703 | 3300049574 | Bacteria | 1383 |
| 1143 | Ga0501038_1056961 | 3300049574 | Bacteria | 594 |
| 1144 | Ga0501039_0114908 | 3300049575 | Bacteria | 2106 |
| 1145 | Ga0501039_0369568 | 3300049575 | Bacteria | 1127 |
| 1146 | Ga0501040_0371016 | 3300049576 | Bacteria | 1026 |
| 1147 | Ga0501041_0458884 | 3300049577 | Bacteria | 809 |
| 1148 | Ga0501042_0350317 | 3300049578 | Bacteria | 1068 |
| 1149 | Ga0501043_0001206 | 3300049579 | Bacteria | 22752 |
| 1150 | Ga0501043_0017209 | 3300049579 | Bacteria | 5670 |
| 1151 | Ga0501043_0046402 | 3300049579 | Bacteria | 3416 |
| 1152 | Ga0501043_0126750 | 3300049579 | Bacteria | 2002 |
| 1153 | Ga0501043_0127784 | 3300049579 | Bacteria | 1992 |
| 1154 | Ga0501043_0363361 | 3300049579 | Bacteria | 1098 |
| 1155 | Ga0501043_0439054 | 3300049579 | Bacteria | 982 |
| 1156 | Ga0501046_0045583 | 3300049580 | Bacteria | 3483 |
| 1157 | Ga0501046_0055684 | 3300049580 | Bacteria | 3106 |
| 1158 | Ga0501046_0107057 | 3300049580 | Bacteria | 2139 |
| 1159 | Ga0501046_0297421 | 3300049580 | Bacteria | 1179 |
| 1160 | Ga0501046_0762529 | 3300049580 | Bacteria | 679 |
| 1161 | Ga0501047_0000108 | 3300049581 | Bacteria | 101252 |
| 1162 | Ga0501047_0019198 | 3300049581 | Bacteria | 6557 |
| 1163 | Ga0501047_0025537 | 3300049581 | Bacteria | 5679 |
| 1164 | Ga0501047_0026716 | 3300049581 | Bacteria | 5556 |
| 1165 | Ga0501047_0071230 | 3300049581 | Bacteria | 3346 |
| 1166 | Ga0501047_0649495 | 3300049581 | Bacteria | 874 |
| 1167 | Ga0501047_1036189 | 3300049581 | Bacteria | 634 |
| 1168 | Ga0501048_0000493 | 3300049582 | Bacteria | 27551 |
| 1169 | Ga0501048_0318236 | 3300049582 | Bacteria | 1108 |
| 1170 | Ga0501048_0883248 | 3300049582 | Bacteria | 643 |
| 1171 | Ga0501048_0983869 | 3300049582 | Bacteria | 607 |
| 1172 | Ga0501067_0073670 | 3300049583 | Bacteria | 1892 |
| 1173 | Ga0501067_0093786 | 3300049583 | Bacteria | 1666 |
| 1174 | Ga0501067_0094020 | 3300049583 | Bacteria | 1664 |
| 1175 | Ga0501068_0015903 | 3300049584 | Bacteria | 4333 |
| 1176 | Ga0501068_0020518 | 3300049584 | Bacteria | 3851 |
| 1177 | Ga0501068_0034351 | 3300049584 | Bacteria | 3024 |
| 1178 | Ga0501068_0037280 | 3300049584 | Bacteria | 2911 |
| 1179 | Ga0501068_0216501 | 3300049584 | Bacteria | 1217 |
| 1180 | Ga0501068_0327063 | 3300049584 | Bacteria | 983 |
| 1181 | Ga0501068_0464142 | 3300049584 | Bacteria | 820 |
| 1182 | Ga0501069_0015562 | 3300049585 | Bacteria | 4079 |
| 1183 | Ga0501069_0045707 | 3300049585 | Bacteria | 2426 |
| 1184 | Ga0501069_0050681 | 3300049585 | Bacteria | 2308 |
| 1185 | Ga0501069_0067526 | 3300049585 | Bacteria | 2000 |
| 1186 | Ga0501069_0535158 | 3300049585 | Bacteria | 700 |
| 1187 | Ga0501070_0011892 | 3300049586 | Bacteria | 7350 |
| 1188 | Ga0501070_0014072 | 3300049586 | Bacteria | 6735 |
| 1189 | Ga0501070_0035357 | 3300049586 | Bacteria | 4175 |
| 1190 | Ga0501070_0040072 | 3300049586 | Bacteria | 3907 |
| 1191 | Ga0501070_0084044 | 3300049586 | Bacteria | 2635 |
| 1192 | Ga0501070_0098991 | 3300049586 | Bacteria | 2412 |
| 1193 | Ga0501070_0205471 | 3300049586 | Bacteria | 1617 |
| 1194 | Ga0501070_0317514 | 3300049586 | Bacteria | 1267 |
| 1195 | Ga0501070_0568244 | 3300049586 | Bacteria | 906 |
| 1196 | Ga0501071_0095836 | 3300049587 | Bacteria | 2183 |
| 1197 | Ga0501071_0188658 | 3300049587 | Bacteria | 1546 |
| 1198 | Ga0501071_0263613 | 3300049587 | Bacteria | 1302 |
| 1199 | Ga0501071_0306405 | 3300049587 | Bacteria | 1205 |
| 1200 | Ga0501071_0504879 | 3300049587 | Bacteria | 928 |
| 1201 | Ga0501072_0231686 | 3300049588 | Bacteria | 1471 |
| 1202 | Ga0501072_0309354 | 3300049588 | Bacteria | 1256 |
| 1203 | Ga0501072_0439428 | 3300049588 | Bacteria | 1033 |
| 1204 | Ga0501072_0458229 | 3300049588 | Bacteria | 1009 |
| 1205 | Ga0501073_0023624 | 3300049589 | Bacteria | 4412 |
| 1206 | Ga0501073_0032267 | 3300049589 | Bacteria | 3734 |
| 1207 | Ga0501073_0033637 | 3300049589 | Bacteria | 3649 |
| 1208 | Ga0501073_0082743 | 3300049589 | Bacteria | 2233 |
| 1209 | Ga0501073_0095315 | 3300049589 | Bacteria | 2067 |
| 1210 | Ga0501073_0124288 | 3300049589 | Bacteria | 1788 |
| 1211 | Ga0501073_0133256 | 3300049589 | Bacteria | 1722 |
| 1212 | Ga0501074_0001683 | 3300049590 | Bacteria | 15063 |
| 1213 | Ga0501074_0060299 | 3300049590 | Bacteria | 2733 |
| 1214 | Ga0501074_0137681 | 3300049590 | Bacteria | 1747 |
| 1215 | Ga0501074_0219011 | 3300049590 | Bacteria | 1355 |
| 1216 | Ga0501074_0666259 | 3300049590 | Bacteria | 735 |
| 1217 | Ga0501075_0657896 | 3300049591 | Bacteria | 799 |
| 1218 | Ga0501076_0158078 | 3300049592 | Bacteria | 1846 |
| 1219 | Ga0501079_0082316 | 3300049741 | Bacteria | 2489 |
| 1220 | Ga0501079_0091325 | 3300049741 | Bacteria | 2359 |
| 1221 | Ga0501079_0267791 | 3300049741 | Bacteria | 1335 |
| 1222 | Ga0501079_0409050 | 3300049741 | Bacteria | 1064 |
| 1223 | Ga0501079_0821377 | 3300049741 | Bacteria | 732 |
| 1224 | Ga0501079_0847288 | 3300049741 | Bacteria | 720 |
| 1225 | Ga0501080_0001065 | 3300049742 | Bacteria | 22565 |
| 1226 | Ga0501080_0026663 | 3300049742 | Bacteria | 5369 |
| 1227 | Ga0501080_0187422 | 3300049742 | Bacteria | 1902 |
| 1228 | Ga0501080_0638796 | 3300049742 | Bacteria | 942 |
| 1229 | Ga0501081_0050631 | 3300049743 | Bacteria | 2861 |
| 1230 | Ga0501083_0006385 | 3300049744 | Bacteria | 8356 |
| 1231 | Ga0501083_0019929 | 3300049744 | Bacteria | 4668 |
| 1232 | Ga0501083_0030750 | 3300049744 | Bacteria | 3686 |
| 1233 | Ga0501083_0175332 | 3300049744 | Bacteria | 1401 |
| 1234 | Ga0501083_0435178 | 3300049744 | Bacteria | 853 |
| 1235 | Ga0501083_0537039 | 3300049744 | Bacteria | 761 |
| 1236 | Ga0501035_0001940 | 3300049822 | Bacteria | 20709 |
| 1237 | Ga0501035_0011937 | 3300049822 | Bacteria | 8039 |
| 1238 | Ga0501035_0114912 | 3300049822 | Bacteria | 2356 |
| 1239 | Ga0501035_0194431 | 3300049822 | Bacteria | 1743 |
| 1240 | Ga0501035_0740284 | 3300049822 | Bacteria | 790 |
| 1241 | Ga0501035_0750151 | 3300049822 | Bacteria | 783 |
| 1242 | Ga0501035_0890801 | 3300049822 | Bacteria | 705 |
| 1243 | Ga0501044_0000457 | 3300049823 | Bacteria | 49748 |
| 1244 | Ga0501044_0000998 | 3300049823 | Bacteria | 34042 |
| 1245 | Ga0501044_0063861 | 3300049823 | Bacteria | 3759 |
| 1246 | Ga0501044_0065493 | 3300049823 | Bacteria | 3705 |
| 1247 | Ga0501044_0067570 | 3300049823 | Bacteria | 3642 |
| 1248 | Ga0501044_0078229 | 3300049823 | Bacteria | 3352 |
| 1249 | Ga0501044_0154782 | 3300049823 | Bacteria | 2272 |
| 1250 | Ga0501044_0221125 | 3300049823 | Bacteria | 1844 |
| 1251 | Ga0501044_0265525 | 3300049823 | Bacteria | 1654 |
| 1252 | Ga0501044_0680119 | 3300049823 | Bacteria | 916 |
| 1253 | Ga0501044_0690114 | 3300049823 | Bacteria | 907 |
| 1254 | Ga0501044_0876869 | 3300049823 | Bacteria | 773 |
| 1255 | Ga0501044_1009884 | 3300049823 | Bacteria | 703 |
| 1256 | Ga0501045_0309138 | 3300049824 | Bacteria | 1176 |
| 1257 | nmdc:mga03683_424032_c1 | 3300050489 | Bacteria | 638 |
| 1258 | nmdc:mga03683_51330_c1 | 3300050489 | Bacteria | 1721 |
| 1259 | nmdc:mga03683_76607_c1 | 3300050489 | Bacteria | 1438 |
| 1260 | nmdc:mga03n38_141272_c1 | 3300050490 | Bacteria | 1203 |
| 1261 | nmdc:mga03n38_225140_c1 | 3300050490 | Bacteria | 981 |
| 1262 | nmdc:mga03n38_36768_c1 | 3300050490 | Bacteria | 2107 |
| 1263 | nmdc:mga00v17_16761_c1 | 3300050491 | Bacteria | 4133 |
| 1264 | nmdc:mga00v17_17630_c1 | 3300050491 | Bacteria | 4046 |
| 1265 | nmdc:mga00v17_221874_c1 | 3300050491 | Bacteria | 1224 |
| 1266 | nmdc:mga00v17_23425_c1 | 3300050491 | Bacteria | 3571 |
| 1267 | nmdc:mga00v17_250682_c1 | 3300050491 | Bacteria | 1148 |
| 1268 | nmdc:mga00v17_304384_c1 | 3300050491 | Bacteria | 1035 |
| 1269 | nmdc:mga0yw44_104888_c1 | 3300050492 | Bacteria | 1805 |
| 1270 | nmdc:mga0yw44_1096250_c1 | 3300050492 | Bacteria | 538 |
| 1271 | nmdc:mga0yw44_264534_c1 | 3300050492 | Bacteria | 934 |
| 1272 | nmdc:mga0yw44_458855_c1 | 3300050492 | Bacteria | 864 |
| 1273 | nmdc:mga0yw44_699616_c1 | 3300050492 | Bacteria | 688 |
| 1274 | nmdc:mga0yw44_764880_c1 | 3300050492 | Bacteria | 656 |
| 1275 | nmdc:mga0yw44_8452_c1 | 3300050492 | Bacteria | 5132 |
| 1276 | nmdc:mga0k408_2858_c1 | 3300050493 | Bacteria | 9168 |
| 1277 | nmdc:mga06z11_140328_c1 | 3300050494 | Bacteria | 1365 |
| 1278 | nmdc:mga06z11_163592_c1 | 3300050494 | Bacteria | 1273 |
| 1279 | nmdc:mga06z11_211578_c1 | 3300050494 | Bacteria | 1130 |
| 1280 | nmdc:mga06z11_231076_c1 | 3300050494 | Bacteria | 1084 |
| 1281 | nmdc:mga06z11_243294_c1 | 3300050494 | Bacteria | 1057 |
| 1282 | nmdc:mga06z11_24562_c1 | 3300050494 | Bacteria | 2845 |
| 1283 | nmdc:mga06z11_275809_c1 | 3300050494 | Bacteria | 995 |
| 1284 | nmdc:mga06z11_2837_c1 | 3300050494 | Bacteria | 6650 |
| 1285 | nmdc:mga06z11_353853_c1 | 3300050494 | Bacteria | 879 |
| 1286 | nmdc:mga06z11_626523_c1 | 3300050494 | Bacteria | 655 |
| 1287 | nmdc:mga04h51_14443_c1 | 3300050495 | Bacteria | 2256 |
| 1288 | nmdc:mga04h51_226413_c1 | 3300050495 | Bacteria | 743 |
| 1289 | nmdc:mga04h51_26351_c1 | 3300050495 | Bacteria | 1797 |
| 1290 | nmdc:mga04h51_29121_c1 | 3300050495 | Bacteria | 1728 |
| 1291 | nmdc:mga04h51_338720_c1 | 3300050495 | Bacteria | 620 |
| 1292 | nmdc:mga04h51_50945_c1 | 3300050495 | Bacteria | 1389 |
| 1293 | nmdc:mga07m45_146238_c1 | 3300050496 | Bacteria | 1370 |
| 1294 | nmdc:mga07m45_208873_c1 | 3300050496 | Bacteria | 1136 |
| 1295 | nmdc:mga07m45_218408_c1 | 3300050496 | Bacteria | 1109 |
| 1296 | nmdc:mga07m45_577798_c1 | 3300050496 | Bacteria | 649 |
| 1297 | nmdc:mga07m45_70189_c1 | 3300050496 | Bacteria | 1993 |
| 1298 | nmdc:mga05p37_30731_c1 | 3300050507 | Bacteria | 6554 |
| 1299 | nmdc:mga05p37_357158_c1 | 3300050507 | Bacteria | 1719 |
| 1300 | nmdc:mga05p37_36596_c1 | 3300050507 | Bacteria | 6020 |
| 1301 | nmdc:mga05p37_368829_c1 | 3300050507 | Bacteria | 1685 |
| 1302 | nmdc:mga05p37_64392_c1 | 3300050507 | Bacteria | 1438 |
| 1303 | nmdc:mga09592_190239_c1 | 3300050508 | Bacteria | 1776 |
| 1304 | nmdc:mga0qj67_180918_c1 | 3300050509 | Bacteria | 1712 |
| 1305 | nmdc:mga06r32_54186_c1 | 3300050510 | Bacteria | 3845 |
| 1306 | nmdc:mga08y16_362536_c1 | 3300050511 | Bacteria | 1488 |
| 1307 | nmdc:mga08y16_507552_c1 | 3300050511 | Bacteria | 1224 |
| 1308 | nmdc:mga0n895_125540_c1 | 3300050512 | Bacteria | 2590 |
| 1309 | nmdc:mga0n895_2911_c1 | 3300050512 | Bacteria | 13576 |
| 1310 | nmdc:mga0n895_35380_c1 | 3300050512 | Bacteria | 4815 |
| 1311 | nmdc:mga0n895_576084_c1 | 3300050512 | Bacteria | 1130 |
| 1312 | nmdc:mga0rr50_187927_c1 | 3300050513 | Bacteria | 1692 |
| 1313 | nmdc:mga0rr50_71104_c1 | 3300050513 | Bacteria | 2654 |
| 1314 | nmdc:mga08x19_292984_c1 | 3300050514 | Bacteria | 1129 |
| 1315 | nmdc:mga08x19_38629_c1 | 3300050514 | Bacteria | 3032 |
| 1316 | nmdc:mga0a205_190118_c1 | 3300050515 | Bacteria | 1945 |
| 1317 | nmdc:mga0a205_334238_c1 | 3300050515 | Bacteria | 1384 |
| 1318 | nmdc:mga0a205_7768_c1 | 3300050515 | Bacteria | 9737 |
| 1319 | nmdc:mga0sz30_134193_c1 | 3300050516 | Bacteria | 1092 |
| 1320 | nmdc:mga0sz30_2969_c1 | 3300050516 | Bacteria | 6083 |
| 1321 | Ga0495601_0001750 | 3300053077 | Bacteria | 12016 |
| 1322 | Ga0495601_0002382 | 3300053077 | Bacteria | 10661 |
| 1323 | Ga0495601_0006675 | 3300053077 | Bacteria | 6756 |
| 1324 | Ga0495601_0081671 | 3300053077 | Bacteria | 2074 |
| 1325 | Ga0495601_0101403 | 3300053077 | Bacteria | 1859 |
| 1326 | Ga0495612_0008869 | 3300053078 | Bacteria | 4073 |
| 1327 | Ga0495612_0027993 | 3300053078 | Bacteria | 2267 |
| 1328 | Ga0495612_0052294 | 3300053078 | Bacteria | 1680 |
| 1329 | Ga0495612_0117550 | 3300053078 | Bacteria | 1142 |
| 1330 | Ga0500610_0228732 | 3300053079 | Bacteria | 874 |
| 1331 | Ga0495655_0236117 | 3300053083 | Bacteria | 610 |
| 1332 | Ga0495595_0000576 | 3300053084 | Bacteria | 14034 |
| 1333 | Ga0495595_0007184 | 3300053084 | Bacteria | 4551 |
| 1334 | Ga0495595_0032435 | 3300053084 | Bacteria | 2353 |
| 1335 | Ga0495595_0092899 | 3300053084 | Bacteria | 1449 |
| 1336 | Ga0495595_0203348 | 3300053084 | Bacteria | 986 |
| 1337 | Ga0495595_0550449 | 3300053084 | Bacteria | 589 |
| 1338 | Ga0495619_0000132 | 3300053085 | Bacteria | 55452 |
| 1339 | Ga0495619_0000178 | 3300053085 | Bacteria | 46773 |
| 1340 | Ga0495619_0003001 | 3300053085 | Bacteria | 10960 |
| 1341 | Ga0495619_0037425 | 3300053085 | Bacteria | 3161 |
| 1342 | Ga0495619_0068325 | 3300053085 | Bacteria | 2373 |
| 1343 | Ga0500643_004941 | 3300053087 | Bacteria | 5862 |
| 1344 | Ga0500644_0001366 | 3300053088 | Bacteria | 6514 |
| 1345 | Ga0500646_0130426 | 3300053090 | Bacteria | 816 |
| 1346 | Ga0500583_0090895 | 3300053092 | Bacteria | 1486 |
| 1347 | Ga0500651_0447757 | 3300053093 | Bacteria | 719 |
| 1348 | Ga0500566_0067107 | 3300053094 | Bacteria | 2020 |
| 1349 | Ga0500566_0067583 | 3300053094 | Bacteria | 2012 |
| 1350 | Ga0500566_0327303 | 3300053094 | Bacteria | 711 |
| 1351 | Ga0500641_0024406 | 3300053096 | Bacteria | 2331 |
| 1352 | Ga0500654_104851 | 3300053099 | Bacteria | 1187 |
| 1353 | Ga0500593_002852 | 3300053117 | Bacteria | 6417 |
| 1354 | Ga0500594_0278893 | 3300053118 | Bacteria | 559 |
| 1355 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1356 | Ga0500595_061203 | 3300053119 | Bacteria | 1136 |
| 1357 | Ga0500595_068320 | 3300053119 | Bacteria | 1059 |
| 1358 | Ga0500597_128940 | 3300053120 | Bacteria | 1094 |
| 1359 | Ga0500642_0036021 | 3300053130 | Bacteria | 2106 |
| 1360 | Ga0500642_0100336 | 3300053130 | Bacteria | 1346 |
| 1361 | Ga0500652_000043 | 3300053131 | Bacteria | 64726 |
| 1362 | Ga0500652_019276 | 3300053131 | Bacteria | 2531 |
| 1363 | Ga0500577_0066345 | 3300053142 | Bacteria | 1403 |
| 1364 | Ga0500577_0236772 | 3300053142 | Bacteria | 792 |
| 1365 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1366 | Ga0500616_0018461 | 3300053153 | Bacteria | 3944 |
| 1367 | Ga0500622_0032344 | 3300053156 | Bacteria | 2743 |
| 1368 | Ga0500622_0275325 | 3300053156 | Bacteria | 728 |
| 1369 | Ga0500627_0126477 | 3300053158 | Bacteria | 1154 |
| 1370 | Ga0500636_0022293 | 3300053177 | Bacteria | 3749 |
| 1371 | Ga0500636_0228656 | 3300053177 | Bacteria | 964 |
| 1372 | Ga0500611_008670 | 3300053727 | Bacteria | 1583 |
| 1373 | Ga0500645_000913 | 3300053730 | Bacteria | 16992 |
| 1374 | Ga0500609_001854 | 3300053731 | Bacteria | 3064 |
| 1375 | Ga0501084_0977272 | 3300054114 | Bacteria | 712 |
| 1376 | Ga0501084_1049892 | 3300054114 | Bacteria | 684 |
| 1377 | Ga0501084_1329780 | 3300054114 | Bacteria | 602 |
| 1378 | Ga0501084_1399725 | 3300054114 | Bacteria | 586 |
| 1379 | Ga0501082_0018450 | 3300060353 | Bacteria | 6010 |
| 1380 | Ga0501082_0230530 | 3300060353 | Bacteria | 1612 |
| 1381 | Ga0501082_0244844 | 3300060353 | Bacteria | 1560 |
| 1382 | Ga0501082_0392979 | 3300060353 | Bacteria | 1210 |
| 1383 | Ga0501082_0569340 | 3300060353 | Bacteria | 991 |
| 1384 | Ga0466962_0154826 | 3300061719 | Bacteria | 1113 |
| 1385 | Ga0530510_0215513 | 3300061734 | Bacteria | 1426 |
| 1386 | 2643757891 | 2643221547 | Bacteria | 4740017 |
| 1387 | Ga0068851_10121186 | |||
| 1388 | JGI24746J21847_1001422 | |||
| 1389 | JGI24743J22301_10000943 | |||
| 1390 | JGI24743J22301_10001063 | |||
| 1391 | JGI24735J21928_10122033 | |||
| 1392 | JGI24750J21931_1001324 | |||
| 1393 | JGI24745J21846_1024265 | |||
| 1394 | JGI24738J21930_10017677 | |||
| 1395 | JGI24749J21850_1006538 | |||
| 1396 | JGI24744J21845_10001216 | |||
| 1397 | JGI24033J26618_1023504 | |||
| 1398 | JGI24742J22300_10012337 | |||
| 1399 | JGI24751J29686_10004135 | |||
| 1400 | JGI25405J52794_10007754 | |||
| 1401 | Ga0058859_11818714 | |||
| 1402 | Ga0065715_10767562 | |||
| 1403 | Ga0065707_10046659 | |||
| 1404 | Ga0065707_10139584 | |||
| 1405 | Ga0065707_10163520 | |||
| 1406 | Ga0070658_10025964 | |||
| 1407 | Ga0070658_10146995 | |||
| 1408 | Ga0070658_10279641 | |||
| 1409 | Ga0070676_10024250 | |||
| 1410 | Ga0070676_10274875 | |||
| 1411 | Ga0070683_100092767 | |||
| 1412 | Ga0070683_100483370 | |||
| 1413 | Ga0070683_101318005 | |||
| 1414 | Ga0070690_100002546 | |||
| 1415 | Ga0070690_100777856 | |||
| 1416 | Ga0070670_100005236 | |||
| 1417 | Ga0070670_100048292 | |||
| 1418 | Ga0068869_100016497 | |||
| 1419 | Ga0068869_100056415 | |||
| 1420 | Ga0068869_100432580 | |||
| 1421 | Ga0068869_100693738 | |||
| 1422 | Ga0070666_10046576 | |||
| 1423 | Ga0070680_100043520 | |||
| 1424 | Ga0070680_100066652 | |||
| 1425 | Ga0070680_100261566 | |||
| 1426 | Ga0070680_100310594 | |||
| 1427 | Ga0070680_100407083 | |||
| 1428 | Ga0070680_100496378 | |||
| 1429 | Ga0070680_100514255 | |||
| 1430 | Ga0070680_100571215 | |||
| 1431 | Ga0070682_100034178 | |||
| 1432 | Ga0070682_100126832 | |||
| 1433 | Ga0070682_100720667 | |||
| 1434 | Ga0068868_100003086 | |||
| 1435 | Ga0068868_100020299 | |||
| 1436 | Ga0068868_100087352 | |||
| 1437 | Ga0068868_100526545 | |||
| 1438 | Ga0070660_100010850 | |||
| 1439 | Ga0070660_100409712 | |||
| 1440 | Ga0070689_100003434 | |||
| 1441 | Ga0070689_100029697 | |||
| 1442 | Ga0070689_100215663 | |||
| 1443 | Ga0070687_100034735 | |||
| 1444 | Ga0070687_100043598 | |||
| 1445 | Ga0070661_100047641 | |||
| 1446 | Ga0070661_100047671 | |||
| 1447 | Ga0070661_100256635 | |||
| 1448 | Ga0070692_10008804 | |||
| 1449 | Ga0070669_100127010 | |||
| 1450 | Ga0070669_100492346 | |||
| 1451 | Ga0070669_101065855 | |||
| 1452 | Ga0070675_100039707 | |||
| 1453 | Ga0070675_100375302 | |||
| 1454 | Ga0070675_100468279 | |||
| 1455 | Ga0070675_100915966 | |||
| 1456 | Ga0070671_100066484 | |||
| 1457 | Ga0070671_100091145 | |||
| 1458 | Ga0070671_100279237 | |||
| 1459 | Ga0070674_100050261 | |||
| 1460 | Ga0070674_100176129 | |||
| 1461 | Ga0070674_100917551 | |||
| 1462 | Ga0070673_100061221 | |||
| 1463 | Ga0070673_100189697 | |||
| 1464 | Ga0070673_100588719 | |||
| 1465 | Ga0070688_100005196 | |||
| 1466 | Ga0070688_100050977 | |||
| 1467 | Ga0070688_100414492 | |||
| 1468 | Ga0070659_100032102 | |||
| 1469 | Ga0070659_100042897 | |||
| 1470 | Ga0070659_100083017 | |||
| 1471 | Ga0070659_100559234 | |||
| 1472 | Ga0070659_100678522 | |||
| 1473 | Ga0070667_100099728 | |||
| 1474 | Ga0070709_10283637 | |||
| 1475 | Ga0070709_10586636 | |||
| 1476 | Ga0070709_10771220 | |||
| 1477 | Ga0070714_100035153 | |||
| 1478 | Ga0070714_100066297 | |||
| 1479 | Ga0070714_100310702 | |||
| 1480 | Ga0070713_100010421 | |||
| 1481 | Ga0070713_100021777 | |||
| 1482 | Ga0070713_100162501 | |||
| 1483 | Ga0070710_10014806 | |||
| 1484 | Ga0070710_10035879 | |||
| 1485 | Ga0070710_10081214 | |||
| 1486 | Ga0070710_10263827 | |||
| 1487 | Ga0070701_10001300 | |||
| 1488 | Ga0070701_10140015 | |||
| 1489 | Ga0070711_100084187 | |||
| 1490 | Ga0070711_100247468 | |||
| 1491 | Ga0070711_100414205 | |||
| 1492 | Ga0070711_100433901 | |||
| 1493 | Ga0070711_100572298 | |||
| 1494 | Ga0070705_100149675 | |||
| 1495 | Ga0070700_100011750 | |||
| 1496 | Ga0070700_100220337 | |||
| 1497 | Ga0070708_100273033 | |||
| 1498 | Ga0070708_100651795 | |||
| 1499 | Ga0070663_100028875 | |||
| 1500 | Ga0070663_100293346 | |||
| 1501 | Ga0070663_101557402 | |||
| 1502 | Ga0070678_100048644 | |||
| 1503 | Ga0070678_100055189 | |||
| 1504 | Ga0070678_100200529 | |||
| 1505 | Ga0070678_100205458 | |||
| 1506 | Ga0070678_100315879 | |||
| 1507 | Ga0070662_100034665 | |||
| 1508 | Ga0070662_100103951 | |||
| 1509 | Ga0070662_100232464 | |||
| 1510 | Ga0070662_100581643 | |||
| 1511 | Ga0070662_100637882 | |||
| 1512 | Ga0070681_10016513 | |||
| 1513 | Ga0070681_10396383 | |||
| 1514 | Ga0070681_10503935 | |||
| 1515 | Ga0068867_100031738 | |||
| 1516 | Ga0068867_100381106 | |||
| 1517 | Ga0068867_100979031 | |||
| 1518 | Ga0068867_101065547 | |||
| 1519 | Ga0070685_10011992 | |||
| 1520 | Ga0070685_10233939 | |||
| 1521 | Ga0070679_100033661 | |||
| 1522 | Ga0070679_100063548 | |||
| 1523 | Ga0070679_100182104 | |||
| 1524 | Ga0070679_100190909 | |||
| 1525 | Ga0070679_100198143 | |||
| 1526 | Ga0070679_100222283 | |||
| 1527 | Ga0070684_100076754 | |||
| 1528 | Ga0070684_100163107 | |||
| 1529 | Ga0070684_100174253 | |||
| 1530 | Ga0070697_100071761 | |||
| 1531 | Ga0070697_101135207 | |||
| 1532 | Ga0068853_100232868 | |||
| 1533 | Ga0068853_100239340 | |||
| 1534 | Ga0068853_100395245 | |||
| 1535 | Ga0068853_100630884 | |||
| 1536 | Ga0070672_100215685 | |||
| 1537 | Ga0070672_100357537 | |||
| 1538 | Ga0070686_100009403 | |||
| 1539 | Ga0070686_100036878 | |||
| 1540 | Ga0070686_100059554 | |||
| 1541 | Ga0070686_100313887 | |||
| 1542 | Ga0070695_100033983 | |||
| 1543 | Ga0070695_100441454 | |||
| 1544 | Ga0070693_100082579 | |||
| 1545 | Ga0070693_100142215 | |||
| 1546 | Ga0070665_100043641 | |||
| 1547 | Ga0070704_100002201 | |||
| 1548 | Ga0070704_100058274 | |||
| 1549 | Ga0068855_100033639 | |||
| 1550 | Ga0068855_100095264 | |||
| 1551 | Ga0068855_100384545 | |||
| 1552 | Ga0068855_100912698 | |||
| 1553 | Ga0068855_100988370 | |||
| 1554 | Ga0070664_100130899 | |||
| 1555 | Ga0070664_100539966 | |||
| 1556 | Ga0068857_100079852 | |||
| 1557 | Ga0068857_100519577 | |||
| 1558 | Ga0068856_100251766 | |||
| 1559 | Ga0068856_100354130 | |||
| 1560 | Ga0068856_101145474 | |||
| 1561 | Ga0068856_101411532 | |||
| 1562 | Ga0070702_100002073 | |||
| 1563 | Ga0070702_100064308 | |||
| 1564 | Ga0070702_100112578 | |||
| 1565 | Ga0070702_100180227 | |||
| 1566 | Ga0068852_100017739 | |||
| 1567 | Ga0068852_100032297 | |||
| 1568 | Ga0068852_100055851 | |||
| 1569 | Ga0068852_100109132 | |||
| 1570 | Ga0068852_101076701 | |||
| 1571 | Ga0068859_100014564 | |||
| 1572 | Ga0068859_100228480 | |||
| 1573 | Ga0068864_100005707 | |||
| 1574 | Ga0068864_100146517 | |||
| 1575 | Ga0068864_100180677 | |||
| 1576 | Ga0068864_100196550 | |||
| 1577 | Ga0068864_100241964 | |||
| 1578 | Ga0068864_101324956 | |||
| 1579 | Ga0068866_10101073 | |||
| 1580 | Ga0068866_10254189 | |||
| 1581 | Ga0068866_10333805 | |||
| 1582 | Ga0068861_100005727 | |||
| 1583 | Ga0068861_100674542 | |||
| 1584 | Ga0068870_10002924 | |||
| 1585 | Ga0068863_100047412 | |||
| 1586 | Ga0068863_100424857 | |||
| 1587 | Ga0068863_100475979 | |||
| 1588 | Ga0068863_101108543 | |||
| 1589 | Ga0068863_101124962 | |||
| 1590 | Ga0068858_100014295 | |||
| 1591 | Ga0068858_100120659 | |||
| 1592 | Ga0068858_100264879 | |||
| 1593 | Ga0068860_100059288 | |||
| 1594 | Ga0068860_100420949 | |||
| 1595 | Ga0068860_100453279 | |||
| 1596 | Ga0068860_101013167 | |||
| 1597 | Ga0068862_100003247 | |||
| 1598 | Ga0068862_100098160 | |||
| 1599 | Ga0068862_100801179 | |||
| 1600 | Ga0081455_10007598 | |||
| 1601 | Ga0081455_10011036 | |||
| 1602 | Ga0081455_10011972 | |||
| 1603 | Ga0081455_10145108 | |||
| 1604 | Ga0081538_10066339 | |||
| 1605 | Ga0081538_10095102 | |||
| 1606 | Ga0081540_1010582 | |||
| 1607 | Ga0081540_1054952 | |||
| 1608 | Ga0081540_1060030 | |||
| 1609 | Ga0081539_10001661 | |||
| 1610 | Ga0070717_10004108 | |||
| 1611 | Ga0070717_10029876 | |||
| 1612 | Ga0070717_10159237 | |||
| 1613 | Ga0070717_10226271 | |||
| 1614 | Ga0075365_10014447 | |||
| 1615 | Ga0075365_10020051 | |||
| 1616 | Ga0075365_10037653 | |||
| 1617 | Ga0075365_10121452 | |||
| 1618 | Ga0075365_10237213 | |||
| 1619 | Ga0075365_10452463 | |||
| 1620 | Ga0075368_10020274 | |||
| 1621 | Ga0075368_10192590 | |||
| 1622 | Ga0075368_10276328 | |||
| 1623 | Ga0075368_10419524 | |||
| 1624 | Ga0075363_100026782 | |||
| 1625 | Ga0075363_100061239 | |||
| 1626 | Ga0075363_100067201 | |||
| 1627 | Ga0075363_100135950 | |||
| 1628 | Ga0075363_100212868 | |||
| 1629 | Ga0075363_100231472 | |||
| 1630 | Ga0075363_100357059 | |||
| 1631 | Ga0075363_100371148 | |||
| 1632 | Ga0075364_10018301 | |||
| 1633 | Ga0075364_10038276 | |||
| 1634 | Ga0075364_10377523 | |||
| 1635 | Ga0075364_10397650 | |||
| 1636 | Ga0075364_10669778 | |||
| 1637 | Ga0075432_10264905 | |||
| 1638 | Ga0070715_10000720 | |||
| 1639 | Ga0070715_10063278 | |||
| 1640 | Ga0070715_10097752 | |||
| 1641 | Ga0070715_10116932 | |||
| 1642 | Ga0070716_100001889 | |||
| 1643 | Ga0070716_100010508 | |||
| 1644 | Ga0070716_100145713 | |||
| 1645 | Ga0070716_100389665 | |||
| 1646 | Ga0070712_100004033 | |||
| 1647 | Ga0070712_100061863 | |||
| 1648 | Ga0070712_100374650 | |||
| 1649 | Ga0070712_100409988 | |||
| 1650 | Ga0075362_10039557 | |||
| 1651 | Ga0075362_10045310 | |||
| 1652 | Ga0075362_10069781 | |||
| 1653 | Ga0075367_10001316 | |||
| 1654 | Ga0075367_10002916 | |||
| 1655 | Ga0075367_10063008 | |||
| 1656 | Ga0075367_10103936 | |||
| 1657 | Ga0075367_10294336 | |||
| 1658 | Ga0075367_10434289 | |||
| 1659 | Ga0075367_10458801 | |||
| 1660 | Ga0075367_10807620 | |||
| 1661 | Ga0075369_10018330 | |||
| 1662 | Ga0075369_10033265 | |||
| 1663 | Ga0075369_10050752 | |||
| 1664 | Ga0075369_10511074 | |||
| 1665 | Ga0075366_10012444 | |||
| 1666 | Ga0075366_10023107 | |||
| 1667 | Ga0075366_10051353 | |||
| 1668 | Ga0075366_10119067 | |||
| 1669 | Ga0075366_10264575 | |||
| 1670 | Ga0075366_10524970 | |||
| 1671 | Ga0097621_100059823 | |||
| 1672 | Ga0097621_100191505 | |||
| 1673 | Ga0097621_100334205 | |||
| 1674 | Ga0097621_101074706 | |||
| 1675 | Ga0075370_10047361 | |||
| 1676 | Ga0075370_10079080 | |||
| 1677 | Ga0075370_10191128 | |||
| 1678 | Ga0075370_10364188 | |||
| 1679 | Ga0075370_10605688 | |||
| 1680 | Ga0068871_100005491 | |||
| 1681 | Ga0068871_100093724 | |||
| 1682 | Ga0068871_100119621 | |||
| 1683 | Ga0068871_100139509 | |||
| 1684 | Ga0068871_100162960 | |||
| 1685 | Ga0068871_100183445 | |||
| 1686 | Ga0075428_100030184 | |||
| 1687 | Ga0075428_100650920 | |||
| 1688 | Ga0075428_102434721 | |||
| 1689 | Ga0075431_100659652 | |||
| 1690 | Ga0075431_100898433 | |||
| 1691 | Ga0075433_10698076 | |||
| 1692 | Ga0075434_100085876 | |||
| 1693 | Ga0075434_100103939 | |||
| 1694 | Ga0075434_100156042 | |||
| 1695 | Ga0075434_100187475 | |||
| 1696 | Ga0075434_100405874 | |||
| 1697 | Ga0075429_100530133 | |||
| 1698 | Ga0068865_100069839 | |||
| 1699 | Ga0068865_100265917 | |||
| 1700 | Ga0068865_100278061 | |||
| 1701 | Ga0075436_100029917 | |||
| 1702 | Ga0075436_100301414 | |||
| 1703 | Ga0097620_100014563 | |||
| 1704 | Ga0097620_100228484 | |||
| 1705 | Ga0075435_100006092 | |||
| 1706 | Ga0075435_100102310 | |||
| 1707 | Ga0075435_100290415 | |||
| 1708 | Ga0099795_10009154 | |||
| 1709 | Ga0105250_10065204 | |||
| 1710 | Ga0105240_10056226 | |||
| 1711 | Ga0105240_10117882 | |||
| 1712 | Ga0105240_10274810 | |||
| 1713 | Ga0105240_11096065 | |||
| 1714 | Ga0105240_11778359 | |||
| 1715 | Ga0111539_10183045 | |||
| 1716 | Ga0111539_10381342 | |||
| 1717 | Ga0111539_11259560 | |||
| 1718 | Ga0105245_10278620 | |||
| 1719 | Ga0105245_10326187 | |||
| 1720 | Ga0105245_10921301 | |||
| 1721 | Ga0105247_10004828 | |||
| 1722 | Ga0105247_10198780 | |||
| 1723 | Ga0105247_10392558 | |||
| 1724 | Ga0114129_10061242 | |||
| 1725 | Ga0114129_10095382 | |||
| 1726 | Ga0114129_10197097 | |||
| 1727 | Ga0114129_10208543 | |||
| 1728 | Ga0114129_10652695 | |||
| 1729 | Ga0105243_10047635 | |||
| 1730 | Ga0105243_10146727 | |||
| 1731 | Ga0105243_10244089 | |||
| 1732 | Ga0105243_10498700 | |||
| 1733 | Ga0105243_10575201 | |||
| 1734 | Ga0105243_11398543 | |||
| 1735 | Ga0105241_10257903 | |||
| 1736 | Ga0105241_10402151 | |||
| 1737 | Ga0105242_10027348 | |||
| 1738 | Ga0105242_10048559 | |||
| 1739 | Ga0105242_10068809 | |||
| 1740 | Ga0105242_10200080 | |||
| 1741 | Ga0105248_10012305 | |||
| 1742 | Ga0105248_10074998 | |||
| 1743 | Ga0105248_10097925 | |||
| 1744 | Ga0105248_10404753 | |||
| 1745 | Ga0105248_12532992 | |||
| 1746 | Ga0105237_10063614 | |||
| 1747 | Ga0105237_10103380 | |||
| 1748 | Ga0105238_10113642 | |||
| 1749 | Ga0105238_10171734 | |||
| 1750 | Ga0105238_10342858 | |||
| 1751 | Ga0105238_11044904 | |||
| 1752 | Ga0105249_10000366 | |||
| 1753 | Ga0105249_10032153 | |||
| 1754 | Ga0105249_10055253 | |||
| 1755 | Ga0105249_10421066 | |||
| 1756 | Ga0105249_10677854 | |||
| 1757 | Ga0105249_13268909 | |||
| 1758 | Ga0099796_10161233 | |||
| 1759 | Ga0105239_10082645 | |||
| 1760 | Ga0105239_10163984 | |||
| 1761 | Ga0105239_10822535 | |||
| 1762 | Ga0105239_11234049 | |||
| 1763 | Ga0105239_11791739 | |||
| 1764 | Ga0105246_10054178 | |||
| 1765 | Ga0105246_10105727 | |||
| 1766 | Ga0105246_10765605 | |||
| 1767 | Ga0105246_11515320 | |||
| 1768 | Ga0157346_1001067 | |||
| 1769 | Ga0157315_1017040 | |||
| 1770 | Ga0157373_10085737 | |||
| 1771 | Ga0157371_10059021 | |||
| 1772 | Ga0157371_10582183 | |||
| 1773 | Ga0157370_10116838 | |||
| 1774 | Ga0157370_10124689 | |||
| 1775 | Ga0157370_10637614 | |||
| 1776 | Ga0157370_10712379 | |||
| 1777 | Ga0157369_10229201 | |||
| 1778 | Ga0157369_10335996 | |||
| 1779 | Ga0157369_10802702 | |||
| 1780 | Ga0157374_10091851 | |||
| 1781 | Ga0157374_10397952 | |||
| 1782 | Ga0157374_11510137 | |||
| 1783 | Ga0157378_10080426 | |||
| 1784 | Ga0157378_10093499 | |||
| 1785 | Ga0157378_10687797 | |||
| 1786 | Ga0157372_10116237 | |||
| 1787 | Ga0157375_10022311 | |||
| 1788 | Ga0157375_10990293 | |||
| 1789 | Ga0163163_10126580 | |||
| 1790 | Ga0163163_10183790 | |||
| 1791 | Ga0163163_10246684 | |||
| 1792 | Ga0163163_10878867 | |||
| 1793 | Ga0157380_10077598 | |||
| 1794 | Ga0157380_10147233 | |||
| 1795 | Ga0157380_11009929 | |||
| 1796 | Ga0182008_10032425 | |||
| 1797 | Ga0157377_10015614 | |||
| 1798 | Ga0157377_10091494 | |||
| 1799 | Ga0157377_10113348 | |||
| 1800 | Ga0157379_10010974 | |||
| 1801 | Ga0157379_10324966 | |||
| 1802 | Ga0157379_10465813 | |||
| 1803 | Ga0157379_10602530 | |||
| 1804 | Ga0157376_10282950 | |||
| 1805 | Ga0157376_11244548 | |||
| 1806 | Ga0182007_10234096 | |||
| 1807 | Ga0182005_1133320 | |||
| 1808 | Ga0163161_10197530 | |||
| 1809 | Ga0163161_10314456 | |||
| 1810 | Ga0206356_11118909 | |||
| 1811 | Ga0206354_10212022 | |||
| 1812 | Ga0206353_10376412 | |||
| 1813 | Ga0206353_10853757 | |||
| 1814 | Ga0206353_11627131 | |||
| 1815 | Ga0213872_10060323 | |||
| 1816 | Ga0213872_10135485 | |||
| 1817 | Ga0213876_10008421 | |||
| 1818 | Ga0213876_10393722 | |||
| 1819 | Ga0213875_10000031 | |||
| 1820 | Ga0213875_10120279 | |||
| 1821 | Ga0213875_10127419 | |||
| 1822 | Ga0209233_1014532 | |||
| 1823 | Ga0207682_10055792 | |||
| 1824 | Ga0207692_10002654 | |||
| 1825 | Ga0207692_10033904 | |||
| 1826 | Ga0207692_10047511 | |||
| 1827 | Ga0207692_10068942 | |||
| 1828 | Ga0207692_10097832 | |||
| 1829 | Ga0207710_10059418 | |||
| 1830 | Ga0207688_10002814 | |||
| 1831 | Ga0207688_10045009 | |||
| 1832 | Ga0207688_10096148 | |||
| 1833 | Ga0207680_10028876 | |||
| 1834 | Ga0207680_10853700 | |||
| 1835 | Ga0207647_10046289 | |||
| 1836 | Ga0207685_10035901 | |||
| 1837 | Ga0207685_10061390 | |||
| 1838 | Ga0207685_10125559 | |||
| 1839 | Ga0207685_10152884 | |||
| 1840 | Ga0207685_10174019 | |||
| 1841 | Ga0207699_10036496 | |||
| 1842 | Ga0207699_10045331 | |||
| 1843 | Ga0207699_10203490 | |||
| 1844 | Ga0207699_10371678 | |||
| 1845 | Ga0207699_10710092 | |||
| 1846 | Ga0207699_11129440 | |||
| 1847 | Ga0207645_10002945 | |||
| 1848 | Ga0207645_10025104 | |||
| 1849 | Ga0207643_10002845 | |||
| 1850 | Ga0207643_10161260 | |||
| 1851 | Ga0207705_10049781 | |||
| 1852 | Ga0207705_10143820 | |||
| 1853 | Ga0207705_10379135 | |||
| 1854 | Ga0207684_10002963 | |||
| 1855 | Ga0207654_10011794 | |||
| 1856 | Ga0207654_10027072 | |||
| 1857 | Ga0207654_10910837 | |||
| 1858 | Ga0207707_10045230 | |||
| 1859 | Ga0207707_10119083 | |||
| 1860 | Ga0207707_10505509 | |||
| 1861 | Ga0207707_10658336 | |||
| 1862 | Ga0207695_10235929 | |||
| 1863 | Ga0207695_10623058 | |||
| 1864 | Ga0207695_10718183 | |||
| 1865 | Ga0207695_11105559 | |||
| 1866 | Ga0207671_10219760 | |||
| 1867 | Ga0207671_10469263 | |||
| 1868 | Ga0207693_10000825 | |||
| 1869 | Ga0207693_10004273 | |||
| 1870 | Ga0207693_10007085 | |||
| 1871 | Ga0207693_10009090 | |||
| 1872 | Ga0207693_10053018 | |||
| 1873 | Ga0207693_10082455 | |||
| 1874 | Ga0207693_10135084 | |||
| 1875 | Ga0207693_10172403 | |||
| 1876 | Ga0207663_10059104 | |||
| 1877 | Ga0207663_10105854 | |||
| 1878 | Ga0207663_10109082 | |||
| 1879 | Ga0207663_10207397 | |||
| 1880 | Ga0207663_10225145 | |||
| 1881 | Ga0207663_10370903 | |||
| 1882 | Ga0207663_10379286 | |||
| 1883 | Ga0207663_10557903 | |||
| 1884 | Ga0207663_11077550 | |||
| 1885 | Ga0207660_10087246 | |||
| 1886 | Ga0207660_10105093 | |||
| 1887 | Ga0207660_10409140 | |||
| 1888 | Ga0207660_10691008 | |||
| 1889 | Ga0207660_11117308 | |||
| 1890 | Ga0207662_10008927 | |||
| 1891 | Ga0207662_10051522 | |||
| 1892 | Ga0207662_10509100 | |||
| 1893 | Ga0207657_10028698 | |||
| 1894 | Ga0207657_10045555 | |||
| 1895 | Ga0207657_10093700 | |||
| 1896 | Ga0207649_10038210 | |||
| 1897 | Ga0207649_10251877 | |||
| 1898 | Ga0207649_10706584 | |||
| 1899 | Ga0207652_10102361 | |||
| 1900 | Ga0207652_10151429 | |||
| 1901 | Ga0207652_10208051 | |||
| 1902 | Ga0207652_10218154 | |||
| 1903 | Ga0207652_10225012 | |||
| 1904 | Ga0207652_10864760 | |||
| 1905 | Ga0207681_10084122 | |||
| 1906 | Ga0207681_10324738 | |||
| 1907 | Ga0207694_10134797 | |||
| 1908 | Ga0207694_10549584 | |||
| 1909 | Ga0207694_10609454 | |||
| 1910 | Ga0207650_10002572 | |||
| 1911 | Ga0207650_10033447 | |||
| 1912 | Ga0207650_10473508 | |||
| 1913 | Ga0207659_10018147 | |||
| 1914 | Ga0207687_10005621 | |||
| 1915 | Ga0207687_10111414 | |||
| 1916 | Ga0207687_10121271 | |||
| 1917 | Ga0207700_10068719 | |||
| 1918 | Ga0207700_10127513 | |||
| 1919 | Ga0207700_10151584 | |||
| 1920 | Ga0207700_10185594 | |||
| 1921 | Ga0207700_10213529 | |||
| 1922 | Ga0207700_10364038 | |||
| 1923 | Ga0207700_11033398 | |||
| 1924 | Ga0207700_11387789 | |||
| 1925 | Ga0207664_10007232 | |||
| 1926 | Ga0207664_10023737 | |||
| 1927 | Ga0207664_10066940 | |||
| 1928 | Ga0207664_10070473 | |||
| 1929 | Ga0207664_10076974 | |||
| 1930 | Ga0207664_10196941 | |||
| 1931 | Ga0207644_10029417 | |||
| 1932 | Ga0207644_10038563 | |||
| 1933 | Ga0207644_10097299 | |||
| 1934 | Ga0207644_10338694 | |||
| 1935 | Ga0207644_11883285 | |||
| 1936 | Ga0207690_10158979 | |||
| 1937 | Ga0207706_10001336 | |||
| 1938 | Ga0207706_10108352 | |||
| 1939 | Ga0207706_10255971 | |||
| 1940 | Ga0207706_10268663 | |||
| 1941 | Ga0207706_10878002 | |||
| 1942 | Ga0207686_10023636 | |||
| 1943 | Ga0207686_10056288 | |||
| 1944 | Ga0207686_10392290 | |||
| 1945 | Ga0207686_10625514 | |||
| 1946 | Ga0207709_10003540 | |||
| 1947 | Ga0207709_10124088 | |||
| 1948 | Ga0207670_10035722 | |||
| 1949 | Ga0207670_10160451 | |||
| 1950 | Ga0207669_10029074 | |||
| 1951 | Ga0207669_10160665 | |||
| 1952 | Ga0207704_10052137 | |||
| 1953 | Ga0207704_10173913 | |||
| 1954 | Ga0207704_10202384 | |||
| 1955 | Ga0207665_10001068 | |||
| 1956 | Ga0207665_10003817 | |||
| 1957 | Ga0207665_10040571 | |||
| 1958 | Ga0207665_10130207 | |||
| 1959 | Ga0207665_10291151 | |||
| 1960 | Ga0207691_10000635 | |||
| 1961 | Ga0207711_10010280 | |||
| 1962 | Ga0207711_10036737 | |||
| 1963 | Ga0207711_10069609 | |||
| 1964 | Ga0207711_10602185 | |||
| 1965 | Ga0207689_10003641 | |||
| 1966 | Ga0207689_10024648 | |||
| 1967 | Ga0207689_10046276 | |||
| 1968 | Ga0207661_10035883 | |||
| 1969 | Ga0207661_10131898 | |||
| 1970 | Ga0207661_10412446 | |||
| 1971 | Ga0207679_10014282 | |||
| 1972 | Ga0207679_10652239 | |||
| 1973 | Ga0207679_10816047 | |||
| 1974 | Ga0207667_10036413 | |||
| 1975 | Ga0207667_10072960 | |||
| 1976 | Ga0207667_10151081 | |||
| 1977 | Ga0207667_10762693 | |||
| 1978 | Ga0207667_11455545 | |||
| 1979 | Ga0207651_10048486 | |||
| 1980 | Ga0207712_10002399 | |||
| 1981 | Ga0207668_10031104 | |||
| 1982 | Ga0207668_10473718 | |||
| 1983 | Ga0207668_11580275 | |||
| 1984 | Ga0207640_10041977 | |||
| 1985 | Ga0207640_10379314 | |||
| 1986 | Ga0207640_11008770 | |||
| 1987 | Ga0207658_10046077 | |||
| 1988 | Ga0207677_10004734 | |||
| 1989 | Ga0207677_10041256 | |||
| 1990 | Ga0207677_11304936 | |||
| 1991 | Ga0207703_10012768 | |||
| 1992 | Ga0207703_10287925 | |||
| 1993 | Ga0207703_11426111 | |||
| 1994 | Ga0207639_10342757 | |||
| 1995 | Ga0207639_10419380 | |||
| 1996 | Ga0207639_10442090 | |||
| 1997 | Ga0207678_10004902 | |||
| 1998 | Ga0207678_10010341 | |||
| 1999 | Ga0207678_10551135 | |||
| 2000 | Ga0207708_10001330 | |||
| 2001 | Ga0207708_10162321 | |||
| 2002 | Ga0207702_10039530 | |||
| 2003 | Ga0207702_10069314 | |||
| 2004 | Ga0207702_10536090 | |||
| 2005 | Ga0207641_10019656 | |||
| 2006 | Ga0207641_10189502 | |||
| 2007 | Ga0207641_11079858 | |||
| 2008 | Ga0207641_11141361 | |||
| 2009 | Ga0207648_10003105 | |||
| 2010 | Ga0207648_10302535 | |||
| 2011 | Ga0207648_11378156 | |||
| 2012 | Ga0207676_10024382 | |||
| 2013 | Ga0207676_10042058 | |||
| 2014 | Ga0207676_10137329 | |||
| 2015 | Ga0207676_11481023 | |||
| 2016 | Ga0207674_10333373 | |||
| 2017 | Ga0207675_100004255 | |||
| 2018 | Ga0207675_100238194 | |||
| 2019 | Ga0207675_100400593 | |||
| 2020 | Ga0207683_10004806 | |||
| 2021 | Ga0207683_10007077 | |||
| 2022 | Ga0207683_10023723 | |||
| 2023 | Ga0207683_10065336 | |||
| 2024 | Ga0207683_10156650 | |||
| 2025 | Ga0207698_10014590 | |||
| 2026 | Ga0207698_10019033 | |||
| 2027 | Ga0207698_10408090 | |||
| 2028 | Ga0209179_1005113 | |||
| 2029 | Ga0209813_10010282 | |||
| 2030 | Ga0209813_10022000 | |||
| 2031 | Ga0209813_10185473 | |||
| 2032 | Ga0207428_10212984 | |||
| 2033 | Ga0207428_10268096 | |||
| 2034 | Ga0268266_10026518 | |||
| 2035 | Ga0268266_10137663 | |||
| 2036 | Ga0268266_10681102 | |||
| 2037 | Ga0268265_10003591 | |||
| 2038 | Ga0268265_10678934 | |||
| 2039 | Ga0268264_10005325 | |||
| 2040 | Ga0265337_1018778 | |||
| 2041 | Ga0265318_10004032 | |||
| 2042 | Ga0265330_10007771 | |||
| 2043 | Ga0265330_10034373 | |||
| 2044 | Ga0265332_10002695 | |||
| 2045 | Ga0265332_10012389 | |||
| 2046 | Ga0265328_10050582 | |||
| 2047 | Ga0265320_10018493 | |||
| 2048 | Ga0265325_10004992 | |||
| 2049 | Ga0265325_10016894 | |||
| 2050 | Ga0265325_10025118 | |||
| 2051 | Ga0265325_10025624 | |||
| 2052 | Ga0265325_10036101 | |||
| 2053 | Ga0265329_10012587 | |||
| 2054 | Ga0265329_10031690 | |||
| 2055 | Ga0265340_10004865 | |||
| 2056 | Ga0265340_10063523 | |||
| 2057 | Ga0265340_10122473 | |||
| 2058 | Ga0265340_10168967 | |||
| 2059 | Ga0265339_10004645 | |||
| 2060 | Ga0265339_10010159 | |||
| 2061 | Ga0265339_10013807 | |||
| 2062 | Ga0265331_10007949 | |||
| 2063 | Ga0265331_10012924 | |||
| 2064 | Ga0265316_10017769 | |||
| 2065 | Ga0265316_10025046 | |||
| 2066 | Ga0265316_10034592 | |||
| 2067 | Ga0265316_10094403 | |||
| 2068 | Ga0307513_10115927 | |||
| 2069 | Ga0307513_10402560 | |||
| 2070 | Ga0265313_10002478 | |||
| 2071 | Ga0265313_10022841 | |||
| 2072 | Ga0265313_10035654 | |||
| 2073 | Ga0265313_10068739 | |||
| 2074 | Ga0265313_10187543 | |||
| 2075 | Ga0316575_10043017 | |||
| 2076 | Ga0316579_10146555 | |||
| 2077 | Ga0265314_10060775 | |||
| 2078 | Ga0265314_10087405 | |||
| 2079 | Ga0265314_10142508 | |||
| 2080 | Ga0265342_10000092 | |||
| 2081 | Ga0265342_10000983 | |||
| 2082 | Ga0265342_10014308 | |||
| 2083 | Ga0316576_10182607 | |||
| 2084 | Ga0316578_10015600 | |||
| 2085 | Ga0316578_10337639 | |||
| 2086 | Ga0307405_11398694 | |||
| 2087 | Ga0307409_100480786 | |||
| 2088 | Ga0316583_10193944 | |||
| 2089 | Ga0373930_0014853 | |||
| 2090 | Ga0373948_0001761 | |||
| 2091 | Ga0373950_0050463 | |||
| 2092 | Ga0373950_0051664 | |||
| 2093 | Ga0373958_0006709 | |||
| 2094 | Ga0373959_0002292 | |||
| 2095 | Ga0373938_0014292 | |||
| 2096 | Ga0373926_0021500 | |||
| 2097 | Ga0373926_0023001 | |||
| 2098 | Ga0373926_0122552 | |||
| 2099 | Ga0373929_0017613 | |||
| 2100 | Ga0373929_0020957 | |||
| 2101 | Ga0373929_0179757 | |||
| 2102 | Ga0373940_0019255 | |||
| 2103 | Ga0373944_0003559 | |||
| 2104 | Ga0373944_0005088 | |||
| 2105 | Ga0373944_0308046 | |||
| 2106 | Ga0373949_0096076 | |||
| 2107 | Ga0373951_0001694 | |||
| 2108 | Ga0373951_0075012 | |||
| 2109 | Ga0373952_0003947 | |||
| 2110 | Ga0373923_0033073 | |||
| 2111 | Ga0373923_0257390 | |||
| 2112 | Ga0373932_0114190 | |||
| 2113 | Ga0373936_0005473 | |||
| 2114 | Ga0373939_0096441 | |||
| 2115 | Ga0373941_0017500 | |||
| 2116 | Ga0373941_0130301 | |||
| 2117 | Ga0373945_0018914 | |||
| 2118 | Ga0373945_0029086 | |||
| 2119 | Ga0373945_0033872 | |||
| 2120 | Ga0373945_0326891 | |||
| 2121 | Ga0373953_0007986 | |||
| 2122 | Ga0373953_0014564 | |||
| 2123 | Ga0373954_0006853 | |||
| 2124 | Ga0373954_0117790 | |||
| 2125 | Ga0373954_0130238 | |||
| 2126 | Ga0373956_0018386 | |||
| 2127 | Ga0373956_0043454 | |||
| 2128 | Ga0373956_0062504 | |||
| 2129 | Ga0373956_0216390 | |||
| 2130 | Ga0373957_0006573 | |||
| 2131 | Ga0373957_0006843 | |||
| 2132 | Ga0373957_0147333 | |||
| 2133 | Ga0373960_0044241 | |||
| 2134 | Ga0373960_0184427 | |||
| 2135 | Ga0373943_0002330 | |||
| 2136 | Ga0373943_0280058 | |||
| 2137 | Ga0373946_0007021 | |||
| 2138 | Ga0373946_0008539 | |||
| 2139 | Ga0373946_0011321 | |||
| 2140 | Ga0373946_0394515 | |||
| 2141 | Ga0373946_0544091 | |||
| 2142 | Ga0373955_0001883 | |||
| 2143 | Ga0373955_0471865 | |||
| 2144 | Ga0373942_0322324 | |||
| 2145 | Ga0373961_0002014 | |||
| 2146 | Ga0373961_0019548 | |||
| 2147 | Ga0373961_0034548 | |||
| 2148 | Ga0373961_0314726 | |||
| 2149 | Ga0373962_0001403 | |||
| 2150 | Ga0316574_0060391 | |||
| 2151 | Ga0373924_0117763 | |||
| 2152 | Ga0373924_0147059 | |||
| 2153 | Ga0373931_0001882 | |||
| 2154 | Ga0373931_0008995 | |||
| 2155 | Ga0373931_0027332 | |||
| 2156 | Ga0373935_0002676 | |||
| 2157 | Ga0373935_0047198 | |||
| 2158 | Ga0373935_0128655 | |||
| 2159 | Ga0373935_0159944 | |||
| 2160 | Ga0373927_0010750 | |||
| 2161 | Ga0373927_0023475 | |||
| 2162 | Ga0373927_0119628 | |||
| 2163 | Ga0373927_0217060 | |||
| 2164 | Ga0373927_0355443 | |||
| 2165 | Ga0373933_0002112 | |||
| 2166 | Ga0373933_0010711 | |||
| 2167 | Ga0373947_0001553 | |||
| 2168 | Ga0373947_0098441 | |||
| 2169 | Ga0373947_0144790 | |||
| 2170 | Ga0373947_0276995 | |||
| 2171 | Ga0373947_0393855 | |||
| 2172 | Ga0373947_0596989 | |||
| 2173 | Ga0373937_0002048 | |||
| 2174 | Ga0373937_0007361 | |||
| 2175 | Ga0373937_0050920 | |||
| 2176 | Ga0373937_0118279 | |||
| 2177 | Ga0373937_1003849 | |||
| 2178 | Ga0316582_0047745 | |||
| 2179 | Ga0316582_0365261 | |||
| 2180 | Ga0316584_0026489 | |||
| 2181 | Ga0373925_0008896 | |||
| 2182 | Ga0373925_0189534 | |||
| 2183 | Ga0373925_0309072 | |||
| 2184 | Ga0373925_0355153 | |||
| 2185 | Ga0395899_0013226 | |||
| 2186 | Ga0395899_0053827 | |||
| 2187 | Ga0395900_0006301 | |||
| 2188 | Ga0395900_0007225 | |||
| 2189 | Ga0395900_0042502 | |||
| 2190 | Ga0395898_0037430 | |||
| 2191 | Ga0395898_0063745 | |||
| 2192 | Ga0395898_0235150 | |||
| 2193 | Ga0316581_0037028 | |||
| 2194 | Ga0436364_0793438 | |||
| 2195 | Ga0436364_1132027 | |||
| 2196 | Ga0395901_0028459 | |||
| 2197 | Ga0395901_0036482 | |||
| 2198 | Ga0395901_0070801 | |||
| 2199 | Ga0436365_0030899 | |||
| 2200 | Ga0436365_0589402 | |||
| 2201 | Ga0436365_1138630 | |||
| 2202 | Ga0436365_1500007 | |||
| 2203 | Ga0436365_1653395 | |||
| 2204 | Ga0436365_1701023 | |||
| 2205 | Ga0436360_0004969 | |||
| 2206 | Ga0436360_0167135 | |||
| 2207 | Ga0436361_0889648 | |||
| 2208 | Ga0436361_0986695 | |||
| 2209 | Ga0436361_1183143 | |||
| 2210 | Ga0436363_0535034 | |||
| 2211 | Ga0436362_0367554 | |||
| 2212 | Ga0436362_0381093 | |||
| 2213 | Ga0436362_0550311 | |||
| 2214 | Ga0451793_0823115 | |||
| 2215 | Ga0466966_0834581 | |||
| 2216 | Ga0466963_0399849 | |||
| 2217 | Ga0466971_0121780 | |||
| 2218 | Ga0466957_0225911 | |||
| 2219 | Ga0466957_0264244 | |||
| 2220 | Ga0466957_0268110 | |||
| 2221 | Ga0466957_1165514 | |||
| 2222 | Ga0466959_0411348 | |||
| 2223 | Ga0466958_0094962 | |||
| 2224 | Ga0466958_0331628 | |||
| 2225 | Ga0466958_0632706 | |||
| 2226 | Ga0466967_0211963 | |||
| 2227 | Ga0466967_1646740 | |||
| 2228 | Ga0495617_058596 | |||
| 2229 | Ga0495592_0004699 | |||
| 2230 | Ga0495592_0014796 | |||
| 2231 | Ga0495592_0041714 | |||
| 2232 | Ga0495592_0347945 | |||
| 2233 | Ga0495603_0025855 | |||
| 2234 | Ga0495603_0033915 | |||
| 2235 | Ga0495603_0221869 | |||
| 2236 | Ga0495590_0348954 | |||
| 2237 | Ga0495629_0003044 | |||
| 2238 | Ga0495629_0177976 | |||
| 2239 | Ga0495638_0006650 | |||
| 2240 | Ga0495638_0046393 | |||
| 2241 | Ga0495641_0016811 | |||
| 2242 | Ga0495641_0039453 | |||
| 2243 | Ga0495651_0002035 | |||
| 2244 | Ga0495651_0010719 | |||
| 2245 | Ga0495651_0279307 | |||
| 2246 | Ga0495653_0065475 | |||
| 2247 | Ga0495653_0089810 | |||
| 2248 | Ga0495580_0222311 | |||
| 2249 | Ga0495580_0375312 | |||
| 2250 | Ga0495580_0429890 | |||
| 2251 | Ga0495582_0003239 | |||
| 2252 | Ga0495582_0103214 | |||
| 2253 | Ga0495605_0097627 | |||
| 2254 | Ga0495662_0018960 | |||
| 2255 | Ga0495662_0349252 | |||
| 2256 | Ga0495664_0030072 | |||
| 2257 | Ga0495584_0142625 | |||
| 2258 | Ga0495584_0198472 | |||
| 2259 | Ga0495584_0219334 | |||
| 2260 | Ga0495585_0000856 | |||
| 2261 | Ga0495585_0028456 | |||
| 2262 | Ga0495594_0231035 | |||
| 2263 | Ga0495608_0000915 | |||
| 2264 | Ga0495616_0000405 | |||
| 2265 | Ga0495616_0254436 | |||
| 2266 | Ga0495618_0009502 | |||
| 2267 | Ga0495618_0544478 | |||
| 2268 | Ga0495620_0278241 | |||
| 2269 | Ga0495628_0008958 | |||
| 2270 | Ga0495628_0083828 | |||
| 2271 | Ga0495630_0009867 | |||
| 2272 | Ga0495630_0430163 | |||
| 2273 | Ga0495632_0071653 | |||
| 2274 | Ga0495637_0070180 | |||
| 2275 | Ga0495643_0229787 | |||
| 2276 | Ga0495644_0033593 | |||
| 2277 | Ga0495663_0402127 | |||
| 2278 | Ga0495666_0028495 | |||
| 2279 | Ga0495666_0120708 | |||
| 2280 | Ga0495666_0467390 | |||
| 2281 | Ga0495642_0227908 | |||
| 2282 | Ga0495652_0005789 | |||
| 2283 | Ga0495652_0053448 | |||
| 2284 | Ga0495652_0150117 | |||
| 2285 | Ga0495652_0192140 | |||
| 2286 | Ga0495652_0356333 | |||
| 2287 | Ga0495665_0019335 | |||
| 2288 | Ga0495665_0113061 | |||
| 2289 | Ga0495665_0132447 | |||
| 2290 | Ga0495665_0153177 | |||
| 2291 | Ga0495640_0071044 | |||
| 2292 | Ga0495640_0256964 | |||
| 2293 | Ga0495640_0270213 | |||
| 2294 | Ga0495640_0296216 | |||
| 2295 | Ga0495640_0432324 | |||
| 2296 | Ga0495640_0787677 | |||
| 2297 | Ga0495586_0085835 | |||
| 2298 | Ga0495586_0404665 | |||
| 2299 | Ga0495587_0001734 | |||
| 2300 | Ga0495598_0010894 | |||
| 2301 | Ga0495609_0416845 | |||
| 2302 | Ga0495621_0074061 | |||
| 2303 | Ga0495645_0011672 | |||
| 2304 | Ga0495645_0086453 | |||
| 2305 | Ga0495622_0018384 | |||
| 2306 | Ga0495633_0017034 | |||
| 2307 | Ga0495667_0000259 | |||
| 2308 | Ga0495667_0014619 | |||
| 2309 | Ga0495656_0000215 | |||
| 2310 | Ga0495656_0217611 | |||
| 2311 | Ga0495668_0106370 | |||
| 2312 | Ga0495668_0225302 | |||
| 2313 | Ga0495634_0008814 | |||
| 2314 | Ga0495634_0451287 | |||
| 2315 | Ga0495611_0010807 | |||
| 2316 | Ga0495635_0010301 | |||
| 2317 | Ga0495635_0028478 | |||
| 2318 | Ga0495635_0460497 | |||
| 2319 | Ga0495659_0002574 | |||
| 2320 | Ga0495659_0346154 | |||
| 2321 | Ga0495661_0364002 | |||
| 2322 | Ga0495657_0003179 | |||
| 2323 | Ga0495657_0125454 | |||
| 2324 | Ga0495599_0002681 | |||
| 2325 | Ga0495646_0010194 | |||
| 2326 | Ga0495646_0026632 | |||
| 2327 | Ga0495647_0003634 | |||
| 2328 | Ga0495647_0072747 | |||
| 2329 | Ga0495647_0178586 | |||
| 2330 | Ga0495658_0000360 | |||
| 2331 | Ga0495658_0005781 | |||
| 2332 | Ga0495658_0114114 | |||
| 2333 | Ga0495669_0167915 | |||
| 2334 | Ga0495613_0006693 | |||
| 2335 | Ga0495613_0027827 | |||
| 2336 | Ga0495613_0033307 | |||
| 2337 | Ga0495613_0447219 | |||
| 2338 | Ga0495624_0026537 | |||
| 2339 | Ga0495624_0041895 | |||
| 2340 | Ga0495624_0083331 | |||
| 2341 | Ga0495624_0211509 | |||
| 2342 | Ga0495670_0000213 | |||
| 2343 | Ga0495671_0081284 | |||
| 2344 | Ga0495671_0095482 | |||
| 2345 | Ga0495671_0095485 | |||
| 2346 | Ga0495600_0006046 | |||
| 2347 | Ga0495600_0034222 | |||
| 2348 | Ga0495581_0057033 | |||
| 2349 | Ga0495581_0059837 | |||
| 2350 | Ga0495581_0064661 | |||
| 2351 | Ga0495581_0249409 | |||
| 2352 | Ga0495604_0006070 | |||
| 2353 | Ga0495604_0009049 | |||
| 2354 | Ga0495604_0209491 | |||
| 2355 | Ga0495604_0465148 | |||
| 2356 | Ga0495636_0108984 | |||
| 2357 | Ga0495674_0092171 | |||
| 2358 | Ga0495674_0110713 | |||
| 2359 | Ga0495674_0138581 | |||
| 2360 | Ga0495674_0176434 | |||
| 2361 | Ga0495672_0280589 | |||
| 2362 | Ga0495676_0067235 | |||
| 2363 | Ga0495676_0098466 | |||
| 2364 | Ga0495676_0103110 | |||
| 2365 | Ga0495680_0002446 | |||
| 2366 | Ga0495680_0004222 | |||
| 2367 | Ga0495680_0012206 | |||
| 2368 | Ga0495680_0092425 | |||
| 2369 | Ga0495680_0320898 | |||
| 2370 | Ga0495675_0000147 | |||
| 2371 | Ga0495675_0066110 | |||
| 2372 | Ga0495675_0301904 | |||
| 2373 | Ga0495677_0115500 | |||
| 2374 | Ga0495679_020691 | |||
| 2375 | Ga0495681_0027851 | |||
| 2376 | Ga0495684_0028528 | |||
| 2377 | Ga0495684_0047645 | |||
| 2378 | Ga0495684_0066900 | |||
| 2379 | Ga0495684_0127008 | |||
| 2380 | Ga0495684_0336106 | |||
| 2381 | Ga0495593_0014970 | |||
| 2382 | Ga0495593_0110428 | |||
| 2383 | Ga0495602_0017376 | |||
| 2384 | Ga0495602_0095091 | |||
| 2385 | Ga0495602_0302117 | |||
| 2386 | Ga0495602_0809023 | |||
| 2387 | Ga0495614_0016270 | |||
| 2388 | Ga0495615_0285013 | |||
| 2389 | Ga0496100_0014640 | |||
| 2390 | Ga0496100_0019150 | |||
| 2391 | Ga0496100_0055392 | |||
| 2392 | Ga0496100_0670068 | |||
| 2393 | Ga0496101_0005701 | |||
| 2394 | Ga0496101_0030810 | |||
| 2395 | Ga0496101_0038396 | |||
| 2396 | Ga0496101_0040176 | |||
| 2397 | Ga0496101_0118220 | |||
| 2398 | Ga0496101_0347426 | |||
| 2399 | Ga0496101_0718694 | |||
| 2400 | Ga0496102_0005090 | |||
| 2401 | Ga0496102_0008860 | |||
| 2402 | Ga0496102_0058807 | |||
| 2403 | Ga0496102_0062689 | |||
| 2404 | Ga0496102_0313371 | |||
| 2405 | Ga0496102_0476294 | |||
| 2406 | Ga0496102_0563766 | |||
| 2407 | Ga0496103_0003997 | |||
| 2408 | Ga0496103_0049774 | |||
| 2409 | Ga0496103_0077497 | |||
| 2410 | Ga0496103_0089875 | |||
| 2411 | Ga0496103_0223957 | |||
| 2412 | Ga0496104_0000431 | |||
| 2413 | Ga0496104_0004143 | |||
| 2414 | Ga0496104_0026643 | |||
| 2415 | Ga0496104_0119489 | |||
| 2416 | Ga0496104_0151649 | |||
| 2417 | Ga0496104_0319108 | |||
| 2418 | Ga0496104_0347710 | |||
| 2419 | Ga0496104_0372043 | |||
| 2420 | Ga0496104_1730800 | |||
| 2421 | Ga0496105_0003143 | |||
| 2422 | Ga0496105_0011647 | |||
| 2423 | Ga0496105_0030941 | |||
| 2424 | Ga0496105_0035148 | |||
| 2425 | Ga0496105_0052050 | |||
| 2426 | Ga0496105_0092739 | |||
| 2427 | Ga0496105_0341832 | |||
| 2428 | Ga0496105_0403622 | |||
| 2429 | Ga0496105_0539243 | |||
| 2430 | Ga0496105_0765951 | |||
| 2431 | Ga0496106_0006510 | |||
| 2432 | Ga0496106_0006633 | |||
| 2433 | Ga0496106_0025322 | |||
| 2434 | Ga0496106_0028566 | |||
| 2435 | Ga0496107_0015236 | |||
| 2436 | Ga0496107_0016151 | |||
| 2437 | Ga0496107_0031502 | |||
| 2438 | Ga0496107_0034286 | |||
| 2439 | Ga0496107_0286681 | |||
| 2440 | Ga0496107_0509417 | |||
| 2441 | Ga0496107_0875251 | |||
| 2442 | Ga0496108_0004006 | |||
| 2443 | Ga0496108_0029590 | |||
| 2444 | Ga0496108_0049594 | |||
| 2445 | Ga0496108_0188822 | |||
| 2446 | Ga0496108_0496022 | |||
| 2447 | Ga0496109_0000404 | |||
| 2448 | Ga0496109_0032437 | |||
| 2449 | Ga0496109_0062763 | |||
| 2450 | Ga0496109_0111595 | |||
| 2451 | Ga0496109_0160862 | |||
| 2452 | Ga0496109_0276439 | |||
| 2453 | Ga0496109_0582501 | |||
| 2454 | Ga0496110_0001910 | |||
| 2455 | Ga0496110_0035366 | |||
| 2456 | Ga0496110_0144583 | |||
| 2457 | Ga0496110_0153551 | |||
| 2458 | Ga0496110_0156603 | |||
| 2459 | Ga0496110_0179451 | |||
| 2460 | Ga0496110_0756182 | |||
| 2461 | Ga0496111_0002312 | |||
| 2462 | Ga0496111_0021244 | |||
| 2463 | Ga0496111_0052032 | |||
| 2464 | Ga0496111_0101642 | |||
| 2465 | Ga0496111_0230705 | |||
| 2466 | Ga0496112_0002963 | |||
| 2467 | Ga0496112_0033447 | |||
| 2468 | Ga0496112_0038890 | |||
| 2469 | Ga0496112_0163683 | |||
| 2470 | Ga0496112_0191834 | |||
| 2471 | Ga0496112_0214013 | |||
| 2472 | Ga0496112_0227988 | |||
| 2473 | Ga0496112_0344731 | |||
| 2474 | Ga0496112_0375277 | |||
| 2475 | Ga0496112_0509676 | |||
| 2476 | Ga0496113_0001735 | |||
| 2477 | Ga0496113_0023714 | |||
| 2478 | Ga0496113_0038693 | |||
| 2479 | Ga0496113_0055173 | |||
| 2480 | Ga0496114_0007969 | |||
| 2481 | Ga0496114_0011998 | |||
| 2482 | Ga0496114_0026647 | |||
| 2483 | Ga0496114_0193555 | |||
| 2484 | Ga0496115_0005562 | |||
| 2485 | Ga0496115_0030415 | |||
| 2486 | Ga0496115_0090149 | |||
| 2487 | Ga0496115_0126837 | |||
| 2488 | Ga0496115_0127301 | |||
| 2489 | Ga0496115_0549087 | |||
| 2490 | Ga0496119_0361203 | |||
| 2491 | Ga0496126_0227298 | |||
| 2492 | Ga0501032_0055099 | |||
| 2493 | Ga0501032_0210740 | |||
| 2494 | Ga0501032_0230049 | |||
| 2495 | Ga0501032_0310667 | |||
| 2496 | Ga0501033_0056452 | |||
| 2497 | Ga0501033_0076983 | |||
| 2498 | Ga0501033_0213753 | |||
| 2499 | Ga0501034_0000089 | |||
| 2500 | Ga0501034_0001928 | |||
| 2501 | Ga0501034_0013803 | |||
| 2502 | Ga0501034_0062587 | |||
| 2503 | Ga0501034_0079663 | |||
| 2504 | Ga0501034_0094307 | |||
| 2505 | Ga0501034_0115064 | |||
| 2506 | Ga0501034_0155648 | |||
| 2507 | Ga0501034_0204376 | |||
| 2508 | Ga0501034_0383137 | |||
| 2509 | Ga0501034_1105629 | |||
| 2510 | Ga0501034_1342534 | |||
| 2511 | Ga0501036_0000939 | |||
| 2512 | Ga0501036_0027820 | |||
| 2513 | Ga0501036_0065300 | |||
| 2514 | Ga0501036_0596290 | |||
| 2515 | Ga0501036_0803273 | |||
| 2516 | Ga0501037_0006892 | |||
| 2517 | Ga0501037_0007211 | |||
| 2518 | Ga0501037_0032070 | |||
| 2519 | Ga0501037_0070788 | |||
| 2520 | Ga0501037_0130420 | |||
| 2521 | Ga0501037_0366637 | |||
| 2522 | Ga0501038_0011084 | |||
| 2523 | Ga0501038_0020694 | |||
| 2524 | Ga0501038_0093602 | |||
| 2525 | Ga0501038_0163069 | |||
| 2526 | Ga0501038_0180645 | |||
| 2527 | Ga0501038_0186334 | |||
| 2528 | Ga0501038_0256703 | |||
| 2529 | Ga0501038_1056961 | |||
| 2530 | Ga0501039_0114908 | |||
| 2531 | Ga0501039_0369568 | |||
| 2532 | Ga0501040_0371016 | |||
| 2533 | Ga0501041_0458884 | |||
| 2534 | Ga0501042_0350317 | |||
| 2535 | Ga0501043_0001206 | |||
| 2536 | Ga0501043_0017209 | |||
| 2537 | Ga0501043_0046402 | |||
| 2538 | Ga0501043_0126750 | |||
| 2539 | Ga0501043_0127784 | |||
| 2540 | Ga0501043_0363361 | |||
| 2541 | Ga0501043_0439054 | |||
| 2542 | Ga0501046_0045583 | |||
| 2543 | Ga0501046_0055684 | |||
| 2544 | Ga0501046_0107057 | |||
| 2545 | Ga0501046_0297421 | |||
| 2546 | Ga0501046_0762529 | |||
| 2547 | Ga0501047_0000108 | |||
| 2548 | Ga0501047_0019198 | |||
| 2549 | Ga0501047_0025537 | |||
| 2550 | Ga0501047_0026716 | |||
| 2551 | Ga0501047_0071230 | |||
| 2552 | Ga0501047_0649495 | |||
| 2553 | Ga0501047_1036189 | |||
| 2554 | Ga0501048_0000493 | |||
| 2555 | Ga0501048_0318236 | |||
| 2556 | Ga0501048_0883248 | |||
| 2557 | Ga0501048_0983869 | |||
| 2558 | Ga0501067_0073670 | |||
| 2559 | Ga0501067_0093786 | |||
| 2560 | Ga0501067_0094020 | |||
| 2561 | Ga0501068_0015903 | |||
| 2562 | Ga0501068_0020518 | |||
| 2563 | Ga0501068_0034351 | |||
| 2564 | Ga0501068_0037280 | |||
| 2565 | Ga0501068_0216501 | |||
| 2566 | Ga0501068_0327063 | |||
| 2567 | Ga0501068_0464142 | |||
| 2568 | Ga0501069_0015562 | |||
| 2569 | Ga0501069_0045707 | |||
| 2570 | Ga0501069_0050681 | |||
| 2571 | Ga0501069_0067526 | |||
| 2572 | Ga0501069_0535158 | |||
| 2573 | Ga0501070_0011892 | |||
| 2574 | Ga0501070_0014072 | |||
| 2575 | Ga0501070_0035357 | |||
| 2576 | Ga0501070_0040072 | |||
| 2577 | Ga0501070_0084044 | |||
| 2578 | Ga0501070_0098991 | |||
| 2579 | Ga0501070_0205471 | |||
| 2580 | Ga0501070_0317514 | |||
| 2581 | Ga0501070_0568244 | |||
| 2582 | Ga0501071_0095836 | |||
| 2583 | Ga0501071_0188658 | |||
| 2584 | Ga0501071_0263613 | |||
| 2585 | Ga0501071_0306405 | |||
| 2586 | Ga0501071_0504879 | |||
| 2587 | Ga0501072_0231686 | |||
| 2588 | Ga0501072_0309354 | |||
| 2589 | Ga0501072_0439428 | |||
| 2590 | Ga0501072_0458229 | |||
| 2591 | Ga0501073_0023624 | |||
| 2592 | Ga0501073_0032267 | |||
| 2593 | Ga0501073_0033637 | |||
| 2594 | Ga0501073_0082743 | |||
| 2595 | Ga0501073_0095315 | |||
| 2596 | Ga0501073_0124288 | |||
| 2597 | Ga0501073_0133256 | |||
| 2598 | Ga0501074_0001683 | |||
| 2599 | Ga0501074_0060299 | |||
| 2600 | Ga0501074_0137681 | |||
| 2601 | Ga0501074_0219011 | |||
| 2602 | Ga0501074_0666259 | |||
| 2603 | Ga0501075_0657896 | |||
| 2604 | Ga0501076_0158078 | |||
| 2605 | Ga0501079_0082316 | |||
| 2606 | Ga0501079_0091325 | |||
| 2607 | Ga0501079_0267791 | |||
| 2608 | Ga0501079_0409050 | |||
| 2609 | Ga0501079_0821377 | |||
| 2610 | Ga0501079_0847288 | |||
| 2611 | Ga0501080_0001065 | |||
| 2612 | Ga0501080_0026663 | |||
| 2613 | Ga0501080_0187422 | |||
| 2614 | Ga0501080_0638796 | |||
| 2615 | Ga0501081_0050631 | |||
| 2616 | Ga0501083_0006385 | |||
| 2617 | Ga0501083_0019929 | |||
| 2618 | Ga0501083_0030750 | |||
| 2619 | Ga0501083_0175332 | |||
| 2620 | Ga0501083_0435178 | |||
| 2621 | Ga0501083_0537039 | |||
| 2622 | Ga0501035_0001940 | |||
| 2623 | Ga0501035_0011937 | |||
| 2624 | Ga0501035_0114912 | |||
| 2625 | Ga0501035_0194431 | |||
| 2626 | Ga0501035_0740284 | |||
| 2627 | Ga0501035_0750151 | |||
| 2628 | Ga0501035_0890801 | |||
| 2629 | Ga0501044_0000457 | |||
| 2630 | Ga0501044_0000998 | |||
| 2631 | Ga0501044_0063861 | |||
| 2632 | Ga0501044_0065493 | |||
| 2633 | Ga0501044_0067570 | |||
| 2634 | Ga0501044_0078229 | |||
| 2635 | Ga0501044_0154782 | |||
| 2636 | Ga0501044_0221125 | |||
| 2637 | Ga0501044_0265525 | |||
| 2638 | Ga0501044_0680119 | |||
| 2639 | Ga0501044_0690114 | |||
| 2640 | Ga0501044_0876869 | |||
| 2641 | Ga0501044_1009884 | |||
| 2642 | Ga0501045_0309138 | |||
| 2643 | nmdc:mga03683_424032_c1 | |||
| 2644 | nmdc:mga03683_51330_c1 | |||
| 2645 | nmdc:mga03683_76607_c1 | |||
| 2646 | nmdc:mga03n38_141272_c1 | |||
| 2647 | nmdc:mga03n38_225140_c1 | |||
| 2648 | nmdc:mga03n38_36768_c1 | |||
| 2649 | nmdc:mga00v17_16761_c1 | |||
| 2650 | nmdc:mga00v17_17630_c1 | |||
| 2651 | nmdc:mga00v17_221874_c1 | |||
| 2652 | nmdc:mga00v17_23425_c1 | |||
| 2653 | nmdc:mga00v17_250682_c1 | |||
| 2654 | nmdc:mga00v17_304384_c1 | |||
| 2655 | nmdc:mga0yw44_104888_c1 | |||
| 2656 | nmdc:mga0yw44_1096250_c1 | |||
| 2657 | nmdc:mga0yw44_264534_c1 | |||
| 2658 | nmdc:mga0yw44_458855_c1 | |||
| 2659 | nmdc:mga0yw44_699616_c1 | |||
| 2660 | nmdc:mga0yw44_764880_c1 | |||
| 2661 | nmdc:mga0yw44_8452_c1 | |||
| 2662 | nmdc:mga0k408_2858_c1 | |||
| 2663 | nmdc:mga06z11_140328_c1 | |||
| 2664 | nmdc:mga06z11_163592_c1 | |||
| 2665 | nmdc:mga06z11_211578_c1 | |||
| 2666 | nmdc:mga06z11_231076_c1 | |||
| 2667 | nmdc:mga06z11_243294_c1 | |||
| 2668 | nmdc:mga06z11_24562_c1 | |||
| 2669 | nmdc:mga06z11_275809_c1 | |||
| 2670 | nmdc:mga06z11_2837_c1 | |||
| 2671 | nmdc:mga06z11_353853_c1 | |||
| 2672 | nmdc:mga06z11_626523_c1 | |||
| 2673 | nmdc:mga04h51_14443_c1 | |||
| 2674 | nmdc:mga04h51_226413_c1 | |||
| 2675 | nmdc:mga04h51_26351_c1 | |||
| 2676 | nmdc:mga04h51_29121_c1 | |||
| 2677 | nmdc:mga04h51_338720_c1 | |||
| 2678 | nmdc:mga04h51_50945_c1 | |||
| 2679 | nmdc:mga07m45_146238_c1 | |||
| 2680 | nmdc:mga07m45_208873_c1 | |||
| 2681 | nmdc:mga07m45_218408_c1 | |||
| 2682 | nmdc:mga07m45_577798_c1 | |||
| 2683 | nmdc:mga07m45_70189_c1 | |||
| 2684 | nmdc:mga05p37_30731_c1 | |||
| 2685 | nmdc:mga05p37_357158_c1 | |||
| 2686 | nmdc:mga05p37_36596_c1 | |||
| 2687 | nmdc:mga05p37_368829_c1 | |||
| 2688 | nmdc:mga05p37_64392_c1 | |||
| 2689 | nmdc:mga09592_190239_c1 | |||
| 2690 | nmdc:mga0qj67_180918_c1 | |||
| 2691 | nmdc:mga06r32_54186_c1 | |||
| 2692 | nmdc:mga08y16_362536_c1 | |||
| 2693 | nmdc:mga08y16_507552_c1 | |||
| 2694 | nmdc:mga0n895_125540_c1 | |||
| 2695 | nmdc:mga0n895_2911_c1 | |||
| 2696 | nmdc:mga0n895_35380_c1 | |||
| 2697 | nmdc:mga0n895_576084_c1 | |||
| 2698 | nmdc:mga0rr50_187927_c1 | |||
| 2699 | nmdc:mga0rr50_71104_c1 | |||
| 2700 | nmdc:mga08x19_292984_c1 | |||
| 2701 | nmdc:mga08x19_38629_c1 | |||
| 2702 | nmdc:mga0a205_190118_c1 | |||
| 2703 | nmdc:mga0a205_334238_c1 | |||
| 2704 | nmdc:mga0a205_7768_c1 | |||
| 2705 | nmdc:mga0sz30_134193_c1 | |||
| 2706 | nmdc:mga0sz30_2969_c1 | |||
| 2707 | Ga0495601_0001750 | |||
| 2708 | Ga0495601_0002382 | |||
| 2709 | Ga0495601_0006675 | |||
| 2710 | Ga0495601_0081671 | |||
| 2711 | Ga0495601_0101403 | |||
| 2712 | Ga0495612_0008869 | |||
| 2713 | Ga0495612_0027993 | |||
| 2714 | Ga0495612_0052294 | |||
| 2715 | Ga0495612_0117550 | |||
| 2716 | Ga0500610_0228732 | |||
| 2717 | Ga0495655_0236117 | |||
| 2718 | Ga0495595_0000576 | |||
| 2719 | Ga0495595_0007184 | |||
| 2720 | Ga0495595_0032435 | |||
| 2721 | Ga0495595_0092899 | |||
| 2722 | Ga0495595_0203348 | |||
| 2723 | Ga0495595_0550449 | |||
| 2724 | Ga0495619_0000132 | |||
| 2725 | Ga0495619_0000178 | |||
| 2726 | Ga0495619_0003001 | |||
| 2727 | Ga0495619_0037425 | |||
| 2728 | Ga0495619_0068325 | |||
| 2729 | Ga0500643_004941 | |||
| 2730 | Ga0500644_0001366 | |||
| 2731 | Ga0500646_0130426 | |||
| 2732 | Ga0500583_0090895 | |||
| 2733 | Ga0500651_0447757 | |||
| 2734 | Ga0500566_0067107 | |||
| 2735 | Ga0500566_0067583 | |||
| 2736 | Ga0500566_0327303 | |||
| 2737 | Ga0500641_0024406 | |||
| 2738 | Ga0500654_104851 | |||
| 2739 | Ga0500593_002852 | |||
| 2740 | Ga0500594_0278893 | |||
| 2741 | Ga0500595_000001 | |||
| 2742 | Ga0500595_061203 | |||
| 2743 | Ga0500595_068320 | |||
| 2744 | Ga0500597_128940 | |||
| 2745 | Ga0500642_0036021 | |||
| 2746 | Ga0500642_0100336 | |||
| 2747 | Ga0500652_000043 | |||
| 2748 | Ga0500652_019276 | |||
| 2749 | Ga0500577_0066345 | |||
| 2750 | Ga0500577_0236772 | |||
| 2751 | Ga0500616_0000001 | |||
| 2752 | Ga0500616_0018461 | |||
| 2753 | Ga0500622_0032344 | |||
| 2754 | Ga0500622_0275325 | |||
| 2755 | Ga0500627_0126477 | |||
| 2756 | Ga0500636_0022293 | |||
| 2757 | Ga0500636_0228656 | |||
| 2758 | Ga0500611_008670 | |||
| 2759 | Ga0500645_000913 | |||
| 2760 | Ga0500609_001854 | |||
| 2761 | Ga0501084_0977272 | |||
| 2762 | Ga0501084_1049892 | |||
| 2763 | Ga0501084_1329780 | |||
| 2764 | Ga0501084_1399725 | |||
| 2765 | Ga0501082_0018450 | |||
| 2766 | Ga0501082_0230530 | |||
| 2767 | Ga0501082_0244844 | |||
| 2768 | Ga0501082_0392979 | |||
| 2769 | Ga0501082_0569340 | |||
| 2770 | Ga0466962_0154826 | |||
| 2771 | Ga0530510_0215513 | |||
| 2772 | 2643757891 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy