F493554

General Info

Members Datasets Scaffolds Average Seq Length
1386 479 2772 146

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10121186|Ga0068851_101211863
Length 144
Sequence MGLKPGTDGFHPPCHDIAVGRRSVVNAPKPRDIEALCTAKGMRMTEQRRVIARVLAAADDHPDVEELYAGIIERHDFRNGRARYEQIPDSHHDHLINLRTGEVIEFQSEDIERLQAEVARRLGYRLIDHRLELYAVPLDDKPKR

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
127 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
240 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
244 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
254 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
255 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
256 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
275 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
280 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
283 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
293 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
296 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
373 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
379 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
417 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
418 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
419 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
420 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
421 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
422 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
425 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
426 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
429 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
430 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
439 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
444 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
445 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
450 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
451 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
454 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
455 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
456 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
457 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
458 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
461 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
462 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
463 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
464 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
465 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
466 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
467 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
470 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
471 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
472 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
478 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
479 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.43
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0
Rhizoplane 7.36
Rhizosphere 81.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10121186 3300005834 Bacteria 1405
2 JGI24746J21847_1001422 3300001977 Bacteria 3808
3 JGI24743J22301_10000943 3300001991 Bacteria 3751
4 JGI24743J22301_10001063 3300001991 Bacteria 3631
5 JGI24735J21928_10122033 3300002067 Bacteria 750
6 JGI24750J21931_1001324 3300002070 Bacteria 3116
7 JGI24745J21846_1024265 3300002073 Bacteria 719
8 JGI24738J21930_10017677 3300002075 Bacteria 1497
9 JGI24749J21850_1006538 3300002076 Bacteria 1624
10 JGI24744J21845_10001216 3300002077 Bacteria 5049
11 JGI24033J26618_1023504 3300002155 Bacteria 802
12 JGI24742J22300_10012337 3300002244 Bacteria 1424
13 JGI24751J29686_10004135 3300002459 Bacteria 2942
14 JGI25405J52794_10007754 3300003911 Bacteria 1988
15 Ga0058859_11818714 3300004798 Bacteria 666
16 Ga0065715_10767562 3300005293 Bacteria 623
17 Ga0065707_10046659 3300005295 Bacteria 827
18 Ga0065707_10139584 3300005295 Bacteria 1791
19 Ga0065707_10163520 3300005295 Bacteria 1542
20 Ga0070658_10025964 3300005327 Bacteria 4699
21 Ga0070658_10146995 3300005327 Bacteria 1971
22 Ga0070658_10279641 3300005327 Bacteria 1420
23 Ga0070676_10024250 3300005328 Bacteria 3416
24 Ga0070676_10274875 3300005328 Bacteria 1133
25 Ga0070683_100092767 3300005329 Bacteria 2836
26 Ga0070683_100483370 3300005329 Bacteria 1182
27 Ga0070683_101318005 3300005329 Bacteria 694
28 Ga0070690_100002546 3300005330 Bacteria 9809
29 Ga0070690_100777856 3300005330 Bacteria 741
30 Ga0070670_100005236 3300005331 Bacteria 10920
31 Ga0070670_100048292 3300005331 Bacteria 3663
32 Ga0068869_100016497 3300005334 Bacteria 4979
33 Ga0068869_100056415 3300005334 Bacteria 2865
34 Ga0068869_100432580 3300005334 Bacteria 1088
35 Ga0068869_100693738 3300005334 Bacteria 868
36 Ga0070666_10046576 3300005335 Bacteria 2909
37 Ga0070680_100043520 3300005336 Bacteria 3648
38 Ga0070680_100066652 3300005336 Bacteria 2952
39 Ga0070680_100261566 3300005336 Bacteria 1464
40 Ga0070680_100310594 3300005336 Bacteria 1338
41 Ga0070680_100407083 3300005336 Bacteria 1160
42 Ga0070680_100496378 3300005336 Bacteria 1044
43 Ga0070680_100514255 3300005336 Bacteria 1025
44 Ga0070680_100571215 3300005336 Bacteria 970
45 Ga0070682_100034178 3300005337 Bacteria 3094
46 Ga0070682_100126832 3300005337 Bacteria 1721
47 Ga0070682_100720667 3300005337 Bacteria 802
48 Ga0068868_100003086 3300005338 Bacteria 11592
49 Ga0068868_100020299 3300005338 Bacteria 4988
50 Ga0068868_100087352 3300005338 Bacteria 2507
51 Ga0068868_100526545 3300005338 Bacteria 1038
52 Ga0070660_100010850 3300005339 Bacteria 6450
53 Ga0070660_100409712 3300005339 Bacteria 1122
54 Ga0070689_100003434 3300005340 Bacteria 10545
55 Ga0070689_100029697 3300005340 Bacteria 4141
56 Ga0070689_100215663 3300005340 Bacteria 1573
57 Ga0070687_100034735 3300005343 Bacteria 2498
58 Ga0070687_100043598 3300005343 Bacteria 2281
59 Ga0070661_100047641 3300005344 Bacteria 3137
60 Ga0070661_100047671 3300005344 Bacteria 3136
61 Ga0070661_100256635 3300005344 Bacteria 1350
62 Ga0070692_10008804 3300005345 Bacteria 4517
63 Ga0070669_100127010 3300005353 Bacteria 1952
64 Ga0070669_100492346 3300005353 Bacteria 1016
65 Ga0070669_101065855 3300005353 Bacteria 695
66 Ga0070675_100039707 3300005354 Bacteria 3841
67 Ga0070675_100375302 3300005354 Bacteria 1265
68 Ga0070675_100468279 3300005354 Bacteria 1132
69 Ga0070675_100915966 3300005354 Bacteria 804
70 Ga0070671_100066484 3300005355 Bacteria 3004
71 Ga0070671_100091145 3300005355 Bacteria 2552
72 Ga0070671_100279237 3300005355 Bacteria 1420
73 Ga0070674_100050261 3300005356 Bacteria 2870
74 Ga0070674_100176129 3300005356 Bacteria 1634
75 Ga0070674_100917551 3300005356 Bacteria 764
76 Ga0070673_100061221 3300005364 Bacteria 2986
77 Ga0070673_100189697 3300005364 Bacteria 1765
78 Ga0070673_100588719 3300005364 Bacteria 1014
79 Ga0070688_100005196 3300005365 Bacteria 6837
80 Ga0070688_100050977 3300005365 Bacteria 2580
81 Ga0070688_100414492 3300005365 Bacteria 1000
82 Ga0070659_100032102 3300005366 Bacteria 4070
83 Ga0070659_100042897 3300005366 Bacteria 3537
84 Ga0070659_100083017 3300005366 Bacteria 2560
85 Ga0070659_100559234 3300005366 Bacteria 980
86 Ga0070659_100678522 3300005366 Bacteria 890
87 Ga0070667_100099728 3300005367 Bacteria 2507
88 Ga0070709_10283637 3300005434 Bacteria 1204
89 Ga0070709_10586636 3300005434 Bacteria 857
90 Ga0070709_10771220 3300005434 Bacteria 753
91 Ga0070714_100035153 3300005435 Bacteria 4198
92 Ga0070714_100066297 3300005435 Bacteria 3111
93 Ga0070714_100310702 3300005435 Bacteria 1472
94 Ga0070713_100010421 3300005436 Bacteria 6712
95 Ga0070713_100021777 3300005436 Bacteria 4940
96 Ga0070713_100162501 3300005436 Bacteria 1994
97 Ga0070710_10014806 3300005437 Bacteria 3931
98 Ga0070710_10035879 3300005437 Bacteria 2707
99 Ga0070710_10081214 3300005437 Bacteria 1893
100 Ga0070710_10263827 3300005437 Bacteria 1111
101 Ga0070701_10001300 3300005438 Bacteria 9184
102 Ga0070701_10140015 3300005438 Bacteria 1383
103 Ga0070711_100084187 3300005439 Bacteria 2274
104 Ga0070711_100247468 3300005439 Bacteria 1397
105 Ga0070711_100414205 3300005439 Bacteria 1096
106 Ga0070711_100433901 3300005439 Bacteria 1073
107 Ga0070711_100572298 3300005439 Bacteria 939
108 Ga0070705_100149675 3300005440 Bacteria 1547
109 Ga0070700_100011750 3300005441 Bacteria 4860
110 Ga0070700_100220337 3300005441 Bacteria 1344
111 Ga0070708_100273033 3300005445 Bacteria 1590
112 Ga0070708_100651795 3300005445 Bacteria 992
113 Ga0070663_100028875 3300005455 Bacteria 3782
114 Ga0070663_100293346 3300005455 Bacteria 1299
115 Ga0070663_101557402 3300005455 Bacteria 588
116 Ga0070678_100048644 3300005456 Bacteria 3055
117 Ga0070678_100055189 3300005456 Bacteria 2899
118 Ga0070678_100200529 3300005456 Bacteria 1646
119 Ga0070678_100205458 3300005456 Bacteria 1628
120 Ga0070678_100315879 3300005456 Bacteria 1333
121 Ga0070662_100034665 3300005457 Bacteria 3560
122 Ga0070662_100103951 3300005457 Bacteria 2154
123 Ga0070662_100232464 3300005457 Bacteria 1475
124 Ga0070662_100581643 3300005457 Bacteria 941
125 Ga0070662_100637882 3300005457 Bacteria 898
126 Ga0070681_10016513 3300005458 Bacteria 7372
127 Ga0070681_10396383 3300005458 Bacteria 1291
128 Ga0070681_10503935 3300005458 Bacteria 1124
129 Ga0068867_100031738 3300005459 Bacteria 3816
130 Ga0068867_100381106 3300005459 Bacteria 1184
131 Ga0068867_100979031 3300005459 Bacteria 766
132 Ga0068867_101065547 3300005459 Bacteria 736
133 Ga0070685_10011992 3300005466 Bacteria 4544
134 Ga0070685_10233939 3300005466 Bacteria 1210
135 Ga0070679_100033661 3300005530 Bacteria 5074
136 Ga0070679_100063548 3300005530 Bacteria 3679
137 Ga0070679_100182104 3300005530 Bacteria 2073
138 Ga0070679_100190909 3300005530 Bacteria 2018
139 Ga0070679_100198143 3300005530 Bacteria 1975
140 Ga0070679_100222283 3300005530 Bacteria 1849
141 Ga0070684_100076754 3300005535 Bacteria 2950
142 Ga0070684_100163107 3300005535 Bacteria 2022
143 Ga0070684_100174253 3300005535 Bacteria 1954
144 Ga0070697_100071761 3300005536 Bacteria 2841
145 Ga0070697_101135207 3300005536 Bacteria 696
146 Ga0068853_100232868 3300005539 Bacteria 1685
147 Ga0068853_100239340 3300005539 Bacteria 1663
148 Ga0068853_100395245 3300005539 Bacteria 1293
149 Ga0068853_100630884 3300005539 Bacteria 1019
150 Ga0070672_100215685 3300005543 Bacteria 1608
151 Ga0070672_100357537 3300005543 Bacteria 1246
152 Ga0070686_100009403 3300005544 Bacteria 5495
153 Ga0070686_100036878 3300005544 Bacteria 3030
154 Ga0070686_100059554 3300005544 Bacteria 2460
155 Ga0070686_100313887 3300005544 Bacteria 1167
156 Ga0070695_100033983 3300005545 Bacteria 3193
157 Ga0070695_100441454 3300005545 Bacteria 995
158 Ga0070693_100082579 3300005547 Bacteria 1919
159 Ga0070693_100142215 3300005547 Bacteria 1511
160 Ga0070665_100043641 3300005548 Bacteria 4505
161 Ga0070704_100002201 3300005549 Bacteria 10864
162 Ga0070704_100058274 3300005549 Bacteria 2750
163 Ga0068855_100033639 3300005563 Bacteria 6116
164 Ga0068855_100095264 3300005563 Bacteria 3431
165 Ga0068855_100384545 3300005563 Bacteria 1540
166 Ga0068855_100912698 3300005563 Bacteria 927
167 Ga0068855_100988370 3300005563 Bacteria 885
168 Ga0070664_100130899 3300005564 Bacteria 2204
169 Ga0070664_100539966 3300005564 Bacteria 1077
170 Ga0068857_100079852 3300005577 Bacteria 2920
171 Ga0068857_100519577 3300005577 Bacteria 1119
172 Ga0068856_100251766 3300005614 Bacteria 1781
173 Ga0068856_100354130 3300005614 Bacteria 1487
174 Ga0068856_101145474 3300005614 Bacteria 795
175 Ga0068856_101411532 3300005614 Bacteria 711
176 Ga0070702_100002073 3300005615 Bacteria 8492
177 Ga0070702_100064308 3300005615 Bacteria 2146
178 Ga0070702_100112578 3300005615 Bacteria 1690
179 Ga0070702_100180227 3300005615 Bacteria 1382
180 Ga0068852_100017739 3300005616 Bacteria 5592
181 Ga0068852_100032297 3300005616 Bacteria 4333
182 Ga0068852_100055851 3300005616 Bacteria 3410
183 Ga0068852_100109132 3300005616 Bacteria 2512
184 Ga0068852_101076701 3300005616 Bacteria 824
185 Ga0068859_100014564 3300005617 Bacteria 7899
186 Ga0068859_100228480 3300005617 Bacteria 1949
187 Ga0068864_100005707 3300005618 Bacteria 10206
188 Ga0068864_100146517 3300005618 Bacteria 2135
189 Ga0068864_100180677 3300005618 Bacteria 1929
190 Ga0068864_100196550 3300005618 Bacteria 1851
191 Ga0068864_100241964 3300005618 Bacteria 1672
192 Ga0068864_101324956 3300005618 Bacteria 721
193 Ga0068866_10101073 3300005718 Bacteria 1591
194 Ga0068866_10254189 3300005718 Bacteria 1077
195 Ga0068866_10333805 3300005718 Bacteria 958
196 Ga0068861_100005727 3300005719 Bacteria 8423
197 Ga0068861_100674542 3300005719 Bacteria 958
198 Ga0068870_10002924 3300005840 Bacteria 7197
199 Ga0068863_100047412 3300005841 Bacteria 4075
200 Ga0068863_100424857 3300005841 Bacteria 1302
201 Ga0068863_100475979 3300005841 Bacteria 1227
202 Ga0068863_101108543 3300005841 Bacteria 796
203 Ga0068863_101124962 3300005841 Bacteria 790
204 Ga0068858_100014295 3300005842 Bacteria 7485
205 Ga0068858_100120659 3300005842 Bacteria 2451
206 Ga0068858_100264879 3300005842 Bacteria 1634
207 Ga0068860_100059288 3300005843 Bacteria 3639
208 Ga0068860_100420949 3300005843 Bacteria 1324
209 Ga0068860_100453279 3300005843 Bacteria 1276
210 Ga0068860_101013167 3300005843 Bacteria 849
211 Ga0068862_100003247 3300005844 Bacteria 14065
212 Ga0068862_100098160 3300005844 Bacteria 2558
213 Ga0068862_100801179 3300005844 Bacteria 920
214 Ga0081455_10007598 3300005937 Bacteria 11395
215 Ga0081455_10011036 3300005937 Bacteria 9099
216 Ga0081455_10011972 3300005937 Bacteria 8683
217 Ga0081455_10145108 3300005937 Bacteria 1837
218 Ga0081538_10066339 3300005981 Bacteria 2024
219 Ga0081538_10095102 3300005981 Bacteria 1523
220 Ga0081540_1010582 3300005983 Bacteria 6231
221 Ga0081540_1054952 3300005983 Bacteria 1942
222 Ga0081540_1060030 3300005983 Bacteria 1822
223 Ga0081539_10001661 3300005985 Bacteria 36064
224 Ga0070717_10004108 3300006028 Bacteria 10499
225 Ga0070717_10029876 3300006028 Bacteria 4378
226 Ga0070717_10159237 3300006028 Bacteria 1958
227 Ga0070717_10226271 3300006028 Bacteria 1646
228 Ga0075365_10014447 3300006038 Bacteria 4752
229 Ga0075365_10020051 3300006038 Bacteria 4138
230 Ga0075365_10037653 3300006038 Bacteria 3141
231 Ga0075365_10121452 3300006038 Bacteria 1802
232 Ga0075365_10237213 3300006038 Bacteria 1281
233 Ga0075365_10452463 3300006038 Bacteria 907
234 Ga0075368_10020274 3300006042 Bacteria 2516
235 Ga0075368_10192590 3300006042 Bacteria 861
236 Ga0075368_10276328 3300006042 Bacteria 721
237 Ga0075368_10419524 3300006042 Bacteria 590
238 Ga0075363_100026782 3300006048 Bacteria 2951
239 Ga0075363_100061239 3300006048 Bacteria 2028
240 Ga0075363_100067201 3300006048 Bacteria 1942
241 Ga0075363_100135950 3300006048 Bacteria 1381
242 Ga0075363_100212868 3300006048 Bacteria 1106
243 Ga0075363_100231472 3300006048 Bacteria 1061
244 Ga0075363_100357059 3300006048 Bacteria 854
245 Ga0075363_100371148 3300006048 Bacteria 838
246 Ga0075364_10018301 3300006051 Bacteria 4383
247 Ga0075364_10038276 3300006051 Bacteria 3107
248 Ga0075364_10377523 3300006051 Bacteria 967
249 Ga0075364_10397650 3300006051 Bacteria 940
250 Ga0075364_10669778 3300006051 Bacteria 708
251 Ga0075432_10264905 3300006058 Bacteria 702
252 Ga0070715_10000720 3300006163 Bacteria 8912
253 Ga0070715_10063278 3300006163 Bacteria 1630
254 Ga0070715_10097752 3300006163 Bacteria 1363
255 Ga0070715_10116932 3300006163 Bacteria 1266
256 Ga0070716_100001889 3300006173 Bacteria 9507
257 Ga0070716_100010508 3300006173 Bacteria 4642
258 Ga0070716_100145713 3300006173 Bacteria 1517
259 Ga0070716_100389665 3300006173 Bacteria 998
260 Ga0070712_100004033 3300006175 Bacteria 9009
261 Ga0070712_100061863 3300006175 Bacteria 2646
262 Ga0070712_100374650 3300006175 Bacteria 1170
263 Ga0070712_100409988 3300006175 Bacteria 1121
264 Ga0075362_10039557 3300006177 Bacteria 2074
265 Ga0075362_10045310 3300006177 Bacteria 1953
266 Ga0075362_10069781 3300006177 Bacteria 1603
267 Ga0075367_10001316 3300006178 Bacteria 10529
268 Ga0075367_10002916 3300006178 Bacteria 7973
269 Ga0075367_10063008 3300006178 Bacteria 2216
270 Ga0075367_10103936 3300006178 Bacteria 1738
271 Ga0075367_10294336 3300006178 Bacteria 1021
272 Ga0075367_10434289 3300006178 Bacteria 832
273 Ga0075367_10458801 3300006178 Bacteria 808
274 Ga0075367_10807620 3300006178 Bacteria 597
275 Ga0075369_10018330 3300006186 Bacteria 2849
276 Ga0075369_10033265 3300006186 Bacteria 2184
277 Ga0075369_10050752 3300006186 Bacteria 1795
278 Ga0075369_10511074 3300006186 Bacteria 571
279 Ga0075366_10012444 3300006195 Bacteria 4826
280 Ga0075366_10023107 3300006195 Bacteria 3622
281 Ga0075366_10051353 3300006195 Bacteria 2450
282 Ga0075366_10119067 3300006195 Bacteria 1591
283 Ga0075366_10264575 3300006195 Bacteria 1050
284 Ga0075366_10524970 3300006195 Bacteria 732
285 Ga0097621_100059823 3300006237 Bacteria 3120
286 Ga0097621_100191505 3300006237 Bacteria 1771
287 Ga0097621_100334205 3300006237 Bacteria 1344
288 Ga0097621_101074706 3300006237 Bacteria 755
289 Ga0075370_10047361 3300006353 Bacteria 2434
290 Ga0075370_10079080 3300006353 Bacteria 1889
291 Ga0075370_10191128 3300006353 Bacteria 1206
292 Ga0075370_10364188 3300006353 Bacteria 865
293 Ga0075370_10605688 3300006353 Bacteria 664
294 Ga0068871_100005491 3300006358 Bacteria 8893
295 Ga0068871_100093724 3300006358 Bacteria 2506
296 Ga0068871_100119621 3300006358 Bacteria 2224
297 Ga0068871_100139509 3300006358 Bacteria 2061
298 Ga0068871_100162960 3300006358 Bacteria 1908
299 Ga0068871_100183445 3300006358 Bacteria 1799
300 Ga0075428_100030184 3300006844 Bacteria 5997
301 Ga0075428_100650920 3300006844 Bacteria 1124
302 Ga0075428_102434721 3300006844 Bacteria 537
303 Ga0075431_100659652 3300006847 Bacteria 1026
304 Ga0075431_100898433 3300006847 Bacteria 855
305 Ga0075433_10698076 3300006852 Bacteria 889
306 Ga0075434_100085876 3300006871 Bacteria 3146
307 Ga0075434_100103939 3300006871 Bacteria 2849
308 Ga0075434_100156042 3300006871 Bacteria 2302
309 Ga0075434_100187475 3300006871 Bacteria 2089
310 Ga0075434_100405874 3300006871 Bacteria 1384
311 Ga0075429_100530133 3300006880 Bacteria 1032
312 Ga0068865_100069839 3300006881 Bacteria 2487
313 Ga0068865_100265917 3300006881 Bacteria 1360
314 Ga0068865_100278061 3300006881 Bacteria 1332
315 Ga0075436_100029917 3300006914 Bacteria 3746
316 Ga0075436_100301414 3300006914 Bacteria 1149
317 Ga0097620_100014563 3300006931 Bacteria 7899
318 Ga0097620_100228484 3300006931 Bacteria 1949
319 Ga0075435_100006092 3300007076 Bacteria 8497
320 Ga0075435_100102310 3300007076 Bacteria 2374
321 Ga0075435_100290415 3300007076 Bacteria 1397
322 Ga0099795_10009154 3300007788 Bacteria 2860
323 Ga0105250_10065204 3300009092 Bacteria 1468
324 Ga0105240_10056226 3300009093 Bacteria 4924
325 Ga0105240_10117882 3300009093 Bacteria 3200
326 Ga0105240_10274810 3300009093 Bacteria 1938
327 Ga0105240_11096065 3300009093 Bacteria 847
328 Ga0105240_11778359 3300009093 Bacteria 642
329 Ga0111539_10183045 3300009094 Bacteria 2447
330 Ga0111539_10381342 3300009094 Bacteria 1641
331 Ga0111539_11259560 3300009094 Bacteria 858
332 Ga0105245_10278620 3300009098 Bacteria 1634
333 Ga0105245_10326187 3300009098 Bacteria 1514
334 Ga0105245_10921301 3300009098 Bacteria 916
335 Ga0105247_10004828 3300009101 Bacteria 8579
336 Ga0105247_10198780 3300009101 Bacteria 1346
337 Ga0105247_10392558 3300009101 Bacteria 986
338 Ga0114129_10061242 3300009147 Bacteria 5259
339 Ga0114129_10095382 3300009147 Bacteria 4120
340 Ga0114129_10197097 3300009147 Bacteria 2730
341 Ga0114129_10208543 3300009147 Bacteria 2643
342 Ga0114129_10652695 3300009147 Bacteria 1358
343 Ga0105243_10047635 3300009148 Bacteria 3376
344 Ga0105243_10146727 3300009148 Bacteria 2019
345 Ga0105243_10244089 3300009148 Bacteria 1600
346 Ga0105243_10498700 3300009148 Bacteria 1153
347 Ga0105243_10575201 3300009148 Bacteria 1080
348 Ga0105243_11398543 3300009148 Bacteria 720
349 Ga0105241_10257903 3300009174 Bacteria 1481
350 Ga0105241_10402151 3300009174 Bacteria 1201
351 Ga0105242_10027348 3300009176 Bacteria 4527
352 Ga0105242_10048559 3300009176 Bacteria 3450
353 Ga0105242_10068809 3300009176 Bacteria 2930
354 Ga0105242_10200080 3300009176 Bacteria 1774
355 Ga0105248_10012305 3300009177 Bacteria 9437
356 Ga0105248_10074998 3300009177 Bacteria 3801
357 Ga0105248_10097925 3300009177 Bacteria 3305
358 Ga0105248_10404753 3300009177 Bacteria 1536
359 Ga0105248_12532992 3300009177 Bacteria 585
360 Ga0105237_10063614 3300009545 Bacteria 3687
361 Ga0105237_10103380 3300009545 Bacteria 2841
362 Ga0105238_10113642 3300009551 Bacteria 2687
363 Ga0105238_10171734 3300009551 Bacteria 2144
364 Ga0105238_10342858 3300009551 Bacteria 1482
365 Ga0105238_11044904 3300009551 Bacteria 838
366 Ga0105249_10000366 3300009553 Bacteria 44857
367 Ga0105249_10032153 3300009553 Bacteria 4745
368 Ga0105249_10055253 3300009553 Bacteria 3631
369 Ga0105249_10421066 3300009553 Bacteria 1369
370 Ga0105249_10677854 3300009553 Bacteria 1090
371 Ga0105249_13268909 3300009553 Bacteria 521
372 Ga0099796_10161233 3300010159 Bacteria 889
373 Ga0105239_10082645 3300010375 Bacteria 3537
374 Ga0105239_10163984 3300010375 Bacteria 2484
375 Ga0105239_10822535 3300010375 Bacteria 1064
376 Ga0105239_11234049 3300010375 Bacteria 862
377 Ga0105239_11791739 3300010375 Bacteria 711
378 Ga0105246_10054178 3300011119 Bacteria 2763
379 Ga0105246_10105727 3300011119 Bacteria 2058
380 Ga0105246_10765605 3300011119 Bacteria 853
381 Ga0105246_11515320 3300011119 Bacteria 630
382 Ga0157346_1001067 3300012480 Bacteria 1262
383 Ga0157315_1017040 3300012508 Bacteria 726
384 Ga0157373_10085737 3300013100 Bacteria 2220
385 Ga0157371_10059021 3300013102 Bacteria 2721
386 Ga0157371_10582183 3300013102 Bacteria 831
387 Ga0157370_10116838 3300013104 Bacteria 2492
388 Ga0157370_10124689 3300013104 Bacteria 2404
389 Ga0157370_10637614 3300013104 Bacteria 974
390 Ga0157370_10712379 3300013104 Bacteria 916
391 Ga0157369_10229201 3300013105 Bacteria 1942
392 Ga0157369_10335996 3300013105 Bacteria 1569
393 Ga0157369_10802702 3300013105 Bacteria 967
394 Ga0157374_10091851 3300013296 Bacteria 2895
395 Ga0157374_10397952 3300013296 Bacteria 1374
396 Ga0157374_11510137 3300013296 Bacteria 695
397 Ga0157378_10080426 3300013297 Bacteria 2944
398 Ga0157378_10093499 3300013297 Bacteria 2737
399 Ga0157378_10687797 3300013297 Bacteria 1041
400 Ga0157372_10116237 3300013307 Bacteria 3067
401 Ga0157375_10022311 3300013308 Bacteria 5825
402 Ga0157375_10990293 3300013308 Bacteria 981
403 Ga0163163_10126580 3300014325 Bacteria 2593
404 Ga0163163_10183790 3300014325 Bacteria 2138
405 Ga0163163_10246684 3300014325 Bacteria 1836
406 Ga0163163_10878867 3300014325 Bacteria 960
407 Ga0157380_10077598 3300014326 Bacteria 2707
408 Ga0157380_10147233 3300014326 Bacteria 2031
409 Ga0157380_11009929 3300014326 Bacteria 866
410 Ga0182008_10032425 3300014497 Bacteria 2625
411 Ga0157377_10015614 3300014745 Bacteria 3891
412 Ga0157377_10091494 3300014745 Bacteria 1797
413 Ga0157377_10113348 3300014745 Bacteria 1633
414 Ga0157379_10010974 3300014968 Bacteria 7901
415 Ga0157379_10324966 3300014968 Bacteria 1405
416 Ga0157379_10465813 3300014968 Bacteria 1168
417 Ga0157379_10602530 3300014968 Bacteria 1026
418 Ga0157376_10282950 3300014969 Bacteria 1563
419 Ga0157376_11244548 3300014969 Bacteria 773
420 Ga0182007_10234096 3300015262 Bacteria 653
421 Ga0182005_1133320 3300015265 Bacteria 714
422 Ga0163161_10197530 3300017792 Bacteria 1549
423 Ga0163161_10314456 3300017792 Bacteria 1236
424 Ga0206356_11118909 3300020070 Bacteria 622
425 Ga0206354_10212022 3300020081 Bacteria 910
426 Ga0206353_10376412 3300020082 Bacteria 3399
427 Ga0206353_10853757 3300020082 Bacteria 1123
428 Ga0206353_11627131 3300020082 Bacteria 645
429 Ga0213872_10060323 3300021361 Bacteria 1716
430 Ga0213872_10135485 3300021361 Bacteria 1083
431 Ga0213876_10008421 3300021384 Bacteria 5581
432 Ga0213876_10393722 3300021384 Bacteria 737
433 Ga0213875_10000031 3300021388 Bacteria 176367
434 Ga0213875_10120279 3300021388 Bacteria 1227
435 Ga0213875_10127419 3300021388 Bacteria 1190
436 Ga0209233_1014532 3300025261 Bacteria 2215
437 Ga0207682_10055792 3300025893 Bacteria 1644
438 Ga0207692_10002654 3300025898 Bacteria 6883
439 Ga0207692_10033904 3300025898 Bacteria 2468
440 Ga0207692_10047511 3300025898 Bacteria 2155
441 Ga0207692_10068942 3300025898 Bacteria 1857
442 Ga0207692_10097832 3300025898 Bacteria 1605
443 Ga0207710_10059418 3300025900 Bacteria 1731
444 Ga0207688_10002814 3300025901 Bacteria 9448
445 Ga0207688_10045009 3300025901 Bacteria 2461
446 Ga0207688_10096148 3300025901 Bacteria 1706
447 Ga0207680_10028876 3300025903 Bacteria 3108
448 Ga0207680_10853700 3300025903 Bacteria 653
449 Ga0207647_10046289 3300025904 Bacteria 2711
450 Ga0207685_10035901 3300025905 Bacteria 1813
451 Ga0207685_10061390 3300025905 Bacteria 1490
452 Ga0207685_10125559 3300025905 Bacteria 1132
453 Ga0207685_10152884 3300025905 Bacteria 1046
454 Ga0207685_10174019 3300025905 Bacteria 993
455 Ga0207699_10036496 3300025906 Bacteria 2802
456 Ga0207699_10045331 3300025906 Bacteria 2566
457 Ga0207699_10203490 3300025906 Bacteria 1343
458 Ga0207699_10371678 3300025906 Bacteria 1013
459 Ga0207699_10710092 3300025906 Bacteria 736
460 Ga0207699_11129440 3300025906 Bacteria 580
461 Ga0207645_10002945 3300025907 Bacteria 13153
462 Ga0207645_10025104 3300025907 Bacteria 3859
463 Ga0207643_10002845 3300025908 Bacteria 9348
464 Ga0207643_10161260 3300025908 Bacteria 1349
465 Ga0207705_10049781 3300025909 Bacteria 3016
466 Ga0207705_10143820 3300025909 Bacteria 1783
467 Ga0207705_10379135 3300025909 Bacteria 1092
468 Ga0207684_10002963 3300025910 Bacteria 16822
469 Ga0207654_10011794 3300025911 Bacteria 4463
470 Ga0207654_10027072 3300025911 Bacteria 3113
471 Ga0207654_10910837 3300025911 Bacteria 638
472 Ga0207707_10045230 3300025912 Bacteria 3837
473 Ga0207707_10119083 3300025912 Bacteria 2308
474 Ga0207707_10505509 3300025912 Bacteria 1030
475 Ga0207707_10658336 3300025912 Bacteria 882
476 Ga0207695_10235929 3300025913 Bacteria 1732
477 Ga0207695_10623058 3300025913 Bacteria 960
478 Ga0207695_10718183 3300025913 Bacteria 880
479 Ga0207695_11105559 3300025913 Bacteria 672
480 Ga0207671_10219760 3300025914 Bacteria 1488
481 Ga0207671_10469263 3300025914 Bacteria 1003
482 Ga0207693_10000825 3300025915 Bacteria 27536
483 Ga0207693_10004273 3300025915 Bacteria 12116
484 Ga0207693_10007085 3300025915 Bacteria 9254
485 Ga0207693_10009090 3300025915 Bacteria 8110
486 Ga0207693_10053018 3300025915 Bacteria 3182
487 Ga0207693_10082455 3300025915 Bacteria 2519
488 Ga0207693_10135084 3300025915 Bacteria 1939
489 Ga0207693_10172403 3300025915 Bacteria 1703
490 Ga0207663_10059104 3300025916 Bacteria 2424
491 Ga0207663_10105854 3300025916 Bacteria 1900
492 Ga0207663_10109082 3300025916 Bacteria 1875
493 Ga0207663_10207397 3300025916 Bacteria 1418
494 Ga0207663_10225145 3300025916 Bacteria 1367
495 Ga0207663_10370903 3300025916 Bacteria 1088
496 Ga0207663_10379286 3300025916 Bacteria 1077
497 Ga0207663_10557903 3300025916 Bacteria 896
498 Ga0207663_11077550 3300025916 Bacteria 646
499 Ga0207660_10087246 3300025917 Bacteria 2305
500 Ga0207660_10105093 3300025917 Bacteria 2115
501 Ga0207660_10409140 3300025917 Bacteria 1093
502 Ga0207660_10691008 3300025917 Bacteria 832
503 Ga0207660_11117308 3300025917 Bacteria 642
504 Ga0207662_10008927 3300025918 Bacteria 5499
505 Ga0207662_10051522 3300025918 Bacteria 2449
506 Ga0207662_10509100 3300025918 Bacteria 830
507 Ga0207657_10028698 3300025919 Bacteria 5072
508 Ga0207657_10045555 3300025919 Bacteria 3848
509 Ga0207657_10093700 3300025919 Bacteria 2501
510 Ga0207649_10038210 3300025920 Bacteria 2905
511 Ga0207649_10251877 3300025920 Bacteria 1272
512 Ga0207649_10706584 3300025920 Bacteria 782
513 Ga0207652_10102361 3300025921 Bacteria 2531
514 Ga0207652_10151429 3300025921 Bacteria 2077
515 Ga0207652_10208051 3300025921 Bacteria 1761
516 Ga0207652_10218154 3300025921 Bacteria 1719
517 Ga0207652_10225012 3300025921 Bacteria 1690
518 Ga0207652_10864760 3300025921 Bacteria 800
519 Ga0207681_10084122 3300025923 Bacteria 2254
520 Ga0207681_10324738 3300025923 Bacteria 1225
521 Ga0207694_10134797 3300025924 Bacteria 1982
522 Ga0207694_10549584 3300025924 Bacteria 969
523 Ga0207694_10609454 3300025924 Bacteria 918
524 Ga0207650_10002572 3300025925 Bacteria 12563
525 Ga0207650_10033447 3300025925 Bacteria 3724
526 Ga0207650_10473508 3300025925 Bacteria 1044
527 Ga0207659_10018147 3300025926 Bacteria 4608
528 Ga0207687_10005621 3300025927 Bacteria 8288
529 Ga0207687_10111414 3300025927 Bacteria 2032
530 Ga0207687_10121271 3300025927 Bacteria 1956
531 Ga0207700_10068719 3300025928 Bacteria 2716
532 Ga0207700_10127513 3300025928 Bacteria 2072
533 Ga0207700_10151584 3300025928 Bacteria 1916
534 Ga0207700_10185594 3300025928 Bacteria 1744
535 Ga0207700_10213529 3300025928 Bacteria 1632
536 Ga0207700_10364038 3300025928 Bacteria 1261
537 Ga0207700_11033398 3300025928 Bacteria 735
538 Ga0207700_11387789 3300025928 Bacteria 625
539 Ga0207664_10007232 3300025929 Bacteria 7689
540 Ga0207664_10023737 3300025929 Bacteria 4599
541 Ga0207664_10066940 3300025929 Bacteria 2881
542 Ga0207664_10070473 3300025929 Bacteria 2814
543 Ga0207664_10076974 3300025929 Bacteria 2702
544 Ga0207664_10196941 3300025929 Bacteria 1737
545 Ga0207644_10029417 3300025931 Bacteria 3811
546 Ga0207644_10038563 3300025931 Bacteria 3367
547 Ga0207644_10097299 3300025931 Bacteria 2204
548 Ga0207644_10338694 3300025931 Bacteria 1219
549 Ga0207644_11883285 3300025931 Bacteria 500
550 Ga0207690_10158979 3300025932 Bacteria 1683
551 Ga0207706_10001336 3300025933 Bacteria 24661
552 Ga0207706_10108352 3300025933 Bacteria 2445
553 Ga0207706_10255971 3300025933 Bacteria 1528
554 Ga0207706_10268663 3300025933 Bacteria 1488
555 Ga0207706_10878002 3300025933 Bacteria 758
556 Ga0207686_10023636 3300025934 Bacteria 3553
557 Ga0207686_10056288 3300025934 Bacteria 2471
558 Ga0207686_10392290 3300025934 Bacteria 1055
559 Ga0207686_10625514 3300025934 Bacteria 849
560 Ga0207709_10003540 3300025935 Bacteria 9237
561 Ga0207709_10124088 3300025935 Bacteria 1749
562 Ga0207670_10035722 3300025936 Bacteria 3225
563 Ga0207670_10160451 3300025936 Bacteria 1678
564 Ga0207669_10029074 3300025937 Bacteria 3051
565 Ga0207669_10160665 3300025937 Bacteria 1587
566 Ga0207704_10052137 3300025938 Bacteria 2478
567 Ga0207704_10173913 3300025938 Bacteria 1548
568 Ga0207704_10202384 3300025938 Bacteria 1454
569 Ga0207665_10001068 3300025939 Bacteria 18420
570 Ga0207665_10003817 3300025939 Bacteria 10071
571 Ga0207665_10040571 3300025939 Bacteria 3107
572 Ga0207665_10130207 3300025939 Bacteria 1785
573 Ga0207665_10291151 3300025939 Bacteria 1218
574 Ga0207691_10000635 3300025940 Bacteria 34764
575 Ga0207711_10010280 3300025941 Bacteria 7772
576 Ga0207711_10036737 3300025941 Bacteria 4158
577 Ga0207711_10069609 3300025941 Bacteria 3051
578 Ga0207711_10602185 3300025941 Bacteria 1025
579 Ga0207689_10003641 3300025942 Bacteria 14070
580 Ga0207689_10024648 3300025942 Bacteria 5045
581 Ga0207689_10046276 3300025942 Bacteria 3596
582 Ga0207661_10035883 3300025944 Bacteria 3867
583 Ga0207661_10131898 3300025944 Bacteria 2141
584 Ga0207661_10412446 3300025944 Bacteria 1226
585 Ga0207679_10014282 3300025945 Bacteria 5216
586 Ga0207679_10652239 3300025945 Bacteria 952
587 Ga0207679_10816047 3300025945 Bacteria 851
588 Ga0207667_10036413 3300025949 Bacteria 5274
589 Ga0207667_10072960 3300025949 Bacteria 3567
590 Ga0207667_10151081 3300025949 Bacteria 2390
591 Ga0207667_10762693 3300025949 Bacteria 966
592 Ga0207667_11455545 3300025949 Bacteria 657
593 Ga0207651_10048486 3300025960 Bacteria 2872
594 Ga0207712_10002399 3300025961 Bacteria 12137
595 Ga0207668_10031104 3300025972 Bacteria 3512
596 Ga0207668_10473718 3300025972 Bacteria 1073
597 Ga0207668_11580275 3300025972 Bacteria 592
598 Ga0207640_10041977 3300025981 Bacteria 2913
599 Ga0207640_10379314 3300025981 Bacteria 1145
600 Ga0207640_11008770 3300025981 Bacteria 733
601 Ga0207658_10046077 3300025986 Bacteria 3182
602 Ga0207677_10004734 3300026023 Bacteria 7334
603 Ga0207677_10041256 3300026023 Bacteria 3050
604 Ga0207677_11304936 3300026023 Bacteria 667
605 Ga0207703_10012768 3300026035 Bacteria 6549
606 Ga0207703_10287925 3300026035 Bacteria 1494
607 Ga0207703_11426111 3300026035 Bacteria 666
608 Ga0207639_10342757 3300026041 Bacteria 1333
609 Ga0207639_10419380 3300026041 Bacteria 1210
610 Ga0207639_10442090 3300026041 Bacteria 1179
611 Ga0207678_10004902 3300026067 Bacteria 12024
612 Ga0207678_10010341 3300026067 Bacteria 8190
613 Ga0207678_10551135 3300026067 Bacteria 1008
614 Ga0207708_10001330 3300026075 Bacteria 18590
615 Ga0207708_10162321 3300026075 Bacteria 1765
616 Ga0207702_10039530 3300026078 Bacteria 3953
617 Ga0207702_10069314 3300026078 Bacteria 3032
618 Ga0207702_10536090 3300026078 Bacteria 1144
619 Ga0207641_10019656 3300026088 Bacteria 5546
620 Ga0207641_10189502 3300026088 Bacteria 1889
621 Ga0207641_11079858 3300026088 Bacteria 801
622 Ga0207641_11141361 3300026088 Bacteria 778
623 Ga0207648_10003105 3300026089 Bacteria 17542
624 Ga0207648_10302535 3300026089 Bacteria 1434
625 Ga0207648_11378156 3300026089 Bacteria 663
626 Ga0207676_10024382 3300026095 Bacteria 4475
627 Ga0207676_10042058 3300026095 Bacteria 3513
628 Ga0207676_10137329 3300026095 Bacteria 2088
629 Ga0207676_11481023 3300026095 Bacteria 675
630 Ga0207674_10333373 3300026116 Bacteria 1467
631 Ga0207675_100004255 3300026118 Bacteria 13848
632 Ga0207675_100238194 3300026118 Bacteria 1758
633 Ga0207675_100400593 3300026118 Bacteria 1352
634 Ga0207683_10004806 3300026121 Bacteria 11633
635 Ga0207683_10007077 3300026121 Bacteria 9617
636 Ga0207683_10023723 3300026121 Bacteria 5278
637 Ga0207683_10065336 3300026121 Bacteria 3208
638 Ga0207683_10156650 3300026121 Bacteria 2057
639 Ga0207698_10014590 3300026142 Bacteria 5230
640 Ga0207698_10019033 3300026142 Bacteria 4691
641 Ga0207698_10408090 3300026142 Bacteria 1300
642 Ga0209179_1005113 3300027512 Bacteria 2029
643 Ga0209813_10010282 3300027866 Bacteria 2416
644 Ga0209813_10022000 3300027866 Bacteria 1798
645 Ga0209813_10185473 3300027866 Bacteria 763
646 Ga0207428_10212984 3300027907 Bacteria 1451
647 Ga0207428_10268096 3300027907 Bacteria 1270
648 Ga0268266_10026518 3300028379 Bacteria 4930
649 Ga0268266_10137663 3300028379 Bacteria 2188
650 Ga0268266_10681102 3300028379 Bacteria 990
651 Ga0268265_10003591 3300028380 Bacteria 11076
652 Ga0268265_10678934 3300028380 Bacteria 993
653 Ga0268264_10005325 3300028381 Bacteria 10898
654 Ga0265337_1018778 3300028556 Bacteria 2189
655 Ga0265318_10004032 3300028577 Bacteria 7212
656 Ga0265330_10007771 3300031235 Bacteria 5206
657 Ga0265330_10034373 3300031235 Bacteria 2264
658 Ga0265332_10002695 3300031238 Bacteria 8873
659 Ga0265332_10012389 3300031238 Bacteria 3785
660 Ga0265328_10050582 3300031239 Bacteria 1526
661 Ga0265320_10018493 3300031240 Bacteria 3834
662 Ga0265325_10004992 3300031241 Bacteria 8267
663 Ga0265325_10016894 3300031241 Bacteria 4068
664 Ga0265325_10025118 3300031241 Bacteria 3237
665 Ga0265325_10025624 3300031241 Bacteria 3201
666 Ga0265325_10036101 3300031241 Bacteria 2621
667 Ga0265329_10012587 3300031242 Bacteria 3036
668 Ga0265329_10031690 3300031242 Bacteria 1716
669 Ga0265340_10004865 3300031247 Bacteria 7472
670 Ga0265340_10063523 3300031247 Bacteria 1761
671 Ga0265340_10122473 3300031247 Bacteria 1196
672 Ga0265340_10168967 3300031247 Bacteria 991
673 Ga0265339_10004645 3300031249 Bacteria 9336
674 Ga0265339_10010159 3300031249 Bacteria 5859
675 Ga0265339_10013807 3300031249 Bacteria 4887
676 Ga0265331_10007949 3300031250 Bacteria 6074
677 Ga0265331_10012924 3300031250 Bacteria 4501
678 Ga0265316_10017769 3300031344 Bacteria 6132
679 Ga0265316_10025046 3300031344 Bacteria 4984
680 Ga0265316_10034592 3300031344 Bacteria 4103
681 Ga0265316_10094403 3300031344 Bacteria 2279
682 Ga0307513_10115927 3300031456 Bacteria 2660
683 Ga0307513_10402560 3300031456 Bacteria 1103
684 Ga0265313_10002478 3300031595 Bacteria 15910
685 Ga0265313_10022841 3300031595 Bacteria 3383
686 Ga0265313_10035654 3300031595 Bacteria 2503
687 Ga0265313_10068739 3300031595 Bacteria 1636
688 Ga0265313_10187543 3300031595 Bacteria 866
689 Ga0316575_10043017 3300031665 Bacteria 1789
690 Ga0316579_10146555 3300031691 Bacteria 1138
691 Ga0265314_10060775 3300031711 Bacteria 2577
692 Ga0265314_10087405 3300031711 Bacteria 2038
693 Ga0265314_10142508 3300031711 Bacteria 1480
694 Ga0265342_10000092 3300031712 Bacteria 99040
695 Ga0265342_10000983 3300031712 Bacteria 28114
696 Ga0265342_10014308 3300031712 Bacteria 5271
697 Ga0316576_10182607 3300031727 Bacteria 1582
698 Ga0316578_10015600 3300031728 Bacteria 4089
699 Ga0316578_10337639 3300031728 Bacteria 898
700 Ga0307405_11398694 3300031731 Bacteria 612
701 Ga0307409_100480786 3300031995 Bacteria 1205
702 Ga0316583_10193944 3300032133 Bacteria 705
703 Ga0373930_0014853 3300034816 Bacteria 1456
704 Ga0373948_0001761 3300034817 Bacteria 3079
705 Ga0373950_0050463 3300034818 Bacteria 816
706 Ga0373950_0051664 3300034818 Bacteria 809
707 Ga0373958_0006709 3300034819 Bacteria 1806
708 Ga0373959_0002292 3300034820 Bacteria 3042
709 Ga0373938_0014292 3300034957 Bacteria 1521
710 Ga0373926_0021500 3300035083 Bacteria 2234
711 Ga0373926_0023001 3300035083 Bacteria 2162
712 Ga0373926_0122552 3300035083 Bacteria 981
713 Ga0373929_0017613 3300035085 Bacteria 1411
714 Ga0373929_0020957 3300035085 Bacteria 1322
715 Ga0373929_0179757 3300035085 Bacteria 583
716 Ga0373940_0019255 3300035088 Bacteria 1722
717 Ga0373944_0003559 3300035089 Bacteria 4028
718 Ga0373944_0005088 3300035089 Bacteria 3453
719 Ga0373944_0308046 3300035089 Bacteria 596
720 Ga0373949_0096076 3300035090 Bacteria 807
721 Ga0373951_0001694 3300035091 Bacteria 5757
722 Ga0373951_0075012 3300035091 Bacteria 867
723 Ga0373952_0003947 3300035092 Bacteria 2683
724 Ga0373923_0033073 3300035111 Bacteria 2092
725 Ga0373923_0257390 3300035111 Bacteria 818
726 Ga0373932_0114190 3300035112 Bacteria 893
727 Ga0373936_0005473 3300035113 Bacteria 4790
728 Ga0373939_0096441 3300035114 Bacteria 1008
729 Ga0373941_0017500 3300035115 Bacteria 1965
730 Ga0373941_0130301 3300035115 Bacteria 905
731 Ga0373945_0018914 3300035116 Bacteria 2347
732 Ga0373945_0029086 3300035116 Bacteria 1939
733 Ga0373945_0033872 3300035116 Bacteria 1818
734 Ga0373945_0326891 3300035116 Bacteria 661
735 Ga0373953_0007986 3300035117 Bacteria 3573
736 Ga0373953_0014564 3300035117 Bacteria 2832
737 Ga0373954_0006853 3300035118 Bacteria 4973
738 Ga0373954_0117790 3300035118 Bacteria 1288
739 Ga0373954_0130238 3300035118 Bacteria 1224
740 Ga0373956_0018386 3300035119 Bacteria 2959
741 Ga0373956_0043454 3300035119 Bacteria 2001
742 Ga0373956_0062504 3300035119 Bacteria 1688
743 Ga0373956_0216390 3300035119 Bacteria 909
744 Ga0373957_0006573 3300035120 Bacteria 3671
745 Ga0373957_0006843 3300035120 Bacteria 3614
746 Ga0373957_0147333 3300035120 Bacteria 965
747 Ga0373960_0044241 3300035121 Bacteria 1300
748 Ga0373960_0184427 3300035121 Bacteria 730
749 Ga0373943_0002330 3300035170 Bacteria 8635
750 Ga0373943_0280058 3300035170 Bacteria 943
751 Ga0373946_0007021 3300035171 Bacteria 4106
752 Ga0373946_0008539 3300035171 Bacteria 3759
753 Ga0373946_0011321 3300035171 Bacteria 3325
754 Ga0373946_0394515 3300035171 Bacteria 698
755 Ga0373946_0544091 3300035171 Bacteria 598
756 Ga0373955_0001883 3300035172 Bacteria 9050
757 Ga0373955_0471865 3300035172 Bacteria 765
758 Ga0373942_0322324 3300035207 Bacteria 540
759 Ga0373961_0002014 3300035241 Bacteria 5447
760 Ga0373961_0019548 3300035241 Bacteria 1781
761 Ga0373961_0034548 3300035241 Bacteria 1430
762 Ga0373961_0314726 3300035241 Bacteria 582
763 Ga0373962_0001403 3300035242 Bacteria 5685
764 Ga0316574_0060391 3300035398 Bacteria 2379
765 Ga0373924_0117763 3300035410 Bacteria 1151
766 Ga0373924_0147059 3300035410 Bacteria 1030
767 Ga0373931_0001882 3300035691 Bacteria 9166
768 Ga0373931_0008995 3300035691 Bacteria 4761
769 Ga0373931_0027332 3300035691 Bacteria 2912
770 Ga0373935_0002676 3300035692 Bacteria 10246
771 Ga0373935_0047198 3300035692 Bacteria 2722
772 Ga0373935_0128655 3300035692 Bacteria 1699
773 Ga0373935_0159944 3300035692 Bacteria 1534
774 Ga0373927_0010750 3300035695 Bacteria 6096
775 Ga0373927_0023475 3300035695 Bacteria 4039
776 Ga0373927_0119628 3300035695 Bacteria 1719
777 Ga0373927_0217060 3300035695 Bacteria 1256
778 Ga0373927_0355443 3300035695 Bacteria 965
779 Ga0373933_0002112 3300035724 Bacteria 11410
780 Ga0373933_0010711 3300035724 Bacteria 5029
781 Ga0373947_0001553 3300035725 Bacteria 14063
782 Ga0373947_0098441 3300035725 Bacteria 1835
783 Ga0373947_0144790 3300035725 Bacteria 1527
784 Ga0373947_0276995 3300035725 Bacteria 1114
785 Ga0373947_0393855 3300035725 Bacteria 933
786 Ga0373947_0596989 3300035725 Bacteria 752
787 Ga0373937_0002048 3300036401 Bacteria 16856
788 Ga0373937_0007361 3300036401 Bacteria 9530
789 Ga0373937_0050920 3300036401 Bacteria 3795
790 Ga0373937_0118279 3300036401 Bacteria 2468
791 Ga0373937_1003849 3300036401 Bacteria 783
792 Ga0316582_0047745 3300036647 Bacteria 2704
793 Ga0316582_0365261 3300036647 Bacteria 993
794 Ga0316584_0026489 3300036712 Bacteria 4262
795 Ga0373925_0008896 3300037068 Bacteria 7316
796 Ga0373925_0189534 3300037068 Bacteria 1631
797 Ga0373925_0309072 3300037068 Bacteria 1277
798 Ga0373925_0355153 3300037068 Bacteria 1190
799 Ga0395899_0013226 3300037312 Bacteria 6313
800 Ga0395899_0053827 3300037312 Bacteria 2979
801 Ga0395900_0006301 3300037418 Bacteria 12376
802 Ga0395900_0007225 3300037418 Bacteria 11505
803 Ga0395900_0042502 3300037418 Bacteria 4684
804 Ga0395898_0037430 3300037466 Bacteria 4813
805 Ga0395898_0063745 3300037466 Bacteria 3576
806 Ga0395898_0235150 3300037466 Bacteria 1747
807 Ga0316581_0037028 3300037588 Bacteria 1482
808 Ga0436364_0793438 3300037853 Bacteria 64960
809 Ga0436364_1132027 3300037853 Bacteria 593
810 Ga0395901_0028459 3300038443 Bacteria 5746
811 Ga0395901_0036482 3300038443 Bacteria 5082
812 Ga0395901_0070801 3300038443 Bacteria 3634
813 Ga0436365_0030899 3300039437 Bacteria 1068
814 Ga0436365_0589402 3300039437 Bacteria 973
815 Ga0436365_1138630 3300039437 Bacteria 9502
816 Ga0436365_1500007 3300039437 Bacteria 880
817 Ga0436365_1653395 3300039437 Bacteria 4904
818 Ga0436365_1701023 3300039437 Bacteria 878
819 Ga0436360_0004969 3300039438 Bacteria 1028
820 Ga0436360_0167135 3300039438 Bacteria 697
821 Ga0436361_0889648 3300039447 Bacteria 2943
822 Ga0436361_0986695 3300039447 Bacteria 2102
823 Ga0436361_1183143 3300039447 Bacteria 1403
824 Ga0436363_0535034 3300039450 Bacteria 888
825 Ga0436362_0367554 3300039453 Bacteria 541
826 Ga0436362_0381093 3300039453 Bacteria 1368
827 Ga0436362_0550311 3300039453 Bacteria 582
828 Ga0451793_0823115 3300041452 Bacteria 682
829 Ga0466966_0834581 3300044684 Bacteria 556
830 Ga0466963_0399849 3300044694 Bacteria 969
831 Ga0466971_0121780 3300044719 Bacteria 1208
832 Ga0466957_0225911 3300044842 Bacteria 1238
833 Ga0466957_0264244 3300044842 Bacteria 1147
834 Ga0466957_0268110 3300044842 Bacteria 1139
835 Ga0466957_1165514 3300044842 Bacteria 557
836 Ga0466959_0411348 3300045049 Bacteria 919
837 Ga0466958_0094962 3300045836 Bacteria 1848
838 Ga0466958_0331628 3300045836 Bacteria 978
839 Ga0466958_0632706 3300045836 Bacteria 696
840 Ga0466967_0211963 3300045976 Bacteria 1837
841 Ga0466967_1646740 3300045976 Bacteria 639
842 Ga0495617_058596 3300046452 Bacteria 1276
843 Ga0495592_0004699 3300046454 Bacteria 10018
844 Ga0495592_0014796 3300046454 Bacteria 5923
845 Ga0495592_0041714 3300046454 Bacteria 3439
846 Ga0495592_0347945 3300046454 Bacteria 951
847 Ga0495603_0025855 3300046455 Bacteria 3548
848 Ga0495603_0033915 3300046455 Bacteria 3071
849 Ga0495603_0221869 3300046455 Bacteria 1090
850 Ga0495590_0348954 3300046457 Bacteria 562
851 Ga0495629_0003044 3300046459 Bacteria 12743
852 Ga0495629_0177976 3300046459 Bacteria 1474
853 Ga0495638_0006650 3300046460 Bacteria 8391
854 Ga0495638_0046393 3300046460 Bacteria 2729
855 Ga0495641_0016811 3300046461 Bacteria 3839
856 Ga0495641_0039453 3300046461 Bacteria 2202
857 Ga0495651_0002035 3300046462 Bacteria 15618
858 Ga0495651_0010719 3300046462 Bacteria 7049
859 Ga0495651_0279307 3300046462 Bacteria 1129
860 Ga0495653_0065475 3300046463 Bacteria 2735
861 Ga0495653_0089810 3300046463 Bacteria 2250
862 Ga0495580_0222311 3300046472 Bacteria 1297
863 Ga0495580_0375312 3300046472 Bacteria 961
864 Ga0495580_0429890 3300046472 Bacteria 887
865 Ga0495582_0003239 3300046473 Bacteria 9143
866 Ga0495582_0103214 3300046473 Bacteria 1597
867 Ga0495605_0097627 3300046474 Bacteria 1354
868 Ga0495662_0018960 3300046476 Bacteria 3330
869 Ga0495662_0349252 3300046476 Bacteria 727
870 Ga0495664_0030072 3300046477 Bacteria 3180
871 Ga0495584_0142625 3300046491 Bacteria 1216
872 Ga0495584_0198472 3300046491 Bacteria 1020
873 Ga0495584_0219334 3300046491 Bacteria 967
874 Ga0495585_0000856 3300046492 Bacteria 26041
875 Ga0495585_0028456 3300046492 Bacteria 3188
876 Ga0495594_0231035 3300046499 Bacteria 1054
877 Ga0495608_0000915 3300046511 Bacteria 20676
878 Ga0495616_0000405 3300046513 Bacteria 33255
879 Ga0495616_0254436 3300046513 Bacteria 753
880 Ga0495618_0009502 3300046514 Bacteria 5873
881 Ga0495618_0544478 3300046514 Bacteria 695
882 Ga0495620_0278241 3300046515 Bacteria 637
883 Ga0495628_0008958 3300046516 Bacteria 8558
884 Ga0495628_0083828 3300046516 Bacteria 2474
885 Ga0495630_0009867 3300046517 Bacteria 6876
886 Ga0495630_0430163 3300046517 Bacteria 1011
887 Ga0495632_0071653 3300046519 Bacteria 1664
888 Ga0495637_0070180 3300046520 Bacteria 1416
889 Ga0495643_0229787 3300046522 Bacteria 875
890 Ga0495644_0033593 3300046523 Bacteria 1937
891 Ga0495663_0402127 3300046525 Bacteria 504
892 Ga0495666_0028495 3300046526 Bacteria 2747
893 Ga0495666_0120708 3300046526 Bacteria 1228
894 Ga0495666_0467390 3300046526 Bacteria 565
895 Ga0495642_0227908 3300046528 Bacteria 814
896 Ga0495652_0005789 3300046529 Bacteria 11570
897 Ga0495652_0053448 3300046529 Bacteria 3442
898 Ga0495652_0150117 3300046529 Bacteria 1822
899 Ga0495652_0192140 3300046529 Bacteria 1557
900 Ga0495652_0356333 3300046529 Bacteria 1047
901 Ga0495665_0019335 3300046531 Bacteria 3662
902 Ga0495665_0113061 3300046531 Bacteria 1423
903 Ga0495665_0132447 3300046531 Bacteria 1305
904 Ga0495665_0153177 3300046531 Bacteria 1203
905 Ga0495640_0071044 3300046533 Bacteria 2336
906 Ga0495640_0256964 3300046533 Bacteria 1092
907 Ga0495640_0270213 3300046533 Bacteria 1060
908 Ga0495640_0296216 3300046533 Bacteria 1005
909 Ga0495640_0432324 3300046533 Bacteria 805
910 Ga0495640_0787677 3300046533 Bacteria 567
911 Ga0495586_0085835 3300046535 Bacteria 1734
912 Ga0495586_0404665 3300046535 Bacteria 785
913 Ga0495587_0001734 3300046536 Bacteria 14559
914 Ga0495598_0010894 3300046537 Bacteria 2190
915 Ga0495609_0416845 3300046538 Bacteria 536
916 Ga0495621_0074061 3300046539 Bacteria 1259
917 Ga0495645_0011672 3300046543 Bacteria 6184
918 Ga0495645_0086453 3300046543 Bacteria 2244
919 Ga0495622_0018384 3300046557 Bacteria 3254
920 Ga0495633_0017034 3300046558 Bacteria 3727
921 Ga0495667_0000259 3300046559 Bacteria 34280
922 Ga0495667_0014619 3300046559 Bacteria 5302
923 Ga0495656_0000215 3300046615 Bacteria 20636
924 Ga0495656_0217611 3300046615 Bacteria 954
925 Ga0495668_0106370 3300046616 Bacteria 1534
926 Ga0495668_0225302 3300046616 Bacteria 1027
927 Ga0495634_0008814 3300046642 Bacteria 7480
928 Ga0495634_0451287 3300046642 Bacteria 758
929 Ga0495611_0010807 3300046648 Bacteria 3867
930 Ga0495635_0010301 3300046663 Bacteria 6538
931 Ga0495635_0028478 3300046663 Bacteria 3883
932 Ga0495635_0460497 3300046663 Bacteria 840
933 Ga0495659_0002574 3300046664 Bacteria 5848
934 Ga0495659_0346154 3300046664 Bacteria 634
935 Ga0495661_0364002 3300046665 Bacteria 709
936 Ga0495657_0003179 3300046675 Bacteria 13534
937 Ga0495657_0125454 3300046675 Bacteria 1613
938 Ga0495599_0002681 3300046678 Bacteria 10394
939 Ga0495646_0010194 3300046680 Bacteria 5975
940 Ga0495646_0026632 3300046680 Bacteria 3629
941 Ga0495647_0003634 3300046681 Bacteria 4952
942 Ga0495647_0072747 3300046681 Bacteria 1379
943 Ga0495647_0178586 3300046681 Bacteria 923
944 Ga0495658_0000360 3300046683 Bacteria 25675
945 Ga0495658_0005781 3300046683 Bacteria 6071
946 Ga0495658_0114114 3300046683 Bacteria 1627
947 Ga0495669_0167915 3300046684 Bacteria 1043
948 Ga0495613_0006693 3300046689 Bacteria 8606
949 Ga0495613_0027827 3300046689 Bacteria 4207
950 Ga0495613_0033307 3300046689 Bacteria 3829
951 Ga0495613_0447219 3300046689 Bacteria 876
952 Ga0495624_0026537 3300046690 Bacteria 3796
953 Ga0495624_0041895 3300046690 Bacteria 2926
954 Ga0495624_0083331 3300046690 Bacteria 1977
955 Ga0495624_0211509 3300046690 Bacteria 1176
956 Ga0495670_0000213 3300046691 Bacteria 26531
957 Ga0495671_0081284 3300046692 Bacteria 1588
958 Ga0495671_0095482 3300046692 Bacteria 1455
959 Ga0495671_0095485 3300046692 Bacteria 1455
960 Ga0495600_0006046 3300046809 Bacteria 7331
961 Ga0495600_0034222 3300046809 Bacteria 3298
962 Ga0495581_0057033 3300047315 Bacteria 2254
963 Ga0495581_0059837 3300047315 Bacteria 2201
964 Ga0495581_0064661 3300047315 Bacteria 2114
965 Ga0495581_0249409 3300047315 Bacteria 1038
966 Ga0495604_0006070 3300047317 Bacteria 9587
967 Ga0495604_0009049 3300047317 Bacteria 7879
968 Ga0495604_0209491 3300047317 Bacteria 1348
969 Ga0495604_0465148 3300047317 Bacteria 824
970 Ga0495636_0108984 3300047318 Bacteria 1217
971 Ga0495674_0092171 3300047319 Bacteria 2587
972 Ga0495674_0110713 3300047319 Bacteria 2328
973 Ga0495674_0138581 3300047319 Bacteria 2046
974 Ga0495674_0176434 3300047319 Bacteria 1780
975 Ga0495672_0280589 3300047320 Bacteria 796
976 Ga0495676_0067235 3300047321 Bacteria 2773
977 Ga0495676_0098466 3300047321 Bacteria 2169
978 Ga0495676_0103110 3300047321 Bacteria 2107
979 Ga0495680_0002446 3300047322 Bacteria 19009
980 Ga0495680_0004222 3300047322 Bacteria 13790
981 Ga0495680_0012206 3300047322 Bacteria 7577
982 Ga0495680_0092425 3300047322 Bacteria 2266
983 Ga0495680_0320898 3300047322 Bacteria 1084
984 Ga0495675_0000147 3300047444 Bacteria 49274
985 Ga0495675_0066110 3300047444 Bacteria 2286
986 Ga0495675_0301904 3300047444 Bacteria 951
987 Ga0495677_0115500 3300047445 Bacteria 1022
988 Ga0495679_020691 3300047446 Bacteria 2287
989 Ga0495681_0027851 3300047470 Bacteria 2918
990 Ga0495684_0028528 3300047471 Bacteria 4284
991 Ga0495684_0047645 3300047471 Bacteria 3278
992 Ga0495684_0066900 3300047471 Bacteria 2732
993 Ga0495684_0127008 3300047471 Bacteria 1918
994 Ga0495684_0336106 3300047471 Bacteria 1076
995 Ga0495593_0014970 3300047673 Bacteria 4403
996 Ga0495593_0110428 3300047673 Bacteria 1404
997 Ga0495602_0017376 3300048088 Bacteria 7212
998 Ga0495602_0095091 3300048088 Bacteria 2461
999 Ga0495602_0302117 3300048088 Bacteria 1171
1000 Ga0495602_0809023 3300048088 Bacteria 629
1001 Ga0495614_0016270 3300048089 Bacteria 3239
1002 Ga0495615_0285013 3300048090 Bacteria 532
1003 Ga0496100_0014640 3300048903 Bacteria 4559
1004 Ga0496100_0019150 3300048903 Bacteria 4077
1005 Ga0496100_0055392 3300048903 Bacteria 2590
1006 Ga0496100_0670068 3300048903 Bacteria 808
1007 Ga0496101_0005701 3300048904 Bacteria 7949
1008 Ga0496101_0030810 3300048904 Bacteria 3765
1009 Ga0496101_0038396 3300048904 Bacteria 3401
1010 Ga0496101_0040176 3300048904 Bacteria 3331
1011 Ga0496101_0118220 3300048904 Bacteria 2002
1012 Ga0496101_0347426 3300048904 Bacteria 1165
1013 Ga0496101_0718694 3300048904 Bacteria 788
1014 Ga0496102_0005090 3300048905 Bacteria 11137
1015 Ga0496102_0008860 3300048905 Bacteria 8634
1016 Ga0496102_0058807 3300048905 Bacteria 3513
1017 Ga0496102_0062689 3300048905 Bacteria 3404
1018 Ga0496102_0313371 3300048905 Bacteria 1478
1019 Ga0496102_0476294 3300048905 Bacteria 1169
1020 Ga0496102_0563766 3300048905 Bacteria 1061
1021 Ga0496103_0003997 3300048906 Bacteria 8957
1022 Ga0496103_0049774 3300048906 Bacteria 2591
1023 Ga0496103_0077497 3300048906 Bacteria 2086
1024 Ga0496103_0089875 3300048906 Bacteria 1937
1025 Ga0496103_0223957 3300048906 Bacteria 1209
1026 Ga0496104_0000431 3300048907 Bacteria 36365
1027 Ga0496104_0004143 3300048907 Bacteria 12587
1028 Ga0496104_0026643 3300048907 Bacteria 5341
1029 Ga0496104_0119489 3300048907 Bacteria 2530
1030 Ga0496104_0151649 3300048907 Bacteria 2224
1031 Ga0496104_0319108 3300048907 Bacteria 1466
1032 Ga0496104_0347710 3300048907 Bacteria 1395
1033 Ga0496104_0372043 3300048907 Bacteria 1341
1034 Ga0496104_1730800 3300048907 Bacteria 527
1035 Ga0496105_0003143 3300048908 Bacteria 12154
1036 Ga0496105_0011647 3300048908 Bacteria 6959
1037 Ga0496105_0030941 3300048908 Bacteria 4387
1038 Ga0496105_0035148 3300048908 Bacteria 4124
1039 Ga0496105_0052050 3300048908 Bacteria 3381
1040 Ga0496105_0092739 3300048908 Bacteria 2493
1041 Ga0496105_0341832 3300048908 Bacteria 1196
1042 Ga0496105_0403622 3300048908 Bacteria 1084
1043 Ga0496105_0539243 3300048908 Bacteria 912
1044 Ga0496105_0765951 3300048908 Bacteria 736
1045 Ga0496106_0006510 3300048909 Bacteria 8646
1046 Ga0496106_0006633 3300048909 Bacteria 8570
1047 Ga0496106_0025322 3300048909 Bacteria 4415
1048 Ga0496106_0028566 3300048909 Bacteria 4154
1049 Ga0496107_0015236 3300048910 Bacteria 5387
1050 Ga0496107_0016151 3300048910 Bacteria 5238
1051 Ga0496107_0031502 3300048910 Bacteria 3784
1052 Ga0496107_0034286 3300048910 Bacteria 3635
1053 Ga0496107_0286681 3300048910 Bacteria 1226
1054 Ga0496107_0509417 3300048910 Bacteria 892
1055 Ga0496107_0875251 3300048910 Bacteria 656
1056 Ga0496108_0004006 3300048911 Bacteria 11815
1057 Ga0496108_0029590 3300048911 Bacteria 4537
1058 Ga0496108_0049594 3300048911 Bacteria 3511
1059 Ga0496108_0188822 3300048911 Bacteria 1785
1060 Ga0496108_0496022 3300048911 Bacteria 1066
1061 Ga0496109_0000404 3300048912 Bacteria 38842
1062 Ga0496109_0032437 3300048912 Bacteria 4695
1063 Ga0496109_0062763 3300048912 Bacteria 3398
1064 Ga0496109_0111595 3300048912 Bacteria 2542
1065 Ga0496109_0160862 3300048912 Bacteria 2104
1066 Ga0496109_0276439 3300048912 Bacteria 1582
1067 Ga0496109_0582501 3300048912 Bacteria 1054
1068 Ga0496110_0001910 3300048913 Bacteria 15419
1069 Ga0496110_0035366 3300048913 Bacteria 4333
1070 Ga0496110_0144583 3300048913 Bacteria 2150
1071 Ga0496110_0153551 3300048913 Bacteria 2085
1072 Ga0496110_0156603 3300048913 Bacteria 2064
1073 Ga0496110_0179451 3300048913 Bacteria 1922
1074 Ga0496110_0756182 3300048913 Bacteria 875
1075 Ga0496111_0002312 3300048914 Bacteria 11466
1076 Ga0496111_0021244 3300048914 Bacteria 4530
1077 Ga0496111_0052032 3300048914 Bacteria 2957
1078 Ga0496111_0101642 3300048914 Bacteria 2112
1079 Ga0496111_0230705 3300048914 Bacteria 1375
1080 Ga0496112_0002963 3300048915 Bacteria 13850
1081 Ga0496112_0033447 3300048915 Bacteria 4998
1082 Ga0496112_0038890 3300048915 Bacteria 4647
1083 Ga0496112_0163683 3300048915 Bacteria 2190
1084 Ga0496112_0191834 3300048915 Bacteria 2005
1085 Ga0496112_0214013 3300048915 Bacteria 1884
1086 Ga0496112_0227988 3300048915 Bacteria 1818
1087 Ga0496112_0344731 3300048915 Bacteria 1433
1088 Ga0496112_0375277 3300048915 Bacteria 1363
1089 Ga0496112_0509676 3300048915 Bacteria 1138
1090 Ga0496113_0001735 3300048916 Bacteria 12339
1091 Ga0496113_0023714 3300048916 Bacteria 4353
1092 Ga0496113_0038693 3300048916 Bacteria 3508
1093 Ga0496113_0055173 3300048916 Bacteria 2977
1094 Ga0496114_0007969 3300048917 Bacteria 8384
1095 Ga0496114_0011998 3300048917 Bacteria 6930
1096 Ga0496114_0026647 3300048917 Bacteria 4734
1097 Ga0496114_0193555 3300048917 Bacteria 1780
1098 Ga0496115_0005562 3300048918 Bacteria 9168
1099 Ga0496115_0030415 3300048918 Bacteria 4248
1100 Ga0496115_0090149 3300048918 Bacteria 2504
1101 Ga0496115_0126837 3300048918 Bacteria 2102
1102 Ga0496115_0127301 3300048918 Bacteria 2098
1103 Ga0496115_0549087 3300048918 Bacteria 924
1104 Ga0496119_0361203 3300048922 Bacteria 701
1105 Ga0496126_0227298 3300048929 Bacteria 1565
1106 Ga0501032_0055099 3300049569 Bacteria 2675
1107 Ga0501032_0210740 3300049569 Bacteria 1267
1108 Ga0501032_0230049 3300049569 Bacteria 1205
1109 Ga0501032_0310667 3300049569 Bacteria 1018
1110 Ga0501033_0056452 3300049570 Bacteria 2902
1111 Ga0501033_0076983 3300049570 Bacteria 2448
1112 Ga0501033_0213753 3300049570 Bacteria 1374
1113 Ga0501034_0000089 3300049571 Bacteria 165644
1114 Ga0501034_0001928 3300049571 Bacteria 26276
1115 Ga0501034_0013803 3300049571 Bacteria 8313
1116 Ga0501034_0062587 3300049571 Bacteria 3737
1117 Ga0501034_0079663 3300049571 Bacteria 3279
1118 Ga0501034_0094307 3300049571 Bacteria 2989
1119 Ga0501034_0115064 3300049571 Bacteria 2678
1120 Ga0501034_0155648 3300049571 Bacteria 2259
1121 Ga0501034_0204376 3300049571 Bacteria 1932
1122 Ga0501034_0383137 3300049571 Bacteria 1331
1123 Ga0501034_1105629 3300049571 Bacteria 673
1124 Ga0501034_1342534 3300049571 Bacteria 591
1125 Ga0501036_0000939 3300049572 Bacteria 21877
1126 Ga0501036_0027820 3300049572 Bacteria 4779
1127 Ga0501036_0065300 3300049572 Bacteria 3080
1128 Ga0501036_0596290 3300049572 Bacteria 916
1129 Ga0501036_0803273 3300049572 Bacteria 775
1130 Ga0501037_0006892 3300049573 Bacteria 8299
1131 Ga0501037_0007211 3300049573 Bacteria 8123
1132 Ga0501037_0032070 3300049573 Bacteria 3879
1133 Ga0501037_0070788 3300049573 Bacteria 2537
1134 Ga0501037_0130420 3300049573 Bacteria 1803
1135 Ga0501037_0366637 3300049573 Bacteria 991
1136 Ga0501038_0011084 3300049574 Bacteria 8232
1137 Ga0501038_0020694 3300049574 Bacteria 5914
1138 Ga0501038_0093602 3300049574 Bacteria 2513
1139 Ga0501038_0163069 3300049574 Bacteria 1810
1140 Ga0501038_0180645 3300049574 Bacteria 1702
1141 Ga0501038_0186334 3300049574 Bacteria 1672
1142 Ga0501038_0256703 3300049574 Bacteria 1383
1143 Ga0501038_1056961 3300049574 Bacteria 594
1144 Ga0501039_0114908 3300049575 Bacteria 2106
1145 Ga0501039_0369568 3300049575 Bacteria 1127
1146 Ga0501040_0371016 3300049576 Bacteria 1026
1147 Ga0501041_0458884 3300049577 Bacteria 809
1148 Ga0501042_0350317 3300049578 Bacteria 1068
1149 Ga0501043_0001206 3300049579 Bacteria 22752
1150 Ga0501043_0017209 3300049579 Bacteria 5670
1151 Ga0501043_0046402 3300049579 Bacteria 3416
1152 Ga0501043_0126750 3300049579 Bacteria 2002
1153 Ga0501043_0127784 3300049579 Bacteria 1992
1154 Ga0501043_0363361 3300049579 Bacteria 1098
1155 Ga0501043_0439054 3300049579 Bacteria 982
1156 Ga0501046_0045583 3300049580 Bacteria 3483
1157 Ga0501046_0055684 3300049580 Bacteria 3106
1158 Ga0501046_0107057 3300049580 Bacteria 2139
1159 Ga0501046_0297421 3300049580 Bacteria 1179
1160 Ga0501046_0762529 3300049580 Bacteria 679
1161 Ga0501047_0000108 3300049581 Bacteria 101252
1162 Ga0501047_0019198 3300049581 Bacteria 6557
1163 Ga0501047_0025537 3300049581 Bacteria 5679
1164 Ga0501047_0026716 3300049581 Bacteria 5556
1165 Ga0501047_0071230 3300049581 Bacteria 3346
1166 Ga0501047_0649495 3300049581 Bacteria 874
1167 Ga0501047_1036189 3300049581 Bacteria 634
1168 Ga0501048_0000493 3300049582 Bacteria 27551
1169 Ga0501048_0318236 3300049582 Bacteria 1108
1170 Ga0501048_0883248 3300049582 Bacteria 643
1171 Ga0501048_0983869 3300049582 Bacteria 607
1172 Ga0501067_0073670 3300049583 Bacteria 1892
1173 Ga0501067_0093786 3300049583 Bacteria 1666
1174 Ga0501067_0094020 3300049583 Bacteria 1664
1175 Ga0501068_0015903 3300049584 Bacteria 4333
1176 Ga0501068_0020518 3300049584 Bacteria 3851
1177 Ga0501068_0034351 3300049584 Bacteria 3024
1178 Ga0501068_0037280 3300049584 Bacteria 2911
1179 Ga0501068_0216501 3300049584 Bacteria 1217
1180 Ga0501068_0327063 3300049584 Bacteria 983
1181 Ga0501068_0464142 3300049584 Bacteria 820
1182 Ga0501069_0015562 3300049585 Bacteria 4079
1183 Ga0501069_0045707 3300049585 Bacteria 2426
1184 Ga0501069_0050681 3300049585 Bacteria 2308
1185 Ga0501069_0067526 3300049585 Bacteria 2000
1186 Ga0501069_0535158 3300049585 Bacteria 700
1187 Ga0501070_0011892 3300049586 Bacteria 7350
1188 Ga0501070_0014072 3300049586 Bacteria 6735
1189 Ga0501070_0035357 3300049586 Bacteria 4175
1190 Ga0501070_0040072 3300049586 Bacteria 3907
1191 Ga0501070_0084044 3300049586 Bacteria 2635
1192 Ga0501070_0098991 3300049586 Bacteria 2412
1193 Ga0501070_0205471 3300049586 Bacteria 1617
1194 Ga0501070_0317514 3300049586 Bacteria 1267
1195 Ga0501070_0568244 3300049586 Bacteria 906
1196 Ga0501071_0095836 3300049587 Bacteria 2183
1197 Ga0501071_0188658 3300049587 Bacteria 1546
1198 Ga0501071_0263613 3300049587 Bacteria 1302
1199 Ga0501071_0306405 3300049587 Bacteria 1205
1200 Ga0501071_0504879 3300049587 Bacteria 928
1201 Ga0501072_0231686 3300049588 Bacteria 1471
1202 Ga0501072_0309354 3300049588 Bacteria 1256
1203 Ga0501072_0439428 3300049588 Bacteria 1033
1204 Ga0501072_0458229 3300049588 Bacteria 1009
1205 Ga0501073_0023624 3300049589 Bacteria 4412
1206 Ga0501073_0032267 3300049589 Bacteria 3734
1207 Ga0501073_0033637 3300049589 Bacteria 3649
1208 Ga0501073_0082743 3300049589 Bacteria 2233
1209 Ga0501073_0095315 3300049589 Bacteria 2067
1210 Ga0501073_0124288 3300049589 Bacteria 1788
1211 Ga0501073_0133256 3300049589 Bacteria 1722
1212 Ga0501074_0001683 3300049590 Bacteria 15063
1213 Ga0501074_0060299 3300049590 Bacteria 2733
1214 Ga0501074_0137681 3300049590 Bacteria 1747
1215 Ga0501074_0219011 3300049590 Bacteria 1355
1216 Ga0501074_0666259 3300049590 Bacteria 735
1217 Ga0501075_0657896 3300049591 Bacteria 799
1218 Ga0501076_0158078 3300049592 Bacteria 1846
1219 Ga0501079_0082316 3300049741 Bacteria 2489
1220 Ga0501079_0091325 3300049741 Bacteria 2359
1221 Ga0501079_0267791 3300049741 Bacteria 1335
1222 Ga0501079_0409050 3300049741 Bacteria 1064
1223 Ga0501079_0821377 3300049741 Bacteria 732
1224 Ga0501079_0847288 3300049741 Bacteria 720
1225 Ga0501080_0001065 3300049742 Bacteria 22565
1226 Ga0501080_0026663 3300049742 Bacteria 5369
1227 Ga0501080_0187422 3300049742 Bacteria 1902
1228 Ga0501080_0638796 3300049742 Bacteria 942
1229 Ga0501081_0050631 3300049743 Bacteria 2861
1230 Ga0501083_0006385 3300049744 Bacteria 8356
1231 Ga0501083_0019929 3300049744 Bacteria 4668
1232 Ga0501083_0030750 3300049744 Bacteria 3686
1233 Ga0501083_0175332 3300049744 Bacteria 1401
1234 Ga0501083_0435178 3300049744 Bacteria 853
1235 Ga0501083_0537039 3300049744 Bacteria 761
1236 Ga0501035_0001940 3300049822 Bacteria 20709
1237 Ga0501035_0011937 3300049822 Bacteria 8039
1238 Ga0501035_0114912 3300049822 Bacteria 2356
1239 Ga0501035_0194431 3300049822 Bacteria 1743
1240 Ga0501035_0740284 3300049822 Bacteria 790
1241 Ga0501035_0750151 3300049822 Bacteria 783
1242 Ga0501035_0890801 3300049822 Bacteria 705
1243 Ga0501044_0000457 3300049823 Bacteria 49748
1244 Ga0501044_0000998 3300049823 Bacteria 34042
1245 Ga0501044_0063861 3300049823 Bacteria 3759
1246 Ga0501044_0065493 3300049823 Bacteria 3705
1247 Ga0501044_0067570 3300049823 Bacteria 3642
1248 Ga0501044_0078229 3300049823 Bacteria 3352
1249 Ga0501044_0154782 3300049823 Bacteria 2272
1250 Ga0501044_0221125 3300049823 Bacteria 1844
1251 Ga0501044_0265525 3300049823 Bacteria 1654
1252 Ga0501044_0680119 3300049823 Bacteria 916
1253 Ga0501044_0690114 3300049823 Bacteria 907
1254 Ga0501044_0876869 3300049823 Bacteria 773
1255 Ga0501044_1009884 3300049823 Bacteria 703
1256 Ga0501045_0309138 3300049824 Bacteria 1176
1257 nmdc:mga03683_424032_c1 3300050489 Bacteria 638
1258 nmdc:mga03683_51330_c1 3300050489 Bacteria 1721
1259 nmdc:mga03683_76607_c1 3300050489 Bacteria 1438
1260 nmdc:mga03n38_141272_c1 3300050490 Bacteria 1203
1261 nmdc:mga03n38_225140_c1 3300050490 Bacteria 981
1262 nmdc:mga03n38_36768_c1 3300050490 Bacteria 2107
1263 nmdc:mga00v17_16761_c1 3300050491 Bacteria 4133
1264 nmdc:mga00v17_17630_c1 3300050491 Bacteria 4046
1265 nmdc:mga00v17_221874_c1 3300050491 Bacteria 1224
1266 nmdc:mga00v17_23425_c1 3300050491 Bacteria 3571
1267 nmdc:mga00v17_250682_c1 3300050491 Bacteria 1148
1268 nmdc:mga00v17_304384_c1 3300050491 Bacteria 1035
1269 nmdc:mga0yw44_104888_c1 3300050492 Bacteria 1805
1270 nmdc:mga0yw44_1096250_c1 3300050492 Bacteria 538
1271 nmdc:mga0yw44_264534_c1 3300050492 Bacteria 934
1272 nmdc:mga0yw44_458855_c1 3300050492 Bacteria 864
1273 nmdc:mga0yw44_699616_c1 3300050492 Bacteria 688
1274 nmdc:mga0yw44_764880_c1 3300050492 Bacteria 656
1275 nmdc:mga0yw44_8452_c1 3300050492 Bacteria 5132
1276 nmdc:mga0k408_2858_c1 3300050493 Bacteria 9168
1277 nmdc:mga06z11_140328_c1 3300050494 Bacteria 1365
1278 nmdc:mga06z11_163592_c1 3300050494 Bacteria 1273
1279 nmdc:mga06z11_211578_c1 3300050494 Bacteria 1130
1280 nmdc:mga06z11_231076_c1 3300050494 Bacteria 1084
1281 nmdc:mga06z11_243294_c1 3300050494 Bacteria 1057
1282 nmdc:mga06z11_24562_c1 3300050494 Bacteria 2845
1283 nmdc:mga06z11_275809_c1 3300050494 Bacteria 995
1284 nmdc:mga06z11_2837_c1 3300050494 Bacteria 6650
1285 nmdc:mga06z11_353853_c1 3300050494 Bacteria 879
1286 nmdc:mga06z11_626523_c1 3300050494 Bacteria 655
1287 nmdc:mga04h51_14443_c1 3300050495 Bacteria 2256
1288 nmdc:mga04h51_226413_c1 3300050495 Bacteria 743
1289 nmdc:mga04h51_26351_c1 3300050495 Bacteria 1797
1290 nmdc:mga04h51_29121_c1 3300050495 Bacteria 1728
1291 nmdc:mga04h51_338720_c1 3300050495 Bacteria 620
1292 nmdc:mga04h51_50945_c1 3300050495 Bacteria 1389
1293 nmdc:mga07m45_146238_c1 3300050496 Bacteria 1370
1294 nmdc:mga07m45_208873_c1 3300050496 Bacteria 1136
1295 nmdc:mga07m45_218408_c1 3300050496 Bacteria 1109
1296 nmdc:mga07m45_577798_c1 3300050496 Bacteria 649
1297 nmdc:mga07m45_70189_c1 3300050496 Bacteria 1993
1298 nmdc:mga05p37_30731_c1 3300050507 Bacteria 6554
1299 nmdc:mga05p37_357158_c1 3300050507 Bacteria 1719
1300 nmdc:mga05p37_36596_c1 3300050507 Bacteria 6020
1301 nmdc:mga05p37_368829_c1 3300050507 Bacteria 1685
1302 nmdc:mga05p37_64392_c1 3300050507 Bacteria 1438
1303 nmdc:mga09592_190239_c1 3300050508 Bacteria 1776
1304 nmdc:mga0qj67_180918_c1 3300050509 Bacteria 1712
1305 nmdc:mga06r32_54186_c1 3300050510 Bacteria 3845
1306 nmdc:mga08y16_362536_c1 3300050511 Bacteria 1488
1307 nmdc:mga08y16_507552_c1 3300050511 Bacteria 1224
1308 nmdc:mga0n895_125540_c1 3300050512 Bacteria 2590
1309 nmdc:mga0n895_2911_c1 3300050512 Bacteria 13576
1310 nmdc:mga0n895_35380_c1 3300050512 Bacteria 4815
1311 nmdc:mga0n895_576084_c1 3300050512 Bacteria 1130
1312 nmdc:mga0rr50_187927_c1 3300050513 Bacteria 1692
1313 nmdc:mga0rr50_71104_c1 3300050513 Bacteria 2654
1314 nmdc:mga08x19_292984_c1 3300050514 Bacteria 1129
1315 nmdc:mga08x19_38629_c1 3300050514 Bacteria 3032
1316 nmdc:mga0a205_190118_c1 3300050515 Bacteria 1945
1317 nmdc:mga0a205_334238_c1 3300050515 Bacteria 1384
1318 nmdc:mga0a205_7768_c1 3300050515 Bacteria 9737
1319 nmdc:mga0sz30_134193_c1 3300050516 Bacteria 1092
1320 nmdc:mga0sz30_2969_c1 3300050516 Bacteria 6083
1321 Ga0495601_0001750 3300053077 Bacteria 12016
1322 Ga0495601_0002382 3300053077 Bacteria 10661
1323 Ga0495601_0006675 3300053077 Bacteria 6756
1324 Ga0495601_0081671 3300053077 Bacteria 2074
1325 Ga0495601_0101403 3300053077 Bacteria 1859
1326 Ga0495612_0008869 3300053078 Bacteria 4073
1327 Ga0495612_0027993 3300053078 Bacteria 2267
1328 Ga0495612_0052294 3300053078 Bacteria 1680
1329 Ga0495612_0117550 3300053078 Bacteria 1142
1330 Ga0500610_0228732 3300053079 Bacteria 874
1331 Ga0495655_0236117 3300053083 Bacteria 610
1332 Ga0495595_0000576 3300053084 Bacteria 14034
1333 Ga0495595_0007184 3300053084 Bacteria 4551
1334 Ga0495595_0032435 3300053084 Bacteria 2353
1335 Ga0495595_0092899 3300053084 Bacteria 1449
1336 Ga0495595_0203348 3300053084 Bacteria 986
1337 Ga0495595_0550449 3300053084 Bacteria 589
1338 Ga0495619_0000132 3300053085 Bacteria 55452
1339 Ga0495619_0000178 3300053085 Bacteria 46773
1340 Ga0495619_0003001 3300053085 Bacteria 10960
1341 Ga0495619_0037425 3300053085 Bacteria 3161
1342 Ga0495619_0068325 3300053085 Bacteria 2373
1343 Ga0500643_004941 3300053087 Bacteria 5862
1344 Ga0500644_0001366 3300053088 Bacteria 6514
1345 Ga0500646_0130426 3300053090 Bacteria 816
1346 Ga0500583_0090895 3300053092 Bacteria 1486
1347 Ga0500651_0447757 3300053093 Bacteria 719
1348 Ga0500566_0067107 3300053094 Bacteria 2020
1349 Ga0500566_0067583 3300053094 Bacteria 2012
1350 Ga0500566_0327303 3300053094 Bacteria 711
1351 Ga0500641_0024406 3300053096 Bacteria 2331
1352 Ga0500654_104851 3300053099 Bacteria 1187
1353 Ga0500593_002852 3300053117 Bacteria 6417
1354 Ga0500594_0278893 3300053118 Bacteria 559
1355 Ga0500595_000001 3300053119 Bacteria 1088438
1356 Ga0500595_061203 3300053119 Bacteria 1136
1357 Ga0500595_068320 3300053119 Bacteria 1059
1358 Ga0500597_128940 3300053120 Bacteria 1094
1359 Ga0500642_0036021 3300053130 Bacteria 2106
1360 Ga0500642_0100336 3300053130 Bacteria 1346
1361 Ga0500652_000043 3300053131 Bacteria 64726
1362 Ga0500652_019276 3300053131 Bacteria 2531
1363 Ga0500577_0066345 3300053142 Bacteria 1403
1364 Ga0500577_0236772 3300053142 Bacteria 792
1365 Ga0500616_0000001 3300053153 Bacteria 1986011
1366 Ga0500616_0018461 3300053153 Bacteria 3944
1367 Ga0500622_0032344 3300053156 Bacteria 2743
1368 Ga0500622_0275325 3300053156 Bacteria 728
1369 Ga0500627_0126477 3300053158 Bacteria 1154
1370 Ga0500636_0022293 3300053177 Bacteria 3749
1371 Ga0500636_0228656 3300053177 Bacteria 964
1372 Ga0500611_008670 3300053727 Bacteria 1583
1373 Ga0500645_000913 3300053730 Bacteria 16992
1374 Ga0500609_001854 3300053731 Bacteria 3064
1375 Ga0501084_0977272 3300054114 Bacteria 712
1376 Ga0501084_1049892 3300054114 Bacteria 684
1377 Ga0501084_1329780 3300054114 Bacteria 602
1378 Ga0501084_1399725 3300054114 Bacteria 586
1379 Ga0501082_0018450 3300060353 Bacteria 6010
1380 Ga0501082_0230530 3300060353 Bacteria 1612
1381 Ga0501082_0244844 3300060353 Bacteria 1560
1382 Ga0501082_0392979 3300060353 Bacteria 1210
1383 Ga0501082_0569340 3300060353 Bacteria 991
1384 Ga0466962_0154826 3300061719 Bacteria 1113
1385 Ga0530510_0215513 3300061734 Bacteria 1426
1386 2643757891 2643221547 Bacteria 4740017
1387 Ga0068851_10121186
1388 JGI24746J21847_1001422
1389 JGI24743J22301_10000943
1390 JGI24743J22301_10001063
1391 JGI24735J21928_10122033
1392 JGI24750J21931_1001324
1393 JGI24745J21846_1024265
1394 JGI24738J21930_10017677
1395 JGI24749J21850_1006538
1396 JGI24744J21845_10001216
1397 JGI24033J26618_1023504
1398 JGI24742J22300_10012337
1399 JGI24751J29686_10004135
1400 JGI25405J52794_10007754
1401 Ga0058859_11818714
1402 Ga0065715_10767562
1403 Ga0065707_10046659
1404 Ga0065707_10139584
1405 Ga0065707_10163520
1406 Ga0070658_10025964
1407 Ga0070658_10146995
1408 Ga0070658_10279641
1409 Ga0070676_10024250
1410 Ga0070676_10274875
1411 Ga0070683_100092767
1412 Ga0070683_100483370
1413 Ga0070683_101318005
1414 Ga0070690_100002546
1415 Ga0070690_100777856
1416 Ga0070670_100005236
1417 Ga0070670_100048292
1418 Ga0068869_100016497
1419 Ga0068869_100056415
1420 Ga0068869_100432580
1421 Ga0068869_100693738
1422 Ga0070666_10046576
1423 Ga0070680_100043520
1424 Ga0070680_100066652
1425 Ga0070680_100261566
1426 Ga0070680_100310594
1427 Ga0070680_100407083
1428 Ga0070680_100496378
1429 Ga0070680_100514255
1430 Ga0070680_100571215
1431 Ga0070682_100034178
1432 Ga0070682_100126832
1433 Ga0070682_100720667
1434 Ga0068868_100003086
1435 Ga0068868_100020299
1436 Ga0068868_100087352
1437 Ga0068868_100526545
1438 Ga0070660_100010850
1439 Ga0070660_100409712
1440 Ga0070689_100003434
1441 Ga0070689_100029697
1442 Ga0070689_100215663
1443 Ga0070687_100034735
1444 Ga0070687_100043598
1445 Ga0070661_100047641
1446 Ga0070661_100047671
1447 Ga0070661_100256635
1448 Ga0070692_10008804
1449 Ga0070669_100127010
1450 Ga0070669_100492346
1451 Ga0070669_101065855
1452 Ga0070675_100039707
1453 Ga0070675_100375302
1454 Ga0070675_100468279
1455 Ga0070675_100915966
1456 Ga0070671_100066484
1457 Ga0070671_100091145
1458 Ga0070671_100279237
1459 Ga0070674_100050261
1460 Ga0070674_100176129
1461 Ga0070674_100917551
1462 Ga0070673_100061221
1463 Ga0070673_100189697
1464 Ga0070673_100588719
1465 Ga0070688_100005196
1466 Ga0070688_100050977
1467 Ga0070688_100414492
1468 Ga0070659_100032102
1469 Ga0070659_100042897
1470 Ga0070659_100083017
1471 Ga0070659_100559234
1472 Ga0070659_100678522
1473 Ga0070667_100099728
1474 Ga0070709_10283637
1475 Ga0070709_10586636
1476 Ga0070709_10771220
1477 Ga0070714_100035153
1478 Ga0070714_100066297
1479 Ga0070714_100310702
1480 Ga0070713_100010421
1481 Ga0070713_100021777
1482 Ga0070713_100162501
1483 Ga0070710_10014806
1484 Ga0070710_10035879
1485 Ga0070710_10081214
1486 Ga0070710_10263827
1487 Ga0070701_10001300
1488 Ga0070701_10140015
1489 Ga0070711_100084187
1490 Ga0070711_100247468
1491 Ga0070711_100414205
1492 Ga0070711_100433901
1493 Ga0070711_100572298
1494 Ga0070705_100149675
1495 Ga0070700_100011750
1496 Ga0070700_100220337
1497 Ga0070708_100273033
1498 Ga0070708_100651795
1499 Ga0070663_100028875
1500 Ga0070663_100293346
1501 Ga0070663_101557402
1502 Ga0070678_100048644
1503 Ga0070678_100055189
1504 Ga0070678_100200529
1505 Ga0070678_100205458
1506 Ga0070678_100315879
1507 Ga0070662_100034665
1508 Ga0070662_100103951
1509 Ga0070662_100232464
1510 Ga0070662_100581643
1511 Ga0070662_100637882
1512 Ga0070681_10016513
1513 Ga0070681_10396383
1514 Ga0070681_10503935
1515 Ga0068867_100031738
1516 Ga0068867_100381106
1517 Ga0068867_100979031
1518 Ga0068867_101065547
1519 Ga0070685_10011992
1520 Ga0070685_10233939
1521 Ga0070679_100033661
1522 Ga0070679_100063548
1523 Ga0070679_100182104
1524 Ga0070679_100190909
1525 Ga0070679_100198143
1526 Ga0070679_100222283
1527 Ga0070684_100076754
1528 Ga0070684_100163107
1529 Ga0070684_100174253
1530 Ga0070697_100071761
1531 Ga0070697_101135207
1532 Ga0068853_100232868
1533 Ga0068853_100239340
1534 Ga0068853_100395245
1535 Ga0068853_100630884
1536 Ga0070672_100215685
1537 Ga0070672_100357537
1538 Ga0070686_100009403
1539 Ga0070686_100036878
1540 Ga0070686_100059554
1541 Ga0070686_100313887
1542 Ga0070695_100033983
1543 Ga0070695_100441454
1544 Ga0070693_100082579
1545 Ga0070693_100142215
1546 Ga0070665_100043641
1547 Ga0070704_100002201
1548 Ga0070704_100058274
1549 Ga0068855_100033639
1550 Ga0068855_100095264
1551 Ga0068855_100384545
1552 Ga0068855_100912698
1553 Ga0068855_100988370
1554 Ga0070664_100130899
1555 Ga0070664_100539966
1556 Ga0068857_100079852
1557 Ga0068857_100519577
1558 Ga0068856_100251766
1559 Ga0068856_100354130
1560 Ga0068856_101145474
1561 Ga0068856_101411532
1562 Ga0070702_100002073
1563 Ga0070702_100064308
1564 Ga0070702_100112578
1565 Ga0070702_100180227
1566 Ga0068852_100017739
1567 Ga0068852_100032297
1568 Ga0068852_100055851
1569 Ga0068852_100109132
1570 Ga0068852_101076701
1571 Ga0068859_100014564
1572 Ga0068859_100228480
1573 Ga0068864_100005707
1574 Ga0068864_100146517
1575 Ga0068864_100180677
1576 Ga0068864_100196550
1577 Ga0068864_100241964
1578 Ga0068864_101324956
1579 Ga0068866_10101073
1580 Ga0068866_10254189
1581 Ga0068866_10333805
1582 Ga0068861_100005727
1583 Ga0068861_100674542
1584 Ga0068870_10002924
1585 Ga0068863_100047412
1586 Ga0068863_100424857
1587 Ga0068863_100475979
1588 Ga0068863_101108543
1589 Ga0068863_101124962
1590 Ga0068858_100014295
1591 Ga0068858_100120659
1592 Ga0068858_100264879
1593 Ga0068860_100059288
1594 Ga0068860_100420949
1595 Ga0068860_100453279
1596 Ga0068860_101013167
1597 Ga0068862_100003247
1598 Ga0068862_100098160
1599 Ga0068862_100801179
1600 Ga0081455_10007598
1601 Ga0081455_10011036
1602 Ga0081455_10011972
1603 Ga0081455_10145108
1604 Ga0081538_10066339
1605 Ga0081538_10095102
1606 Ga0081540_1010582
1607 Ga0081540_1054952
1608 Ga0081540_1060030
1609 Ga0081539_10001661
1610 Ga0070717_10004108
1611 Ga0070717_10029876
1612 Ga0070717_10159237
1613 Ga0070717_10226271
1614 Ga0075365_10014447
1615 Ga0075365_10020051
1616 Ga0075365_10037653
1617 Ga0075365_10121452
1618 Ga0075365_10237213
1619 Ga0075365_10452463
1620 Ga0075368_10020274
1621 Ga0075368_10192590
1622 Ga0075368_10276328
1623 Ga0075368_10419524
1624 Ga0075363_100026782
1625 Ga0075363_100061239
1626 Ga0075363_100067201
1627 Ga0075363_100135950
1628 Ga0075363_100212868
1629 Ga0075363_100231472
1630 Ga0075363_100357059
1631 Ga0075363_100371148
1632 Ga0075364_10018301
1633 Ga0075364_10038276
1634 Ga0075364_10377523
1635 Ga0075364_10397650
1636 Ga0075364_10669778
1637 Ga0075432_10264905
1638 Ga0070715_10000720
1639 Ga0070715_10063278
1640 Ga0070715_10097752
1641 Ga0070715_10116932
1642 Ga0070716_100001889
1643 Ga0070716_100010508
1644 Ga0070716_100145713
1645 Ga0070716_100389665
1646 Ga0070712_100004033
1647 Ga0070712_100061863
1648 Ga0070712_100374650
1649 Ga0070712_100409988
1650 Ga0075362_10039557
1651 Ga0075362_10045310
1652 Ga0075362_10069781
1653 Ga0075367_10001316
1654 Ga0075367_10002916
1655 Ga0075367_10063008
1656 Ga0075367_10103936
1657 Ga0075367_10294336
1658 Ga0075367_10434289
1659 Ga0075367_10458801
1660 Ga0075367_10807620
1661 Ga0075369_10018330
1662 Ga0075369_10033265
1663 Ga0075369_10050752
1664 Ga0075369_10511074
1665 Ga0075366_10012444
1666 Ga0075366_10023107
1667 Ga0075366_10051353
1668 Ga0075366_10119067
1669 Ga0075366_10264575
1670 Ga0075366_10524970
1671 Ga0097621_100059823
1672 Ga0097621_100191505
1673 Ga0097621_100334205
1674 Ga0097621_101074706
1675 Ga0075370_10047361
1676 Ga0075370_10079080
1677 Ga0075370_10191128
1678 Ga0075370_10364188
1679 Ga0075370_10605688
1680 Ga0068871_100005491
1681 Ga0068871_100093724
1682 Ga0068871_100119621
1683 Ga0068871_100139509
1684 Ga0068871_100162960
1685 Ga0068871_100183445
1686 Ga0075428_100030184
1687 Ga0075428_100650920
1688 Ga0075428_102434721
1689 Ga0075431_100659652
1690 Ga0075431_100898433
1691 Ga0075433_10698076
1692 Ga0075434_100085876
1693 Ga0075434_100103939
1694 Ga0075434_100156042
1695 Ga0075434_100187475
1696 Ga0075434_100405874
1697 Ga0075429_100530133
1698 Ga0068865_100069839
1699 Ga0068865_100265917
1700 Ga0068865_100278061
1701 Ga0075436_100029917
1702 Ga0075436_100301414
1703 Ga0097620_100014563
1704 Ga0097620_100228484
1705 Ga0075435_100006092
1706 Ga0075435_100102310
1707 Ga0075435_100290415
1708 Ga0099795_10009154
1709 Ga0105250_10065204
1710 Ga0105240_10056226
1711 Ga0105240_10117882
1712 Ga0105240_10274810
1713 Ga0105240_11096065
1714 Ga0105240_11778359
1715 Ga0111539_10183045
1716 Ga0111539_10381342
1717 Ga0111539_11259560
1718 Ga0105245_10278620
1719 Ga0105245_10326187
1720 Ga0105245_10921301
1721 Ga0105247_10004828
1722 Ga0105247_10198780
1723 Ga0105247_10392558
1724 Ga0114129_10061242
1725 Ga0114129_10095382
1726 Ga0114129_10197097
1727 Ga0114129_10208543
1728 Ga0114129_10652695
1729 Ga0105243_10047635
1730 Ga0105243_10146727
1731 Ga0105243_10244089
1732 Ga0105243_10498700
1733 Ga0105243_10575201
1734 Ga0105243_11398543
1735 Ga0105241_10257903
1736 Ga0105241_10402151
1737 Ga0105242_10027348
1738 Ga0105242_10048559
1739 Ga0105242_10068809
1740 Ga0105242_10200080
1741 Ga0105248_10012305
1742 Ga0105248_10074998
1743 Ga0105248_10097925
1744 Ga0105248_10404753
1745 Ga0105248_12532992
1746 Ga0105237_10063614
1747 Ga0105237_10103380
1748 Ga0105238_10113642
1749 Ga0105238_10171734
1750 Ga0105238_10342858
1751 Ga0105238_11044904
1752 Ga0105249_10000366
1753 Ga0105249_10032153
1754 Ga0105249_10055253
1755 Ga0105249_10421066
1756 Ga0105249_10677854
1757 Ga0105249_13268909
1758 Ga0099796_10161233
1759 Ga0105239_10082645
1760 Ga0105239_10163984
1761 Ga0105239_10822535
1762 Ga0105239_11234049
1763 Ga0105239_11791739
1764 Ga0105246_10054178
1765 Ga0105246_10105727
1766 Ga0105246_10765605
1767 Ga0105246_11515320
1768 Ga0157346_1001067
1769 Ga0157315_1017040
1770 Ga0157373_10085737
1771 Ga0157371_10059021
1772 Ga0157371_10582183
1773 Ga0157370_10116838
1774 Ga0157370_10124689
1775 Ga0157370_10637614
1776 Ga0157370_10712379
1777 Ga0157369_10229201
1778 Ga0157369_10335996
1779 Ga0157369_10802702
1780 Ga0157374_10091851
1781 Ga0157374_10397952
1782 Ga0157374_11510137
1783 Ga0157378_10080426
1784 Ga0157378_10093499
1785 Ga0157378_10687797
1786 Ga0157372_10116237
1787 Ga0157375_10022311
1788 Ga0157375_10990293
1789 Ga0163163_10126580
1790 Ga0163163_10183790
1791 Ga0163163_10246684
1792 Ga0163163_10878867
1793 Ga0157380_10077598
1794 Ga0157380_10147233
1795 Ga0157380_11009929
1796 Ga0182008_10032425
1797 Ga0157377_10015614
1798 Ga0157377_10091494
1799 Ga0157377_10113348
1800 Ga0157379_10010974
1801 Ga0157379_10324966
1802 Ga0157379_10465813
1803 Ga0157379_10602530
1804 Ga0157376_10282950
1805 Ga0157376_11244548
1806 Ga0182007_10234096
1807 Ga0182005_1133320
1808 Ga0163161_10197530
1809 Ga0163161_10314456
1810 Ga0206356_11118909
1811 Ga0206354_10212022
1812 Ga0206353_10376412
1813 Ga0206353_10853757
1814 Ga0206353_11627131
1815 Ga0213872_10060323
1816 Ga0213872_10135485
1817 Ga0213876_10008421
1818 Ga0213876_10393722
1819 Ga0213875_10000031
1820 Ga0213875_10120279
1821 Ga0213875_10127419
1822 Ga0209233_1014532
1823 Ga0207682_10055792
1824 Ga0207692_10002654
1825 Ga0207692_10033904
1826 Ga0207692_10047511
1827 Ga0207692_10068942
1828 Ga0207692_10097832
1829 Ga0207710_10059418
1830 Ga0207688_10002814
1831 Ga0207688_10045009
1832 Ga0207688_10096148
1833 Ga0207680_10028876
1834 Ga0207680_10853700
1835 Ga0207647_10046289
1836 Ga0207685_10035901
1837 Ga0207685_10061390
1838 Ga0207685_10125559
1839 Ga0207685_10152884
1840 Ga0207685_10174019
1841 Ga0207699_10036496
1842 Ga0207699_10045331
1843 Ga0207699_10203490
1844 Ga0207699_10371678
1845 Ga0207699_10710092
1846 Ga0207699_11129440
1847 Ga0207645_10002945
1848 Ga0207645_10025104
1849 Ga0207643_10002845
1850 Ga0207643_10161260
1851 Ga0207705_10049781
1852 Ga0207705_10143820
1853 Ga0207705_10379135
1854 Ga0207684_10002963
1855 Ga0207654_10011794
1856 Ga0207654_10027072
1857 Ga0207654_10910837
1858 Ga0207707_10045230
1859 Ga0207707_10119083
1860 Ga0207707_10505509
1861 Ga0207707_10658336
1862 Ga0207695_10235929
1863 Ga0207695_10623058
1864 Ga0207695_10718183
1865 Ga0207695_11105559
1866 Ga0207671_10219760
1867 Ga0207671_10469263
1868 Ga0207693_10000825
1869 Ga0207693_10004273
1870 Ga0207693_10007085
1871 Ga0207693_10009090
1872 Ga0207693_10053018
1873 Ga0207693_10082455
1874 Ga0207693_10135084
1875 Ga0207693_10172403
1876 Ga0207663_10059104
1877 Ga0207663_10105854
1878 Ga0207663_10109082
1879 Ga0207663_10207397
1880 Ga0207663_10225145
1881 Ga0207663_10370903
1882 Ga0207663_10379286
1883 Ga0207663_10557903
1884 Ga0207663_11077550
1885 Ga0207660_10087246
1886 Ga0207660_10105093
1887 Ga0207660_10409140
1888 Ga0207660_10691008
1889 Ga0207660_11117308
1890 Ga0207662_10008927
1891 Ga0207662_10051522
1892 Ga0207662_10509100
1893 Ga0207657_10028698
1894 Ga0207657_10045555
1895 Ga0207657_10093700
1896 Ga0207649_10038210
1897 Ga0207649_10251877
1898 Ga0207649_10706584
1899 Ga0207652_10102361
1900 Ga0207652_10151429
1901 Ga0207652_10208051
1902 Ga0207652_10218154
1903 Ga0207652_10225012
1904 Ga0207652_10864760
1905 Ga0207681_10084122
1906 Ga0207681_10324738
1907 Ga0207694_10134797
1908 Ga0207694_10549584
1909 Ga0207694_10609454
1910 Ga0207650_10002572
1911 Ga0207650_10033447
1912 Ga0207650_10473508
1913 Ga0207659_10018147
1914 Ga0207687_10005621
1915 Ga0207687_10111414
1916 Ga0207687_10121271
1917 Ga0207700_10068719
1918 Ga0207700_10127513
1919 Ga0207700_10151584
1920 Ga0207700_10185594
1921 Ga0207700_10213529
1922 Ga0207700_10364038
1923 Ga0207700_11033398
1924 Ga0207700_11387789
1925 Ga0207664_10007232
1926 Ga0207664_10023737
1927 Ga0207664_10066940
1928 Ga0207664_10070473
1929 Ga0207664_10076974
1930 Ga0207664_10196941
1931 Ga0207644_10029417
1932 Ga0207644_10038563
1933 Ga0207644_10097299
1934 Ga0207644_10338694
1935 Ga0207644_11883285
1936 Ga0207690_10158979
1937 Ga0207706_10001336
1938 Ga0207706_10108352
1939 Ga0207706_10255971
1940 Ga0207706_10268663
1941 Ga0207706_10878002
1942 Ga0207686_10023636
1943 Ga0207686_10056288
1944 Ga0207686_10392290
1945 Ga0207686_10625514
1946 Ga0207709_10003540
1947 Ga0207709_10124088
1948 Ga0207670_10035722
1949 Ga0207670_10160451
1950 Ga0207669_10029074
1951 Ga0207669_10160665
1952 Ga0207704_10052137
1953 Ga0207704_10173913
1954 Ga0207704_10202384
1955 Ga0207665_10001068
1956 Ga0207665_10003817
1957 Ga0207665_10040571
1958 Ga0207665_10130207
1959 Ga0207665_10291151
1960 Ga0207691_10000635
1961 Ga0207711_10010280
1962 Ga0207711_10036737
1963 Ga0207711_10069609
1964 Ga0207711_10602185
1965 Ga0207689_10003641
1966 Ga0207689_10024648
1967 Ga0207689_10046276
1968 Ga0207661_10035883
1969 Ga0207661_10131898
1970 Ga0207661_10412446
1971 Ga0207679_10014282
1972 Ga0207679_10652239
1973 Ga0207679_10816047
1974 Ga0207667_10036413
1975 Ga0207667_10072960
1976 Ga0207667_10151081
1977 Ga0207667_10762693
1978 Ga0207667_11455545
1979 Ga0207651_10048486
1980 Ga0207712_10002399
1981 Ga0207668_10031104
1982 Ga0207668_10473718
1983 Ga0207668_11580275
1984 Ga0207640_10041977
1985 Ga0207640_10379314
1986 Ga0207640_11008770
1987 Ga0207658_10046077
1988 Ga0207677_10004734
1989 Ga0207677_10041256
1990 Ga0207677_11304936
1991 Ga0207703_10012768
1992 Ga0207703_10287925
1993 Ga0207703_11426111
1994 Ga0207639_10342757
1995 Ga0207639_10419380
1996 Ga0207639_10442090
1997 Ga0207678_10004902
1998 Ga0207678_10010341
1999 Ga0207678_10551135
2000 Ga0207708_10001330
2001 Ga0207708_10162321
2002 Ga0207702_10039530
2003 Ga0207702_10069314
2004 Ga0207702_10536090
2005 Ga0207641_10019656
2006 Ga0207641_10189502
2007 Ga0207641_11079858
2008 Ga0207641_11141361
2009 Ga0207648_10003105
2010 Ga0207648_10302535
2011 Ga0207648_11378156
2012 Ga0207676_10024382
2013 Ga0207676_10042058
2014 Ga0207676_10137329
2015 Ga0207676_11481023
2016 Ga0207674_10333373
2017 Ga0207675_100004255
2018 Ga0207675_100238194
2019 Ga0207675_100400593
2020 Ga0207683_10004806
2021 Ga0207683_10007077
2022 Ga0207683_10023723
2023 Ga0207683_10065336
2024 Ga0207683_10156650
2025 Ga0207698_10014590
2026 Ga0207698_10019033
2027 Ga0207698_10408090
2028 Ga0209179_1005113
2029 Ga0209813_10010282
2030 Ga0209813_10022000
2031 Ga0209813_10185473
2032 Ga0207428_10212984
2033 Ga0207428_10268096
2034 Ga0268266_10026518
2035 Ga0268266_10137663
2036 Ga0268266_10681102
2037 Ga0268265_10003591
2038 Ga0268265_10678934
2039 Ga0268264_10005325
2040 Ga0265337_1018778
2041 Ga0265318_10004032
2042 Ga0265330_10007771
2043 Ga0265330_10034373
2044 Ga0265332_10002695
2045 Ga0265332_10012389
2046 Ga0265328_10050582
2047 Ga0265320_10018493
2048 Ga0265325_10004992
2049 Ga0265325_10016894
2050 Ga0265325_10025118
2051 Ga0265325_10025624
2052 Ga0265325_10036101
2053 Ga0265329_10012587
2054 Ga0265329_10031690
2055 Ga0265340_10004865
2056 Ga0265340_10063523
2057 Ga0265340_10122473
2058 Ga0265340_10168967
2059 Ga0265339_10004645
2060 Ga0265339_10010159
2061 Ga0265339_10013807
2062 Ga0265331_10007949
2063 Ga0265331_10012924
2064 Ga0265316_10017769
2065 Ga0265316_10025046
2066 Ga0265316_10034592
2067 Ga0265316_10094403
2068 Ga0307513_10115927
2069 Ga0307513_10402560
2070 Ga0265313_10002478
2071 Ga0265313_10022841
2072 Ga0265313_10035654
2073 Ga0265313_10068739
2074 Ga0265313_10187543
2075 Ga0316575_10043017
2076 Ga0316579_10146555
2077 Ga0265314_10060775
2078 Ga0265314_10087405
2079 Ga0265314_10142508
2080 Ga0265342_10000092
2081 Ga0265342_10000983
2082 Ga0265342_10014308
2083 Ga0316576_10182607
2084 Ga0316578_10015600
2085 Ga0316578_10337639
2086 Ga0307405_11398694
2087 Ga0307409_100480786
2088 Ga0316583_10193944
2089 Ga0373930_0014853
2090 Ga0373948_0001761
2091 Ga0373950_0050463
2092 Ga0373950_0051664
2093 Ga0373958_0006709
2094 Ga0373959_0002292
2095 Ga0373938_0014292
2096 Ga0373926_0021500
2097 Ga0373926_0023001
2098 Ga0373926_0122552
2099 Ga0373929_0017613
2100 Ga0373929_0020957
2101 Ga0373929_0179757
2102 Ga0373940_0019255
2103 Ga0373944_0003559
2104 Ga0373944_0005088
2105 Ga0373944_0308046
2106 Ga0373949_0096076
2107 Ga0373951_0001694
2108 Ga0373951_0075012
2109 Ga0373952_0003947
2110 Ga0373923_0033073
2111 Ga0373923_0257390
2112 Ga0373932_0114190
2113 Ga0373936_0005473
2114 Ga0373939_0096441
2115 Ga0373941_0017500
2116 Ga0373941_0130301
2117 Ga0373945_0018914
2118 Ga0373945_0029086
2119 Ga0373945_0033872
2120 Ga0373945_0326891
2121 Ga0373953_0007986
2122 Ga0373953_0014564
2123 Ga0373954_0006853
2124 Ga0373954_0117790
2125 Ga0373954_0130238
2126 Ga0373956_0018386
2127 Ga0373956_0043454
2128 Ga0373956_0062504
2129 Ga0373956_0216390
2130 Ga0373957_0006573
2131 Ga0373957_0006843
2132 Ga0373957_0147333
2133 Ga0373960_0044241
2134 Ga0373960_0184427
2135 Ga0373943_0002330
2136 Ga0373943_0280058
2137 Ga0373946_0007021
2138 Ga0373946_0008539
2139 Ga0373946_0011321
2140 Ga0373946_0394515
2141 Ga0373946_0544091
2142 Ga0373955_0001883
2143 Ga0373955_0471865
2144 Ga0373942_0322324
2145 Ga0373961_0002014
2146 Ga0373961_0019548
2147 Ga0373961_0034548
2148 Ga0373961_0314726
2149 Ga0373962_0001403
2150 Ga0316574_0060391
2151 Ga0373924_0117763
2152 Ga0373924_0147059
2153 Ga0373931_0001882
2154 Ga0373931_0008995
2155 Ga0373931_0027332
2156 Ga0373935_0002676
2157 Ga0373935_0047198
2158 Ga0373935_0128655
2159 Ga0373935_0159944
2160 Ga0373927_0010750
2161 Ga0373927_0023475
2162 Ga0373927_0119628
2163 Ga0373927_0217060
2164 Ga0373927_0355443
2165 Ga0373933_0002112
2166 Ga0373933_0010711
2167 Ga0373947_0001553
2168 Ga0373947_0098441
2169 Ga0373947_0144790
2170 Ga0373947_0276995
2171 Ga0373947_0393855
2172 Ga0373947_0596989
2173 Ga0373937_0002048
2174 Ga0373937_0007361
2175 Ga0373937_0050920
2176 Ga0373937_0118279
2177 Ga0373937_1003849
2178 Ga0316582_0047745
2179 Ga0316582_0365261
2180 Ga0316584_0026489
2181 Ga0373925_0008896
2182 Ga0373925_0189534
2183 Ga0373925_0309072
2184 Ga0373925_0355153
2185 Ga0395899_0013226
2186 Ga0395899_0053827
2187 Ga0395900_0006301
2188 Ga0395900_0007225
2189 Ga0395900_0042502
2190 Ga0395898_0037430
2191 Ga0395898_0063745
2192 Ga0395898_0235150
2193 Ga0316581_0037028
2194 Ga0436364_0793438
2195 Ga0436364_1132027
2196 Ga0395901_0028459
2197 Ga0395901_0036482
2198 Ga0395901_0070801
2199 Ga0436365_0030899
2200 Ga0436365_0589402
2201 Ga0436365_1138630
2202 Ga0436365_1500007
2203 Ga0436365_1653395
2204 Ga0436365_1701023
2205 Ga0436360_0004969
2206 Ga0436360_0167135
2207 Ga0436361_0889648
2208 Ga0436361_0986695
2209 Ga0436361_1183143
2210 Ga0436363_0535034
2211 Ga0436362_0367554
2212 Ga0436362_0381093
2213 Ga0436362_0550311
2214 Ga0451793_0823115
2215 Ga0466966_0834581
2216 Ga0466963_0399849
2217 Ga0466971_0121780
2218 Ga0466957_0225911
2219 Ga0466957_0264244
2220 Ga0466957_0268110
2221 Ga0466957_1165514
2222 Ga0466959_0411348
2223 Ga0466958_0094962
2224 Ga0466958_0331628
2225 Ga0466958_0632706
2226 Ga0466967_0211963
2227 Ga0466967_1646740
2228 Ga0495617_058596
2229 Ga0495592_0004699
2230 Ga0495592_0014796
2231 Ga0495592_0041714
2232 Ga0495592_0347945
2233 Ga0495603_0025855
2234 Ga0495603_0033915
2235 Ga0495603_0221869
2236 Ga0495590_0348954
2237 Ga0495629_0003044
2238 Ga0495629_0177976
2239 Ga0495638_0006650
2240 Ga0495638_0046393
2241 Ga0495641_0016811
2242 Ga0495641_0039453
2243 Ga0495651_0002035
2244 Ga0495651_0010719
2245 Ga0495651_0279307
2246 Ga0495653_0065475
2247 Ga0495653_0089810
2248 Ga0495580_0222311
2249 Ga0495580_0375312
2250 Ga0495580_0429890
2251 Ga0495582_0003239
2252 Ga0495582_0103214
2253 Ga0495605_0097627
2254 Ga0495662_0018960
2255 Ga0495662_0349252
2256 Ga0495664_0030072
2257 Ga0495584_0142625
2258 Ga0495584_0198472
2259 Ga0495584_0219334
2260 Ga0495585_0000856
2261 Ga0495585_0028456
2262 Ga0495594_0231035
2263 Ga0495608_0000915
2264 Ga0495616_0000405
2265 Ga0495616_0254436
2266 Ga0495618_0009502
2267 Ga0495618_0544478
2268 Ga0495620_0278241
2269 Ga0495628_0008958
2270 Ga0495628_0083828
2271 Ga0495630_0009867
2272 Ga0495630_0430163
2273 Ga0495632_0071653
2274 Ga0495637_0070180
2275 Ga0495643_0229787
2276 Ga0495644_0033593
2277 Ga0495663_0402127
2278 Ga0495666_0028495
2279 Ga0495666_0120708
2280 Ga0495666_0467390
2281 Ga0495642_0227908
2282 Ga0495652_0005789
2283 Ga0495652_0053448
2284 Ga0495652_0150117
2285 Ga0495652_0192140
2286 Ga0495652_0356333
2287 Ga0495665_0019335
2288 Ga0495665_0113061
2289 Ga0495665_0132447
2290 Ga0495665_0153177
2291 Ga0495640_0071044
2292 Ga0495640_0256964
2293 Ga0495640_0270213
2294 Ga0495640_0296216
2295 Ga0495640_0432324
2296 Ga0495640_0787677
2297 Ga0495586_0085835
2298 Ga0495586_0404665
2299 Ga0495587_0001734
2300 Ga0495598_0010894
2301 Ga0495609_0416845
2302 Ga0495621_0074061
2303 Ga0495645_0011672
2304 Ga0495645_0086453
2305 Ga0495622_0018384
2306 Ga0495633_0017034
2307 Ga0495667_0000259
2308 Ga0495667_0014619
2309 Ga0495656_0000215
2310 Ga0495656_0217611
2311 Ga0495668_0106370
2312 Ga0495668_0225302
2313 Ga0495634_0008814
2314 Ga0495634_0451287
2315 Ga0495611_0010807
2316 Ga0495635_0010301
2317 Ga0495635_0028478
2318 Ga0495635_0460497
2319 Ga0495659_0002574
2320 Ga0495659_0346154
2321 Ga0495661_0364002
2322 Ga0495657_0003179
2323 Ga0495657_0125454
2324 Ga0495599_0002681
2325 Ga0495646_0010194
2326 Ga0495646_0026632
2327 Ga0495647_0003634
2328 Ga0495647_0072747
2329 Ga0495647_0178586
2330 Ga0495658_0000360
2331 Ga0495658_0005781
2332 Ga0495658_0114114
2333 Ga0495669_0167915
2334 Ga0495613_0006693
2335 Ga0495613_0027827
2336 Ga0495613_0033307
2337 Ga0495613_0447219
2338 Ga0495624_0026537
2339 Ga0495624_0041895
2340 Ga0495624_0083331
2341 Ga0495624_0211509
2342 Ga0495670_0000213
2343 Ga0495671_0081284
2344 Ga0495671_0095482
2345 Ga0495671_0095485
2346 Ga0495600_0006046
2347 Ga0495600_0034222
2348 Ga0495581_0057033
2349 Ga0495581_0059837
2350 Ga0495581_0064661
2351 Ga0495581_0249409
2352 Ga0495604_0006070
2353 Ga0495604_0009049
2354 Ga0495604_0209491
2355 Ga0495604_0465148
2356 Ga0495636_0108984
2357 Ga0495674_0092171
2358 Ga0495674_0110713
2359 Ga0495674_0138581
2360 Ga0495674_0176434
2361 Ga0495672_0280589
2362 Ga0495676_0067235
2363 Ga0495676_0098466
2364 Ga0495676_0103110
2365 Ga0495680_0002446
2366 Ga0495680_0004222
2367 Ga0495680_0012206
2368 Ga0495680_0092425
2369 Ga0495680_0320898
2370 Ga0495675_0000147
2371 Ga0495675_0066110
2372 Ga0495675_0301904
2373 Ga0495677_0115500
2374 Ga0495679_020691
2375 Ga0495681_0027851
2376 Ga0495684_0028528
2377 Ga0495684_0047645
2378 Ga0495684_0066900
2379 Ga0495684_0127008
2380 Ga0495684_0336106
2381 Ga0495593_0014970
2382 Ga0495593_0110428
2383 Ga0495602_0017376
2384 Ga0495602_0095091
2385 Ga0495602_0302117
2386 Ga0495602_0809023
2387 Ga0495614_0016270
2388 Ga0495615_0285013
2389 Ga0496100_0014640
2390 Ga0496100_0019150
2391 Ga0496100_0055392
2392 Ga0496100_0670068
2393 Ga0496101_0005701
2394 Ga0496101_0030810
2395 Ga0496101_0038396
2396 Ga0496101_0040176
2397 Ga0496101_0118220
2398 Ga0496101_0347426
2399 Ga0496101_0718694
2400 Ga0496102_0005090
2401 Ga0496102_0008860
2402 Ga0496102_0058807
2403 Ga0496102_0062689
2404 Ga0496102_0313371
2405 Ga0496102_0476294
2406 Ga0496102_0563766
2407 Ga0496103_0003997
2408 Ga0496103_0049774
2409 Ga0496103_0077497
2410 Ga0496103_0089875
2411 Ga0496103_0223957
2412 Ga0496104_0000431
2413 Ga0496104_0004143
2414 Ga0496104_0026643
2415 Ga0496104_0119489
2416 Ga0496104_0151649
2417 Ga0496104_0319108
2418 Ga0496104_0347710
2419 Ga0496104_0372043
2420 Ga0496104_1730800
2421 Ga0496105_0003143
2422 Ga0496105_0011647
2423 Ga0496105_0030941
2424 Ga0496105_0035148
2425 Ga0496105_0052050
2426 Ga0496105_0092739
2427 Ga0496105_0341832
2428 Ga0496105_0403622
2429 Ga0496105_0539243
2430 Ga0496105_0765951
2431 Ga0496106_0006510
2432 Ga0496106_0006633
2433 Ga0496106_0025322
2434 Ga0496106_0028566
2435 Ga0496107_0015236
2436 Ga0496107_0016151
2437 Ga0496107_0031502
2438 Ga0496107_0034286
2439 Ga0496107_0286681
2440 Ga0496107_0509417
2441 Ga0496107_0875251
2442 Ga0496108_0004006
2443 Ga0496108_0029590
2444 Ga0496108_0049594
2445 Ga0496108_0188822
2446 Ga0496108_0496022
2447 Ga0496109_0000404
2448 Ga0496109_0032437
2449 Ga0496109_0062763
2450 Ga0496109_0111595
2451 Ga0496109_0160862
2452 Ga0496109_0276439
2453 Ga0496109_0582501
2454 Ga0496110_0001910
2455 Ga0496110_0035366
2456 Ga0496110_0144583
2457 Ga0496110_0153551
2458 Ga0496110_0156603
2459 Ga0496110_0179451
2460 Ga0496110_0756182
2461 Ga0496111_0002312
2462 Ga0496111_0021244
2463 Ga0496111_0052032
2464 Ga0496111_0101642
2465 Ga0496111_0230705
2466 Ga0496112_0002963
2467 Ga0496112_0033447
2468 Ga0496112_0038890
2469 Ga0496112_0163683
2470 Ga0496112_0191834
2471 Ga0496112_0214013
2472 Ga0496112_0227988
2473 Ga0496112_0344731
2474 Ga0496112_0375277
2475 Ga0496112_0509676
2476 Ga0496113_0001735
2477 Ga0496113_0023714
2478 Ga0496113_0038693
2479 Ga0496113_0055173
2480 Ga0496114_0007969
2481 Ga0496114_0011998
2482 Ga0496114_0026647
2483 Ga0496114_0193555
2484 Ga0496115_0005562
2485 Ga0496115_0030415
2486 Ga0496115_0090149
2487 Ga0496115_0126837
2488 Ga0496115_0127301
2489 Ga0496115_0549087
2490 Ga0496119_0361203
2491 Ga0496126_0227298
2492 Ga0501032_0055099
2493 Ga0501032_0210740
2494 Ga0501032_0230049
2495 Ga0501032_0310667
2496 Ga0501033_0056452
2497 Ga0501033_0076983
2498 Ga0501033_0213753
2499 Ga0501034_0000089
2500 Ga0501034_0001928
2501 Ga0501034_0013803
2502 Ga0501034_0062587
2503 Ga0501034_0079663
2504 Ga0501034_0094307
2505 Ga0501034_0115064
2506 Ga0501034_0155648
2507 Ga0501034_0204376
2508 Ga0501034_0383137
2509 Ga0501034_1105629
2510 Ga0501034_1342534
2511 Ga0501036_0000939
2512 Ga0501036_0027820
2513 Ga0501036_0065300
2514 Ga0501036_0596290
2515 Ga0501036_0803273
2516 Ga0501037_0006892
2517 Ga0501037_0007211
2518 Ga0501037_0032070
2519 Ga0501037_0070788
2520 Ga0501037_0130420
2521 Ga0501037_0366637
2522 Ga0501038_0011084
2523 Ga0501038_0020694
2524 Ga0501038_0093602
2525 Ga0501038_0163069
2526 Ga0501038_0180645
2527 Ga0501038_0186334
2528 Ga0501038_0256703
2529 Ga0501038_1056961
2530 Ga0501039_0114908
2531 Ga0501039_0369568
2532 Ga0501040_0371016
2533 Ga0501041_0458884
2534 Ga0501042_0350317
2535 Ga0501043_0001206
2536 Ga0501043_0017209
2537 Ga0501043_0046402
2538 Ga0501043_0126750
2539 Ga0501043_0127784
2540 Ga0501043_0363361
2541 Ga0501043_0439054
2542 Ga0501046_0045583
2543 Ga0501046_0055684
2544 Ga0501046_0107057
2545 Ga0501046_0297421
2546 Ga0501046_0762529
2547 Ga0501047_0000108
2548 Ga0501047_0019198
2549 Ga0501047_0025537
2550 Ga0501047_0026716
2551 Ga0501047_0071230
2552 Ga0501047_0649495
2553 Ga0501047_1036189
2554 Ga0501048_0000493
2555 Ga0501048_0318236
2556 Ga0501048_0883248
2557 Ga0501048_0983869
2558 Ga0501067_0073670
2559 Ga0501067_0093786
2560 Ga0501067_0094020
2561 Ga0501068_0015903
2562 Ga0501068_0020518
2563 Ga0501068_0034351
2564 Ga0501068_0037280
2565 Ga0501068_0216501
2566 Ga0501068_0327063
2567 Ga0501068_0464142
2568 Ga0501069_0015562
2569 Ga0501069_0045707
2570 Ga0501069_0050681
2571 Ga0501069_0067526
2572 Ga0501069_0535158
2573 Ga0501070_0011892
2574 Ga0501070_0014072
2575 Ga0501070_0035357
2576 Ga0501070_0040072
2577 Ga0501070_0084044
2578 Ga0501070_0098991
2579 Ga0501070_0205471
2580 Ga0501070_0317514
2581 Ga0501070_0568244
2582 Ga0501071_0095836
2583 Ga0501071_0188658
2584 Ga0501071_0263613
2585 Ga0501071_0306405
2586 Ga0501071_0504879
2587 Ga0501072_0231686
2588 Ga0501072_0309354
2589 Ga0501072_0439428
2590 Ga0501072_0458229
2591 Ga0501073_0023624
2592 Ga0501073_0032267
2593 Ga0501073_0033637
2594 Ga0501073_0082743
2595 Ga0501073_0095315
2596 Ga0501073_0124288
2597 Ga0501073_0133256
2598 Ga0501074_0001683
2599 Ga0501074_0060299
2600 Ga0501074_0137681
2601 Ga0501074_0219011
2602 Ga0501074_0666259
2603 Ga0501075_0657896
2604 Ga0501076_0158078
2605 Ga0501079_0082316
2606 Ga0501079_0091325
2607 Ga0501079_0267791
2608 Ga0501079_0409050
2609 Ga0501079_0821377
2610 Ga0501079_0847288
2611 Ga0501080_0001065
2612 Ga0501080_0026663
2613 Ga0501080_0187422
2614 Ga0501080_0638796
2615 Ga0501081_0050631
2616 Ga0501083_0006385
2617 Ga0501083_0019929
2618 Ga0501083_0030750
2619 Ga0501083_0175332
2620 Ga0501083_0435178
2621 Ga0501083_0537039
2622 Ga0501035_0001940
2623 Ga0501035_0011937
2624 Ga0501035_0114912
2625 Ga0501035_0194431
2626 Ga0501035_0740284
2627 Ga0501035_0750151
2628 Ga0501035_0890801
2629 Ga0501044_0000457
2630 Ga0501044_0000998
2631 Ga0501044_0063861
2632 Ga0501044_0065493
2633 Ga0501044_0067570
2634 Ga0501044_0078229
2635 Ga0501044_0154782
2636 Ga0501044_0221125
2637 Ga0501044_0265525
2638 Ga0501044_0680119
2639 Ga0501044_0690114
2640 Ga0501044_0876869
2641 Ga0501044_1009884
2642 Ga0501045_0309138
2643 nmdc:mga03683_424032_c1
2644 nmdc:mga03683_51330_c1
2645 nmdc:mga03683_76607_c1
2646 nmdc:mga03n38_141272_c1
2647 nmdc:mga03n38_225140_c1
2648 nmdc:mga03n38_36768_c1
2649 nmdc:mga00v17_16761_c1
2650 nmdc:mga00v17_17630_c1
2651 nmdc:mga00v17_221874_c1
2652 nmdc:mga00v17_23425_c1
2653 nmdc:mga00v17_250682_c1
2654 nmdc:mga00v17_304384_c1
2655 nmdc:mga0yw44_104888_c1
2656 nmdc:mga0yw44_1096250_c1
2657 nmdc:mga0yw44_264534_c1
2658 nmdc:mga0yw44_458855_c1
2659 nmdc:mga0yw44_699616_c1
2660 nmdc:mga0yw44_764880_c1
2661 nmdc:mga0yw44_8452_c1
2662 nmdc:mga0k408_2858_c1
2663 nmdc:mga06z11_140328_c1
2664 nmdc:mga06z11_163592_c1
2665 nmdc:mga06z11_211578_c1
2666 nmdc:mga06z11_231076_c1
2667 nmdc:mga06z11_243294_c1
2668 nmdc:mga06z11_24562_c1
2669 nmdc:mga06z11_275809_c1
2670 nmdc:mga06z11_2837_c1
2671 nmdc:mga06z11_353853_c1
2672 nmdc:mga06z11_626523_c1
2673 nmdc:mga04h51_14443_c1
2674 nmdc:mga04h51_226413_c1
2675 nmdc:mga04h51_26351_c1
2676 nmdc:mga04h51_29121_c1
2677 nmdc:mga04h51_338720_c1
2678 nmdc:mga04h51_50945_c1
2679 nmdc:mga07m45_146238_c1
2680 nmdc:mga07m45_208873_c1
2681 nmdc:mga07m45_218408_c1
2682 nmdc:mga07m45_577798_c1
2683 nmdc:mga07m45_70189_c1
2684 nmdc:mga05p37_30731_c1
2685 nmdc:mga05p37_357158_c1
2686 nmdc:mga05p37_36596_c1
2687 nmdc:mga05p37_368829_c1
2688 nmdc:mga05p37_64392_c1
2689 nmdc:mga09592_190239_c1
2690 nmdc:mga0qj67_180918_c1
2691 nmdc:mga06r32_54186_c1
2692 nmdc:mga08y16_362536_c1
2693 nmdc:mga08y16_507552_c1
2694 nmdc:mga0n895_125540_c1
2695 nmdc:mga0n895_2911_c1
2696 nmdc:mga0n895_35380_c1
2697 nmdc:mga0n895_576084_c1
2698 nmdc:mga0rr50_187927_c1
2699 nmdc:mga0rr50_71104_c1
2700 nmdc:mga08x19_292984_c1
2701 nmdc:mga08x19_38629_c1
2702 nmdc:mga0a205_190118_c1
2703 nmdc:mga0a205_334238_c1
2704 nmdc:mga0a205_7768_c1
2705 nmdc:mga0sz30_134193_c1
2706 nmdc:mga0sz30_2969_c1
2707 Ga0495601_0001750
2708 Ga0495601_0002382
2709 Ga0495601_0006675
2710 Ga0495601_0081671
2711 Ga0495601_0101403
2712 Ga0495612_0008869
2713 Ga0495612_0027993
2714 Ga0495612_0052294
2715 Ga0495612_0117550
2716 Ga0500610_0228732
2717 Ga0495655_0236117
2718 Ga0495595_0000576
2719 Ga0495595_0007184
2720 Ga0495595_0032435
2721 Ga0495595_0092899
2722 Ga0495595_0203348
2723 Ga0495595_0550449
2724 Ga0495619_0000132
2725 Ga0495619_0000178
2726 Ga0495619_0003001
2727 Ga0495619_0037425
2728 Ga0495619_0068325
2729 Ga0500643_004941
2730 Ga0500644_0001366
2731 Ga0500646_0130426
2732 Ga0500583_0090895
2733 Ga0500651_0447757
2734 Ga0500566_0067107
2735 Ga0500566_0067583
2736 Ga0500566_0327303
2737 Ga0500641_0024406
2738 Ga0500654_104851
2739 Ga0500593_002852
2740 Ga0500594_0278893
2741 Ga0500595_000001
2742 Ga0500595_061203
2743 Ga0500595_068320
2744 Ga0500597_128940
2745 Ga0500642_0036021
2746 Ga0500642_0100336
2747 Ga0500652_000043
2748 Ga0500652_019276
2749 Ga0500577_0066345
2750 Ga0500577_0236772
2751 Ga0500616_0000001
2752 Ga0500616_0018461
2753 Ga0500622_0032344
2754 Ga0500622_0275325
2755 Ga0500627_0126477
2756 Ga0500636_0022293
2757 Ga0500636_0228656
2758 Ga0500611_008670
2759 Ga0500645_000913
2760 Ga0500609_001854
2761 Ga0501084_0977272
2762 Ga0501084_1049892
2763 Ga0501084_1329780
2764 Ga0501084_1399725
2765 Ga0501082_0018450
2766 Ga0501082_0230530
2767 Ga0501082_0244844
2768 Ga0501082_0392979
2769 Ga0501082_0569340
2770 Ga0466962_0154826
2771 Ga0530510_0215513
2772 2643757891

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

68

134

0.98

PF01475

FUR

Ferric uptake regulator family

39

74

0.93

Map