F493574

General Info

Members Datasets Scaffolds Average Seq Length
1389 671 1038 871

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000393|Ga0105251_100003933
Length 912
Sequence LPAKTVWLYRLDCLKPPSRASPLPQDGRVLGIIEYANFFGTAIVNSDSRADALLATLPRDDRGRLKVFLGAAPGVGKTYAMLQAAHTQLRQGVSVLVGVVETHGRTETEALLGGLAQQPMLRSEYRGVMLEEMDLDGLLKARPKLALVDELAHSNAPGSRHAKRWQDIQELLSAGIDVYTTVNVQHLESLNDQVRGITGVQVRETLPDWVLQEAFELVLIDLPPRELLERLRDGKVYVPEQARAAIDAFFTQTNLTALRELAMQTAAAQVDNDLALGYRQLGQSAPAVRGRLLVGVDGDAQAERLVRHASRVAQRRHLPWTLVHVDNGRFFDEFARSRLQNAQQLAERLGGEVVVLRAPEVAKTLIQHAAERRASLVLVGQSRPSLRRRVFGGGLAARLLRNAHGLEINVLDSEARPDQPRSNTPRATPWFDYLLAVLATICASALAWPNILVAVRSSVGPAMVCSVLSFLAYDFLFIPPNFSLSIQREEDVLTLLFXXXMAALTGNLAARQRRQLQALRDTQEETSELLDLSRRLTAATDRQAVLSAAEQHLAGWQELEVCILDNPNQQGWKVESGGALQLSEFERAAADWAWQHGQPAGKGTGTLPSGAWWFLPLWVDDAPLALLGARPRAGQSFTAQRRRLLTALSQPLGQALARVRLAEDLEAARLHGETEQLRSALLASVSHDLRTPLTAMRGSIDSLLALGEAIPRADRQELLEGTRDEAERLDRYIQNLLDMTRLGHGALKLARDWVAPADIVGSTLNRLRAVLAPLQVSTELPVELPLLYVHAALIEQALINVVENAARFSPQHGRLQMEVTASSEELVFSVSDEGPGIPEDERAKIFDMFYTAARGDRGGQGTGLGLAICQGMVGAHGGRISVGEGIDGRGTCISLHLPLQTQPQGETEAAMG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
27 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
28 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
29 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
30 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
31 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
32 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
33 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
34 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
35 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
36 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
37 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
38 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
39 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
40 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
41 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
42 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
43 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
44 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
45 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
46 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
47 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
48 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
49 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
50 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
51 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
52 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
53 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
54 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
55 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
56 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
57 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
58 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
59 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
60 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
61 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
62 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
63 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
64 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
65 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
66 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
67 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
68 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
69 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
70 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
71 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
72 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
73 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
74 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
75 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
76 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
77 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
78 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
79 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
80 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
81 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
82 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
83 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
84 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
85 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
86 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
87 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
88 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
89 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
90 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
91 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
92 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
93 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
94 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
95 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
96 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
97 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
98 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
99 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
100 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
101 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
102 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
103 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
104 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
105 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
106 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
107 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
108 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
109 2643221559 Lysobacter sp. Root559 Isolate Unclassified
110 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
111 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
112 2643221573 Lysobacter sp. Root604 Isolate Unclassified
113 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
114 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
115 2643221586 Lysobacter sp. Root667 Isolate Unclassified
116 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
117 2643221593 Lysobacter sp. Root690 Isolate Unclassified
118 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
119 2643221612 Lysobacter sp. Root76 Isolate Unclassified
120 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
121 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
122 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
123 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
124 2643221720 Lysobacter sp. Root916 Isolate Unclassified
125 2643221727 Lysobacter sp. Root96 Isolate Unclassified
126 2643221728 Lysobacter sp. Root983 Isolate Unclassified
127 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
128 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
129 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
130 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
131 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
132 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
133 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
134 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
135 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
136 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
137 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
138 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
139 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
140 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
141 2734482264 Dyella sp. AD052 Isolate Unclassified
142 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
143 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
144 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
145 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
146 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
147 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
148 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
149 2738543009 Luteibacter sp. OK325 Isolate Unclassified
150 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
151 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
152 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
153 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
154 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
155 2739367700 Dyella sp. YR388 Isolate Unclassified
156 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
157 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
158 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
159 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
160 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
161 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
162 2765235841 Pseudomonas putida AA7 Isolate Unclassified
163 2773857670 Pseudomonas sp. 478 Isolate Unclassified
164 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
165 2773857673 Pseudomonas sp. 443 Isolate Unclassified
166 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
167 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
168 2784132063 Pseudomonas sp. 424 Isolate Unclassified
169 2784132072 Pseudomonas sp. 460 Isolate Unclassified
170 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
171 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
172 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
173 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
174 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
175 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
176 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
177 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
178 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
179 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
180 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
181 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
182 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
183 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
184 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
185 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
186 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
187 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
188 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
189 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
190 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
191 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
192 2818991457 Xanthomonas translucens 569 Isolate Unclassified
193 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
194 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
195 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
196 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
197 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
198 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
199 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
200 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
201 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
202 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
203 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
204 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
205 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
206 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
207 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
208 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
209 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
210 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
211 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
212 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
213 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
214 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
215 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
216 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
217 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
218 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
219 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
220 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
221 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
222 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
223 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
224 2884411467 Dyella sp. AD56 Isolate Rhizosphere
225 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
226 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
227 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
228 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
229 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
230 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
231 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
232 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
233 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
234 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
235 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
236 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
237 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
238 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
239 2919085039 Luteibacter sp. 1214 Isolate Unclassified
240 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
241 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
242 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
243 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
244 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
245 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
246 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
247 2919404418 Luteibacter sp. 3190 Isolate Unclassified
248 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
249 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
250 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
251 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
252 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
253 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
254 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
255 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
256 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
257 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
258 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
259 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
260 2928963466 Dyella japonica 1073 Isolate Unclassified
261 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
262 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
263 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
264 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
265 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
266 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
267 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
268 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
269 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
270 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
271 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
272 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
273 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
274 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
275 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
276 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
277 2941471342 Luteibacter sp. 621 Isolate Unclassified
278 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
279 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
280 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
281 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
282 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
283 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
284 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
285 2952252522 Salinicola sp. DM10 Isolate Unclassified
286 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
287 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
288 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
289 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
290 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
291 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
292 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
293 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
294 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
295 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
296 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
297 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
298 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
299 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
300 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
301 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
302 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
303 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
304 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
305 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
306 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
307 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
308 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
309 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
310 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
311 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
312 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
313 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
314 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
315 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
316 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
317 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
318 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
319 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
320 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
321 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
322 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
323 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
324 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
325 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
326 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
327 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
328 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
329 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
330 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
331 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
332 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
333 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
334 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
335 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
336 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
337 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
338 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
339 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
340 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
341 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
342 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
343 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
344 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
345 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
346 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
347 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
348 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
349 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
350 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
351 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
352 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
353 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
354 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
355 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
356 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
357 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
358 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
359 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
360 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
361 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
362 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
363 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
364 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
365 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
366 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
367 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
368 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
369 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
370 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
371 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
372 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
373 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
374 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
375 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
376 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
377 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
378 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
379 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
380 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
381 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
382 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
383 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
384 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
385 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
386 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
387 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
388 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
389 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
390 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
391 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
392 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
393 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
394 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
395 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
396 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
397 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
398 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
399 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
400 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
401 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
402 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
403 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
404 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
405 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
406 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
407 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
408 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
409 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
410 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
411 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
412 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
413 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
414 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
415 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
416 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
417 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
421 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
422 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
424 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
425 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
426 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
427 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
428 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
429 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
431 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
432 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
433 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
434 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
436 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
437 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
438 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
439 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
440 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
441 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
442 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
443 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
445 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
477 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
478 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
479 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
481 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
482 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
483 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
484 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
485 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
486 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
487 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
488 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
489 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
490 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
491 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
492 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
493 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
494 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
495 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
496 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
497 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
498 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
499 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
500 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
501 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
502 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
503 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
504 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
505 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
506 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
507 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
508 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
509 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
510 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
511 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
512 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
513 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
514 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
515 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
516 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
517 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
518 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
519 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
520 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
521 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
522 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
523 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
524 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
525 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
526 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
527 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
528 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
529 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
530 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
531 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
532 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
533 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
534 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
535 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
536 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
537 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
538 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
539 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
540 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
541 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
542 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
543 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
544 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
545 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
546 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
547 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
548 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
549 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
550 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
551 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
552 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
553 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
554 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
555 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
556 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
557 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
558 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
559 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
560 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
561 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
562 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
563 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
564 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
565 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
566 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
567 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
568 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
569 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
570 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
571 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
572 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
573 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
574 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
575 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
576 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
577 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
578 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
579 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
580 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
581 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
582 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
583 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
584 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
585 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
586 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
587 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
588 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
589 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
590 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
591 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
592 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
593 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
594 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
595 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
596 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
597 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
598 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
599 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
600 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
601 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
602 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
603 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
604 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
605 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
606 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
607 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
608 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
609 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
610 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
611 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
612 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
613 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
614 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
615 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
616 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
618 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
619 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
620 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
621 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
624 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
625 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
626 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
627 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
628 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
629 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
630 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
631 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
632 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
633 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
634 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
635 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
636 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
637 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
638 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
639 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
640 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
641 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
642 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
643 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
644 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
645 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
646 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
647 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
648 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
649 8052494512 Pseudomonas putida LD6 Isolate Unclassified
650 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
651 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
652 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
653 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
654 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
655 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
656 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
657 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
658 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
659 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
660 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
661 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
662 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
663 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
664 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
665 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
666 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
667 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
668 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
669 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
670 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
671 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.59
Metatranscriptomes 0.14
Isolates 25.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 15.33
Nodule 2.16
Rhizoplane 5.54
Rhizosphere 57.67
Stem 0
Stem Tuber 0
Unclassified 19.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_254 2124908027 Bacteria 19586
2 MRS2a_Contig_6466 2124908027 Bacteria 5355
3 JGI24740J21852_10007570 3300001979 Bacteria 4399
4 JGI24739J22299_10002415 3300001989 Bacteria 7205
5 JGI24737J22298_10000714 3300001990 Bacteria 11679
6 JGI24735J21928_10003253 3300002067 Bacteria 5557
7 JGI24738J21930_10000119 3300002075 Bacteria 18729
8 JGI25156J39149_1002035 3300002705 Bacteria 7711
9 JGI25156J39149_1002596 3300002705 Bacteria 6372
10 JGI25162J39368_1000174 3300002737 Bacteria 69350
11 JGI25162J39368_1000212 3300002737 Bacteria 61036
12 JGI25162J39368_1000330 3300002737 Bacteria 41675
13 JGI25162J39368_1000968 3300002737 Bacteria 18305
14 JGI25162J39368_1001125 3300002737 Bacteria 16094
15 JGI25162J39368_1001172 3300002737 Bacteria 15583
16 JGI25162J39368_1001190 3300002737 Bacteria 15321
17 JGI25154J39366_1003312 3300002738 Bacteria 3471
18 JGI25157J39369_1000121 3300002741 Bacteria 66489
19 JGI25157J39369_1000201 3300002741 Bacteria 50342
20 JGI25157J39369_1001636 3300002741 Bacteria 7711
21 JGI25157J39369_1001646 3300002741 Bacteria 7663
22 JGI25163J39215_1000140 3300002771 Bacteria 28932
23 JGI25163J39215_1000775 3300002771 Bacteria 7851
24 JGI25163J39215_1001336 3300002771 Bacteria 4247
25 JGI25164J39214_1000004 3300002772 Bacteria 350814
26 JGI25164J39214_1000051 3300002772 Bacteria 122377
27 JGI25164J39214_1000141 3300002772 Bacteria 69350
28 JGI25164J39214_1000251 3300002772 Bacteria 40327
29 JGI25164J39214_1000412 3300002772 Bacteria 24378
30 JGI25164J39214_1000578 3300002772 Bacteria 16482
31 JGI25152J39213_1000190 3300002773 Bacteria 41171
32 JGI25150J39212_1000138 3300002774 Bacteria 41134
33 JGI25151J46595_10000181 3300003187 Bacteria 79677
34 JGI25151J46595_10000382 3300003187 Bacteria 46006
35 JGI25165J46597_1000091 3300003214 Bacteria 167941
36 JGI25165J46597_1000110 3300003214 Bacteria 148234
37 JGI25165J46597_1000262 3300003214 Bacteria 69350
38 JGI25165J46597_1000362 3300003214 Bacteria 50814
39 JGI25165J46597_1001207 3300003214 Bacteria 15587
40 JGI25153J46596_10000241 3300003215 Bacteria 46006
41 rootH1_10016850 3300003316 Bacteria 9170
42 rootH2_10001701 3300003320 Bacteria 4660
43 rootH2_10005102 3300003320 Bacteria 36213
44 Ga0006562J51391_1006159 3300003578 Bacteria 3685
45 Ga0006562J51391_1012175 3300003578 Bacteria 34750
46 Ga0055538_1000102 3300003751 Bacteria 68013
47 Ga0055539_1000151 3300003752 Bacteria 68013
48 Ga0055533_1000154 3300003756 Bacteria 68013
49 Ga0055533_1000785 3300003756 Bacteria 9956
50 Ga0055533_1001061 3300003756 Bacteria 7900
51 Ga0055532_1000831 3300003758 Bacteria 10463
52 Ga0055525_1000152 3300003759 Bacteria 93935
53 Ga0055525_1000204 3300003759 Bacteria 68013
54 Ga0055527_1000059 3300003760 Bacteria 93123
55 Ga0055527_1000099 3300003760 Bacteria 65504
56 Ga0055527_1001620 3300003760 Bacteria 4498
57 Ga0055535_1000173 3300003761 Bacteria 69346
58 Ga0055535_1000174 3300003761 Bacteria 68886
59 Ga0055535_1000176 3300003761 Bacteria 68521
60 Ga0055535_1000190 3300003761 Bacteria 65500
61 Ga0055535_1000504 3300003761 Bacteria 34661
62 Ga0055535_1000583 3300003761 Bacteria 30547
63 Ga0055542_1000137 3300003762 Bacteria 93123
64 Ga0055542_1000148 3300003762 Bacteria 88393
65 Ga0055542_1000170 3300003762 Bacteria 81222
66 Ga0055542_1000218 3300003762 Bacteria 69908
67 Ga0055542_1000221 3300003762 Bacteria 69350
68 Ga0055542_1000470 3300003762 Bacteria 37779
69 Ga0055529_1000092 3300003763 Bacteria 137763
70 Ga0055529_1000174 3300003763 Bacteria 88393
71 Ga0055529_1000236 3300003763 Bacteria 69350
72 Ga0055529_1000465 3300003763 Bacteria 39208
73 Ga0055526_1000426 3300003771 Bacteria 33925
74 Ga0055526_1002501 3300003771 Bacteria 12392
75 Ga0055537_1000299 3300003773 Bacteria 34588
76 Ga0055537_1000452 3300003773 Bacteria 25967
77 Ga0055524_1000453 3300003775 Bacteria 33925
78 Ga0055536_1000186 3300003781 Bacteria 50837
79 Ga0055536_1000300 3300003781 Bacteria 37111
80 Ga0055536_1001363 3300003781 Bacteria 14856
81 Ga0055536_1002848 3300003781 Bacteria 9528
82 Ga0055536_1004258 3300003781 Bacteria 7380
83 Ga0055536_1004562 3300003781 Bacteria 7036
84 Ga0055534_1000291 3300003784 Bacteria 33925
85 Ga0055534_1000322 3300003784 Bacteria 31844
86 Ga0055528_1000425 3300003790 Bacteria 33925
87 Ga0055528_1000950 3300003790 Bacteria 19268
88 Ga0055530_10000225 3300003791 Bacteria 50204
89 Ga0055530_10000434 3300003791 Bacteria 37091
90 Ga0055530_10001426 3300003791 Bacteria 17518
91 Ga0055530_10001839 3300003791 Bacteria 14615
92 Ga0055530_10002449 3300003791 Bacteria 11933
93 Ga0055530_10003082 3300003791 Bacteria 9910
94 Ga0055530_10011806 3300003791 Bacteria 3102
95 Ga0055540_1000205 3300003792 Bacteria 57359
96 Ga0055540_1000239 3300003792 Bacteria 50204
97 Ga0055540_1000771 3300003792 Bacteria 21762
98 Ga0055531_10000155 3300003794 Bacteria 79002
99 Ga0055531_10002141 3300003794 Bacteria 13509
100 Ga0055531_10003928 3300003794 Bacteria 9247
101 Ga0055531_10005904 3300003794 Bacteria 7058
102 Ga0055541_1000101 3300003841 Bacteria 68013
103 Ga0058692_1000001 3300003856 Bacteria 834230
104 Ga0058692_1000005 3300003856 Bacteria 398815
105 Ga0058692_1000075 3300003856 Bacteria 75694
106 Ga0065165_1000035 3300005262 Bacteria 214086
107 Ga0065165_1002080 3300005262 Bacteria 18386
108 Ga0065714_10000370 3300005288 Bacteria 5352
109 Ga0065714_10002480 3300005288 Bacteria 17144
110 Ga0065714_10003085 3300005288 Bacteria 14826
111 Ga0065714_10010636 3300005288 Bacteria 3550
112 Ga0065714_10065526 3300005288 Bacteria 9597
113 Ga0065714_10067129 3300005288 Bacteria 5851
114 Ga0065704_10073713 3300005289 Bacteria 6856
115 Ga0065704_10074873 3300005289 Bacteria 5948
116 Ga0065712_10067903 3300005290 Bacteria 21845
117 Ga0070658_10002285 3300005327 Bacteria 16077
118 Ga0070658_10006367 3300005327 Bacteria 9567
119 Ga0070670_100002004 3300005331 Bacteria 16657
120 Ga0070670_100002874 3300005331 Bacteria 14258
121 Ga0070670_100003451 3300005331 Bacteria 13121
122 Ga0070666_10000007 3300005335 Bacteria 293732
123 Ga0070682_100006836 3300005337 Bacteria 6405
124 Ga0070660_100023551 3300005339 Bacteria 4562
125 Ga0070689_100005817 3300005340 Bacteria 8463
126 Ga0070661_100000132 3300005344 Bacteria 62286
127 Ga0070661_100006265 3300005344 Bacteria 8209
128 Ga0070661_100017022 3300005344 Bacteria 5150
129 Ga0070668_100019845 3300005347 Bacteria 5064
130 Ga0070659_100001246 3300005366 Bacteria 18471
131 Ga0070659_100002715 3300005366 Bacteria 12586
132 Ga0070714_100000114 3300005435 Bacteria 66216
133 Ga0070714_100002726 3300005435 Bacteria 13016
134 Ga0070713_100001236 3300005436 Bacteria 16338
135 Ga0070663_100001900 3300005455 Bacteria 11655
136 Ga0070663_100022255 3300005455 Bacteria 4234
137 Ga0070678_100053909 3300005456 Bacteria 2927
138 Ga0070662_100004466 3300005457 Bacteria 8854
139 Ga0070662_100022493 3300005457 Bacteria 4318
140 Ga0070662_100044271 3300005457 Bacteria 3188
141 Ga0070681_10004433 3300005458 Bacteria 13373
142 Ga0070681_10039916 3300005458 Bacteria 4706
143 Ga0068853_100000402 3300005539 Bacteria 29678
144 Ga0070665_100001457 3300005548 Bacteria 27711
145 Ga0068855_100009015 3300005563 Bacteria 12054
146 Ga0068855_100012653 3300005563 Bacteria 10183
147 Ga0070664_100000361 3300005564 Bacteria 33502
148 Ga0068857_100001373 3300005577 Bacteria 19194
149 Ga0068857_100046251 3300005577 Bacteria 3862
150 Ga0068854_100000620 3300005578 Bacteria 20974
151 Ga0068856_100000074 3300005614 Bacteria 94656
152 Ga0068851_10002263 3300005834 Bacteria 8450
153 Ga0068851_10002944 3300005834 Bacteria 7524
154 Ga0081540_1007424 3300005983 Bacteria 7816
155 Ga0075368_10006848 3300006042 Bacteria 4005
156 Ga0075364_10000093 3300006051 Bacteria 36230
157 Ga0075364_10030881 3300006051 Bacteria 3441
158 Ga0075432_10000610 3300006058 Bacteria 10857
159 Ga0075432_10002552 3300006058 Bacteria 6074
160 Ga0075367_10015478 3300006178 Bacteria 4148
161 Ga0075369_10005634 3300006186 Bacteria 4691
162 Ga0075431_100073439 3300006847 Bacteria 3528
163 Ga0099823_1000173 3300006944 Bacteria 35210
164 Ga0079104_1000115 3300006946 Bacteria 115517
165 Ga0079104_1000346 3300006946 Bacteria 55624
166 Ga0105251_10000018 3300009011 Bacteria 142493
167 Ga0105251_10000192 3300009011 Bacteria 61516
168 Ga0105251_10000393 3300009011 Bacteria 42865
169 Ga0105251_10001113 3300009011 Bacteria 23395
170 Ga0105251_10002842 3300009011 Bacteria 13079
171 Ga0105251_10003175 3300009011 Bacteria 12165
172 Ga0105251_10005394 3300009011 Bacteria 8370
173 Ga0105251_10009208 3300009011 Bacteria 5857
174 Ga0105244_10000305 3300009036 Bacteria 47725
175 Ga0105244_10000403 3300009036 Bacteria 40205
176 Ga0105244_10000874 3300009036 Bacteria 25495
177 Ga0105244_10001000 3300009036 Bacteria 23680
178 Ga0105244_10001252 3300009036 Bacteria 20825
179 Ga0105244_10001441 3300009036 Bacteria 19256
180 Ga0105244_10003576 3300009036 Bacteria 11044
181 Ga0105244_10003744 3300009036 Bacteria 10741
182 Ga0105244_10008596 3300009036 Bacteria 6364
183 Ga0105244_10010531 3300009036 Bacteria 5602
184 Ga0105244_10024522 3300009036 Bacteria 3290
185 Ga0105244_10024885 3300009036 Bacteria 3262
186 Ga0105244_10031815 3300009036 Bacteria 2799
187 Ga0105250_10000068 3300009092 Bacteria 98087
188 Ga0105250_10000894 3300009092 Bacteria 17554
189 Ga0105250_10001340 3300009092 Bacteria 13466
190 Ga0105250_10003150 3300009092 Bacteria 7914
191 Ga0105250_10005483 3300009092 Bacteria 5681
192 Ga0105240_10000613 3300009093 Bacteria 66188
193 Ga0105240_10001052 3300009093 Bacteria 48878
194 Ga0105240_10012795 3300009093 Bacteria 11562
195 Ga0105240_10042352 3300009093 Bacteria 5803
196 Ga0105247_10000271 3300009101 Bacteria 48101
197 Ga0105243_10000010 3300009148 Bacteria 316672
198 Ga0105243_10000271 3300009148 Bacteria 57848
199 Ga0105243_10004053 3300009148 Bacteria 11673
200 Ga0105243_10008238 3300009148 Bacteria 8007
201 Ga0105237_10000022 3300009545 Bacteria 228427
202 Ga0105238_10000211 3300009551 Bacteria 64754
203 Ga0105238_10027975 3300009551 Bacteria 5745
204 Ga0105238_10058291 3300009551 Bacteria 3871
205 Ga0105249_10000320 3300009553 Bacteria 48700
206 Ga0105239_10000304 3300010375 Bacteria 72715
207 Ga0105239_10017754 3300010375 Bacteria 7872
208 Ga0105239_10020676 3300010375 Bacteria 7261
209 Ga0105239_10022066 3300010375 Bacteria 7018
210 Ga0105246_10004539 3300011119 Bacteria 8448
211 Ga0157345_1000065 3300012498 Bacteria 22164
212 Ga0157314_1000052 3300012500 Bacteria 12217
213 Ga0157373_10000216 3300013100 Bacteria 47143
214 Ga0157373_10001195 3300013100 Bacteria 19861
215 Ga0157373_10014159 3300013100 Bacteria 5849
216 Ga0157373_10027766 3300013100 Bacteria 4083
217 Ga0157373_10050360 3300013100 Bacteria 2966
218 Ga0157373_10054044 3300013100 Bacteria 2854
219 Ga0157371_10000539 3300013102 Bacteria 45066
220 Ga0157371_10003036 3300013102 Bacteria 15589
221 Ga0157371_10003604 3300013102 Bacteria 13952
222 Ga0157371_10005595 3300013102 Bacteria 10560
223 Ga0157371_10005919 3300013102 Bacteria 10210
224 Ga0157371_10006647 3300013102 Bacteria 9472
225 Ga0157371_10019595 3300013102 Bacteria 4984
226 Ga0157371_10022111 3300013102 Bacteria 4665
227 Ga0157371_10039749 3300013102 Bacteria 3363
228 Ga0157371_10040820 3300013102 Bacteria 3313
229 Ga0157370_10000114 3300013104 Bacteria 92643
230 Ga0157370_10003574 3300013104 Bacteria 18197
231 Ga0157370_10005119 3300013104 Bacteria 14786
232 Ga0157370_10007559 3300013104 Bacteria 11806
233 Ga0157370_10010963 3300013104 Bacteria 9512
234 Ga0157370_10027408 3300013104 Bacteria 5617
235 Ga0157369_10001269 3300013105 Bacteria 31339
236 Ga0157369_10003045 3300013105 Bacteria 20008
237 Ga0157369_10004391 3300013105 Bacteria 16648
238 Ga0157369_10033471 3300013105 Bacteria 5647
239 Ga0157369_10033615 3300013105 Bacteria 5635
240 Ga0163162_10000188 3300013306 Bacteria 57231
241 Ga0163162_10000541 3300013306 Bacteria 34925
242 Ga0157372_10004091 3300013307 Bacteria 15643
243 Ga0157372_10005123 3300013307 Bacteria 13925
244 Ga0157372_10063947 3300013307 Bacteria 4127
245 Ga0157375_10009019 3300013308 Bacteria 8730
246 Ga0157375_10013702 3300013308 Bacteria 7228
247 Ga0157375_10048715 3300013308 Bacteria 4147
248 Ga0182008_10000220 3300014497 Bacteria 44813
249 Ga0182008_10002720 3300014497 Bacteria 10975
250 Ga0182008_10003269 3300014497 Bacteria 9867
251 Ga0182008_10005552 3300014497 Bacteria 7160
252 Ga0182008_10008220 3300014497 Bacteria 5709
253 Ga0182008_10008370 3300014497 Bacteria 5648
254 Ga0182008_10018279 3300014497 Bacteria 3630
255 Ga0182006_1000036 3300015261 Bacteria 226098
256 Ga0182006_1000167 3300015261 Bacteria 69601
257 Ga0182006_1001679 3300015261 Bacteria 12975
258 Ga0182006_1002821 3300015261 Bacteria 9267
259 Ga0182006_1003310 3300015261 Bacteria 8322
260 Ga0182006_1006317 3300015261 Bacteria 5522
261 Ga0182006_1009334 3300015261 Bacteria 4400
262 Ga0182007_10000500 3300015262 Bacteria 23316
263 Ga0182007_10000622 3300015262 Bacteria 20599
264 Ga0182007_10001614 3300015262 Bacteria 11975
265 Ga0182007_10004808 3300015262 Bacteria 6061
266 Ga0182005_1000186 3300015265 Bacteria 42690
267 Ga0182005_1000260 3300015265 Bacteria 33405
268 Ga0182005_1000873 3300015265 Bacteria 13345
269 Ga0182005_1002125 3300015265 Bacteria 7344
270 Ga0182005_1003121 3300015265 Bacteria 5707
271 Ga0182005_1007528 3300015265 Bacteria 3260
272 Ga0183369_1008 3300015685 Bacteria 346514
273 Ga0183368_1003 3300015687 Bacteria 1276390
274 Ga0183360_10001 3300015689 Bacteria 3943671
275 Ga0163161_10001025 3300017792 Bacteria 21303
276 Ga0163161_10008406 3300017792 Bacteria 7143
277 Ga0163161_10036522 3300017792 Bacteria 3518
278 Ga0213872_10000554 3300021361 Bacteria 28950
279 Ga0213872_10002449 3300021361 Bacteria 10910
280 Ga0213872_10003515 3300021361 Bacteria 8658
281 Ga0213872_10008019 3300021361 Bacteria 5136
282 Ga0213872_10012810 3300021361 Bacteria 3936
283 Ga0209760_100022 3300025207 Bacteria 159218
284 Ga0209760_100043 3300025207 Bacteria 113964
285 Ga0209760_100663 3300025207 Bacteria 5566
286 Ga0209784_100137 3300025224 Bacteria 69520
287 Ga0209784_100138 3300025224 Bacteria 68249
288 Ga0209566_100179 3300025225 Bacteria 68249
289 Ga0209566_101320 3300025225 Bacteria 7991
290 Ga0209674_100012 3300025226 Bacteria 950162
291 Ga0209674_100058 3300025226 Bacteria 286902
292 Ga0209674_100186 3300025226 Bacteria 68249
293 Ga0209674_100282 3300025226 Bacteria 37567
294 Ga0209674_100638 3300025226 Bacteria 12754
295 Ga0209672_100043 3300025228 Bacteria 270302
296 Ga0209672_100061 3300025228 Bacteria 206098
297 Ga0209672_100077 3300025228 Bacteria 158067
298 Ga0209672_100293 3300025228 Bacteria 34763
299 Ga0209147_100195 3300025229 Bacteria 68796
300 Ga0209563_100062 3300025230 Bacteria 264769
301 Ga0209563_100148 3300025230 Bacteria 68249
302 Ga0209563_101535 3300025230 Bacteria 6027
303 Ga0207427_100031 3300025231 Bacteria 350866
304 Ga0207427_100047 3300025231 Bacteria 240409
305 Ga0207427_100082 3300025231 Bacteria 142809
306 Ga0207427_100134 3300025231 Bacteria 91077
307 Ga0207427_100150 3300025231 Bacteria 78685
308 Ga0207427_100176 3300025231 Bacteria 69443
309 Ga0209437_100005 3300025233 Bacteria 1071596
310 Ga0209437_100006 3300025233 Bacteria 1042724
311 Ga0209437_100009 3300025233 Bacteria 915954
312 Ga0209437_100059 3300025233 Bacteria 355048
313 Ga0209437_100061 3300025233 Bacteria 350866
314 Ga0209437_100200 3300025233 Bacteria 119306
315 Ga0209437_100214 3300025233 Bacteria 107034
316 Ga0209258_100027 3300025242 Bacteria 518449
317 Ga0209258_100054 3300025242 Bacteria 339063
318 Ga0209258_100076 3300025242 Bacteria 270302
319 Ga0209258_100097 3300025242 Bacteria 216963
320 Ga0209258_100339 3300025242 Bacteria 69328
321 Ga0209258_100383 3300025242 Bacteria 56544
322 Ga0209258_100507 3300025242 Bacteria 37810
323 Ga0209258_103020 3300025242 Bacteria 3879
324 Ga0207425_1000040 3300025245 Bacteria 218121
325 Ga0209026_1000017 3300025250 Bacteria 385214
326 Ga0209026_1000084 3300025250 Bacteria 186997
327 Ga0209026_1000130 3300025250 Bacteria 120413
328 Ga0209026_1000245 3300025250 Bacteria 69469
329 Ga0209026_1001482 3300025250 Bacteria 10325
330 Ga0209026_1002802 3300025250 Bacteria 6185
331 Ga0209677_100137 3300025253 Bacteria 68249
332 Ga0209677_102120 3300025253 Bacteria 7792
333 Ga0209148_1000001 3300025254 Bacteria 2545271
334 Ga0209148_1000002 3300025254 Bacteria 2399500
335 Ga0209148_1000063 3300025254 Bacteria 346881
336 Ga0209148_1000066 3300025254 Bacteria 339063
337 Ga0209148_1000082 3300025254 Bacteria 270302
338 Ga0209148_1000523 3300025254 Bacteria 37832
339 Ga0209148_1001620 3300025254 Bacteria 10430
340 Ga0209759_1000290 3300025256 Bacteria 69409
341 Ga0209759_1000308 3300025256 Bacteria 66182
342 Ga0209759_1004139 3300025256 Bacteria 5528
343 Ga0209759_1007891 3300025256 Bacteria 3369
344 Ga0209129_1000011 3300025258 Bacteria 568657
345 Ga0209233_1000002 3300025261 Bacteria 2501366
346 Ga0209233_1000011 3300025261 Bacteria 1071611
347 Ga0209233_1000032 3300025261 Bacteria 623596
348 Ga0209233_1000076 3300025261 Bacteria 350866
349 Ga0209233_1000105 3300025261 Bacteria 272035
350 Ga0209233_1000193 3300025261 Bacteria 126812
351 Ga0209565_1000001 3300025263 Bacteria 2950419
352 Ga0209565_1000071 3300025263 Bacteria 166213
353 Ga0209455_1000019 3300025272 Bacteria 705658
354 Ga0209455_1000078 3300025272 Bacteria 270237
355 Ga0209455_1000096 3300025272 Bacteria 217006
356 Ga0209455_1000101 3300025272 Bacteria 206098
357 Ga0209455_1000186 3300025272 Bacteria 97107
358 Ga0209673_1000001 3300025273 Bacteria 3176258
359 Ga0209673_1001159 3300025273 Bacteria 28752
360 Ga0209675_1000001 3300025291 Bacteria 2950293
361 Ga0209675_1000018 3300025291 Bacteria 377481
362 Ga0209676_1000006 3300025292 Bacteria 1039588
363 Ga0209676_1000010 3300025292 Bacteria 954025
364 Ga0209676_1000052 3300025292 Bacteria 371539
365 Ga0209676_1000185 3300025292 Bacteria 142505
366 Ga0209676_1000223 3300025292 Bacteria 124359
367 Ga0209676_1000248 3300025292 Bacteria 115456
368 Ga0209676_1000474 3300025292 Bacteria 66391
369 Ga0209676_1001294 3300025292 Bacteria 25717
370 Ga0209676_1001554 3300025292 Bacteria 20579
371 Ga0209676_1001632 3300025292 Bacteria 19793
372 Ga0209676_1001929 3300025292 Bacteria 16752
373 Ga0209676_1005522 3300025292 Bacteria 6565
374 Ga0209025_1000002 3300025294 Bacteria 1393142
375 Ga0209025_1000015 3300025294 Bacteria 808120
376 Ga0209025_1000401 3300025294 Bacteria 88709
377 Ga0209025_1014426 3300025294 Bacteria 4856
378 Ga0209564_1000001 3300025295 Bacteria 3176258
379 Ga0209564_1000148 3300025295 Bacteria 172177
380 Ga0209758_1000003 3300025297 Bacteria 1398533
381 Ga0209758_1000823 3300025297 Bacteria 43434
382 Ga0209758_1016027 3300025297 Bacteria 3832
383 Ga0209050_1000009 3300025298 Bacteria 1047265
384 Ga0209050_1000081 3300025298 Bacteria 267533
385 Ga0209050_1000182 3300025298 Bacteria 142435
386 Ga0209050_1000260 3300025298 Bacteria 113066
387 Ga0209050_1000896 3300025298 Bacteria 39492
388 Ga0209050_1002287 3300025298 Bacteria 16925
389 Ga0209050_1002531 3300025298 Bacteria 15309
390 Ga0209256_1000002 3300025299 Bacteria 1906740
391 Ga0209256_1000441 3300025299 Bacteria 63697
392 Ga0209256_1004386 3300025299 Bacteria 8910
393 Ga0209051_1000008 3300025303 Bacteria 706935
394 Ga0209051_1000104 3300025303 Bacteria 161001
395 Ga0209051_1000163 3300025303 Bacteria 124249
396 Ga0209051_1001702 3300025303 Bacteria 17612
397 Ga0209051_1008628 3300025303 Bacteria 5368
398 Ga0209257_1000040 3300025304 Bacteria 538759
399 Ga0209257_1000046 3300025304 Bacteria 477765
400 Ga0209257_1000065 3300025304 Bacteria 353604
401 Ga0209257_1000400 3300025304 Bacteria 84778
402 Ga0209257_1000470 3300025304 Bacteria 73603
403 Ga0209257_1000568 3300025304 Bacteria 62433
404 Ga0209257_1002809 3300025304 Bacteria 16362
405 Ga0209257_1002838 3300025304 Bacteria 16251
406 Ga0209257_1005906 3300025304 Bacteria 8242
407 Ga0209257_1006897 3300025304 Bacteria 7110
408 Ga0207656_10000199 3300025321 Bacteria 21459
409 Ga0207656_10001394 3300025321 Bacteria 7981
410 Ga0207696_1000081 3300025711 Bacteria 198887
411 Ga0207696_1000097 3300025711 Bacteria 175696
412 Ga0207696_1000152 3300025711 Bacteria 119512
413 Ga0207696_1001350 3300025711 Bacteria 13485
414 Ga0207696_1007167 3300025711 Bacteria 4394
415 Ga0207655_1000005 3300025728 Bacteria 917277
416 Ga0207655_1000286 3300025728 Bacteria 77168
417 Ga0207655_1000331 3300025728 Bacteria 69149
418 Ga0207655_1000530 3300025728 Bacteria 48477
419 Ga0207655_1000616 3300025728 Bacteria 42781
420 Ga0207655_1000744 3300025728 Bacteria 36545
421 Ga0207655_1000861 3300025728 Bacteria 32310
422 Ga0207655_1001205 3300025728 Bacteria 24927
423 Ga0207655_1001794 3300025728 Bacteria 18643
424 Ga0207655_1002407 3300025728 Bacteria 15235
425 Ga0207655_1002536 3300025728 Bacteria 14635
426 Ga0207655_1002766 3300025728 Bacteria 13663
427 Ga0207655_1008148 3300025728 Bacteria 6698
428 Ga0207655_1013208 3300025728 Bacteria 4757
429 Ga0207655_1019218 3300025728 Bacteria 3583
430 Ga0207713_1000009 3300025735 Bacteria 551314
431 Ga0207713_1000220 3300025735 Bacteria 76897
432 Ga0207713_1000374 3300025735 Bacteria 48773
433 Ga0207713_1001864 3300025735 Bacteria 16028
434 Ga0207713_1002480 3300025735 Bacteria 13415
435 Ga0207713_1004231 3300025735 Bacteria 9388
436 Ga0207713_1004849 3300025735 Bacteria 8622
437 Ga0207713_1004943 3300025735 Bacteria 8524
438 Ga0207710_10000005 3300025900 Bacteria 607066
439 Ga0207680_10000002 3300025903 Bacteria 1018646
440 Ga0207647_10000007 3300025904 Bacteria 209754
441 Ga0207647_10004663 3300025904 Bacteria 10155
442 Ga0207705_10001374 3300025909 Bacteria 19439
443 Ga0207707_10003779 3300025912 Bacteria 13418
444 Ga0207695_10000362 3300025913 Bacteria 104132
445 Ga0207695_10000691 3300025913 Bacteria 66171
446 Ga0207695_10000960 3300025913 Bacteria 51384
447 Ga0207695_10001726 3300025913 Bacteria 34905
448 Ga0207695_10019502 3300025913 Bacteria 7808
449 Ga0207695_10020249 3300025913 Bacteria 7625
450 Ga0207671_10000009 3300025914 Bacteria 724862
451 Ga0207671_10000079 3300025914 Bacteria 149692
452 Ga0207657_10018685 3300025919 Bacteria 6607
453 Ga0207649_10000002 3300025920 Bacteria 498633
454 Ga0207694_10000177 3300025924 Bacteria 65875
455 Ga0207650_10001948 3300025925 Bacteria 14524
456 Ga0207650_10002152 3300025925 Bacteria 13765
457 Ga0207650_10002405 3300025925 Bacteria 13030
458 Ga0207700_10020935 3300025928 Bacteria 4454
459 Ga0207664_10000088 3300025929 Bacteria 87215
460 Ga0207664_10001608 3300025929 Bacteria 14855
461 Ga0207690_10000537 3300025932 Bacteria 24728
462 Ga0207690_10003565 3300025932 Bacteria 9262
463 Ga0207690_10015721 3300025932 Bacteria 4591
464 Ga0207706_10003812 3300025933 Bacteria 14371
465 Ga0207706_10027998 3300025933 Bacteria 5036
466 Ga0207706_10031035 3300025933 Bacteria 4763
467 Ga0207709_10000001 3300025935 Bacteria 2228154
468 Ga0207709_10000035 3300025935 Bacteria 300968
469 Ga0207709_10001022 3300025935 Bacteria 20703
470 Ga0207709_10005176 3300025935 Bacteria 7432
471 Ga0207670_10003314 3300025936 Bacteria 8537
472 Ga0207679_10000006 3300025945 Bacteria 498868
473 Ga0207667_10000441 3300025949 Bacteria 55662
474 Ga0207667_10002011 3300025949 Bacteria 25508
475 Ga0207667_10010429 3300025949 Bacteria 10865
476 Ga0207667_10022673 3300025949 Bacteria 6927
477 Ga0207712_10000413 3300025961 Bacteria 36586
478 Ga0207668_10002517 3300025972 Bacteria 10702
479 Ga0207640_10000037 3300025981 Bacteria 109223
480 Ga0207640_10015274 3300025981 Bacteria 4441
481 Ga0207639_10022023 3300026041 Bacteria 4585
482 Ga0207678_10003160 3300026067 Bacteria 14893
483 Ga0207678_10013915 3300026067 Bacteria 7070
484 Ga0207702_10001508 3300026078 Bacteria 22997
485 Ga0207702_10003054 3300026078 Bacteria 15555
486 Ga0207674_10000625 3300026116 Bacteria 46262
487 Ga0207674_10017933 3300026116 Bacteria 7714
488 Ga0207683_10077888 3300026121 Bacteria 2937
489 Ga0209281_1000018 3300027111 Bacteria 579091
490 Ga0209281_1000077 3300027111 Bacteria 262887
491 Ga0209389_1000059 3300027296 Bacteria 106207
492 Ga0209371_1000008 3300027312 Bacteria 1024606
493 Ga0209371_1000031 3300027312 Bacteria 399263
494 Ga0209371_1000055 3300027312 Bacteria 257599
495 Ga0209371_1001010 3300027312 Bacteria 21538
496 Ga0268266_10000004 3300028379 Bacteria 1495817
497 Ga0268266_10000958 3300028379 Bacteria 36718
498 Ga0268266_10072002 3300028379 Bacteria 2996
499 Ga0265338_10029238 3300028800 Bacteria 5467
500 Ga0265324_10002056 3300029957 Bacteria 10687
501 Ga0268256_1000009 3300030500 Bacteria 1022625
502 Ga0268256_1000034 3300030500 Bacteria 398909
503 Ga0268256_1000054 3300030500 Bacteria 257599
504 Ga0268256_1001010 3300030500 Bacteria 19026
505 Ga0316178_1090118 3300030735 Bacteria 4456
506 Ga0265328_10004817 3300031239 Bacteria 5824
507 Ga0265339_10000725 3300031249 Bacteria 25574
508 Ga0265331_10000088 3300031250 Bacteria 125176
509 Ga0265331_10000327 3300031250 Bacteria 51068
510 Ga0265331_10000403 3300031250 Bacteria 44394
511 Ga0265327_10000457 3300031251 Bacteria 73150
512 Ga0265316_10005447 3300031344 Bacteria 12370
513 Ga0307513_10001443 3300031456 Bacteria 34174
514 Ga0307408_100000019 3300031548 Bacteria 344502
515 Ga0307408_100000135 3300031548 Bacteria 81612
516 Ga0307408_100012568 3300031548 Bacteria 5611
517 Ga0265313_10000387 3300031595 Bacteria 47406
518 Ga0265313_10000632 3300031595 Bacteria 36281
519 Ga0265313_10010441 3300031595 Bacteria 5870
520 Ga0265314_10014498 3300031711 Bacteria 6299
521 Ga0307405_10000793 3300031731 Bacteria 12387
522 Ga0307405_10006501 3300031731 Bacteria 5753
523 Ga0307406_10003229 3300031901 Bacteria 8875
524 Ga0307407_10006191 3300031903 Bacteria 5287
525 Ga0307412_10000311 3300031911 Bacteria 30815
526 Ga0307412_10000830 3300031911 Bacteria 17786
527 Ga0307412_10001099 3300031911 Bacteria 15496
528 Ga0307412_10002054 3300031911 Bacteria 11170
529 Ga0307412_10027947 3300031911 Bacteria 3523
530 Ga0307414_10036861 3300032004 Bacteria 3269
531 Ga0307510_10000389 3300033180 Bacteria 41583
532 Ga0307510_10008630 3300033180 Bacteria 12144
533 Ga0395899_0000215 3300037312 Bacteria 82905
534 Ga0395899_0021585 3300037312 Bacteria 4883
535 Ga0395899_0029460 3300037312 Bacteria 4129
536 Ga0395900_0000117 3300037418 Bacteria 137733
537 Ga0395900_0004192 3300037418 Bacteria 15310
538 Ga0395898_0000013 3300037466 Bacteria 458788
539 Ga0395898_0000120 3300037466 Bacteria 209091
540 Ga0395898_0001668 3300037466 Bacteria 29795
541 Ga0395898_0002038 3300037466 Bacteria 25293
542 Ga0395898_0002482 3300037466 Bacteria 21706
543 Ga0395898_0010240 3300037466 Bacteria 9816
544 Ga0395901_0000926 3300038443 Bacteria 31931
545 Ga0395901_0010648 3300038443 Bacteria 9319
546 Ga0395901_0018582 3300038443 Bacteria 7099
547 Ga0395901_0023450 3300038443 Bacteria 6327
548 Ga0395901_0030166 3300038443 Bacteria 5586
549 Ga0395901_0032389 3300038443 Bacteria 5393
550 Ga0237819_00286 3300038705 Bacteria 18616
551 Ga0400486_14966 3300038742 Bacteria 3538
552 Ga0436361_0167035 3300039447 Bacteria 30176
553 Ga0436361_0210759 3300039447 Bacteria 9702
554 Ga0436361_0286565 3300039447 Bacteria 6135
555 Ga0436361_0499005 3300039447 Bacteria 10115
556 Ga0436361_0541030 3300039447 Bacteria 4172
557 Ga0439436_0000002 3300041404 Bacteria 248787
558 Ga0439436_0001669 3300041404 Bacteria 6485
559 Ga0439438_000067 3300041405 Bacteria 48604
560 Ga0439438_000460 3300041405 Bacteria 18368
561 Ga0439438_002274 3300041405 Bacteria 8235
562 Ga0439438_002726 3300041405 Bacteria 7417
563 Ga0439438_002987 3300041405 Bacteria 6982
564 Ga0439438_003113 3300041405 Bacteria 6823
565 Ga0439447_000332 3300041407 Bacteria 16989
566 Ga0439447_004544 3300041407 Bacteria 4747
567 Ga0439466_0000246 3300041411 Bacteria 21357
568 Ga0439466_0000554 3300041411 Bacteria 14123
569 Ga0439466_0004259 3300041411 Bacteria 5522
570 Ga0439466_0004501 3300041411 Bacteria 5358
571 Ga0439465_0000098 3300041413 Bacteria 19790
572 Ga0451793_1828595 3300041452 Bacteria 4030
573 Ga0439432_000405 3300042006 Bacteria 15980
574 Ga0439432_001128 3300042006 Bacteria 10139
575 Ga0439432_006636 3300042006 Bacteria 4122
576 Ga0439451_002808 3300042009 Bacteria 3540
577 Ga0439452_000154 3300042010 Bacteria 51036
578 Ga0439456_000063 3300042013 Bacteria 38227
579 Ga0439456_000886 3300042013 Bacteria 5996
580 Ga0439456_003327 3300042013 Bacteria 3252
581 Ga0439463_000084 3300042016 Bacteria 22079
582 Ga0450911_000001 3300042115 Bacteria 311012
583 Ga0450911_000259 3300042115 Bacteria 19873
584 Ga0450911_000267 3300042115 Bacteria 19480
585 Ga0450902_000533 3300042137 Bacteria 4783
586 Ga0450904_000014 3300042139 Bacteria 41423
587 Ga0439446_0000260 3300042156 Bacteria 9850
588 Ga0450908_000153 3300042184 Bacteria 14407
589 Ga0450908_002163 3300042184 Bacteria 3847
590 Ga0450901_000555 3300042533 Bacteria 4397
591 Ga0466982_0000001 3300044672 Bacteria 514662
592 Ga0466982_0000073 3300044672 Bacteria 26975
593 Ga0466966_0006479 3300044684 Bacteria 7749
594 Ga0466966_0026959 3300044684 Bacteria 3747
595 Ga0466961_0001073 3300044693 Bacteria 16864
596 Ga0466961_0009242 3300044693 Bacteria 6276
597 Ga0453684_0000449 3300044712 Bacteria 166164
598 Ga0453684_0021449 3300044712 Bacteria 9650
599 Ga0466970_0001219 3300044765 Bacteria 12455
600 Ga0466957_0022725 3300044842 Bacteria 3702
601 Ga0466959_0002131 3300045049 Bacteria 12534
602 Ga0466959_0005777 3300045049 Bacteria 8520
603 Ga0451576_0000167 3300045051 Bacteria 166164
604 Ga0451576_0000276 3300045051 Bacteria 125948
605 Ga0451576_0084093 3300045051 Bacteria 3310
606 Ga0466958_0006045 3300045836 Bacteria 6560
607 Ga0466958_0024695 3300045836 Bacteria 3537
608 Ga0495617_000036 3300046452 Bacteria 138126
609 Ga0495617_000151 3300046452 Bacteria 44813
610 Ga0495617_000511 3300046452 Bacteria 20313
611 Ga0495617_000674 3300046452 Bacteria 17064
612 Ga0495627_000032 3300046453 Bacteria 224665
613 Ga0495627_000164 3300046453 Bacteria 75744
614 Ga0495627_000856 3300046453 Bacteria 21745
615 Ga0495627_000858 3300046453 Bacteria 21700
616 Ga0495627_003145 3300046453 Bacteria 7458
617 Ga0495627_010596 3300046453 Bacteria 3343
618 Ga0495603_0026055 3300046455 Bacteria 3535
619 Ga0495590_0002697 3300046457 Bacteria 7336
620 Ga0495590_0013406 3300046457 Bacteria 3014
621 Ga0495590_0014445 3300046457 Bacteria 2880
622 Ga0495590_0015996 3300046457 Bacteria 2713
623 Ga0495591_000081 3300046458 Bacteria 107738
624 Ga0495591_000114 3300046458 Bacteria 93304
625 Ga0495591_000210 3300046458 Bacteria 59177
626 Ga0495591_000824 3300046458 Bacteria 21960
627 Ga0495591_000837 3300046458 Bacteria 21745
628 Ga0495591_001153 3300046458 Bacteria 17320
629 Ga0495591_001321 3300046458 Bacteria 15599
630 Ga0495591_002811 3300046458 Bacteria 9380
631 Ga0495591_003497 3300046458 Bacteria 8077
632 Ga0495591_015291 3300046458 Bacteria 2718
633 Ga0495629_0028027 3300046459 Bacteria 4000
634 Ga0495638_0000106 3300046460 Bacteria 133921
635 Ga0495638_0000111 3300046460 Bacteria 130877
636 Ga0495638_0000164 3300046460 Bacteria 103139
637 Ga0495638_0000369 3300046460 Bacteria 55785
638 Ga0495638_0001132 3300046460 Bacteria 25792
639 Ga0495638_0001424 3300046460 Bacteria 21692
640 Ga0495638_0015177 3300046460 Bacteria 5180
641 Ga0495653_0001795 3300046463 Bacteria 16914
642 Ga0495650_0000250 3300046471 Bacteria 105746
643 Ga0495650_0000430 3300046471 Bacteria 67718
644 Ga0495650_0000779 3300046471 Bacteria 39137
645 Ga0495650_0000885 3300046471 Bacteria 35354
646 Ga0495650_0002309 3300046471 Bacteria 15816
647 Ga0495605_0000026 3300046474 Bacteria 221832
648 Ga0495605_0000198 3300046474 Bacteria 75112
649 Ga0495605_0000414 3300046474 Bacteria 38982
650 Ga0495605_0000837 3300046474 Bacteria 21616
651 Ga0495605_0009018 3300046474 Bacteria 5615
652 Ga0495605_0021501 3300046474 Bacteria 3417
653 Ga0495639_0000020 3300046475 Bacteria 73983
654 Ga0495584_0005022 3300046491 Bacteria 7043
655 Ga0495584_0006331 3300046491 Bacteria 6202
656 Ga0495584_0015677 3300046491 Bacteria 3864
657 Ga0495585_0000121 3300046492 Bacteria 84876
658 Ga0495585_0000134 3300046492 Bacteria 80529
659 Ga0495585_0002984 3300046492 Bacteria 11690
660 Ga0495585_0008128 3300046492 Bacteria 6375
661 Ga0495585_0013816 3300046492 Bacteria 4718
662 Ga0495585_0020907 3300046492 Bacteria 3760
663 Ga0495594_0003522 3300046499 Bacteria 8064
664 Ga0495596_0000107 3300046500 Bacteria 59095
665 Ga0495596_0003894 3300046500 Bacteria 7399
666 Ga0495607_0000002 3300046501 Bacteria 414833
667 Ga0495607_0000039 3300046501 Bacteria 133875
668 Ga0495607_0000054 3300046501 Bacteria 116402
669 Ga0495607_0000283 3300046501 Bacteria 54438
670 Ga0495607_0000606 3300046501 Bacteria 34853
671 Ga0495607_0000713 3300046501 Bacteria 32111
672 Ga0495607_0001723 3300046501 Bacteria 18747
673 Ga0495607_0001926 3300046501 Bacteria 17548
674 Ga0495607_0002169 3300046501 Bacteria 16344
675 Ga0495607_0002214 3300046501 Bacteria 16101
676 Ga0495607_0016168 3300046501 Bacteria 4818
677 Ga0495583_0000043 3300046506 Bacteria 230804
678 Ga0495583_0000312 3300046506 Bacteria 76605
679 Ga0495583_0000460 3300046506 Bacteria 60178
680 Ga0495583_0000676 3300046506 Bacteria 44423
681 Ga0495583_0014254 3300046506 Bacteria 4395
682 Ga0495583_0015491 3300046506 Bacteria 4143
683 Ga0495606_0000107 3300046507 Bacteria 140948
684 Ga0495606_0000274 3300046507 Bacteria 90529
685 Ga0495606_0000310 3300046507 Bacteria 84133
686 Ga0495606_0000630 3300046507 Bacteria 55478
687 Ga0495606_0000675 3300046507 Bacteria 53375
688 Ga0495606_0000861 3300046507 Bacteria 45459
689 Ga0495606_0001081 3300046507 Bacteria 39097
690 Ga0495606_0001316 3300046507 Bacteria 34004
691 Ga0495606_0002500 3300046507 Bacteria 21237
692 Ga0495606_0003361 3300046507 Bacteria 17058
693 Ga0495606_0003406 3300046507 Bacteria 16886
694 Ga0495606_0005982 3300046507 Bacteria 11403
695 Ga0495610_0000483 3300046512 Bacteria 41185
696 Ga0495610_0001597 3300046512 Bacteria 19947
697 Ga0495610_0001786 3300046512 Bacteria 18793
698 Ga0495610_0002020 3300046512 Bacteria 17362
699 Ga0495610_0003860 3300046512 Bacteria 11388
700 Ga0495610_0004967 3300046512 Bacteria 9633
701 Ga0495610_0031445 3300046512 Bacteria 2769
702 Ga0495616_0000005 3300046513 Bacteria 260589
703 Ga0495616_0001346 3300046513 Bacteria 17142
704 Ga0495616_0002321 3300046513 Bacteria 12716
705 Ga0495616_0002834 3300046513 Bacteria 11308
706 Ga0495616_0006642 3300046513 Bacteria 6985
707 Ga0495616_0009359 3300046513 Bacteria 5741
708 Ga0495616_0011122 3300046513 Bacteria 5168
709 Ga0495616_0016722 3300046513 Bacteria 4053
710 Ga0495620_0000083 3300046515 Bacteria 78909
711 Ga0495620_0000160 3300046515 Bacteria 53936
712 Ga0495620_0000280 3300046515 Bacteria 37104
713 Ga0495620_0000371 3300046515 Bacteria 30848
714 Ga0495620_0003304 3300046515 Bacteria 9247
715 Ga0495620_0005651 3300046515 Bacteria 6953
716 Ga0495620_0017204 3300046515 Bacteria 3610
717 Ga0495631_0000037 3300046518 Bacteria 81401
718 Ga0495631_0000582 3300046518 Bacteria 24350
719 Ga0495631_0000665 3300046518 Bacteria 22214
720 Ga0495631_0000839 3300046518 Bacteria 19534
721 Ga0495631_0004237 3300046518 Bacteria 7673
722 Ga0495631_0004972 3300046518 Bacteria 7005
723 Ga0495631_0011772 3300046518 Bacteria 4290
724 Ga0495632_0000015 3300046519 Bacteria 237713
725 Ga0495632_0001473 3300046519 Bacteria 19573
726 Ga0495632_0002967 3300046519 Bacteria 12429
727 Ga0495632_0003516 3300046519 Bacteria 11084
728 Ga0495632_0004944 3300046519 Bacteria 8932
729 Ga0495632_0007741 3300046519 Bacteria 6703
730 Ga0495632_0010271 3300046519 Bacteria 5560
731 Ga0495632_0024030 3300046519 Bacteria 3244
732 Ga0495637_0000174 3300046520 Bacteria 49455
733 Ga0495637_0000201 3300046520 Bacteria 46576
734 Ga0495637_0000756 3300046520 Bacteria 21810
735 Ga0495637_0001223 3300046520 Bacteria 15577
736 Ga0495637_0001377 3300046520 Bacteria 14556
737 Ga0495637_0004399 3300046520 Bacteria 7310
738 Ga0495637_0010651 3300046520 Bacteria 4439
739 Ga0495637_0012737 3300046520 Bacteria 4013
740 Ga0495637_0022592 3300046520 Bacteria 2867
741 Ga0495643_0000618 3300046522 Bacteria 42338
742 Ga0495643_0000701 3300046522 Bacteria 38480
743 Ga0495643_0001848 3300046522 Bacteria 17969
744 Ga0495643_0003329 3300046522 Bacteria 11847
745 Ga0495643_0003402 3300046522 Bacteria 11691
746 Ga0495643_0008038 3300046522 Bacteria 6727
747 Ga0495643_0029644 3300046522 Bacteria 3060
748 Ga0495644_0000587 3300046523 Bacteria 15241
749 Ga0495644_0000786 3300046523 Bacteria 13051
750 Ga0495648_0000533 3300046524 Bacteria 40990
751 Ga0495648_0001456 3300046524 Bacteria 23152
752 Ga0495648_0001574 3300046524 Bacteria 22241
753 Ga0495648_0002374 3300046524 Bacteria 17484
754 Ga0495648_0002447 3300046524 Bacteria 17146
755 Ga0495648_0005922 3300046524 Bacteria 10060
756 Ga0495648_0007331 3300046524 Bacteria 8839
757 Ga0495648_0011085 3300046524 Bacteria 6825
758 Ga0495648_0023388 3300046524 Bacteria 4232
759 Ga0495663_0002943 3300046525 Bacteria 5011
760 Ga0495663_0004762 3300046525 Bacteria 3800
761 Ga0495666_0010618 3300046526 Bacteria 4590
762 Ga0495642_0000089 3300046528 Bacteria 53775
763 Ga0495642_0000096 3300046528 Bacteria 50386
764 Ga0495654_0000693 3300046530 Bacteria 26422
765 Ga0495654_0001330 3300046530 Bacteria 17245
766 Ga0495654_0006160 3300046530 Bacteria 6856
767 Ga0495654_0007681 3300046530 Bacteria 6000
768 Ga0495654_0009239 3300046530 Bacteria 5407
769 Ga0495654_0009783 3300046530 Bacteria 5240
770 Ga0495654_0010330 3300046530 Bacteria 5079
771 Ga0495654_0011968 3300046530 Bacteria 4677
772 Ga0495587_0020925 3300046536 Bacteria 4035
773 Ga0495609_0000036 3300046538 Bacteria 186358
774 Ga0495609_0000125 3300046538 Bacteria 83190
775 Ga0495609_0000902 3300046538 Bacteria 21674
776 Ga0495609_0003347 3300046538 Bacteria 9243
777 Ga0495609_0012445 3300046538 Bacteria 4036
778 Ga0495609_0020094 3300046538 Bacteria 3086
779 Ga0495597_0000020 3300046542 Bacteria 161793
780 Ga0495597_0000092 3300046542 Bacteria 79435
781 Ga0495597_0022393 3300046542 Bacteria 2931
782 Ga0495633_0000143 3300046558 Bacteria 95292
783 Ga0495633_0002603 3300046558 Bacteria 12621
784 Ga0495633_0003268 3300046558 Bacteria 10914
785 Ga0495668_0006208 3300046616 Bacteria 7893
786 Ga0495634_0001982 3300046642 Bacteria 17435
787 Ga0495611_0000002 3300046648 Bacteria 705677
788 Ga0495611_0000070 3300046648 Bacteria 70949
789 Ga0495611_0000569 3300046648 Bacteria 21253
790 Ga0495611_0002616 3300046648 Bacteria 8152
791 Ga0495625_0000002 3300046660 Bacteria 813323
792 Ga0495625_0000070 3300046660 Bacteria 167336
793 Ga0495625_0003773 3300046660 Bacteria 14714
794 Ga0495625_0005710 3300046660 Bacteria 11257
795 Ga0495625_0024577 3300046660 Bacteria 4583
796 Ga0495625_0035701 3300046660 Bacteria 3661
797 Ga0495635_0002464 3300046663 Bacteria 12639
798 Ga0495659_0000094 3300046664 Bacteria 39086
799 Ga0495661_0000042 3300046665 Bacteria 150599
800 Ga0495661_0000048 3300046665 Bacteria 144678
801 Ga0495661_0000121 3300046665 Bacteria 93554
802 Ga0495661_0000278 3300046665 Bacteria 58843
803 Ga0495661_0000577 3300046665 Bacteria 38100
804 Ga0495661_0001220 3300046665 Bacteria 22312
805 Ga0495661_0007992 3300046665 Bacteria 7344
806 Ga0495661_0012447 3300046665 Bacteria 5742
807 Ga0495588_0010018 3300046674 Bacteria 4394
808 Ga0495646_0017344 3300046680 Bacteria 4566
809 Ga0495624_0001626 3300046690 Bacteria 17227
810 Ga0495670_0000082 3300046691 Bacteria 42423
811 Ga0495670_0000537 3300046691 Bacteria 18052
812 Ga0495670_0001000 3300046691 Bacteria 13741
813 Ga0495670_0001803 3300046691 Bacteria 10526
814 Ga0495670_0004166 3300046691 Bacteria 7083
815 Ga0495670_0006383 3300046691 Bacteria 5792
816 Ga0495670_0027172 3300046691 Bacteria 2833
817 Ga0495671_0000199 3300046692 Bacteria 52734
818 Ga0495671_0000230 3300046692 Bacteria 48157
819 Ga0495671_0001229 3300046692 Bacteria 17540
820 Ga0495671_0002198 3300046692 Bacteria 12420
821 Ga0495671_0002316 3300046692 Bacteria 12099
822 Ga0495671_0008808 3300046692 Bacteria 5666
823 Ga0495671_0013281 3300046692 Bacteria 4467
824 Ga0495649_0000636 3300046694 Bacteria 28565
825 Ga0495649_0001049 3300046694 Bacteria 21662
826 Ga0495649_0001188 3300046694 Bacteria 20109
827 Ga0495649_0002635 3300046694 Bacteria 12511
828 Ga0495649_0004601 3300046694 Bacteria 8975
829 Ga0495649_0011177 3300046694 Bacteria 5279
830 Ga0495589_0000014 3300046794 Bacteria 246197
831 Ga0495589_0000539 3300046794 Bacteria 26416
832 Ga0495589_0001729 3300046794 Bacteria 12402
833 Ga0495589_0005934 3300046794 Bacteria 6448
834 Ga0495600_0012901 3300046809 Bacteria 5236
835 Ga0495660_0000066 3300046810 Bacteria 119694
836 Ga0495660_0000084 3300046810 Bacteria 100402
837 Ga0495660_0000611 3300046810 Bacteria 28147
838 Ga0495660_0003940 3300046810 Bacteria 9074
839 Ga0495660_0009203 3300046810 Bacteria 5771
840 Ga0495660_0017775 3300046810 Bacteria 4090
841 Ga0495636_0000165 3300047318 Bacteria 26611
842 Ga0495672_0000092 3300047320 Bacteria 146431
843 Ga0495672_0000378 3300047320 Bacteria 55187
844 Ga0495672_0000761 3300047320 Bacteria 35155
845 Ga0495672_0001849 3300047320 Bacteria 20188
846 Ga0495672_0002751 3300047320 Bacteria 15766
847 Ga0495672_0005047 3300047320 Bacteria 10554
848 Ga0495672_0006185 3300047320 Bacteria 9336
849 Ga0495672_0013803 3300047320 Bacteria 5556
850 Ga0495676_0000019 3300047321 Bacteria 167261
851 Ga0495680_0025666 3300047322 Bacteria 4873
852 Ga0495680_0044109 3300047322 Bacteria 3527
853 Ga0495683_0000003 3300047323 Bacteria 383992
854 Ga0495683_0000019 3300047323 Bacteria 183206
855 Ga0495683_0000940 3300047323 Bacteria 20512
856 Ga0495683_0001294 3300047323 Bacteria 16908
857 Ga0495683_0001838 3300047323 Bacteria 13331
858 Ga0495683_0002712 3300047323 Bacteria 10556
859 Ga0495683_0004921 3300047323 Bacteria 7477
860 Ga0495687_001573 3300047443 Bacteria 20724
861 Ga0495687_007987 3300047443 Bacteria 6132
862 Ga0495679_000003 3300047446 Bacteria 787868
863 Ga0495679_000235 3300047446 Bacteria 46002
864 Ga0495679_000268 3300047446 Bacteria 43506
865 Ga0495679_001031 3300047446 Bacteria 17096
866 Ga0495679_004616 3300047446 Bacteria 6284
867 Ga0495679_015009 3300047446 Bacteria 2848
868 Ga0495673_0000043 3300047469 Bacteria 284984
869 Ga0495673_0000161 3300047469 Bacteria 115632
870 Ga0495673_0000269 3300047469 Bacteria 71832
871 Ga0495673_0001342 3300047469 Bacteria 19992
872 Ga0495673_0001475 3300047469 Bacteria 18620
873 Ga0495673_0001737 3300047469 Bacteria 16640
874 Ga0495673_0001827 3300047469 Bacteria 16060
875 Ga0495673_0002156 3300047469 Bacteria 14285
876 Ga0495673_0005221 3300047469 Bacteria 7897
877 Ga0495673_0011054 3300047469 Bacteria 4879
878 Ga0495673_0011208 3300047469 Bacteria 4837
879 Ga0495673_0019719 3300047469 Bacteria 3374
880 Ga0495681_0000592 3300047470 Bacteria 27697
881 Ga0495681_0001114 3300047470 Bacteria 20373
882 Ga0495681_0001147 3300047470 Bacteria 20110
883 Ga0495681_0001970 3300047470 Bacteria 15009
884 Ga0495681_0002769 3300047470 Bacteria 12404
885 Ga0495681_0007431 3300047470 Bacteria 7003
886 Ga0495681_0010751 3300047470 Bacteria 5514
887 Ga0495681_0011853 3300047470 Bacteria 5158
888 Ga0495681_0012186 3300047470 Bacteria 5066
889 Ga0495681_0013195 3300047470 Bacteria 4809
890 Ga0495681_0013669 3300047470 Bacteria 4698
891 Ga0495686_0000092 3300047472 Bacteria 189292
892 Ga0495686_0000176 3300047472 Bacteria 121953
893 Ga0495686_0002276 3300047472 Bacteria 18474
894 Ga0495593_0012666 3300047673 Bacteria 4816
895 Ga0495626_0000179 3300048091 Bacteria 77215
896 Ga0495626_0000191 3300048091 Bacteria 74236
897 Ga0495626_0000321 3300048091 Bacteria 50472
898 Ga0495626_0000659 3300048091 Bacteria 33166
899 Ga0495626_0002721 3300048091 Bacteria 11915
900 Ga0495626_0010477 3300048091 Bacteria 4941
901 Ga0495626_0010809 3300048091 Bacteria 4850
902 Ga0496100_0024510 3300048903 Bacteria 3681
903 Ga0496101_0008336 3300048904 Bacteria 6771
904 Ga0496104_0022607 3300048907 Bacteria 5775
905 Ga0496105_0004791 3300048908 Bacteria 10216
906 Ga0496106_0000066 3300048909 Bacteria 83918
907 Ga0496113_0015683 3300048916 Bacteria 5217
908 Ga0496115_0000268 3300048918 Bacteria 45994
909 Ga0496115_0000332 3300048918 Bacteria 40242
910 Ga0496116_0000496 3300048919 Bacteria 54033
911 Ga0496116_0000532 3300048919 Bacteria 51124
912 Ga0496116_0003037 3300048919 Bacteria 16975
913 Ga0496116_0003235 3300048919 Bacteria 16221
914 Ga0496116_0009940 3300048919 Bacteria 8039
915 Ga0496117_0000937 3300048920 Bacteria 44690
916 Ga0496117_0001050 3300048920 Bacteria 42088
917 Ga0496117_0001159 3300048920 Bacteria 39611
918 Ga0496117_0001172 3300048920 Bacteria 39406
919 Ga0496117_0001324 3300048920 Bacteria 36401
920 Ga0496117_0003896 3300048920 Bacteria 16918
921 Ga0496117_0003971 3300048920 Bacteria 16717
922 Ga0496117_0004119 3300048920 Bacteria 16288
923 Ga0496117_0004182 3300048920 Bacteria 16142
924 Ga0496117_0029416 3300048920 Bacteria 4236
925 Ga0496118_0001439 3300048921 Bacteria 35854
926 Ga0496118_0003159 3300048921 Bacteria 21056
927 Ga0496118_0004490 3300048921 Bacteria 16520
928 Ga0496118_0004569 3300048921 Bacteria 16301
929 Ga0496118_0004809 3300048921 Bacteria 15755
930 Ga0496118_0005901 3300048921 Bacteria 13706
931 Ga0496118_0005951 3300048921 Bacteria 13619
932 Ga0496118_0009147 3300048921 Bacteria 10069
933 Ga0496118_0018228 3300048921 Bacteria 6342
934 Ga0496118_0023281 3300048921 Bacteria 5385
935 Ga0496119_0000176 3300048922 Bacteria 89501
936 Ga0496119_0000248 3300048922 Bacteria 76311
937 Ga0496119_0001174 3300048922 Bacteria 32839
938 Ga0496119_0008176 3300048922 Bacteria 9258
939 Ga0496119_0008893 3300048922 Bacteria 8733
940 Ga0496120_0000143 3300048923 Bacteria 120051
941 Ga0496120_0000277 3300048923 Bacteria 85951
942 Ga0496120_0000919 3300048923 Bacteria 40956
943 Ga0496120_0003710 3300048923 Bacteria 13605
944 Ga0496120_0006858 3300048923 Bacteria 8605
945 Ga0496120_0011536 3300048923 Bacteria 6070
946 Ga0496120_0039831 3300048923 Bacteria 2768
947 Ga0496121_0000075 3300048924 Bacteria 240437
948 Ga0496121_0000321 3300048924 Bacteria 100530
949 Ga0496121_0001218 3300048924 Bacteria 44832
950 Ga0496121_0001599 3300048924 Bacteria 37586
951 Ga0496121_0002351 3300048924 Bacteria 29160
952 Ga0496121_0006681 3300048924 Bacteria 14182
953 Ga0496121_0007017 3300048924 Bacteria 13681
954 Ga0496121_0010562 3300048924 Bacteria 10384
955 Ga0496121_0022317 3300048924 Bacteria 6150
956 Ga0496121_0023263 3300048924 Bacteria 5975
957 Ga0496121_0057221 3300048924 Bacteria 3233
958 Ga0496121_0067627 3300048924 Bacteria 2894
959 Ga0496122_0000843 3300048925 Bacteria 58014
960 Ga0496122_0001411 3300048925 Bacteria 38913
961 Ga0496122_0003698 3300048925 Bacteria 19806
962 Ga0496122_0008640 3300048925 Bacteria 10930
963 Ga0496122_0010236 3300048925 Bacteria 9715
964 Ga0496122_0014173 3300048925 Bacteria 7730
965 Ga0496122_0021338 3300048925 Bacteria 5801
966 Ga0496122_0022936 3300048925 Bacteria 5526
967 Ga0496122_0026342 3300048925 Bacteria 5016
968 Ga0496123_0000765 3300048926 Bacteria 51914
969 Ga0496123_0000868 3300048926 Bacteria 48075
970 Ga0496123_0001387 3300048926 Bacteria 33973
971 Ga0496123_0002808 3300048926 Bacteria 20671
972 Ga0496123_0004426 3300048926 Bacteria 14778
973 Ga0496123_0016937 3300048926 Bacteria 5888
974 Ga0496123_0031512 3300048926 Bacteria 3856
975 Ga0496123_0035399 3300048926 Bacteria 3558
976 Ga0496123_0038804 3300048926 Bacteria 3341
977 Ga0496123_0050804 3300048926 Bacteria 2767
978 Ga0496124_0000022 3300048927 Bacteria 421020
979 Ga0496124_0000118 3300048927 Bacteria 164259
980 Ga0496124_0000699 3300048927 Bacteria 54987
981 Ga0496124_0001111 3300048927 Bacteria 42338
982 Ga0496124_0001413 3300048927 Bacteria 35745
983 Ga0496124_0002152 3300048927 Bacteria 26450
984 Ga0496124_0002223 3300048927 Bacteria 25841
985 Ga0496124_0004999 3300048927 Bacteria 15161
986 Ga0496124_0005421 3300048927 Bacteria 14361
987 Ga0496124_0005910 3300048927 Bacteria 13543
988 Ga0496124_0013632 3300048927 Bacteria 7925
989 Ga0496124_0015555 3300048927 Bacteria 7285
990 Ga0496124_0018700 3300048927 Bacteria 6481
991 Ga0496124_0020695 3300048927 Bacteria 6071
992 Ga0496124_0021055 3300048927 Bacteria 6013
993 Ga0496125_0000088 3300048928 Bacteria 214942
994 Ga0496125_0000714 3300048928 Bacteria 54950
995 Ga0496125_0000793 3300048928 Bacteria 51550
996 Ga0496125_0001174 3300048928 Bacteria 39666
997 Ga0496125_0002832 3300048928 Bacteria 21858
998 Ga0496125_0003484 3300048928 Bacteria 19026
999 Ga0496125_0005738 3300048928 Bacteria 13658
1000 Ga0496125_0006187 3300048928 Bacteria 13037
1001 Ga0496125_0009159 3300048928 Bacteria 10232
1002 Ga0496125_0009947 3300048928 Bacteria 9670
1003 Ga0496125_0012715 3300048928 Bacteria 8328
1004 Ga0496125_0048475 3300048928 Bacteria 3542
1005 Ga0496126_0008940 3300048929 Bacteria 10727
1006 Ga0496126_0009493 3300048929 Bacteria 10321
1007 Ga0496126_0014323 3300048929 Bacteria 8019
1008 Ga0496126_0031441 3300048929 Bacteria 5016
1009 Ga0496126_0031860 3300048929 Bacteria 4974
1010 Ga0496126_0032068 3300048929 Bacteria 4955
1011 Ga0496126_0050176 3300048929 Bacteria 3804
1012 Ga0496126_0050300 3300048929 Bacteria 3799
1013 Ga0495678_000007 3300049459 Bacteria 448039
1014 Ga0495678_000044 3300049459 Bacteria 172592
1015 Ga0495678_000545 3300049459 Bacteria 36291
1016 Ga0495678_003646 3300049459 Bacteria 9355
1017 Ga0495682_0000048 3300049460 Bacteria 111881
1018 Ga0495682_0000663 3300049460 Bacteria 22883
1019 Ga0495682_0005246 3300049460 Bacteria 5414
1020 Ga0501032_0011927 3300049569 Bacteria 6225
1021 Ga0501034_0000263 3300049571 Bacteria 95188
1022 Ga0501034_0000750 3300049571 Bacteria 48931
1023 Ga0501070_0006118 3300049586 Bacteria 10259
1024 Ga0501074_0014699 3300049590 Bacteria 5693
1025 Ga0501225_0000518 3300049705 Bacteria 12029
1026 Ga0501080_0022066 3300049742 Bacteria 5898
1027 Ga0501035_0005229 3300049822 Bacteria 12287
1028 Ga0501044_0022094 3300049823 Bacteria 6784
1029 Ga0501226_000003 3300049853 Bacteria 358977
1030 nmdc:mga00v17_1060_c1 3300050491 Bacteria 14522
1031 Ga0500643_000024 3300053087 Bacteria 265935
1032 Ga0500555_000794 3300053103 Bacteria 11465
1033 Ga0500618_000536 3300053125 Bacteria 23581
1034 Ga0500659_0001462 3300053135 Bacteria 14961
1035 Ga0500634_0000078 3300053161 Bacteria 37746
1036 Ga0500645_000663 3300053730 Bacteria 21583
1037 Ga0500645_006491 3300053730 Bacteria 4164
1038 Ga0466962_0004425 3300061719 Bacteria 6729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0000676 Ga0495583_0000676_10_2181 691
2 iso_pu_bacteria 2718217725 2718635190 713
3 3300049823 Ga0501044_0022094 Ga0501044_0022094_3918_6191 717
4 3300045051 Ga0451576_0084093 Ga0451576_0084093_887_3292 746
5 3300013100 Ga0157373_10050360 Ga0157373_100503602 751
6 3300017792 Ga0163161_10036522 Ga0163161_100365222 752
7 3300042533 Ga0450901_000555 Ga0450901_000555_847_3507 754
8 3300046558 Ga0495633_0002603 Ga0495633_0002603_2092_4752 755
9 3300038443 Ga0395901_0018582 Ga0395901_0018582_348_2894 761
10 3300046526 Ga0495666_0010618 Ga0495666_0010618_2217_4580 763
11 3300042137 Ga0450902_000533 Ga0450902_000533_1700_4138 766
12 3300046458 Ga0495591_003497 Ga0495591_003497_5677_8067 767
13 3300003794 Ga0055531_10003928 Ga0055531_100039283 773
14 3300025292 Ga0209676_1005522 Ga0209676_10055223 773
15 3300025294 Ga0209025_1000401 Ga0209025_10004018 773
16 3300025304 Ga0209257_1000400 Ga0209257_10004005 773
17 3300013102 Ga0157371_10040820 Ga0157371_100408202 774
18 3300048926 Ga0496123_0038804 Ga0496123_0038804_11_2554 778
19 3300009036 Ga0105244_10000403 Ga0105244_1000040332 780
20 3300009553 Ga0105249_10000320 Ga0105249_100003207 780
21 3300025728 Ga0207655_1000331 Ga0207655_100033132 780
22 3300025961 Ga0207712_10000413 Ga0207712_1000041331 780
23 3300025299 Ga0209256_1000441 Ga0209256_100044142 781
24 3300003791 Ga0055530_10003082 Ga0055530_100030825 785
25 3300013102 Ga0157371_10005919 Ga0157371_1000591911 785
26 3300025298 Ga0209050_1002531 Ga0209050_10025317 785
27 3300025304 Ga0209257_1005906 Ga0209257_10059064 785
28 3300025728 Ga0207655_1002536 Ga0207655_10025369 785
29 3300048927 Ga0496124_0020695 Ga0496124_0020695_2385_5042 787
30 3300009011 Ga0105251_10009208 Ga0105251_100092083 791
31 3300046492 Ga0495585_0002984 Ga0495585_0002984_2558_5218 792
32 3300046507 Ga0495606_0000310 Ga0495606_0000310_3154_5814 792
33 3300046513 Ga0495616_0000005 Ga0495616_0000005_97089_99749 792
34 3300047323 Ga0495683_0000940 Ga0495683_0000940_1498_4158 792
35 3300048924 Ga0496121_0002351 Ga0496121_0002351_16966_19626 792
36 3300006051 Ga0075364_10000093 Ga0075364_1000009314 794
37 3300037466 Ga0395898_0001668 Ga0395898_0001668_8434_10974 794
38 3300038443 Ga0395901_0023450 Ga0395901_0023450_3615_6155 794
39 3300046810 Ga0495660_0000084 Ga0495660_0000084_32655_35315 794
40 3300047469 Ga0495673_0000043 Ga0495673_0000043_102665_105325 794
41 3300047472 Ga0495686_0000176 Ga0495686_0000176_23734_26394 794
42 3300050491 nmdc:mga00v17_1060_c1 nmdc:mga00v17_1060_c1_2593_5226 794
43 3300003791 Ga0055530_10002449 Ga0055530_100024497 796
44 3300010375 Ga0105239_10022066 Ga0105239_100220664 796
45 3300025298 Ga0209050_1000896 Ga0209050_100089612 796
46 iso_pu_bacteria 8055878733 8055880469 796
47 3300032004 Ga0307414_10036861 Ga0307414_100368612 797
48 3300046452 Ga0495617_000151 Ga0495617_000151_3265_5925 797
49 3300046457 Ga0495590_0014445 Ga0495590_0014445_16_2676 797
50 3300046460 Ga0495638_0000369 Ga0495638_0000369_16946_19606 797
51 3300046501 Ga0495607_0000039 Ga0495607_0000039_128214_130874 797
52 3300046538 Ga0495609_0012445 Ga0495609_0012445_1271_3931 797
53 3300046648 Ga0495611_0000002 Ga0495611_0000002_117394_120054 797
54 3300046660 Ga0495625_0000002 Ga0495625_0000002_117394_120054 797
55 3300046691 Ga0495670_0001000 Ga0495670_0001000_10969_13629 797
56 3300046692 Ga0495671_0000230 Ga0495671_0000230_7233_9893 797
57 3300046794 Ga0495589_0000014 Ga0495589_0000014_116289_118949 797
58 3300046810 Ga0495660_0000066 Ga0495660_0000066_32787_35447 797
59 3300047446 Ga0495679_000003 Ga0495679_000003_667782_670442 797
60 3300047469 Ga0495673_0001475 Ga0495673_0001475_10049_12709 797
61 3300048925 Ga0496122_0026342 Ga0496122_0026342_1528_4188 797
62 3300049459 Ga0495678_000044 Ga0495678_000044_50338_52998 797
63 3300053087 Ga0500643_000024 Ga0500643_000024_51376_54036 797
64 3300053103 Ga0500555_000794 Ga0500555_000794_6772_9432 797
65 3300046513 Ga0495616_0011122 Ga0495616_0011122_1780_4440 798
66 3300005344 Ga0070661_100006265 Ga0070661_1000062653 799
67 3300046492 Ga0495585_0000134 Ga0495585_0000134_69604_72264 799
68 3300046518 Ga0495631_0000037 Ga0495631_0000037_70502_73162 799
69 3300046524 Ga0495648_0001574 Ga0495648_0001574_11316_13976 799
70 3300046665 Ga0495661_0000577 Ga0495661_0000577_5852_8512 799
71 3300053730 Ga0500645_000663 Ga0500645_000663_11316_13976 799
72 3300015261 Ga0182006_1000036 Ga0182006_100003698 800
73 3300025294 Ga0209025_1014426 Ga0209025_10144263 800
74 3300048927 Ga0496124_0000022 Ga0496124_0000022_194364_197093 801
75 3300003771 Ga0055526_1002501 Ga0055526_10025018 802
76 3300046452 Ga0495617_000036 Ga0495617_000036_100152_102812 802
77 3300046515 Ga0495620_0000280 Ga0495620_0000280_26745_29405 802
78 3300017792 Ga0163161_10008406 Ga0163161_100084062 803
79 3300046507 Ga0495606_0000107 Ga0495606_0000107_65892_68552 803
80 3300046660 Ga0495625_0024577 Ga0495625_0024577_24_2684 803
81 3300003781 Ga0055536_1002848 Ga0055536_10028485 804
82 3300005337 Ga0070682_100006836 Ga0070682_1000068363 804
83 3300005339 Ga0070660_100023551 Ga0070660_1000235513 804
84 3300005366 Ga0070659_100001246 Ga0070659_10000124612 804
85 3300005458 Ga0070681_10004433 Ga0070681_100044339 804
86 3300025292 Ga0209676_1001554 Ga0209676_100155411 804
87 3300025304 Ga0209257_1002809 Ga0209257_10028099 804
88 3300025912 Ga0207707_10003779 Ga0207707_100037793 804
89 3300025919 Ga0207657_10018685 Ga0207657_100186855 804
90 3300025932 Ga0207690_10003565 Ga0207690_100035655 804
91 3300038705 Ga0237819_00286 Ga0237819_00286_12559_15222 804
92 3300002773 JGI25152J39213_1000190 JGI25152J39213_100019029 805
93 3300002774 JGI25150J39212_1000138 JGI25150J39212_10001385 805
94 3300003187 JGI25151J46595_10000382 JGI25151J46595_1000038231 805
95 3300003215 JGI25153J46596_10000241 JGI25153J46596_1000024131 805
96 3300003773 Ga0055537_1000299 Ga0055537_100029931 805
97 3300003781 Ga0055536_1004258 Ga0055536_10042583 805
98 3300003781 Ga0055536_1004562 Ga0055536_10045623 805
99 3300003784 Ga0055534_1000322 Ga0055534_100032213 805
100 3300003790 Ga0055528_1000950 Ga0055528_10009504 805
101 3300003791 Ga0055530_10001839 Ga0055530_100018394 805
102 3300025245 Ga0207425_1000040 Ga0207425_100004074 805
103 3300025258 Ga0209129_1000011 Ga0209129_1000011188 805
104 3300025263 Ga0209565_1000071 Ga0209565_100007114 805
105 3300025273 Ga0209673_1001159 Ga0209673_100115913 805
106 3300025291 Ga0209675_1000018 Ga0209675_1000018328 805
107 3300025292 Ga0209676_1000185 Ga0209676_1000185134 805
108 3300025292 Ga0209676_1001632 Ga0209676_100163211 805
109 3300025294 Ga0209025_1000002 Ga0209025_1000002609 805
110 3300025295 Ga0209564_1000148 Ga0209564_100014814 805
111 3300025297 Ga0209758_1000003 Ga0209758_1000003616 805
112 3300025298 Ga0209050_1000182 Ga0209050_100018213 805
113 3300025303 Ga0209051_1001702 Ga0209051_10017023 805
114 3300025304 Ga0209257_1000470 Ga0209257_100047061 805
115 3300025304 Ga0209257_1002838 Ga0209257_100283810 805
116 3300046522 Ga0495643_0000701 Ga0495643_0000701_2089_4749 805
117 3300047320 Ga0495672_0000092 Ga0495672_0000092_130832_133492 805
118 3300048920 Ga0496117_0029416 Ga0496117_0029416_641_3301 805
119 3300048921 Ga0496118_0004490 Ga0496118_0004490_995_3655 805
120 3300009551 Ga0105238_10027975 Ga0105238_100279755 806
121 3300013104 Ga0157370_10005119 Ga0157370_100051199 806
122 3300025981 Ga0207640_10015274 Ga0207640_100152742 806
123 3300028800 Ga0265338_10029238 Ga0265338_100292383 806
124 3300031249 Ga0265339_10000725 Ga0265339_1000072512 806
125 3300031344 Ga0265316_10005447 Ga0265316_100054475 806
126 3300031595 Ga0265313_10000387 Ga0265313_1000038721 806
127 3300037466 Ga0395898_0002482 Ga0395898_0002482_9369_11909 806
128 3300038443 Ga0395901_0010648 Ga0395901_0010648_5931_8471 806
129 3300046519 Ga0495632_0004944 Ga0495632_0004944_3813_6473 806
130 3300046648 Ga0495611_0000070 Ga0495611_0000070_18468_21128 806
131 3300015265 Ga0182005_1007528 Ga0182005_10075282 807
132 3300003794 Ga0055531_10005904 Ga0055531_100059043 809
133 3300025304 Ga0209257_1006897 Ga0209257_10068974 809
134 3300013105 Ga0157369_10003045 Ga0157369_100030452 811
135 3300046507 Ga0495606_0005982 Ga0495606_0005982_8626_11286 812
136 3300025292 Ga0209676_1001294 Ga0209676_100129415 813
137 3300046460 Ga0495638_0015177 Ga0495638_0015177_1853_4513 813
138 3300046471 Ga0495650_0000779 Ga0495650_0000779_1416_4076 813
139 3300046512 Ga0495610_0003860 Ga0495610_0003860_4626_7286 813
140 3300046518 Ga0495631_0000665 Ga0495631_0000665_132_2792 813
141 3300046524 Ga0495648_0001456 Ga0495648_0001456_5082_7742 813
142 3300047469 Ga0495673_0000161 Ga0495673_0000161_13618_16278 813
143 3300048903 Ga0496100_0024510 Ga0496100_0024510_654_3323 813
144 3300048921 Ga0496118_0018228 Ga0496118_0018228_722_3391 813
145 3300048927 Ga0496124_0001413 Ga0496124_0001413_13561_16221 813
146 3300048929 Ga0496126_0009493 Ga0496126_0009493_6910_9579 813
147 3300048909 Ga0496106_0000066 Ga0496106_0000066_68567_71227 814
148 3300046453 Ga0495627_000164 Ga0495627_000164_15895_18537 815
149 3300046518 Ga0495631_0000582 Ga0495631_0000582_1969_4611 815
150 3300046530 Ga0495654_0011968 Ga0495654_0011968_1810_4452 815
151 3300046692 Ga0495671_0002198 Ga0495671_0002198_6538_9180 815
152 3300047320 Ga0495672_0000761 Ga0495672_0000761_15952_18594 815
153 3300049705 Ga0501225_0000518 Ga0501225_0000518_8431_11088 815
154 3300048924 Ga0496121_0000321 Ga0496121_0000321_35502_38171 816
155 3300002075 JGI24738J21930_10000119 JGI24738J21930_100001194 817
156 3300014497 Ga0182008_10002720 Ga0182008_100027207 817
157 3300015261 Ga0182006_1000167 Ga0182006_100016758 817
158 3300015265 Ga0182005_1000260 Ga0182005_100026028 817
159 3300031911 Ga0307412_10000830 Ga0307412_1000083011 817
160 3300041404 Ga0439436_0000002 Ga0439436_0000002_121172_123832 817
161 3300046512 Ga0495610_0000483 Ga0495610_0000483_22124_24784 817
162 3300046691 Ga0495670_0000537 Ga0495670_0000537_9229_11889 817
163 3300025299 Ga0209256_1004386 Ga0209256_10043866 818
164 3300041413 Ga0439465_0000098 Ga0439465_0000098_8373_11033 818
165 3300047472 Ga0495686_0000092 Ga0495686_0000092_184017_186677 818
166 3300048920 Ga0496117_0004119 Ga0496117_0004119_6548_9208 818
167 3300048921 Ga0496118_0004569 Ga0496118_0004569_7099_9759 818
168 3300048921 Ga0496118_0009147 Ga0496118_0009147_7171_9831 818
169 3300053125 Ga0500618_000536 Ga0500618_000536_11490_14129 818
170 3300025225 Ga0209566_101320 Ga0209566_1013201 819
171 3300025226 Ga0209674_100638 Ga0209674_1006384 819
172 3300025254 Ga0209148_1001620 Ga0209148_10016208 819
173 3300025256 Ga0209759_1007891 Ga0209759_10078911 819
174 3300003856 Ga0058692_1000001 Ga0058692_1000001287 820
175 3300005289 Ga0065704_10073713 Ga0065704_100737133 820
176 3300009036 Ga0105244_10001252 Ga0105244_1000125210 820
177 3300009036 Ga0105244_10001441 Ga0105244_100014413 820
178 3300009036 Ga0105244_10008596 Ga0105244_100085965 820
179 3300009036 Ga0105244_10024522 Ga0105244_100245222 820
180 3300009101 Ga0105247_10000271 Ga0105247_1000027134 820
181 3300009148 Ga0105243_10000010 Ga0105243_10000010276 820
182 3300009148 Ga0105243_10008238 Ga0105243_100082383 820
183 3300025711 Ga0207696_1000081 Ga0207696_1000081124 820
184 3300025728 Ga0207655_1000616 Ga0207655_100061610 820
185 3300025728 Ga0207655_1000861 Ga0207655_100086110 820
186 3300025728 Ga0207655_1001205 Ga0207655_100120513 820
187 3300025900 Ga0207710_10000005 Ga0207710_10000005599 820
188 3300025935 Ga0207709_10000001 Ga0207709_10000001532 820
189 3300027312 Ga0209371_1000008 Ga0209371_1000008418 820
190 3300030500 Ga0268256_1000009 Ga0268256_1000009418 820
191 3300031911 Ga0307412_10000311 Ga0307412_100003112 820
192 3300046455 Ga0495603_0026055 Ga0495603_0026055_664_3303 820
193 3300046515 Ga0495620_0000083 Ga0495620_0000083_35228_37882 820
194 3300046519 Ga0495632_0001473 Ga0495632_0001473_1045_3699 820
195 3300046522 Ga0495643_0003402 Ga0495643_0003402_8932_11586 820
196 3300046524 Ga0495648_0002374 Ga0495648_0002374_1103_3757 820
197 3300046694 Ga0495649_0001188 Ga0495649_0001188_5853_8492 820
198 3300048920 Ga0496117_0001172 Ga0496117_0001172_16715_19369 820
199 3300048920 Ga0496117_0001324 Ga0496117_0001324_17516_20170 820
200 3300048921 Ga0496118_0001439 Ga0496118_0001439_17114_19768 820
201 3300048925 Ga0496122_0022936 Ga0496122_0022936_86_2740 820
202 3300048926 Ga0496123_0004426 Ga0496123_0004426_3096_5750 820
203 3300048928 Ga0496125_0000793 Ga0496125_0000793_28982_31636 820
204 3300049460 Ga0495682_0005246 Ga0495682_0005246_2750_5404 820
205 3300003578 Ga0006562J51391_1012175 Ga0006562J51391_101217527 821
206 3300006944 Ga0099823_1000173 Ga0099823_100017316 821
207 3300009011 Ga0105251_10000018 Ga0105251_1000001879 821
208 3300009092 Ga0105250_10000068 Ga0105250_1000006840 821
209 3300025711 Ga0207696_1000152 Ga0207696_100015261 821
210 3300025728 Ga0207655_1000530 Ga0207655_100053030 821
211 3300025735 Ga0207713_1000009 Ga0207713_1000009455 821
212 3300027296 Ga0209389_1000059 Ga0209389_100005973 821
213 3300042006 Ga0439432_001128 Ga0439432_001128_4559_7213 821
214 3300042184 Ga0450908_000153 Ga0450908_000153_4187_6847 821
215 3300044672 Ga0466982_0000073 Ga0466982_0000073_2753_5422 821
216 3300046453 Ga0495627_003145 Ga0495627_003145_26_2689 821
217 3300046512 Ga0495610_0031445 Ga0495610_0031445_152_2740 821
218 3300048920 Ga0496117_0001159 Ga0496117_0001159_20410_23064 821
219 3300049571 Ga0501034_0000750 Ga0501034_0000750_28943_31597 821
220 3300053135 Ga0500659_0001462 Ga0500659_0001462_8606_11260 821
221 3300025292 Ga0209676_1000474 Ga0209676_100047431 822
222 3300025304 Ga0209257_1000568 Ga0209257_10005681 822
223 3300031239 Ga0265328_10004817 Ga0265328_100048173 822
224 3300031250 Ga0265331_10000327 Ga0265331_1000032724 822
225 3300005436 Ga0070713_100001236 Ga0070713_10000123610 823
226 3300005455 Ga0070663_100022255 Ga0070663_1000222553 823
227 3300013102 Ga0157371_10006647 Ga0157371_100066477 823
228 3300025250 Ga0209026_1000084 Ga0209026_1000084123 823
229 3300025272 Ga0209455_1000186 Ga0209455_100018645 823
230 3300025913 Ga0207695_10001726 Ga0207695_100017262 823
231 3300025928 Ga0207700_10020935 Ga0207700_100209353 823
232 3300026067 Ga0207678_10013915 Ga0207678_100139155 823
233 3300042013 Ga0439456_000063 Ga0439456_000063_14167_16821 823
234 3300042115 Ga0450911_000259 Ga0450911_000259_2157_4856 823
235 3300048904 Ga0496101_0008336 Ga0496101_0008336_3078_5729 823
236 3300048916 Ga0496113_0015683 Ga0496113_0015683_640_3291 823
237 3300048928 Ga0496125_0003484 Ga0496125_0003484_15438_18137 823
238 3300005435 Ga0070714_100002726 Ga0070714_10000272612 824
239 3300013104 Ga0157370_10007559 Ga0157370_1000755910 824
240 3300014497 Ga0182008_10018279 Ga0182008_100182792 824
241 3300046522 Ga0495643_0000618 Ga0495643_0000618_22714_25368 824
242 3300006051 Ga0075364_10030881 Ga0075364_100308812 825
243 3300025904 Ga0207647_10000007 Ga0207647_1000000729 825
244 3300025929 Ga0207664_10001608 Ga0207664_1000160812 825
245 3300048920 Ga0496117_0003896 Ga0496117_0003896_3488_6148 825
246 3300048921 Ga0496118_0005951 Ga0496118_0005951_6851_9511 825
247 3300048924 Ga0496121_0000075 Ga0496121_0000075_77946_80606 825
248 3300048928 Ga0496125_0005738 Ga0496125_0005738_4619_7279 825
249 3300046542 Ga0495597_0000092 Ga0495597_0000092_58889_61609 826
250 3300048929 Ga0496126_0031441 Ga0496126_0031441_1756_4416 826
251 3300013102 Ga0157371_10003036 Ga0157371_100030368 827
252 3300015262 Ga0182007_10000500 Ga0182007_100005007 827
253 3300015265 Ga0182005_1000186 Ga0182005_100018631 827
254 3300048922 Ga0496119_0000176 Ga0496119_0000176_6848_9508 827
255 3300048923 Ga0496120_0000277 Ga0496120_0000277_6858_9518 827
256 3300048924 Ga0496121_0057221 Ga0496121_0057221_289_2949 827
257 3300048925 Ga0496122_0008640 Ga0496122_0008640_2317_4977 827
258 3300048927 Ga0496124_0005910 Ga0496124_0005910_5973_8633 827
259 3300048927 Ga0496124_0013632 Ga0496124_0013632_1210_3870 827
260 3300048927 Ga0496124_0018700 Ga0496124_0018700_3733_6393 827
261 3300048928 Ga0496125_0001174 Ga0496125_0001174_6185_8845 827
262 3300048928 Ga0496125_0006187 Ga0496125_0006187_4555_7215 827
263 3300048928 Ga0496125_0009947 Ga0496125_0009947_3641_6301 827
264 3300048929 Ga0496126_0008940 Ga0496126_0008940_2163_4823 827
265 3300002737 JGI25162J39368_1001125 JGI25162J39368_10011255 828
266 3300002737 JGI25162J39368_1001172 JGI25162J39368_100117214 828
267 3300002737 JGI25162J39368_1001190 JGI25162J39368_10011907 828
268 3300002772 JGI25164J39214_1000412 JGI25164J39214_10004121 828
269 3300002772 JGI25164J39214_1000578 JGI25164J39214_10005788 828
270 3300003214 JGI25165J46597_1001207 JGI25165J46597_100120714 828
271 3300013104 Ga0157370_10010963 Ga0157370_100109634 828
272 3300014497 Ga0182008_10003269 Ga0182008_100032698 828
273 3300025231 Ga0207427_100134 Ga0207427_10013452 828
274 3300025233 Ga0209437_100005 Ga0209437_100005690 828
275 3300025261 Ga0209233_1000011 Ga0209233_1000011252 828
276 3300046519 Ga0495632_0000015 Ga0495632_0000015_144534_147203 828
277 3300048920 Ga0496117_0004182 Ga0496117_0004182_5809_8469 828
278 3300048921 Ga0496118_0003159 Ga0496118_0003159_5689_8349 828
279 3300048924 Ga0496121_0010562 Ga0496121_0010562_86_2746 828
280 3300048925 Ga0496122_0021338 Ga0496122_0021338_3011_5671 828
281 3300048927 Ga0496124_0015555 Ga0496124_0015555_383_3043 828
282 3300003794 Ga0055531_10002141 Ga0055531_1000214111 829
283 3300013100 Ga0157373_10000216 Ga0157373_1000021611 829
284 3300025304 Ga0209257_1000065 Ga0209257_1000065198 829
285 3300031595 Ga0265313_10010441 Ga0265313_100104413 829
286 3300037466 Ga0395898_0002038 Ga0395898_0002038_8979_11633 829
287 3300038443 Ga0395901_0032389 Ga0395901_0032389_1034_3688 829
288 3300003320 rootH2_10005102 rootH2_100051025 830
289 3300009093 Ga0105240_10000613 Ga0105240_1000061317 830
290 3300009093 Ga0105240_10001052 Ga0105240_1000105227 830
291 3300010375 Ga0105239_10000304 Ga0105239_1000030437 830
292 3300013102 Ga0157371_10005595 Ga0157371_100055955 830
293 3300025913 Ga0207695_10000691 Ga0207695_1000069132 830
294 3300025913 Ga0207695_10000960 Ga0207695_1000096019 830
295 3300031548 Ga0307408_100000019 Ga0307408_100000019225 830
296 3300044712 Ga0453684_0021449 Ga0453684_0021449_1440_4145 830
297 3300048907 Ga0496104_0022607 Ga0496104_0022607_753_3413 830
298 3300048908 Ga0496105_0004791 Ga0496105_0004791_764_3424 830
299 3300048921 Ga0496118_0005901 Ga0496118_0005901_6946_9615 830
300 3300048922 Ga0496119_0000248 Ga0496119_0000248_5531_8191 830
301 3300048922 Ga0496119_0008176 Ga0496119_0008176_1107_3776 830
302 3300048923 Ga0496120_0000143 Ga0496120_0000143_49271_51931 830
303 3300048923 Ga0496120_0003710 Ga0496120_0003710_5408_8077 830
304 3300053161 Ga0500634_0000078 Ga0500634_0000078_28367_31027 830
305 3300053730 Ga0500645_006491 Ga0500645_006491_413_3148 830
306 iso_pu_bacteria 2919506607 2919507453 830
307 3300013104 Ga0157370_10000114 Ga0157370_1000011428 831
308 3300037418 Ga0395900_0004192 Ga0395900_0004192_2454_5108 831
309 3300037466 Ga0395898_0010240 Ga0395898_0010240_6129_8783 831
310 3300038443 Ga0395901_0000926 Ga0395901_0000926_12682_15336 831
311 3300002705 JGI25156J39149_1002035 JGI25156J39149_10020353 832
312 3300002737 JGI25162J39368_1000330 JGI25162J39368_100033023 832
313 3300002771 JGI25163J39215_1000775 JGI25163J39215_10007754 832
314 3300002772 JGI25164J39214_1000251 JGI25164J39214_100025121 832
315 3300003214 JGI25165J46597_1000362 JGI25165J46597_100036222 832
316 3300009148 Ga0105243_10004053 Ga0105243_100040536 832
317 3300013102 Ga0157371_10000539 Ga0157371_1000053918 832
318 3300014497 Ga0182008_10000220 Ga0182008_1000022031 832
319 3300015687 Ga0183368_1003 Ga0183368_1003320 832
320 3300025207 Ga0209760_100043 Ga0209760_10004323 832
321 3300025231 Ga0207427_100082 Ga0207427_10008219 832
322 3300025233 Ga0209437_100006 Ga0209437_100006151 832
323 3300025261 Ga0209233_1000105 Ga0209233_1000105132 832
324 3300025292 Ga0209676_1000052 Ga0209676_1000052144 832
325 3300025935 Ga0207709_10005176 Ga0207709_100051766 832
326 3300031731 Ga0307405_10000793 Ga0307405_100007935 832
327 3300031903 Ga0307407_10006191 Ga0307407_100061913 832
328 3300048919 Ga0496116_0000532 Ga0496116_0000532_22607_25258 832
329 3300048920 Ga0496117_0001050 Ga0496117_0001050_22536_25187 832
330 3300048924 Ga0496121_0001218 Ga0496121_0001218_25871_28522 832
331 3300048925 Ga0496122_0003698 Ga0496122_0003698_16180_18831 832
332 3300048926 Ga0496123_0002808 Ga0496123_0002808_3972_6623 832
333 3300002737 JGI25162J39368_1000174 JGI25162J39368_100017436 833
334 3300002737 JGI25162J39368_1000968 JGI25162J39368_100096821 833
335 3300002741 JGI25157J39369_1000121 JGI25157J39369_100012133 833
336 3300002771 JGI25163J39215_1000140 JGI25163J39215_100014022 833
337 3300002772 JGI25164J39214_1000141 JGI25164J39214_100014122 833
338 3300003214 JGI25165J46597_1000262 JGI25165J46597_100026236 833
339 3300003761 Ga0055535_1000173 Ga0055535_100017336 833
340 3300003762 Ga0055542_1000170 Ga0055542_100017067 833
341 3300003762 Ga0055542_1000221 Ga0055542_100022136 833
342 3300003763 Ga0055529_1000236 Ga0055529_100023622 833
343 3300025207 Ga0209760_100663 Ga0209760_1006632 833
344 3300025224 Ga0209784_100137 Ga0209784_10013724 833
345 3300025228 Ga0209672_100293 Ga0209672_10029319 833
346 3300025231 Ga0207427_100176 Ga0207427_10017635 833
347 3300025233 Ga0209437_100059 Ga0209437_10005935 833
348 3300025233 Ga0209437_100214 Ga0209437_10021410 833
349 3300025242 Ga0209258_100027 Ga0209258_10002743 833
350 3300025242 Ga0209258_103020 Ga0209258_1030201 833
351 3300025250 Ga0209026_1000245 Ga0209026_100024535 833
352 3300025250 Ga0209026_1001482 Ga0209026_10014829 833
353 3300025254 Ga0209148_1000001 Ga0209148_1000001782 833
354 3300025254 Ga0209148_1000002 Ga0209148_1000002867 833
355 3300025256 Ga0209759_1000290 Ga0209759_100029035 833
356 3300025261 Ga0209233_1000002 Ga0209233_10000021449 833
357 3300025272 Ga0209455_1000019 Ga0209455_1000019110 833
358 3300025292 Ga0209676_1000248 Ga0209676_100024813 833
359 3300038443 Ga0395901_0030166 Ga0395901_0030166_121_2775 833
360 3300046460 Ga0495638_0000164 Ga0495638_0000164_36192_38858 833
361 3300046507 Ga0495606_0001316 Ga0495606_0001316_30941_33607 833
362 3300046694 Ga0495649_0000636 Ga0495649_0000636_25487_28153 833
363 3300048918 Ga0496115_0000332 Ga0496115_0000332_4000_6666 833
364 3300048929 Ga0496126_0050176 Ga0496126_0050176_747_3413 833
365 iso_pu_bacteria 2643221665 2644364119 833
366 iso_pu_bacteria 8033232454 8033233881 833
367 3300005340 Ga0070689_100005817 Ga0070689_1000058173 834
368 3300009551 Ga0105238_10058291 Ga0105238_100582913 834
369 3300015685 Ga0183369_1008 Ga0183369_100829 834
370 3300025226 Ga0209674_100058 Ga0209674_100058116 834
371 3300025226 Ga0209674_100282 Ga0209674_1002826 834
372 3300025231 Ga0207427_100150 Ga0207427_10015051 834
373 3300025233 Ga0209437_100200 Ga0209437_10020051 834
374 3300025253 Ga0209677_102120 Ga0209677_1021202 834
375 3300025261 Ga0209233_1000193 Ga0209233_100019351 834
376 3300025936 Ga0207670_10003314 Ga0207670_100033146 834
377 3300044842 Ga0466957_0022725 Ga0466957_0022725_195_2852 834
378 3300045836 Ga0466958_0006045 Ga0466958_0006045_950_3607 834
379 3300046460 Ga0495638_0000111 Ga0495638_0000111_33822_36488 834
380 3300046471 Ga0495650_0000430 Ga0495650_0000430_6903_9569 834
381 3300013102 Ga0157371_10019595 Ga0157371_100195954 835
382 iso_pu_bacteria 2643221581 2643913720 835
383 3300003760 Ga0055527_1000099 Ga0055527_100009936 836
384 3300003761 Ga0055535_1000174 Ga0055535_100017421 836
385 3300003761 Ga0055535_1000190 Ga0055535_100019017 836
386 3300003762 Ga0055542_1000148 Ga0055542_100014837 836
387 3300003763 Ga0055529_1000174 Ga0055529_100017437 836
388 3300003791 Ga0055530_10000225 Ga0055530_1000022518 836
389 3300003792 Ga0055540_1000239 Ga0055540_100023918 836
390 3300006042 Ga0075368_10006848 Ga0075368_100068482 836
391 3300006178 Ga0075367_10015478 Ga0075367_100154782 836
392 3300025228 Ga0209672_100061 Ga0209672_100061114 836
393 3300025242 Ga0209258_100054 Ga0209258_100054114 836
394 3300025242 Ga0209258_100383 Ga0209258_10038340 836
395 3300025254 Ga0209148_1000066 Ga0209148_1000066114 836
396 3300025272 Ga0209455_1000101 Ga0209455_1000101114 836
397 3300025298 Ga0209050_1000009 Ga0209050_1000009332 836
398 3300025303 Ga0209051_1000008 Ga0209051_100000889 836
399 iso_pu_bacteria 2510065053 2510282003 836
400 iso_pu_bacteria 2510065055 2510291838 836
401 iso_pu_bacteria 2510065058 2510310151 836
402 iso_pu_bacteria 2744054655 2745162196 836
403 iso_pu_bacteria 2773857672 2774129778 836
404 iso_pu_bacteria 2917832318 2917832775 836
405 iso_pu_bacteria 2919125081 2919125610 836
406 iso_pu_bacteria 2974298342 2974300207 836
407 iso_pu_bacteria 2984499530 2984502585 836
408 3300002067 JGI24735J21928_10003253 JGI24735J21928_100032532 837
409 3300002741 JGI25157J39369_1001646 JGI25157J39369_10016462 837
410 3300003756 Ga0055533_1000785 Ga0055533_10007852 837
411 3300014497 Ga0182008_10005552 Ga0182008_100055525 837
412 3300015262 Ga0182007_10000622 Ga0182007_100006222 837
413 3300025226 Ga0209674_100012 Ga0209674_10001248 837
414 3300025250 Ga0209026_1000017 Ga0209026_1000017256 837
415 3300048918 Ga0496115_0000268 Ga0496115_0000268_12088_14754 837
416 iso_pu_bacteria 2551306352 2552748256 837
417 iso_pu_bacteria 2639762793 2640734806 837
418 iso_pu_bacteria 2675903507 2678231744 837
419 iso_pu_bacteria 2690315857 2691332031 837
420 iso_pu_bacteria 2773857761 2774389442 837
421 iso_pu_bacteria 2773857770 2774436853 837
422 iso_pu_bacteria 2919182534 2919182913 837
423 iso_pu_bacteria 2919497567 2919498011 837
424 iso_pu_bacteria 2928515477 2928518327 837
425 3300002738 JGI25154J39366_1003312 JGI25154J39366_10033121 838
426 3300002741 JGI25157J39369_1001636 JGI25157J39369_10016363 838
427 3300002772 JGI25164J39214_1000004 JGI25164J39214_1000004116 838
428 3300003214 JGI25165J46597_1000110 JGI25165J46597_100011037 838
429 3300003760 Ga0055527_1001620 Ga0055527_10016203 838
430 3300003761 Ga0055535_1000176 Ga0055535_100017621 838
431 3300003762 Ga0055542_1000218 Ga0055542_100021816 838
432 3300003763 Ga0055529_1000092 Ga0055529_100009267 838
433 3300006946 Ga0079104_1000346 Ga0079104_100034630 838
434 3300015262 Ga0182007_10004808 Ga0182007_100048083 838
435 3300025935 Ga0207709_10001022 Ga0207709_100010227 838
436 3300027111 Ga0209281_1000018 Ga0209281_1000018366 838
437 3300027312 Ga0209371_1001010 Ga0209371_10010109 838
438 3300030500 Ga0268256_1001010 Ga0268256_100101010 838
439 3300046522 Ga0495643_0003329 Ga0495643_0003329_2641_5286 838
440 3300048927 Ga0496124_0021055 Ga0496124_0021055_1149_3803 838
441 3300048929 Ga0496126_0050300 Ga0496126_0050300_88_2742 838
442 iso_pu_bacteria 2916699645 2916702542 838
443 iso_pu_bacteria 2923516293 2923519638 838
444 iso_pu_bacteria 8003014200 8003015661 838
445 3300003756 Ga0055533_1001061 Ga0055533_10010618 839
446 3300003856 Ga0058692_1000075 Ga0058692_10000753 839
447 3300005539 Ga0068853_100000402 Ga0068853_10000040225 839
448 3300010375 Ga0105239_10017754 Ga0105239_100177546 839
449 3300015265 Ga0182005_1003121 Ga0182005_10031211 839
450 3300025228 Ga0209672_100077 Ga0209672_10007739 839
451 3300025231 Ga0207427_100031 Ga0207427_100031189 839
452 3300025233 Ga0209437_100061 Ga0209437_100061116 839
453 3300025242 Ga0209258_100097 Ga0209258_100097112 839
454 3300025250 Ga0209026_1002802 Ga0209026_10028023 839
455 3300025254 Ga0209148_1000063 Ga0209148_1000063112 839
456 3300025256 Ga0209759_1004139 Ga0209759_10041392 839
457 3300025261 Ga0209233_1000076 Ga0209233_1000076189 839
458 3300025272 Ga0209455_1000096 Ga0209455_1000096112 839
459 3300026041 Ga0207639_10022023 Ga0207639_100220233 839
460 3300026116 Ga0207674_10017933 Ga0207674_100179333 839
461 3300027312 Ga0209371_1000055 Ga0209371_1000055176 839
462 3300030500 Ga0268256_1000054 Ga0268256_100005457 839
463 3300031548 Ga0307408_100000135 Ga0307408_1000001353 839
464 3300031901 Ga0307406_10003229 Ga0307406_100032295 839
465 3300037466 Ga0395898_0000013 Ga0395898_0000013_326950_329622 839
466 3300038742 Ga0400486_14966 Ga0400486_14966_553_3306 839
467 3300046452 Ga0495617_000511 Ga0495617_000511_13507_16158 839
468 3300046457 Ga0495590_0002697 Ga0495590_0002697_716_3367 839
469 3300046501 Ga0495607_0001723 Ga0495607_0001723_5559_8210 839
470 3300046513 Ga0495616_0002321 Ga0495616_0002321_3736_6387 839
471 3300046794 Ga0495589_0000539 Ga0495589_0000539_19737_22388 839
472 3300047320 Ga0495672_0000378 Ga0495672_0000378_10538_13189 839
473 3300047469 Ga0495673_0001342 Ga0495673_0001342_11824_14475 839
474 3300048927 Ga0496124_0002223 Ga0496124_0002223_2385_5045 839
475 iso_pu_bacteria 2643221579 2643906775 839
476 iso_pu_bacteria 8002745576 8002750023 839
477 3300003187 JGI25151J46595_10000181 JGI25151J46595_1000018159 840
478 3300003759 Ga0055525_1000152 Ga0055525_100015215 840
479 3300003760 Ga0055527_1000059 Ga0055527_100005915 840
480 3300003761 Ga0055535_1000504 Ga0055535_100050420 840
481 3300003762 Ga0055542_1000137 Ga0055542_100013715 840
482 3300003763 Ga0055529_1000465 Ga0055529_100046515 840
483 3300005288 Ga0065714_10065526 Ga0065714_100655269 840
484 3300005288 Ga0065714_10067129 Ga0065714_100671292 840
485 3300006058 Ga0075432_10002552 Ga0075432_100025523 840
486 3300013307 Ga0157372_10005123 Ga0157372_100051233 840
487 3300021361 Ga0213872_10003515 Ga0213872_100035151 840
488 3300025294 Ga0209025_1000015 Ga0209025_1000015284 840
489 3300025297 Ga0209758_1016027 Ga0209758_10160272 840
490 3300046507 Ga0495606_0000861 Ga0495606_0000861_20860_23505 840
491 3300046519 Ga0495632_0007741 Ga0495632_0007741_132_2783 840
492 3300046538 Ga0495609_0020094 Ga0495609_0020094_338_2989 840
493 3300046694 Ga0495649_0001049 Ga0495649_0001049_4293_6944 840
494 3300046694 Ga0495649_0002635 Ga0495649_0002635_8808_11453 840
495 3300047443 Ga0495687_001573 Ga0495687_001573_2353_5004 840
496 3300047470 Ga0495681_0011853 Ga0495681_0011853_1295_3946 840
497 3300048922 Ga0496119_0008893 Ga0496119_0008893_1965_4619 840
498 3300048923 Ga0496120_0011536 Ga0496120_0011536_1838_4492 840
499 3300049571 Ga0501034_0000263 Ga0501034_0000263_81309_83939 840
500 iso_pu_bacteria 2747842501 2748019256 840
501 iso_pu_bacteria 2842780639 2842783137 840
502 3300009092 Ga0105250_10003150 Ga0105250_100031502 841
503 3300041407 Ga0439447_004544 Ga0439447_004544_1801_4515 841
504 3300046507 Ga0495606_0002500 Ga0495606_0002500_13795_16446 841
505 3300046513 Ga0495616_0002834 Ga0495616_0002834_6340_8991 841
506 3300046515 Ga0495620_0005651 Ga0495620_0005651_90_2741 841
507 3300046518 Ga0495631_0000839 Ga0495631_0000839_13741_16392 841
508 3300046520 Ga0495637_0022592 Ga0495637_0022592_107_2758 841
509 3300046524 Ga0495648_0023388 Ga0495648_0023388_1478_4129 841
510 3300046530 Ga0495654_0009239 Ga0495654_0009239_877_3528 841
511 3300046558 Ga0495633_0003268 Ga0495633_0003268_5227_7878 841
512 3300046616 Ga0495668_0006208 Ga0495668_0006208_4295_7009 841
513 3300047323 Ga0495683_0001838 Ga0495683_0001838_3117_5768 841
514 3300047469 Ga0495673_0001737 Ga0495673_0001737_6367_9018 841
515 3300048928 Ga0496125_0048475 Ga0496125_0048475_782_3433 841
516 3300048929 Ga0496126_0031860 Ga0496126_0031860_1305_3956 841
517 iso_pu_bacteria 2576861471 2578459985 841
518 iso_pu_bacteria 2643221559 2643815341 841
519 iso_pu_bacteria 2643221573 2643879388 841
520 iso_pu_bacteria 2643221586 2643940018 841
521 iso_pu_bacteria 2643221612 2644077074 841
522 iso_pu_bacteria 2643221720 2644660686 841
523 iso_pu_bacteria 2643221727 2644695388 841
524 iso_pu_bacteria 2643221728 2644698046 841
525 iso_pu_bacteria 2747842428 2747950165 841
526 iso_pu_bacteria 2765235840 2765577279 841
527 iso_pu_bacteria 2816332141 2816519920 841
528 iso_pu_bacteria 2842391507 2842394655 841
529 iso_pu_bacteria 2842757796 2842760816 841
530 iso_pu_bacteria 2852649853 2852652556 841
531 iso_pu_bacteria 2857442823 2857445571 841
532 iso_pu_bacteria 2874220319 2874223807 841
533 iso_pu_bacteria 2919089067 2919090271 841
534 iso_pu_bacteria 2919134579 2919138425 841
535 iso_pu_bacteria 2928496128 2928500369 841
536 iso_pu_bacteria 2931380184 2931382433 841
537 iso_pu_bacteria 2937610967 2937613721 841
538 iso_pu_bacteria 2939589442 2939593252 841
539 iso_pu_bacteria 2939622612 2939626212 841
540 iso_pu_bacteria 2939626828 2939627831 841
541 iso_pu_bacteria 2941475908 2941479651 841
542 iso_pu_bacteria 2961047084 2961050571 841
543 iso_pu_bacteria 2961064222 2961065754 841
544 iso_pu_bacteria 2974307012 2974310415 841
545 iso_pu_bacteria 2977247770 2977251147 841
546 iso_pu_bacteria 2984514374 2984518209 841
547 iso_pu_bacteria 2987605356 2987605788 841
548 3300003856 Ga0058692_1000005 Ga0058692_100000514 842
549 3300027312 Ga0209371_1000031 Ga0209371_100003113 842
550 3300030500 Ga0268256_1000034 Ga0268256_1000034339 842
551 3300031595 Ga0265313_10000632 Ga0265313_1000063234 842
552 iso_pu_bacteria 2894414249 2894416751 842
553 3300009011 Ga0105251_10000393 Ga0105251_100003933 843
554 3300009036 Ga0105244_10031815 Ga0105244_100318151 843
555 3300025728 Ga0207655_1002407 Ga0207655_100240711 843
556 3300025735 Ga0207713_1000220 Ga0207713_100022058 843
557 3300048924 Ga0496121_0006681 Ga0496121_0006681_5678_8386 843
558 3300048925 Ga0496122_0000843 Ga0496122_0000843_17490_20198 843
559 3300048925 Ga0496122_0010236 Ga0496122_0010236_3546_6206 843
560 3300048926 Ga0496123_0000765 Ga0496123_0000765_32348_35056 843
561 3300048926 Ga0496123_0016937 Ga0496123_0016937_2257_4917 843
562 3300048928 Ga0496125_0009159 Ga0496125_0009159_2996_5701 843
563 3300048929 Ga0496126_0014323 Ga0496126_0014323_3325_5985 843
564 iso_pu_bacteria 2593339238 2595448537 843
565 iso_pu_bacteria 2643221593 2643974293 843
566 iso_pu_bacteria 2842914999 2842916007 843
567 iso_pu_bacteria 2904479285 2904482172 843
568 iso_pu_bacteria 2919085039 2919088720 843
569 iso_pu_bacteria 2952252522 2952255202 843
570 3300003320 rootH2_10001701 rootH2_100017013 844
571 3300003761 Ga0055535_1000583 Ga0055535_100058320 844
572 3300003762 Ga0055542_1000470 Ga0055542_100047020 844
573 3300005290 Ga0065712_10067903 Ga0065712_1006790312 844
574 3300005347 Ga0070668_100019845 Ga0070668_1000198452 844
575 3300005456 Ga0070678_100053909 Ga0070678_1000539091 844
576 3300006186 Ga0075369_10005634 Ga0075369_100056343 844
577 3300025242 Ga0209258_100507 Ga0209258_10050713 844
578 3300025254 Ga0209148_1000523 Ga0209148_100052313 844
579 3300025304 Ga0209257_1000046 Ga0209257_1000046214 844
580 3300025972 Ga0207668_10002517 Ga0207668_100025175 844
581 3300026121 Ga0207683_10077888 Ga0207683_100778882 844
582 3300031251 Ga0265327_10000457 Ga0265327_1000045754 844
583 3300031456 Ga0307513_10001443 Ga0307513_1000144313 844
584 3300031711 Ga0265314_10014498 Ga0265314_100144983 844
585 3300031911 Ga0307412_10001099 Ga0307412_100010998 844
586 3300042013 Ga0439456_003327 Ga0439456_003327_544_3198 844
587 3300042115 Ga0450911_000001 Ga0450911_000001_52001_54655 844
588 3300042139 Ga0450904_000014 Ga0450904_000014_25810_28461 844
589 3300042156 Ga0439446_0000260 Ga0439446_0000260_771_3425 844
590 3300044684 Ga0466966_0026959 Ga0466966_0026959_670_3321 844
591 3300044693 Ga0466961_0009242 Ga0466961_0009242_1951_4602 844
592 3300045836 Ga0466958_0024695 Ga0466958_0024695_402_3053 844
593 3300046525 Ga0495663_0002943 Ga0495663_0002943_1795_4455 844
594 3300046525 Ga0495663_0004762 Ga0495663_0004762_276_2936 844
595 3300046692 Ga0495671_0013281 Ga0495671_0013281_1051_3711 844
596 3300047318 Ga0495636_0000165 Ga0495636_0000165_12788_15484 844
597 3300048919 Ga0496116_0003037 Ga0496116_0003037_7851_10511 844
598 3300048925 Ga0496122_0014173 Ga0496122_0014173_4973_7633 844
599 3300048926 Ga0496123_0001387 Ga0496123_0001387_15315_18008 844
600 3300048928 Ga0496125_0012715 Ga0496125_0012715_3925_6585 844
601 iso_pu_bacteria 2593339239 2595450907 844
602 iso_pu_bacteria 2687453130 2687582796 844
603 iso_pu_bacteria 2718218334 2721029510 844
604 iso_pu_bacteria 2734482264 2735834894 844
605 iso_pu_bacteria 2738543009 2739227974 844
606 iso_pu_bacteria 2818991440 2819564569 844
607 iso_pu_bacteria 2842918807 2842921268 844
608 iso_pu_bacteria 2884338543 2884342692 844
609 iso_pu_bacteria 2904463128 2904465215 844
610 iso_pu_bacteria 2919404418 2919407328 844
611 iso_pu_bacteria 2939611941 2939614892 844
612 iso_pu_bacteria 2941471342 2941474131 844
613 iso_pu_bacteria 2953994433 2953996511 844
614 iso_pu_bacteria 8021622325 8021622591 844
615 iso_pu_bacteria 8054357960 8054358272 844
616 3300001979 JGI24740J21852_10007570 JGI24740J21852_100075704 845
617 3300001989 JGI24739J22299_10002415 JGI24739J22299_100024155 845
618 3300001990 JGI24737J22298_10000714 JGI24737J22298_100007145 845
619 3300002705 JGI25156J39149_1002596 JGI25156J39149_10025962 845
620 3300002741 JGI25157J39369_1000201 JGI25157J39369_100020136 845
621 3300003316 rootH1_10016850 rootH1_100168503 845
622 3300003578 Ga0006562J51391_1006159 Ga0006562J51391_10061591 845
623 3300005262 Ga0065165_1002080 Ga0065165_100208012 845
624 3300005327 Ga0070658_10002285 Ga0070658_100022853 845
625 3300005335 Ga0070666_10000007 Ga0070666_10000007163 845
626 3300005457 Ga0070662_100044271 Ga0070662_1000442711 845
627 3300005563 Ga0068855_100012653 Ga0068855_1000126538 845
628 3300005577 Ga0068857_100001373 Ga0068857_1000013737 845
629 3300005578 Ga0068854_100000620 Ga0068854_10000062011 845
630 3300005834 Ga0068851_10002944 Ga0068851_100029445 845
631 3300006847 Ga0075431_100073439 Ga0075431_1000734392 845
632 3300009093 Ga0105240_10012795 Ga0105240_100127953 845
633 3300009093 Ga0105240_10042352 Ga0105240_100423523 845
634 3300009545 Ga0105237_10000022 Ga0105237_10000022136 845
635 3300009551 Ga0105238_10000211 Ga0105238_1000021161 845
636 3300010375 Ga0105239_10020676 Ga0105239_100206767 845
637 3300012500 Ga0157314_1000052 Ga0157314_10000529 845
638 3300013105 Ga0157369_10001269 Ga0157369_1000126927 845
639 3300013306 Ga0163162_10000541 Ga0163162_1000054115 845
640 3300021361 Ga0213872_10000554 Ga0213872_1000055410 845
641 3300025250 Ga0209026_1000130 Ga0209026_100013092 845
642 3300025256 Ga0209759_1000308 Ga0209759_100030811 845
643 3300025297 Ga0209758_1000823 Ga0209758_100082331 845
644 3300025321 Ga0207656_10001394 Ga0207656_100013944 845
645 3300025735 Ga0207713_1004943 Ga0207713_10049432 845
646 3300025903 Ga0207680_10000002 Ga0207680_10000002665 845
647 3300025904 Ga0207647_10004663 Ga0207647_100046635 845
648 3300025913 Ga0207695_10000362 Ga0207695_1000036282 845
649 3300025913 Ga0207695_10019502 Ga0207695_100195023 845
650 3300025913 Ga0207695_10020249 Ga0207695_100202496 845
651 3300025914 Ga0207671_10000009 Ga0207671_10000009494 845
652 3300025924 Ga0207694_10000177 Ga0207694_1000017755 845
653 3300025933 Ga0207706_10027998 Ga0207706_100279982 845
654 3300025949 Ga0207667_10000441 Ga0207667_1000044110 845
655 3300025949 Ga0207667_10002011 Ga0207667_1000201110 845
656 3300025981 Ga0207640_10000037 Ga0207640_1000003718 845
657 3300026078 Ga0207702_10003054 Ga0207702_100030545 845
658 3300026116 Ga0207674_10000625 Ga0207674_1000062511 845
659 3300028379 Ga0268266_10000004 Ga0268266_10000004663 845
660 3300029957 Ga0265324_10002056 Ga0265324_100020563 845
661 3300031250 Ga0265331_10000088 Ga0265331_1000008817 845
662 3300031731 Ga0307405_10006501 Ga0307405_100065014 845
663 3300033180 Ga0307510_10008630 Ga0307510_1000863011 845
664 3300037312 Ga0395899_0000215 Ga0395899_0000215_6584_9238 845
665 3300037418 Ga0395900_0000117 Ga0395900_0000117_104066_106720 845
666 3300037466 Ga0395898_0000120 Ga0395898_0000120_73666_76320 845
667 3300039447 Ga0436361_0167035 Ga0436361_0167035_15272_17986 845
668 3300044693 Ga0466961_0001073 Ga0466961_0001073_10895_13549 845
669 3300044765 Ga0466970_0001219 Ga0466970_0001219_8312_10966 845
670 3300045049 Ga0466959_0002131 Ga0466959_0002131_1355_4009 845
671 3300045049 Ga0466959_0005777 Ga0466959_0005777_5227_7881 845
672 3300046471 Ga0495650_0000250 Ga0495650_0000250_15323_17980 845
673 3300046491 Ga0495584_0015677 Ga0495584_0015677_168_2825 845
674 3300046506 Ga0495583_0000312 Ga0495583_0000312_17845_20502 845
675 3300046512 Ga0495610_0002020 Ga0495610_0002020_839_3490 845
676 3300046518 Ga0495631_0011772 Ga0495631_0011772_1370_4027 845
677 3300046522 Ga0495643_0029644 Ga0495643_0029644_103_2760 845
678 3300046665 Ga0495661_0000042 Ga0495661_0000042_18666_21323 845
679 3300047470 Ga0495681_0000592 Ga0495681_0000592_11381_14032 845
680 3300047470 Ga0495681_0013669 Ga0495681_0013669_901_3558 845
681 3300048924 Ga0496121_0023263 Ga0496121_0023263_2885_5542 845
682 3300048928 Ga0496125_0000088 Ga0496125_0000088_179280_181934 845
683 3300048929 Ga0496126_0032068 Ga0496126_0032068_1175_3832 845
684 3300049459 Ga0495678_003646 Ga0495678_003646_4748_7405 845
685 iso_pu_bacteria 2526164512 2526212019 845
686 iso_pu_bacteria 2537561836 2538833849 845
687 iso_pu_bacteria 2574179768 2574429549 845
688 iso_pu_bacteria 2739367700 2739732493 845
689 iso_pu_bacteria 2884411467 2884412575 845
690 iso_pu_bacteria 2895395659 2895398858 845
691 iso_pu_bacteria 2928963466 2928965210 845
692 iso_pu_bacteria 2939631187 2939635035 845
693 iso_pu_bacteria 8048746797 8048748032 845
694 3300005983 Ga0081540_1007424 Ga0081540_10074244 846
695 3300025228 Ga0209672_100043 Ga0209672_100043118 846
696 3300025230 Ga0209563_100062 Ga0209563_100062109 846
697 3300025242 Ga0209258_100076 Ga0209258_100076118 846
698 3300025254 Ga0209148_1000082 Ga0209148_1000082118 846
699 3300025272 Ga0209455_1000078 Ga0209455_1000078118 846
700 3300031250 Ga0265331_10000403 Ga0265331_1000040311 846
701 3300044712 Ga0453684_0000449 Ga0453684_0000449_54247_56982 846
702 3300045051 Ga0451576_0000167 Ga0451576_0000167_54247_56982 846
703 3300046501 Ga0495607_0000002 Ga0495607_0000002_185630_188287 846
704 3300046513 Ga0495616_0001346 Ga0495616_0001346_4770_7421 846
705 3300046520 Ga0495637_0001223 Ga0495637_0001223_12260_14911 846
706 3300046524 Ga0495648_0011085 Ga0495648_0011085_2158_4815 846
707 3300046530 Ga0495654_0001330 Ga0495654_0001330_4873_7524 846
708 3300046660 Ga0495625_0003773 Ga0495625_0003773_7349_10000 846
709 3300046694 Ga0495649_0011177 Ga0495649_0011177_436_3087 846
710 3300048091 Ga0495626_0002721 Ga0495626_0002721_7016_9667 846
711 3300048920 Ga0496117_0003971 Ga0496117_0003971_6094_8769 846
712 3300048922 Ga0496119_0001174 Ga0496119_0001174_10402_13077 846
713 3300048923 Ga0496120_0000919 Ga0496120_0000919_21809_24484 846
714 iso_pu_bacteria 2818991457 2819662591 846
715 iso_pu_bacteria 2852684882 2852687672 846
716 iso_pu_bacteria 2919130084 2919132158 846
717 iso_pu_bacteria 2929195423 2929199103 846
718 iso_pu_bacteria 2941489479 2941489502 846
719 iso_pu_bacteria 2995948881 2995950971 846
720 iso_pu_bacteria 8002869464 8002870047 846
721 3300005331 Ga0070670_100002004 Ga0070670_1000020043 847
722 3300005344 Ga0070661_100017022 Ga0070661_1000170222 847
723 3300005435 Ga0070714_100000114 Ga0070714_1000001144 847
724 3300005457 Ga0070662_100022493 Ga0070662_1000224933 847
725 3300009011 Ga0105251_10000192 Ga0105251_1000019226 847
726 3300009036 Ga0105244_10000874 Ga0105244_1000087421 847
727 3300013307 Ga0157372_10063947 Ga0157372_100639472 847
728 3300025728 Ga0207655_1002766 Ga0207655_10027669 847
729 3300025735 Ga0207713_1000374 Ga0207713_100037413 847
730 3300025735 Ga0207713_1001864 Ga0207713_100186412 847
731 3300025735 Ga0207713_1004231 Ga0207713_10042313 847
732 3300025925 Ga0207650_10002405 Ga0207650_100024054 847
733 3300025929 Ga0207664_10000088 Ga0207664_1000008851 847
734 3300025932 Ga0207690_10000537 Ga0207690_100005375 847
735 3300025933 Ga0207706_10031035 Ga0207706_100310352 847
736 3300025949 Ga0207667_10022673 Ga0207667_100226734 847
737 3300037312 Ga0395899_0029460 Ga0395899_0029460_163_2835 847
738 3300046460 Ga0495638_0000106 Ga0495638_0000106_104469_107135 847
739 3300046463 Ga0495653_0001795 Ga0495653_0001795_9666_12317 847
740 3300046690 Ga0495624_0001626 Ga0495624_0001626_4363_7014 847
741 3300047320 Ga0495672_0013803 Ga0495672_0013803_133_2784 847
742 3300047673 Ga0495593_0012666 Ga0495593_0012666_90_2741 847
743 3300048925 Ga0496122_0001411 Ga0496122_0001411_21763_24441 847
744 3300048926 Ga0496123_0000868 Ga0496123_0000868_21680_24358 847
745 3300048927 Ga0496124_0001111 Ga0496124_0001111_17148_19826 847
746 3300049853 Ga0501226_000003 Ga0501226_000003_256077_258731 847
747 iso_pu_bacteria 2524023250 2524613891 847
748 iso_pu_bacteria 2791355082 2792579903 847
749 iso_pu_bacteria 3007315729 3007319694 847
750 iso_pu_bacteria 8021626552 8021627533 847
751 iso_pu_bacteria 8021648035 8021650263 847
752 iso_pu_bacteria 8049293176 8049298749 847
753 3300005262 Ga0065165_1000035 Ga0065165_1000035184 848
754 3300009011 Ga0105251_10005394 Ga0105251_100053941 848
755 3300041405 Ga0439438_000460 Ga0439438_000460_1939_4590 848
756 3300041407 Ga0439447_000332 Ga0439447_000332_13764_16415 848
757 3300041452 Ga0451793_1828595 Ga0451793_1828595_641_3307 848
758 3300042184 Ga0450908_002163 Ga0450908_002163_230_2881 848
759 3300044672 Ga0466982_0000001 Ga0466982_0000001_321408_324071 848
760 3300044684 Ga0466966_0006479 Ga0466966_0006479_740_3403 848
761 3300046542 Ga0495597_0022393 Ga0495597_0022393_10_2646 848
762 3300048927 Ga0496124_0005421 Ga0496124_0005421_10705_13359 848
763 3300061719 Ga0466962_0004425 Ga0466962_0004425_1177_3840 848
764 iso_pu_bacteria 2522572158 2523103712 848
765 iso_pu_bacteria 2913295892 2913301270 848
766 3300003771 Ga0055526_1000426 Ga0055526_100042629 849
767 3300003773 Ga0055537_1000452 Ga0055537_100045224 849
768 3300003775 Ga0055524_1000453 Ga0055524_100045329 849
769 3300003784 Ga0055534_1000291 Ga0055534_100029129 849
770 3300003790 Ga0055528_1000425 Ga0055528_100042529 849
771 3300013102 Ga0157371_10022111 Ga0157371_100221113 849
772 3300015689 Ga0183360_10001 Ga0183360_100012151 849
773 3300025230 Ga0209563_101535 Ga0209563_1015353 849
774 3300025263 Ga0209565_1000001 Ga0209565_10000011669 849
775 3300025273 Ga0209673_1000001 Ga0209673_10000011669 849
776 3300025291 Ga0209675_1000001 Ga0209675_1000001864 849
777 3300025295 Ga0209564_1000001 Ga0209564_10000011026 849
778 3300025299 Ga0209256_1000002 Ga0209256_1000002527 849
779 3300046501 Ga0495607_0000283 Ga0495607_0000283_43877_46537 849
780 3300048924 Ga0496121_0007017 Ga0496121_0007017_9954_12671 849
781 iso_pu_bacteria 2738543020 2739288042 849
782 iso_pu_bacteria 2738543021 2739293629 849
783 iso_pu_bacteria 2828305725 2828306362 849
784 iso_pu_bacteria 2842805378 2842809523 849
785 3300005331 Ga0070670_100002874 Ga0070670_1000028744 850
786 3300005331 Ga0070670_100003451 Ga0070670_1000034514 850
787 3300005344 Ga0070661_100000132 Ga0070661_10000013212 850
788 3300005457 Ga0070662_100004466 Ga0070662_1000044665 850
789 3300005564 Ga0070664_100000361 Ga0070664_10000036125 850
790 3300009011 Ga0105251_10002842 Ga0105251_100028424 850
791 3300009036 Ga0105244_10003576 Ga0105244_100035764 850
792 3300009092 Ga0105250_10001340 Ga0105250_100013409 850
793 3300011119 Ga0105246_10004539 Ga0105246_100045394 850
794 3300013100 Ga0157373_10014159 Ga0157373_100141595 850
795 3300013100 Ga0157373_10027766 Ga0157373_100277663 850
796 3300013104 Ga0157370_10027408 Ga0157370_100274082 850
797 3300013105 Ga0157369_10033615 Ga0157369_100336153 850
798 3300013308 Ga0157375_10013702 Ga0157375_100137022 850
799 3300014497 Ga0182008_10008220 Ga0182008_100082204 850
800 3300014497 Ga0182008_10008370 Ga0182008_100083701 850
801 3300015261 Ga0182006_1001679 Ga0182006_10016799 850
802 3300015262 Ga0182007_10001614 Ga0182007_100016143 850
803 3300021361 Ga0213872_10002449 Ga0213872_100024497 850
804 3300025711 Ga0207696_1001350 Ga0207696_10013505 850
805 3300025728 Ga0207655_1000744 Ga0207655_100074431 850
806 3300025735 Ga0207713_1004849 Ga0207713_10048499 850
807 3300025914 Ga0207671_10000079 Ga0207671_10000079121 850
808 3300025920 Ga0207649_10000002 Ga0207649_1000000212 850
809 3300025925 Ga0207650_10001948 Ga0207650_100019489 850
810 3300025925 Ga0207650_10002152 Ga0207650_100021529 850
811 3300025933 Ga0207706_10003812 Ga0207706_100038125 850
812 3300025945 Ga0207679_10000006 Ga0207679_10000006479 850
813 3300039447 Ga0436361_0210759 Ga0436361_0210759_1708_4404 850
814 3300039447 Ga0436361_0499005 Ga0436361_0499005_2121_4817 850
815 3300042006 Ga0439432_000405 Ga0439432_000405_4552_7203 850
816 3300045051 Ga0451576_0000276 Ga0451576_0000276_88673_91369 850
817 3300046452 Ga0495617_000674 Ga0495617_000674_12242_14893 850
818 3300046474 Ga0495605_0021501 Ga0495605_0021501_320_2995 850
819 3300046810 Ga0495660_0000611 Ga0495660_0000611_816_3491 850
820 3300048924 Ga0496121_0067627 Ga0496121_0067627_180_2831 850
821 3300048926 Ga0496123_0050804 Ga0496123_0050804_56_2707 850
822 iso_pu_bacteria 651053060 651175825 850
823 3300005327 Ga0070658_10006367 Ga0070658_100063676 851
824 3300005366 Ga0070659_100002715 Ga0070659_1000027153 851
825 3300005455 Ga0070663_100001900 Ga0070663_1000019004 851
826 3300005458 Ga0070681_10039916 Ga0070681_100399164 851
827 3300005563 Ga0068855_100009015 Ga0068855_1000090159 851
828 3300005577 Ga0068857_100046251 Ga0068857_1000462512 851
829 3300005614 Ga0068856_100000074 Ga0068856_10000007451 851
830 3300013100 Ga0157373_10054044 Ga0157373_100540442 851
831 3300013104 Ga0157370_10003574 Ga0157370_100035745 851
832 3300021361 Ga0213872_10008019 Ga0213872_100080192 851
833 3300021361 Ga0213872_10012810 Ga0213872_100128102 851
834 3300025909 Ga0207705_10001374 Ga0207705_1000137412 851
835 3300025932 Ga0207690_10015721 Ga0207690_100157212 851
836 3300025949 Ga0207667_10010429 Ga0207667_100104294 851
837 3300026067 Ga0207678_10003160 Ga0207678_100031604 851
838 3300026078 Ga0207702_10001508 Ga0207702_1000150814 851
839 3300039447 Ga0436361_0286565 Ga0436361_0286565_1812_4511 851
840 3300039447 Ga0436361_0541030 Ga0436361_0541030_1096_3789 851
841 3300046458 Ga0495591_000081 Ga0495591_000081_40750_43410 851
842 3300046460 Ga0495638_0001132 Ga0495638_0001132_7343_9994 851
843 3300046474 Ga0495605_0000198 Ga0495605_0000198_12030_14690 851
844 3300046492 Ga0495585_0008128 Ga0495585_0008128_2902_5544 851
845 3300046501 Ga0495607_0000054 Ga0495607_0000054_76496_79156 851
846 3300046501 Ga0495607_0001926 Ga0495607_0001926_1331_3967 851
847 3300046506 Ga0495583_0000460 Ga0495583_0000460_17755_20406 851
848 3300046507 Ga0495606_0003361 Ga0495606_0003361_9398_12031 851
849 3300046512 Ga0495610_0001597 Ga0495610_0001597_4433_7084 851
850 3300046520 Ga0495637_0012737 Ga0495637_0012737_1028_3667 851
851 3300046530 Ga0495654_0000693 Ga0495654_0000693_17877_20528 851
852 3300046542 Ga0495597_0000020 Ga0495597_0000020_39374_42043 851
853 3300046665 Ga0495661_0000048 Ga0495661_0000048_42934_45576 851
854 3300046665 Ga0495661_0012447 Ga0495661_0012447_140_2791 851
855 3300046810 Ga0495660_0009203 Ga0495660_0009203_2849_5518 851
856 3300047323 Ga0495683_0000019 Ga0495683_0000019_175559_178201 851
857 3300047446 Ga0495679_001031 Ga0495679_001031_11581_14232 851
858 3300047470 Ga0495681_0001970 Ga0495681_0001970_1977_4628 851
859 3300049586 Ga0501070_0006118 Ga0501070_0006118_6476_9160 851
860 3300049590 Ga0501074_0014699 Ga0501074_0014699_153_2837 851
861 3300049742 Ga0501080_0022066 Ga0501080_0022066_2010_4694 851
862 3300049822 Ga0501035_0005229 Ga0501035_0005229_2859_5543 851
863 3300009036 Ga0105244_10001000 Ga0105244_100010004 852
864 3300013308 Ga0157375_10009019 Ga0157375_100090194 852
865 3300047446 Ga0495679_000235 Ga0495679_000235_38507_41158 852
866 3300047469 Ga0495673_0000269 Ga0495673_0000269_66138_68795 852
867 3300048926 Ga0496123_0031512 Ga0496123_0031512_80_2731 852
868 3300048928 Ga0496125_0002832 Ga0496125_0002832_18038_20689 852
869 iso_pu_bacteria 2554235132 2554816084 852
870 iso_pu_bacteria 2597489888 2597862964 852
871 iso_pu_bacteria 2599185189 2599507464 852
872 iso_pu_bacteria 2600254954 2600442698 852
873 iso_pu_bacteria 2606217733 2608382447 852
874 iso_pu_bacteria 2643221571 2643870982 852
875 iso_pu_bacteria 2811994881 2812367905 852
876 iso_pu_bacteria 2923519811 2923521956 852
877 iso_pu_bacteria 8011350971 8011354645 852
878 iso_pu_bacteria 8054347763 8054352041 852
879 iso_pu_bacteria 8056148874 8056149787 852
880 3300037312 Ga0395899_0021585 Ga0395899_0021585_1223_3943 853
881 3300046457 Ga0495590_0013406 Ga0495590_0013406_310_2961 853
882 3300046520 Ga0495637_0010651 Ga0495637_0010651_1438_4089 853
883 3300046522 Ga0495643_0001848 Ga0495643_0001848_8358_11003 853
884 3300046530 Ga0495654_0007681 Ga0495654_0007681_338_2989 853
885 3300046692 Ga0495671_0001229 Ga0495671_0001229_13276_15921 853
886 iso_pu_bacteria 2511231004 2511255013 853
887 iso_pu_bacteria 2511231006 2511268392 853
888 iso_pu_bacteria 2511231007 2511273038 853
889 iso_pu_bacteria 2511231008 2511276022 853
890 iso_pu_bacteria 2511231010 2511287731 853
891 iso_pu_bacteria 2511231011 2511295228 853
892 iso_pu_bacteria 2511231012 2511301133 853
893 iso_pu_bacteria 2511231014 2511313271 853
894 iso_pu_bacteria 2511231015 2511321515 853
895 iso_pu_bacteria 2511231016 2511324164 853
896 iso_pu_bacteria 2511231017 2511331673 853
897 iso_pu_bacteria 2511231018 2511337498 853
898 iso_pu_bacteria 2511231019 2511345914 853
899 iso_pu_bacteria 2511231020 2511349792 853
900 iso_pu_bacteria 2511231021 2511357802 853
901 iso_pu_bacteria 2511231022 2511362957 853
902 iso_pu_bacteria 2511231024 2511373687 853
903 iso_pu_bacteria 2511231031 2511410817 853
904 iso_pu_bacteria 2511231156 2511823656 853
905 iso_pu_bacteria 2512047018 2512324041 853
906 iso_pu_bacteria 2554235231 2555249270 853
907 iso_pu_bacteria 2554235341 2555671303 853
908 iso_pu_bacteria 2582580891 2583793714 853
909 iso_pu_bacteria 2597489887 2597859374 853
910 iso_pu_bacteria 2597489889 2597868755 853
911 iso_pu_bacteria 2599185155 2599326692 853
912 iso_pu_bacteria 2599185160 2599354536 853
913 iso_pu_bacteria 2599185161 2599359750 853
914 iso_pu_bacteria 2599185162 2599366072 853
915 iso_pu_bacteria 2599185163 2599372862 853
916 iso_pu_bacteria 2599185164 2599379644 853
917 iso_pu_bacteria 2599185165 2599385378 853
918 iso_pu_bacteria 2599185166 2599391721 853
919 iso_pu_bacteria 2599185167 2599396439 853
920 iso_pu_bacteria 2599185168 2599403487 853
921 iso_pu_bacteria 2599185179 2599453505 853
922 iso_pu_bacteria 2599185181 2599461370 853
923 iso_pu_bacteria 2599185182 2599469914 853
924 iso_pu_bacteria 2599185185 2599482204 853
925 iso_pu_bacteria 2599185186 2599490390 853
926 iso_pu_bacteria 2599185188 2599504448 853
927 iso_pu_bacteria 2599185190 2599514786 853
928 iso_pu_bacteria 2599185191 2599522246 853
929 iso_pu_bacteria 2599185212 2599611656 853
930 iso_pu_bacteria 2599185248 2599770248 853
931 iso_pu_bacteria 2599185257 2599804076 853
932 iso_pu_bacteria 2599185288 2599883105 853
933 iso_pu_bacteria 2599185289 2599887545 853
934 iso_pu_bacteria 2599185290 2599893949 853
935 iso_pu_bacteria 2599185291 2599899976 853
936 iso_pu_bacteria 2599185300 2599932110 853
937 iso_pu_bacteria 2599185302 2599941817 853
938 iso_pu_bacteria 2599185303 2599951778 853
939 iso_pu_bacteria 2599185304 2599952663 853
940 iso_pu_bacteria 2599185305 2599960553 853
941 iso_pu_bacteria 2599185306 2599964849 853
942 iso_pu_bacteria 2599185307 2599970453 853
943 iso_pu_bacteria 2599185308 2599976038 853
944 iso_pu_bacteria 2599185309 2599981986 853
945 iso_pu_bacteria 2599185310 2599987895 853
946 iso_pu_bacteria 2599185311 2599995597 853
947 iso_pu_bacteria 2599185312 2599998213 853
948 iso_pu_bacteria 2599185313 2600005377 853
949 iso_pu_bacteria 2599185314 2600010081 853
950 iso_pu_bacteria 2599185315 2600017407 853
951 iso_pu_bacteria 2599185316 2600022627 853
952 iso_pu_bacteria 2599185317 2600027647 853
953 iso_pu_bacteria 2599185318 2600034431 853
954 iso_pu_bacteria 2599185319 2600041728 853
955 iso_pu_bacteria 2599185320 2600046225 853
956 iso_pu_bacteria 2599185321 2600052230 853
957 iso_pu_bacteria 2599185322 2600057604 853
958 iso_pu_bacteria 2599185323 2600065192 853
959 iso_pu_bacteria 2599185324 2600072342 853
960 iso_pu_bacteria 2599185325 2600075902 853
961 iso_pu_bacteria 2599185356 2600213987 853
962 iso_pu_bacteria 2600254930 2600356644 853
963 iso_pu_bacteria 2600254931 2600364281 853
964 iso_pu_bacteria 2600255283 2601624856 853
965 iso_pu_bacteria 2600255296 2601691480 853
966 iso_pu_bacteria 2600255313 2601774153 853
967 iso_pu_bacteria 2600255318 2601796290 853
968 iso_pu_bacteria 2600255389 2602011078 853
969 iso_pu_bacteria 2603880185 2606073439 853
970 iso_pu_bacteria 2603880199 2606126915 853
971 iso_pu_bacteria 2619619299 2621300963 853
972 iso_pu_bacteria 2623620443 2624481939 853
973 iso_pu_bacteria 2623620446 2624490975 853
974 iso_pu_bacteria 2643221565 2643845641 853
975 iso_pu_bacteria 2643221589 2643956518 853
976 iso_pu_bacteria 2643221602 2644025440 853
977 iso_pu_bacteria 2643221633 2644188668 853
978 iso_pu_bacteria 2643221650 2644281658 853
979 iso_pu_bacteria 2643221713 2644625230 853
980 iso_pu_bacteria 2667528170 2671090205 853
981 iso_pu_bacteria 2667528171 2671097118 853
982 iso_pu_bacteria 2667528176 2671125983 853
983 iso_pu_bacteria 2671180172 2671770356 853
984 iso_pu_bacteria 2675903420 2677896802 853
985 iso_pu_bacteria 2675903515 2678262586 853
986 iso_pu_bacteria 2713897148 2715751242 853
987 iso_pu_bacteria 2713897149 2715758242 853
988 iso_pu_bacteria 2721755607 2723247779 853
989 iso_pu_bacteria 2738541265 2738670411 853
990 iso_pu_bacteria 2738541271 2738688564 853
991 iso_pu_bacteria 2738541282 2738748804 853
992 iso_pu_bacteria 2738541294 2738809698 853
993 iso_pu_bacteria 2738541303 2738857846 853
994 iso_pu_bacteria 2738541309 2738897058 853
995 iso_pu_bacteria 2738543004 2739197147 853
996 iso_pu_bacteria 2738543015 2739259219 853
997 iso_pu_bacteria 2738543016 2739264296 853
998 iso_pu_bacteria 2738543025 2739314049 853
999 iso_pu_bacteria 2740892503 2743738906 853
1000 iso_pu_bacteria 2744054620 2745008928 853
1001 iso_pu_bacteria 2765235841 2765582986 853
1002 iso_pu_bacteria 2773857670 2774121221 853
1003 iso_pu_bacteria 2773857673 2774132849 853
1004 iso_pu_bacteria 2784132063 2784263296 853
1005 iso_pu_bacteria 2784132072 2784316587 853
1006 iso_pu_bacteria 2791355520 2794596390 853
1007 iso_pu_bacteria 2806310737 2807407498 853
1008 iso_pu_bacteria 2806310745 2807455835 853
1009 iso_pu_bacteria 2808606361 2808855026 853
1010 iso_pu_bacteria 2808606373 2808903932 853
1011 iso_pu_bacteria 2808606376 2808923681 853
1012 iso_pu_bacteria 2808606377 2808930634 853
1013 iso_pu_bacteria 2808606378 2808935682 853
1014 iso_pu_bacteria 2808606380 2808945555 853
1015 iso_pu_bacteria 2808606381 2808952756 853
1016 iso_pu_bacteria 2808606382 2808957754 853
1017 iso_pu_bacteria 2808606383 2808963623 853
1018 iso_pu_bacteria 2808606385 2808979503 853
1019 iso_pu_bacteria 2808606388 2808996777 853
1020 iso_pu_bacteria 2808606389 2808998419 853
1021 iso_pu_bacteria 2808606445 2809218794 853
1022 iso_pu_bacteria 2816332298 2817489735 853
1023 iso_pu_bacteria 2818991456 2819655683 853
1024 iso_pu_bacteria 2818991464 2819702213 853
1025 iso_pu_bacteria 2825651385 2825653051 853
1026 iso_pu_bacteria 2826581358 2826583001 853
1027 iso_pu_bacteria 2834028612 2834029610 853
1028 iso_pu_bacteria 2842815866 2842821206 853
1029 iso_pu_bacteria 2842826826 2842831678 853
1030 iso_pu_bacteria 2842832357 2842836534 853
1031 iso_pu_bacteria 2842837860 2842842267 853
1032 iso_pu_bacteria 2842843487 2842844647 853
1033 iso_pu_bacteria 2842849001 2842850743 853
1034 iso_pu_bacteria 2842854478 2842854640 853
1035 iso_pu_bacteria 2844665904 2844671830 853
1036 iso_pu_bacteria 2852612431 2852614875 853
1037 iso_pu_bacteria 2852657418 2852663183 853
1038 iso_pu_bacteria 2852667396 2852669843 853
1039 iso_pu_bacteria 2860339153 2860340819 853
1040 iso_pu_bacteria 2860867994 2860869601 853
1041 iso_pu_bacteria 2878029506 2878033923 853
1042 iso_pu_bacteria 2880230671 2880234548 853
1043 iso_pu_bacteria 2904518522 2904521311 853
1044 iso_pu_bacteria 2904550169 2904555089 853
1045 iso_pu_bacteria 2908446538 2908448525 853
1046 iso_pu_bacteria 2912963787 2912967306 853
1047 iso_pu_bacteria 2913036834 2913038565 853
1048 iso_pu_bacteria 2917070673 2917075167 853
1049 iso_pu_bacteria 2919063839 2919068909 853
1050 iso_pu_bacteria 2919155634 2919159742 853
1051 iso_pu_bacteria 2919385768 2919388016 853
1052 iso_pu_bacteria 2919456309 2919461049 853
1053 iso_pu_bacteria 2919481497 2919481840 853
1054 iso_pu_bacteria 2919487758 2919489802 853
1055 iso_pu_bacteria 2919697872 2919701990 853
1056 iso_pu_bacteria 2923153595 2923157982 853
1057 iso_pu_bacteria 2923586266 2923587323 853
1058 iso_pu_bacteria 2929144301 2929146015 853
1059 iso_pu_bacteria 2929189879 2929191580 853
1060 iso_pu_bacteria 2931369376 2931370645 853
1061 iso_pu_bacteria 2931390751 2931392675 853
1062 iso_pu_bacteria 2931396565 2931396572 853
1063 iso_pu_bacteria 2935353572 2935356155 853
1064 iso_pu_bacteria 2939636861 2939637604 853
1065 iso_pu_bacteria 2939651529 2939654821 853
1066 iso_pu_bacteria 2945928738 2945928988 853
1067 iso_pu_bacteria 2945961074 2945962216 853
1068 iso_pu_bacteria 2946006987 2946011209 853
1069 iso_pu_bacteria 2946027586 2946029861 853
1070 iso_pu_bacteria 2947233263 2947236431 853
1071 iso_pu_bacteria 2969304461 2969308698 853
1072 iso_pu_bacteria 2974289157 2974289928 853
1073 iso_pu_bacteria 2984286254 2984288191 853
1074 iso_pu_bacteria 2988728565 2988733549 853
1075 iso_pu_bacteria 2998139840 2998144004 853
1076 iso_pu_bacteria 3007395558 3007397289 853
1077 iso_pu_bacteria 3007419365 3007424495 853
1078 iso_pu_bacteria 3007511990 3007513122 853
1079 iso_pu_bacteria 3007614139 3007615619 853
1080 iso_pu_bacteria 3007619802 3007625649 853
1081 iso_pu_bacteria 3007718800 3007718929 853
1082 iso_pu_bacteria 3007855910 3007859001 853
1083 iso_pu_bacteria 3007861166 3007865433 853
1084 iso_pu_bacteria 3007866637 3007870285 853
1085 iso_pu_bacteria 3007872151 3007872578 853
1086 iso_pu_bacteria 637000220 637321631 853
1087 iso_pu_bacteria 8015687852 8015692080 853
1088 iso_pu_bacteria 8019769354 8019775142 853
1089 iso_pu_bacteria 8019775933 8019781006 853
1090 iso_pu_bacteria 8029995093 8029996874 853
1091 iso_pu_bacteria 8034962539 8034964331 853
1092 iso_pu_bacteria 8052494512 8052498279 853
1093 iso_pu_bacteria 8054285046 8054285160 853
1094 iso_pu_bacteria 8054503363 8054505183 853
1095 iso_pu_bacteria 8054929484 8054933433 853
1096 iso_pu_bacteria 8055770955 8055775289 853
1097 iso_pu_bacteria 8055817908 8055819720 853
1098 iso_pu_bacteria 8056115690 8056119643 853
1099 iso_pu_bacteria 8056120720 8056124270 853
1100 iso_pu_bacteria 8056125926 8056127555 853
1101 iso_pu_bacteria 8056131705 8056133507 853
1102 iso_pu_bacteria 8056137416 8056141185 853
1103 iso_pu_bacteria 8056143049 8056147274 853
1104 iso_pu_bacteria 8056155041 8056155045 853
1105 iso_pu_bacteria 8056155041 8056155872 853
1106 iso_pu_bacteria 8056161164 8056164930 853
1107 iso_pu_bacteria 8056166840 8056167272 853
1108 iso_pu_bacteria 8056172158 8056173257 853
1109 iso_pu_bacteria 8056177738 8056179450 853
1110 iso_pu_bacteria 8056569372 8056572745 853
1111 iso_pu_bacteria 8057798959 8057804115 853
1112 3300003751 Ga0055538_1000102 Ga0055538_100010210 854
1113 3300003752 Ga0055539_1000151 Ga0055539_100015110 854
1114 3300003756 Ga0055533_1000154 Ga0055533_100015410 854
1115 3300003758 Ga0055532_1000831 Ga0055532_10008313 854
1116 3300003759 Ga0055525_1000204 Ga0055525_100020410 854
1117 3300003841 Ga0055541_1000101 Ga0055541_100010110 854
1118 3300005288 Ga0065714_10003085 Ga0065714_100030858 854
1119 3300005289 Ga0065704_10074873 Ga0065704_100748732 854
1120 3300005548 Ga0070665_100001457 Ga0070665_1000014578 854
1121 3300025224 Ga0209784_100138 Ga0209784_10013810 854
1122 3300025225 Ga0209566_100179 Ga0209566_10017910 854
1123 3300025226 Ga0209674_100186 Ga0209674_10018610 854
1124 3300025229 Ga0209147_100195 Ga0209147_10019510 854
1125 3300025230 Ga0209563_100148 Ga0209563_10014810 854
1126 3300025242 Ga0209258_100339 Ga0209258_10033910 854
1127 3300025253 Ga0209677_100137 Ga0209677_10013710 854
1128 3300028379 Ga0268266_10000958 Ga0268266_100009582 854
1129 3300049569 Ga0501032_0011927 Ga0501032_0011927_668_3316 855
1130 3300025728 Ga0207655_1000005 Ga0207655_1000005712 856
1131 3300041405 Ga0439438_000067 Ga0439438_000067_32888_35539 856
1132 3300041411 Ga0439466_0004501 Ga0439466_0004501_326_2977 856
1133 3300042006 Ga0439432_006636 Ga0439432_006636_82_2730 856
1134 3300046453 Ga0495627_000032 Ga0495627_000032_115007_117667 856
1135 3300046458 Ga0495591_002811 Ga0495591_002811_4439_7096 856
1136 3300046471 Ga0495650_0002309 Ga0495650_0002309_1067_3724 856
1137 3300046500 Ga0495596_0003894 Ga0495596_0003894_4575_7232 856
1138 3300046507 Ga0495606_0000274 Ga0495606_0000274_69588_72245 856
1139 3300046507 Ga0495606_0000630 Ga0495606_0000630_34526_37183 856
1140 3300046518 Ga0495631_0004237 Ga0495631_0004237_3817_6474 856
1141 3300046519 Ga0495632_0002967 Ga0495632_0002967_20_2677 856
1142 3300046519 Ga0495632_0024030 Ga0495632_0024030_174_2831 856
1143 3300046520 Ga0495637_0000174 Ga0495637_0000174_18275_20932 856
1144 3300046520 Ga0495637_0000201 Ga0495637_0000201_17902_20559 856
1145 3300046522 Ga0495643_0008038 Ga0495643_0008038_2954_5611 856
1146 3300046524 Ga0495648_0002447 Ga0495648_0002447_9055_11712 856
1147 3300046530 Ga0495654_0006160 Ga0495654_0006160_793_3450 856
1148 3300046538 Ga0495609_0000902 Ga0495609_0000902_987_3644 856
1149 3300046648 Ga0495611_0002616 Ga0495611_0002616_115_2772 856
1150 3300046660 Ga0495625_0000070 Ga0495625_0000070_145419_148076 856
1151 3300046692 Ga0495671_0002316 Ga0495671_0002316_6536_9193 856
1152 3300047320 Ga0495672_0005047 Ga0495672_0005047_2952_5603 856
1153 3300047321 Ga0495676_0000019 Ga0495676_0000019_135802_138459 856
1154 3300047446 Ga0495679_004616 Ga0495679_004616_468_3125 856
1155 3300047469 Ga0495673_0011054 Ga0495673_0011054_97_2754 856
1156 3300048091 Ga0495626_0000659 Ga0495626_0000659_29250_31907 856
1157 3300048924 Ga0496121_0001599 Ga0496121_0001599_17422_20079 856
1158 3300048927 Ga0496124_0002152 Ga0496124_0002152_16308_18965 856
1159 3300049459 Ga0495678_000545 Ga0495678_000545_20507_23164 856
1160 2124908027 MRS2a_Contig_254 MRS2a_00156850 857
1161 2124908027 MRS2a_Contig_6466 MRS2a_00351990 857
1162 3300002737 JGI25162J39368_1000212 JGI25162J39368_100021235 857
1163 3300002771 JGI25163J39215_1001336 JGI25163J39215_10013361 857
1164 3300002772 JGI25164J39214_1000051 JGI25164J39214_100005130 857
1165 3300003214 JGI25165J46597_1000091 JGI25165J46597_100009130 857
1166 3300003781 Ga0055536_1000186 Ga0055536_10001869 857
1167 3300003781 Ga0055536_1000300 Ga0055536_100030020 857
1168 3300003781 Ga0055536_1001363 Ga0055536_100136310 857
1169 3300003791 Ga0055530_10000434 Ga0055530_1000043420 857
1170 3300003791 Ga0055530_10001426 Ga0055530_1000142615 857
1171 3300003791 Ga0055530_10011806 Ga0055530_100118062 857
1172 3300003792 Ga0055540_1000205 Ga0055540_100020515 857
1173 3300003792 Ga0055540_1000771 Ga0055540_100077120 857
1174 3300003794 Ga0055531_10000155 Ga0055531_1000015539 857
1175 3300005288 Ga0065714_10000370 Ga0065714_100003703 857
1176 3300005288 Ga0065714_10002480 Ga0065714_1000248013 857
1177 3300005288 Ga0065714_10010636 Ga0065714_100106362 857
1178 3300005834 Ga0068851_10002263 Ga0068851_100022639 857
1179 3300006058 Ga0075432_10000610 Ga0075432_100006102 857
1180 3300006946 Ga0079104_1000115 Ga0079104_100011520 857
1181 3300009011 Ga0105251_10001113 Ga0105251_1000111317 857
1182 3300009011 Ga0105251_10003175 Ga0105251_1000317511 857
1183 3300009036 Ga0105244_10000305 Ga0105244_100003058 857
1184 3300009036 Ga0105244_10003744 Ga0105244_100037449 857
1185 3300009036 Ga0105244_10010531 Ga0105244_100105313 857
1186 3300009036 Ga0105244_10024885 Ga0105244_100248852 857
1187 3300009092 Ga0105250_10000894 Ga0105250_100008945 857
1188 3300009092 Ga0105250_10005483 Ga0105250_100054833 857
1189 3300009148 Ga0105243_10000271 Ga0105243_1000027137 857
1190 3300012498 Ga0157345_1000065 Ga0157345_10000656 857
1191 3300013100 Ga0157373_10001195 Ga0157373_1000119517 857
1192 3300013102 Ga0157371_10003604 Ga0157371_100036044 857
1193 3300013102 Ga0157371_10039749 Ga0157371_100397491 857
1194 3300013105 Ga0157369_10004391 Ga0157369_100043914 857
1195 3300013105 Ga0157369_10033471 Ga0157369_100334714 857
1196 3300013306 Ga0163162_10000188 Ga0163162_1000018838 857
1197 3300013307 Ga0157372_10004091 Ga0157372_100040914 857
1198 3300013308 Ga0157375_10048715 Ga0157375_100487153 857
1199 3300015261 Ga0182006_1002821 Ga0182006_10028218 857
1200 3300015261 Ga0182006_1003310 Ga0182006_10033104 857
1201 3300015261 Ga0182006_1006317 Ga0182006_10063174 857
1202 3300015261 Ga0182006_1009334 Ga0182006_10093343 857
1203 3300015265 Ga0182005_1000873 Ga0182005_10008738 857
1204 3300015265 Ga0182005_1002125 Ga0182005_10021253 857
1205 3300017792 Ga0163161_10001025 Ga0163161_1000102515 857
1206 3300025207 Ga0209760_100022 Ga0209760_100022145 857
1207 3300025231 Ga0207427_100047 Ga0207427_100047105 857
1208 3300025233 Ga0209437_100009 Ga0209437_100009105 857
1209 3300025261 Ga0209233_1000032 Ga0209233_1000032105 857
1210 3300025292 Ga0209676_1000006 Ga0209676_1000006133 857
1211 3300025292 Ga0209676_1000010 Ga0209676_1000010130 857
1212 3300025292 Ga0209676_1000223 Ga0209676_100022384 857
1213 3300025292 Ga0209676_1001929 Ga0209676_100192915 857
1214 3300025298 Ga0209050_1000081 Ga0209050_1000081120 857
1215 3300025298 Ga0209050_1000260 Ga0209050_100026088 857
1216 3300025298 Ga0209050_1002287 Ga0209050_10022872 857
1217 3300025303 Ga0209051_1000104 Ga0209051_1000104125 857
1218 3300025303 Ga0209051_1000163 Ga0209051_100016334 857
1219 3300025303 Ga0209051_1008628 Ga0209051_10086283 857
1220 3300025304 Ga0209257_1000040 Ga0209257_1000040395 857
1221 3300025321 Ga0207656_10000199 Ga0207656_1000019915 857
1222 3300025711 Ga0207696_1000097 Ga0207696_1000097138 857
1223 3300025711 Ga0207696_1007167 Ga0207696_10071672 857
1224 3300025728 Ga0207655_1000286 Ga0207655_100028637 857
1225 3300025728 Ga0207655_1001794 Ga0207655_10017942 857
1226 3300025728 Ga0207655_1008148 Ga0207655_10081483 857
1227 3300025728 Ga0207655_1013208 Ga0207655_10132083 857
1228 3300025728 Ga0207655_1019218 Ga0207655_10192182 857
1229 3300025735 Ga0207713_1002480 Ga0207713_100248010 857
1230 3300025935 Ga0207709_10000035 Ga0207709_10000035128 857
1231 3300027111 Ga0209281_1000077 Ga0209281_1000077122 857
1232 3300028379 Ga0268266_10072002 Ga0268266_100720022 857
1233 3300030735 Ga0316178_1090118 Ga0316178_10901183 857
1234 3300031548 Ga0307408_100012568 Ga0307408_1000125682 857
1235 3300031911 Ga0307412_10002054 Ga0307412_100020542 857
1236 3300031911 Ga0307412_10027947 Ga0307412_100279471 857
1237 3300033180 Ga0307510_10000389 Ga0307510_100003893 857
1238 3300041404 Ga0439436_0001669 Ga0439436_0001669_1160_3808 857
1239 3300041405 Ga0439438_002274 Ga0439438_002274_4034_6685 857
1240 3300041405 Ga0439438_002726 Ga0439438_002726_1183_3834 857
1241 3300041405 Ga0439438_002987 Ga0439438_002987_3664_6315 857
1242 3300041405 Ga0439438_003113 Ga0439438_003113_2355_5003 857
1243 3300041411 Ga0439466_0000246 Ga0439466_0000246_14701_17352 857
1244 3300041411 Ga0439466_0000554 Ga0439466_0000554_2956_5601 857
1245 3300041411 Ga0439466_0004259 Ga0439466_0004259_1903_4551 857
1246 3300042009 Ga0439451_002808 Ga0439451_002808_574_3231 857
1247 3300042010 Ga0439452_000154 Ga0439452_000154_17019_19670 857
1248 3300042013 Ga0439456_000886 Ga0439456_000886_2035_4686 857
1249 3300042016 Ga0439463_000084 Ga0439463_000084_2667_5318 857
1250 3300042115 Ga0450911_000267 Ga0450911_000267_14510_17161 857
1251 3300046453 Ga0495627_000856 Ga0495627_000856_13208_15859 857
1252 3300046453 Ga0495627_000858 Ga0495627_000858_17954_20605 857
1253 3300046453 Ga0495627_010596 Ga0495627_010596_312_2963 857
1254 3300046457 Ga0495590_0015996 Ga0495590_0015996_49_2700 857
1255 3300046458 Ga0495591_000114 Ga0495591_000114_37928_40579 857
1256 3300046458 Ga0495591_000210 Ga0495591_000210_47525_50176 857
1257 3300046458 Ga0495591_000824 Ga0495591_000824_1041_3698 857
1258 3300046458 Ga0495591_000837 Ga0495591_000837_1120_3771 857
1259 3300046458 Ga0495591_001153 Ga0495591_001153_7218_9869 857
1260 3300046458 Ga0495591_001321 Ga0495591_001321_9208_11868 857
1261 3300046458 Ga0495591_015291 Ga0495591_015291_16_2697 857
1262 3300046459 Ga0495629_0028027 Ga0495629_0028027_521_3166 857
1263 3300046460 Ga0495638_0001424 Ga0495638_0001424_10381_13032 857
1264 3300046471 Ga0495650_0000885 Ga0495650_0000885_31408_34077 857
1265 3300046474 Ga0495605_0000026 Ga0495605_0000026_152501_155173 857
1266 3300046474 Ga0495605_0000414 Ga0495605_0000414_25275_27932 857
1267 3300046474 Ga0495605_0000837 Ga0495605_0000837_1162_3819 857
1268 3300046474 Ga0495605_0009018 Ga0495605_0009018_2805_5462 857
1269 3300046475 Ga0495639_0000020 Ga0495639_0000020_13533_16184 857
1270 3300046491 Ga0495584_0005022 Ga0495584_0005022_2621_5272 857
1271 3300046491 Ga0495584_0006331 Ga0495584_0006331_2138_4789 857
1272 3300046492 Ga0495585_0000121 Ga0495585_0000121_34443_37094 857
1273 3300046492 Ga0495585_0013816 Ga0495585_0013816_2008_4659 857
1274 3300046492 Ga0495585_0020907 Ga0495585_0020907_755_3400 857
1275 3300046499 Ga0495594_0003522 Ga0495594_0003522_4556_7228 857
1276 3300046500 Ga0495596_0000107 Ga0495596_0000107_47568_50219 857
1277 3300046501 Ga0495607_0000606 Ga0495607_0000606_14871_17528 857
1278 3300046501 Ga0495607_0000713 Ga0495607_0000713_24203_26860 857
1279 3300046501 Ga0495607_0002169 Ga0495607_0002169_9882_12569 857
1280 3300046501 Ga0495607_0002214 Ga0495607_0002214_1252_3903 857
1281 3300046501 Ga0495607_0016168 Ga0495607_0016168_2062_4713 857
1282 3300046506 Ga0495583_0000043 Ga0495583_0000043_66572_69244 857
1283 3300046506 Ga0495583_0014254 Ga0495583_0014254_1034_3691 857
1284 3300046506 Ga0495583_0015491 Ga0495583_0015491_1072_3717 857
1285 3300046507 Ga0495606_0000675 Ga0495606_0000675_32736_35387 857
1286 3300046507 Ga0495606_0001081 Ga0495606_0001081_78_2729 857
1287 3300046507 Ga0495606_0003406 Ga0495606_0003406_591_3242 857
1288 3300046512 Ga0495610_0001786 Ga0495610_0001786_11880_14531 857
1289 3300046512 Ga0495610_0004967 Ga0495610_0004967_2532_5183 857
1290 3300046513 Ga0495616_0006642 Ga0495616_0006642_107_2758 857
1291 3300046513 Ga0495616_0009359 Ga0495616_0009359_2078_4729 857
1292 3300046513 Ga0495616_0016722 Ga0495616_0016722_198_2885 857
1293 3300046515 Ga0495620_0000160 Ga0495620_0000160_29975_32647 857
1294 3300046515 Ga0495620_0000371 Ga0495620_0000371_2213_4870 857
1295 3300046515 Ga0495620_0003304 Ga0495620_0003304_4649_7300 857
1296 3300046515 Ga0495620_0017204 Ga0495620_0017204_709_3366 857
1297 3300046518 Ga0495631_0004972 Ga0495631_0004972_4265_6916 857
1298 3300046519 Ga0495632_0003516 Ga0495632_0003516_4074_6725 857
1299 3300046519 Ga0495632_0010271 Ga0495632_0010271_2801_5470 857
1300 3300046520 Ga0495637_0000756 Ga0495637_0000756_13201_15852 857
1301 3300046520 Ga0495637_0001377 Ga0495637_0001377_8158_10809 857
1302 3300046520 Ga0495637_0004399 Ga0495637_0004399_1165_3810 857
1303 3300046523 Ga0495644_0000587 Ga0495644_0000587_8776_11427 857
1304 3300046523 Ga0495644_0000786 Ga0495644_0000786_4149_6794 857
1305 3300046524 Ga0495648_0000533 Ga0495648_0000533_13371_16022 857
1306 3300046524 Ga0495648_0005922 Ga0495648_0005922_3143_5794 857
1307 3300046524 Ga0495648_0007331 Ga0495648_0007331_4220_6892 857
1308 3300046528 Ga0495642_0000089 Ga0495642_0000089_14980_17637 857
1309 3300046528 Ga0495642_0000096 Ga0495642_0000096_11158_13803 857
1310 3300046530 Ga0495654_0009783 Ga0495654_0009783_1385_4036 857
1311 3300046530 Ga0495654_0010330 Ga0495654_0010330_1099_3750 857
1312 3300046536 Ga0495587_0020925 Ga0495587_0020925_660_3311 857
1313 3300046538 Ga0495609_0000036 Ga0495609_0000036_66670_69342 857
1314 3300046538 Ga0495609_0000125 Ga0495609_0000125_26579_29269 857
1315 3300046538 Ga0495609_0003347 Ga0495609_0003347_4373_7024 857
1316 3300046558 Ga0495633_0000143 Ga0495633_0000143_28470_31142 857
1317 3300046642 Ga0495634_0001982 Ga0495634_0001982_1159_3810 857
1318 3300046648 Ga0495611_0000569 Ga0495611_0000569_13722_16373 857
1319 3300046660 Ga0495625_0005710 Ga0495625_0005710_6217_8868 857
1320 3300046660 Ga0495625_0035701 Ga0495625_0035701_767_3412 857
1321 3300046663 Ga0495635_0002464 Ga0495635_0002464_1224_3869 857
1322 3300046664 Ga0495659_0000094 Ga0495659_0000094_36326_38977 857
1323 3300046665 Ga0495661_0000121 Ga0495661_0000121_64281_66953 857
1324 3300046665 Ga0495661_0000278 Ga0495661_0000278_17556_20225 857
1325 3300046665 Ga0495661_0001220 Ga0495661_0001220_1118_3769 857
1326 3300046665 Ga0495661_0007992 Ga0495661_0007992_2062_4707 857
1327 3300046674 Ga0495588_0010018 Ga0495588_0010018_956_3613 857
1328 3300046680 Ga0495646_0017344 Ga0495646_0017344_1113_3764 857
1329 3300046691 Ga0495670_0000082 Ga0495670_0000082_37327_39978 857
1330 3300046691 Ga0495670_0001803 Ga0495670_0001803_3990_6635 857
1331 3300046691 Ga0495670_0004166 Ga0495670_0004166_89_2740 857
1332 3300046691 Ga0495670_0006383 Ga0495670_0006383_3084_5735 857
1333 3300046691 Ga0495670_0027172 Ga0495670_0027172_79_2730 857
1334 3300046692 Ga0495671_0000199 Ga0495671_0000199_13899_16550 857
1335 3300046692 Ga0495671_0008808 Ga0495671_0008808_2563_5214 857
1336 3300046694 Ga0495649_0004601 Ga0495649_0004601_2111_4768 857
1337 3300046794 Ga0495589_0001729 Ga0495589_0001729_2294_4945 857
1338 3300046794 Ga0495589_0005934 Ga0495589_0005934_1883_4534 857
1339 3300046809 Ga0495600_0012901 Ga0495600_0012901_116_2761 857
1340 3300046810 Ga0495660_0003940 Ga0495660_0003940_4213_6864 857
1341 3300046810 Ga0495660_0017775 Ga0495660_0017775_362_3007 857
1342 3300047320 Ga0495672_0001849 Ga0495672_0001849_4630_7281 857
1343 3300047320 Ga0495672_0002751 Ga0495672_0002751_4919_7576 857
1344 3300047320 Ga0495672_0006185 Ga0495672_0006185_4637_7288 857
1345 3300047322 Ga0495680_0025666 Ga0495680_0025666_1487_4132 857
1346 3300047322 Ga0495680_0044109 Ga0495680_0044109_538_3183 857
1347 3300047323 Ga0495683_0000003 Ga0495683_0000003_350430_353102 857
1348 3300047323 Ga0495683_0001294 Ga0495683_0001294_13668_16319 857
1349 3300047323 Ga0495683_0002712 Ga0495683_0002712_3458_6109 857
1350 3300047323 Ga0495683_0004921 Ga0495683_0004921_4436_7081 857
1351 3300047443 Ga0495687_007987 Ga0495687_007987_1679_4330 857
1352 3300047446 Ga0495679_000268 Ga0495679_000268_19178_21850 857
1353 3300047446 Ga0495679_015009 Ga0495679_015009_148_2799 857
1354 3300047469 Ga0495673_0001827 Ga0495673_0001827_10282_12939 857
1355 3300047469 Ga0495673_0002156 Ga0495673_0002156_7874_10525 857
1356 3300047469 Ga0495673_0005221 Ga0495673_0005221_1786_4437 857
1357 3300047469 Ga0495673_0011208 Ga0495673_0011208_48_2693 857
1358 3300047469 Ga0495673_0019719 Ga0495673_0019719_548_3205 857
1359 3300047470 Ga0495681_0001114 Ga0495681_0001114_10337_12988 857
1360 3300047470 Ga0495681_0001147 Ga0495681_0001147_13751_16438 857
1361 3300047470 Ga0495681_0002769 Ga0495681_0002769_662_3307 857
1362 3300047470 Ga0495681_0007431 Ga0495681_0007431_2682_5333 857
1363 3300047470 Ga0495681_0010751 Ga0495681_0010751_999_3650 857
1364 3300047470 Ga0495681_0012186 Ga0495681_0012186_550_3201 857
1365 3300047470 Ga0495681_0013195 Ga0495681_0013195_2098_4749 857
1366 3300047472 Ga0495686_0002276 Ga0495686_0002276_2494_5145 857
1367 3300048091 Ga0495626_0000179 Ga0495626_0000179_49058_51709 857
1368 3300048091 Ga0495626_0000191 Ga0495626_0000191_13968_16613 857
1369 3300048091 Ga0495626_0000321 Ga0495626_0000321_44029_46680 857
1370 3300048091 Ga0495626_0010477 Ga0495626_0010477_1321_3966 857
1371 3300048091 Ga0495626_0010809 Ga0495626_0010809_47_2698 857
1372 3300048919 Ga0496116_0000496 Ga0496116_0000496_37494_40145 857
1373 3300048919 Ga0496116_0003235 Ga0496116_0003235_13534_16185 857
1374 3300048919 Ga0496116_0009940 Ga0496116_0009940_1556_4207 857
1375 3300048920 Ga0496117_0000937 Ga0496117_0000937_23496_26147 857
1376 3300048921 Ga0496118_0004809 Ga0496118_0004809_2273_4924 857
1377 3300048921 Ga0496118_0023281 Ga0496118_0023281_1420_4071 857
1378 3300048923 Ga0496120_0006858 Ga0496120_0006858_4591_7242 857
1379 3300048923 Ga0496120_0039831 Ga0496120_0039831_75_2726 857
1380 3300048924 Ga0496121_0022317 Ga0496121_0022317_1397_4048 857
1381 3300048926 Ga0496123_0035399 Ga0496123_0035399_699_3371 857
1382 3300048927 Ga0496124_0000118 Ga0496124_0000118_155751_158408 857
1383 3300048927 Ga0496124_0000699 Ga0496124_0000699_33780_36431 857
1384 3300048927 Ga0496124_0004999 Ga0496124_0004999_3833_6484 857
1385 3300048928 Ga0496125_0000714 Ga0496125_0000714_33683_36334 857
1386 3300049459 Ga0495678_000007 Ga0495678_000007_386131_388803 857
1387 3300049460 Ga0495682_0000048 Ga0495682_0000048_7480_10125 857
1388 3300049460 Ga0495682_0000663 Ga0495682_0000663_14348_17005 857
1389 iso_pu_bacteria 2511231023 2511368087 857

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02702

KdpD

Osmosensitive K+ channel His kinase sensor domain

61

270

0.99

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

790

901

0.93

PF13493

DUF4118

Domain of unknown function (DUF4118)

430

522

0.93

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

677

745

0.92

PF00582

Usp

Universal stress protein family

289

405

0.9

Feature Viewer

pLDDT pTM Quality
78.52 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map