F493579
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1390 | 509 | 2780 | 282 |
Family's Representative Sequence
| Representative Sequence | 2124908027|MRS2a_Contig_7510|MRS2a_00393580 |
| Length | 259 |
| Sequence | MTDSAALLNKHSFVELGARQRAKALLDVGTFRELLDPFQRVMSPXXXXLPVVIAAIEGAFQGGSLGEVGGAKIAGALELAAEDNRKGIPTRAVLLLETGGVRLQEANLGLAAIADIHAAIVDLRQYQPVIGVVAGSVGCFGGMSIASYLLVTQEARLGLNGPQVIEQEAGLEEYDSRDRPFIWSLTGGEQRFASGLVDRYVADDVAQIQQQVGELFKQGLPSQQRSRQAEWFLQRLARLDAEPQIEPSVVRDLYQGERS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 112 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 122 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 123 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 124 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 125 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 137 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 143 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 144 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 145 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 146 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 147 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 148 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 149 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 150 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 151 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 152 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 153 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 154 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 155 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 156 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 157 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 158 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 159 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 160 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 161 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 164 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 284 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 285 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 286 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 287 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 288 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 289 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 290 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 291 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 292 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 293 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 294 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 295 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 296 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 297 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 298 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 299 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 300 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 301 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 302 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 303 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 304 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 305 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 306 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 307 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 308 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 309 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 310 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 311 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 312 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 313 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 314 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 315 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 316 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 317 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 318 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 319 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 320 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 321 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 322 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 323 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 324 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 325 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 326 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 327 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 328 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 329 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 330 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 331 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 332 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 333 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 334 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 335 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 336 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 337 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 338 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 339 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 340 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 341 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 342 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 343 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 344 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 345 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 346 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 347 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 348 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 349 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 350 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 351 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 352 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 353 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 354 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 355 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 356 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 357 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 358 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 359 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 360 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 361 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 362 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 363 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 364 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 365 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 366 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 367 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 368 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 369 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 370 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 371 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 372 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 373 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 374 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 375 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 376 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 377 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 378 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 379 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 380 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 381 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 382 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 383 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 384 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 385 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 386 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 387 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 388 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 389 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 390 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 391 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 392 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 393 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 394 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 395 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 396 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 397 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 398 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 399 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 400 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 401 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 402 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 403 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 404 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 405 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 406 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 407 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 408 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 409 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 410 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 411 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 412 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 413 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 414 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 415 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 416 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 417 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 418 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 419 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 420 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 421 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 422 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 423 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 424 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 425 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 426 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 427 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 428 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 429 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 430 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 431 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 432 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 433 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 434 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 435 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 436 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 437 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 438 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 439 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 440 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 441 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 442 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 443 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 444 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 445 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 446 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 447 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 448 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 449 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 450 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 451 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 452 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 453 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 454 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 455 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 456 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 457 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 458 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 459 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 460 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 461 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 462 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 463 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 464 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 465 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 466 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 467 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 468 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 469 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 470 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 471 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 472 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 473 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 474 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 475 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 476 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 477 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 478 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 479 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 480 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 481 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 482 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 483 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 484 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 485 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 486 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 487 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 488 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 489 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 490 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 491 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 492 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 493 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 494 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 495 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 496 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 497 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 498 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 499 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 500 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 501 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 502 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 503 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 504 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 505 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 506 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 507 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 508 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 509 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.74 |
| Metatranscriptomes | 0 |
| Isolates | 16.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 5.25 |
| Nodule | 2.37 |
| Rhizoplane | 5.97 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_7510 | 2124908027 | Bacteria | 1854 |
| 2 | MRS2a_Contig_816 | 2124908027 | Bacteria | 6407 |
| 3 | SwRhRL2b_contig_1777000 | 2162886007 | Bacteria | 1680 |
| 4 | JGI25162J39368_1000159 | 3300002737 | Bacteria | 74427 |
| 5 | JGI25163J39215_1000156 | 3300002771 | Bacteria | 26838 |
| 6 | JGI25163J39215_1000613 | 3300002771 | Bacteria | 9826 |
| 7 | JGI25164J39214_1000038 | 3300002772 | Bacteria | 131082 |
| 8 | JGI25164J39214_1000124 | 3300002772 | Bacteria | 74427 |
| 9 | JGI25151J46595_10039458 | 3300003187 | Bacteria | 1743 |
| 10 | JGI25165J46597_1000126 | 3300003214 | Bacteria | 131083 |
| 11 | JGI25165J46597_1000243 | 3300003214 | Bacteria | 74427 |
| 12 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 13 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 14 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 15 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 16 | Ga0055526_1013090 | 3300003771 | Bacteria | 3545 |
| 17 | Ga0055537_1011285 | 3300003773 | Bacteria | 1825 |
| 18 | Ga0055524_1000639 | 3300003775 | Bacteria | 24880 |
| 19 | Ga0055534_1001966 | 3300003784 | Bacteria | 7526 |
| 20 | Ga0055530_10000242 | 3300003791 | Bacteria | 49162 |
| 21 | Ga0055530_10000535 | 3300003791 | Bacteria | 32956 |
| 22 | Ga0055530_10000966 | 3300003791 | Bacteria | 23308 |
| 23 | Ga0055540_1000178 | 3300003792 | Bacteria | 62401 |
| 24 | Ga0055540_1000250 | 3300003792 | Bacteria | 49162 |
| 25 | Ga0055540_1000896 | 3300003792 | Bacteria | 19618 |
| 26 | Ga0055531_10000243 | 3300003794 | Bacteria | 59515 |
| 27 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 28 | Ga0065714_10000303 | 3300005288 | Bacteria | 6110 |
| 29 | Ga0065714_10010148 | 3300005288 | Bacteria | 2544 |
| 30 | Ga0065714_10013730 | 3300005288 | Bacteria | 2070 |
| 31 | Ga0065714_10014293 | 3300005288 | Bacteria | 2142 |
| 32 | Ga0065714_10093135 | 3300005288 | Bacteria | 1856 |
| 33 | Ga0065704_10040264 | 3300005289 | Bacteria | 1094 |
| 34 | Ga0065704_10073188 | 3300005289 | Bacteria | 7472 |
| 35 | Ga0065704_10117174 | 3300005289 | Bacteria | 1834 |
| 36 | Ga0065712_10068623 | 3300005290 | Bacteria | 9627 |
| 37 | Ga0065715_10020516 | 3300005293 | Bacteria | 1625 |
| 38 | Ga0070670_100000567 | 3300005331 | Bacteria | 29311 |
| 39 | Ga0070670_100000599 | 3300005331 | Bacteria | 28476 |
| 40 | Ga0068869_100254349 | 3300005334 | Bacteria | 1404 |
| 41 | Ga0068868_100107158 | 3300005338 | Bacteria | 2268 |
| 42 | Ga0070669_100000963 | 3300005353 | Bacteria | 21008 |
| 43 | Ga0070669_100001975 | 3300005353 | Bacteria | 14816 |
| 44 | Ga0070671_100046498 | 3300005355 | Bacteria | 3610 |
| 45 | Ga0070673_100297792 | 3300005364 | Bacteria | 1419 |
| 46 | Ga0070673_100317598 | 3300005364 | Bacteria | 1375 |
| 47 | Ga0070659_100070588 | 3300005366 | Bacteria | 2775 |
| 48 | Ga0070678_100101454 | 3300005456 | Bacteria | 2231 |
| 49 | Ga0070678_100172045 | 3300005456 | Bacteria | 1765 |
| 50 | Ga0070662_100012513 | 3300005457 | Bacteria | 5627 |
| 51 | Ga0070662_100030517 | 3300005457 | Bacteria | 3773 |
| 52 | Ga0070662_100345694 | 3300005457 | Bacteria | 1218 |
| 53 | Ga0068853_100000448 | 3300005539 | Bacteria | 28021 |
| 54 | Ga0068853_100008600 | 3300005539 | Bacteria | 8208 |
| 55 | Ga0070665_100043300 | 3300005548 | Bacteria | 4524 |
| 56 | Ga0070664_100395160 | 3300005564 | Bacteria | 1264 |
| 57 | Ga0068851_10000012 | 3300005834 | Bacteria | 175130 |
| 58 | Ga0075364_10032918 | 3300006051 | Bacteria | 3334 |
| 59 | Ga0075364_10145993 | 3300006051 | Bacteria | 1593 |
| 60 | Ga0075432_10000124 | 3300006058 | Bacteria | 17412 |
| 61 | Ga0075432_10017844 | 3300006058 | Bacteria | 2420 |
| 62 | Ga0075432_10047640 | 3300006058 | Bacteria | 1507 |
| 63 | Ga0075432_10050633 | 3300006058 | Bacteria | 1465 |
| 64 | Ga0075362_10012105 | 3300006177 | Bacteria | 3417 |
| 65 | Ga0068871_100292310 | 3300006358 | Bacteria | 1428 |
| 66 | Ga0079104_1000133 | 3300006946 | Bacteria | 105452 |
| 67 | Ga0079104_1000158 | 3300006946 | Bacteria | 96620 |
| 68 | Ga0079104_1018453 | 3300006946 | Bacteria | 1975 |
| 69 | Ga0079104_1040675 | 3300006946 | Bacteria | 1087 |
| 70 | Ga0079104_1045630 | 3300006946 | Bacteria | 999 |
| 71 | Ga0099826_10000009 | 3300006948 | Bacteria | 336081 |
| 72 | Ga0099826_10010680 | 3300006948 | Bacteria | 6887 |
| 73 | Ga0105251_10001928 | 3300009011 | Bacteria | 16975 |
| 74 | Ga0105251_10002313 | 3300009011 | Bacteria | 15110 |
| 75 | Ga0105251_10008346 | 3300009011 | Bacteria | 6250 |
| 76 | Ga0105251_10014124 | 3300009011 | Bacteria | 4431 |
| 77 | Ga0105251_10040228 | 3300009011 | Bacteria | 2280 |
| 78 | Ga0105251_10072078 | 3300009011 | Bacteria | 1607 |
| 79 | Ga0105251_10109960 | 3300009011 | Bacteria | 1256 |
| 80 | Ga0105251_10203879 | 3300009011 | Bacteria | 891 |
| 81 | Ga0105244_10000578 | 3300009036 | Bacteria | 32824 |
| 82 | Ga0105244_10004114 | 3300009036 | Bacteria | 10153 |
| 83 | Ga0105244_10005547 | 3300009036 | Bacteria | 8361 |
| 84 | Ga0105244_10008160 | 3300009036 | Bacteria | 6567 |
| 85 | Ga0105244_10010492 | 3300009036 | Bacteria | 5616 |
| 86 | Ga0105244_10017241 | 3300009036 | Bacteria | 4087 |
| 87 | Ga0105244_10018822 | 3300009036 | Bacteria | 3866 |
| 88 | Ga0105244_10027263 | 3300009036 | Bacteria | 3081 |
| 89 | Ga0105244_10045877 | 3300009036 | Bacteria | 2246 |
| 90 | Ga0105244_10049891 | 3300009036 | Bacteria | 2136 |
| 91 | Ga0105244_10051319 | 3300009036 | Bacteria | 2102 |
| 92 | Ga0105244_10059386 | 3300009036 | Bacteria | 1928 |
| 93 | Ga0105244_10063608 | 3300009036 | Bacteria | 1853 |
| 94 | Ga0105244_10077973 | 3300009036 | Bacteria | 1643 |
| 95 | Ga0105244_10088012 | 3300009036 | Bacteria | 1530 |
| 96 | Ga0105250_10001478 | 3300009092 | Bacteria | 12704 |
| 97 | Ga0105250_10003707 | 3300009092 | Bacteria | 7192 |
| 98 | Ga0105250_10004553 | 3300009092 | Bacteria | 6357 |
| 99 | Ga0105250_10039943 | 3300009092 | Bacteria | 1881 |
| 100 | Ga0105250_10041819 | 3300009092 | Bacteria | 1837 |
| 101 | Ga0105250_10098898 | 3300009092 | Bacteria | 1190 |
| 102 | Ga0105250_10123936 | 3300009092 | Bacteria | 1064 |
| 103 | Ga0105250_10178042 | 3300009092 | Bacteria | 892 |
| 104 | Ga0105240_10036334 | 3300009093 | Bacteria | 6340 |
| 105 | Ga0105245_10200818 | 3300009098 | Bacteria | 1914 |
| 106 | Ga0105243_10000327 | 3300009148 | Bacteria | 52095 |
| 107 | Ga0105243_10000757 | 3300009148 | Bacteria | 31002 |
| 108 | Ga0105243_10020164 | 3300009148 | Bacteria | 5054 |
| 109 | Ga0105243_10029005 | 3300009148 | Bacteria | 4253 |
| 110 | Ga0105243_10039068 | 3300009148 | Bacteria | 3699 |
| 111 | Ga0105243_10070908 | 3300009148 | Bacteria | 2816 |
| 112 | Ga0105243_10285199 | 3300009148 | Bacteria | 1489 |
| 113 | Ga0105242_10168199 | 3300009176 | Bacteria | 1924 |
| 114 | Ga0105237_10001290 | 3300009545 | Bacteria | 33327 |
| 115 | Ga0105237_10442651 | 3300009545 | Bacteria | 1305 |
| 116 | Ga0105238_10025795 | 3300009551 | Bacteria | 5992 |
| 117 | Ga0105239_10027896 | 3300010375 | Bacteria | 6212 |
| 118 | Ga0105239_10311525 | 3300010375 | Bacteria | 1774 |
| 119 | Ga0105246_10019133 | 3300011119 | Bacteria | 4371 |
| 120 | Ga0105246_10024872 | 3300011119 | Bacteria | 3897 |
| 121 | Ga0157345_1000113 | 3300012498 | Bacteria | 15805 |
| 122 | Ga0157373_10006015 | 3300013100 | Bacteria | 9073 |
| 123 | Ga0157373_10011468 | 3300013100 | Bacteria | 6516 |
| 124 | Ga0157373_10076312 | 3300013100 | Bacteria | 2365 |
| 125 | Ga0157373_10150041 | 3300013100 | Bacteria | 1640 |
| 126 | Ga0157373_10157716 | 3300013100 | Bacteria | 1596 |
| 127 | Ga0157373_10158960 | 3300013100 | Bacteria | 1590 |
| 128 | Ga0157373_10161052 | 3300013100 | Bacteria | 1579 |
| 129 | Ga0157373_10182517 | 3300013100 | Bacteria | 1478 |
| 130 | Ga0157373_10244529 | 3300013100 | Bacteria | 1269 |
| 131 | Ga0157371_10000131 | 3300013102 | Bacteria | 113432 |
| 132 | Ga0157371_10000870 | 3300013102 | Bacteria | 34253 |
| 133 | Ga0157371_10001015 | 3300013102 | Bacteria | 30796 |
| 134 | Ga0157370_10031525 | 3300013104 | Bacteria | 5183 |
| 135 | Ga0157370_10502491 | 3300013104 | Bacteria | 1113 |
| 136 | Ga0157369_10003054 | 3300013105 | Bacteria | 19992 |
| 137 | Ga0157369_10019315 | 3300013105 | Bacteria | 7626 |
| 138 | Ga0157369_10025398 | 3300013105 | Bacteria | 6577 |
| 139 | Ga0157369_10426156 | 3300013105 | Bacteria | 1375 |
| 140 | Ga0157378_10031436 | 3300013297 | Bacteria | 4689 |
| 141 | Ga0163162_10004799 | 3300013306 | Bacteria | 13043 |
| 142 | Ga0163162_10884283 | 3300013306 | Bacteria | 1007 |
| 143 | Ga0157372_10049668 | 3300013307 | Bacteria | 4665 |
| 144 | Ga0157375_10121839 | 3300013308 | Bacteria | 2718 |
| 145 | Ga0182008_10000366 | 3300014497 | Bacteria | 35219 |
| 146 | Ga0182008_10002588 | 3300014497 | Bacteria | 11236 |
| 147 | Ga0182008_10004328 | 3300014497 | Bacteria | 8308 |
| 148 | Ga0182008_10007530 | 3300014497 | Bacteria | 6004 |
| 149 | Ga0182008_10017974 | 3300014497 | Bacteria | 3663 |
| 150 | Ga0182008_10038290 | 3300014497 | Bacteria | 2398 |
| 151 | Ga0182006_1003374 | 3300015261 | Bacteria | 8194 |
| 152 | Ga0182006_1008809 | 3300015261 | Bacteria | 4560 |
| 153 | Ga0182006_1055848 | 3300015261 | Bacteria | 1506 |
| 154 | Ga0182005_1007014 | 3300015265 | Bacteria | 3403 |
| 155 | Ga0182005_1011061 | 3300015265 | Bacteria | 2581 |
| 156 | Ga0182005_1018058 | 3300015265 | Bacteria | 1951 |
| 157 | Ga0182005_1018813 | 3300015265 | Bacteria | 1907 |
| 158 | Ga0163161_10003913 | 3300017792 | Bacteria | 10446 |
| 159 | Ga0163161_10004476 | 3300017792 | Bacteria | 9724 |
| 160 | Ga0163161_10019329 | 3300017792 | Bacteria | 4778 |
| 161 | Ga0163161_10024786 | 3300017792 | Bacteria | 4240 |
| 162 | Ga0163161_10053133 | 3300017792 | Bacteria | 2938 |
| 163 | Ga0163161_10094546 | 3300017792 | Bacteria | 2216 |
| 164 | Ga0163161_10167906 | 3300017792 | Bacteria | 1676 |
| 165 | Ga0163161_10194872 | 3300017792 | Bacteria | 1559 |
| 166 | Ga0163161_10215653 | 3300017792 | Bacteria | 1484 |
| 167 | Ga0163161_10264404 | 3300017792 | Bacteria | 1344 |
| 168 | Ga0163161_10296884 | 3300017792 | Bacteria | 1271 |
| 169 | Ga0163161_10343754 | 3300017792 | Bacteria | 1184 |
| 170 | Ga0209435_101472 | 3300025206 | Bacteria | 2962 |
| 171 | Ga0209760_100036 | 3300025207 | Bacteria | 130845 |
| 172 | Ga0209760_100115 | 3300025207 | Bacteria | 57436 |
| 173 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 174 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 175 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 176 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 177 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 178 | Ga0209563_101205 | 3300025230 | Bacteria | 7225 |
| 179 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 180 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 181 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 182 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 183 | Ga0209258_100365 | 3300025242 | Bacteria | 59822 |
| 184 | Ga0209646_1000867 | 3300025246 | Bacteria | 10079 |
| 185 | Ga0209026_1002897 | 3300025250 | Bacteria | 6030 |
| 186 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 187 | Ga0209759_1015851 | 3300025256 | Bacteria | 1928 |
| 188 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 189 | Ga0209233_1000145 | 3300025261 | Bacteria | 188955 |
| 190 | Ga0209565_1000160 | 3300025263 | Bacteria | 90271 |
| 191 | Ga0209565_1001633 | 3300025263 | Bacteria | 9446 |
| 192 | Ga0209675_1000406 | 3300025291 | Bacteria | 35410 |
| 193 | Ga0209675_1001142 | 3300025291 | Bacteria | 16192 |
| 194 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 195 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 196 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 197 | Ga0209676_1002604 | 3300025292 | Bacteria | 12373 |
| 198 | Ga0209676_1002636 | 3300025292 | Bacteria | 12231 |
| 199 | Ga0209025_1000098 | 3300025294 | Bacteria | 233886 |
| 200 | Ga0209025_1000527 | 3300025294 | Bacteria | 72823 |
| 201 | Ga0209025_1001087 | 3300025294 | Bacteria | 39361 |
| 202 | Ga0209564_1000855 | 3300025295 | Bacteria | 40690 |
| 203 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 204 | Ga0209050_1000075 | 3300025298 | Bacteria | 286562 |
| 205 | Ga0209050_1000923 | 3300025298 | Bacteria | 38715 |
| 206 | Ga0209050_1001094 | 3300025298 | Bacteria | 32904 |
| 207 | Ga0209256_1000400 | 3300025299 | Bacteria | 68737 |
| 208 | Ga0209256_1000452 | 3300025299 | Bacteria | 62144 |
| 209 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 210 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 211 | Ga0209051_1000041 | 3300025303 | Bacteria | 311155 |
| 212 | Ga0209051_1029449 | 3300025303 | Bacteria | 2149 |
| 213 | Ga0209051_1069179 | 3300025303 | Bacteria | 1071 |
| 214 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 215 | Ga0209257_1024425 | 3300025304 | Bacteria | 2093 |
| 216 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 217 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 218 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 219 | Ga0207696_1000105 | 3300025711 | Bacteria | 163421 |
| 220 | Ga0207696_1001194 | 3300025711 | Bacteria | 14810 |
| 221 | Ga0207696_1002488 | 3300025711 | Bacteria | 9000 |
| 222 | Ga0207696_1008980 | 3300025711 | Bacteria | 3759 |
| 223 | Ga0207696_1010456 | 3300025711 | Bacteria | 3400 |
| 224 | Ga0207696_1010611 | 3300025711 | Bacteria | 3369 |
| 225 | Ga0207696_1071418 | 3300025711 | Bacteria | 965 |
| 226 | Ga0207655_1000068 | 3300025728 | Bacteria | 241705 |
| 227 | Ga0207655_1000212 | 3300025728 | Bacteria | 101771 |
| 228 | Ga0207655_1000249 | 3300025728 | Bacteria | 87500 |
| 229 | Ga0207655_1000412 | 3300025728 | Bacteria | 58943 |
| 230 | Ga0207655_1000469 | 3300025728 | Bacteria | 52077 |
| 231 | Ga0207655_1000641 | 3300025728 | Bacteria | 41843 |
| 232 | Ga0207655_1001720 | 3300025728 | Bacteria | 19228 |
| 233 | Ga0207655_1002726 | 3300025728 | Bacteria | 13806 |
| 234 | Ga0207655_1002865 | 3300025728 | Bacteria | 13324 |
| 235 | Ga0207655_1004718 | 3300025728 | Bacteria | 9535 |
| 236 | Ga0207655_1008251 | 3300025728 | Bacteria | 6636 |
| 237 | Ga0207655_1011013 | 3300025728 | Bacteria | 5427 |
| 238 | Ga0207655_1016099 | 3300025728 | Bacteria | 4115 |
| 239 | Ga0207655_1018564 | 3300025728 | Bacteria | 3681 |
| 240 | Ga0207655_1021009 | 3300025728 | Bacteria | 3330 |
| 241 | Ga0207655_1036906 | 3300025728 | Bacteria | 2160 |
| 242 | Ga0207655_1047538 | 3300025728 | Bacteria | 1770 |
| 243 | Ga0207655_1060159 | 3300025728 | Bacteria | 1474 |
| 244 | Ga0207713_1000077 | 3300025735 | Bacteria | 176517 |
| 245 | Ga0207713_1000438 | 3300025735 | Bacteria | 43784 |
| 246 | Ga0207713_1000463 | 3300025735 | Bacteria | 42547 |
| 247 | Ga0207713_1000596 | 3300025735 | Bacteria | 35680 |
| 248 | Ga0207713_1001118 | 3300025735 | Bacteria | 22851 |
| 249 | Ga0207713_1002392 | 3300025735 | Bacteria | 13710 |
| 250 | Ga0207713_1003929 | 3300025735 | Bacteria | 9886 |
| 251 | Ga0207713_1005406 | 3300025735 | Bacteria | 7998 |
| 252 | Ga0207713_1006267 | 3300025735 | Bacteria | 7278 |
| 253 | Ga0207713_1006352 | 3300025735 | Bacteria | 7212 |
| 254 | Ga0207713_1010717 | 3300025735 | Bacteria | 5049 |
| 255 | Ga0207713_1034599 | 3300025735 | Bacteria | 2191 |
| 256 | Ga0207713_1036693 | 3300025735 | Bacteria | 2099 |
| 257 | Ga0207713_1041307 | 3300025735 | Bacteria | 1926 |
| 258 | Ga0207713_1053690 | 3300025735 | Bacteria | 1585 |
| 259 | Ga0207713_1060278 | 3300025735 | Bacteria | 1451 |
| 260 | Ga0207713_1086742 | 3300025735 | Bacteria | 1111 |
| 261 | Ga0207688_10105863 | 3300025901 | Bacteria | 1628 |
| 262 | Ga0207645_10015865 | 3300025907 | Bacteria | 4991 |
| 263 | Ga0207695_10053384 | 3300025913 | Bacteria | 4228 |
| 264 | Ga0207671_10001788 | 3300025914 | Bacteria | 24084 |
| 265 | Ga0207681_10000132 | 3300025923 | Bacteria | 60959 |
| 266 | Ga0207681_10001211 | 3300025923 | Bacteria | 16596 |
| 267 | Ga0207650_10000140 | 3300025925 | Bacteria | 88140 |
| 268 | Ga0207650_10000512 | 3300025925 | Bacteria | 32392 |
| 269 | Ga0207644_10200951 | 3300025931 | Bacteria | 1572 |
| 270 | Ga0207690_10075271 | 3300025932 | Bacteria | 2341 |
| 271 | Ga0207706_10000175 | 3300025933 | Bacteria | 71118 |
| 272 | Ga0207706_10041412 | 3300025933 | Bacteria | 4083 |
| 273 | Ga0207686_10107300 | 3300025934 | Bacteria | 1876 |
| 274 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 275 | Ga0207709_10000178 | 3300025935 | Bacteria | 85098 |
| 276 | Ga0207709_10011052 | 3300025935 | Bacteria | 4978 |
| 277 | Ga0207709_10033696 | 3300025935 | Bacteria | 3011 |
| 278 | Ga0207709_10077935 | 3300025935 | Bacteria | 2126 |
| 279 | Ga0207709_10140382 | 3300025935 | Bacteria | 1660 |
| 280 | Ga0207709_10168329 | 3300025935 | Bacteria | 1535 |
| 281 | Ga0207689_10200823 | 3300025942 | Bacteria | 1646 |
| 282 | Ga0207679_10071668 | 3300025945 | Bacteria | 2615 |
| 283 | Ga0207712_10228823 | 3300025961 | Bacteria | 1491 |
| 284 | Ga0207639_10000857 | 3300026041 | Bacteria | 20635 |
| 285 | Ga0207639_10038157 | 3300026041 | Bacteria | 3572 |
| 286 | Ga0207683_10094430 | 3300026121 | Bacteria | 2665 |
| 287 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 288 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 289 | Ga0209281_1004943 | 3300027111 | Bacteria | 3830 |
| 290 | Ga0209281_1010798 | 3300027111 | Bacteria | 2069 |
| 291 | Ga0209281_1011374 | 3300027111 | Bacteria | 1997 |
| 292 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 293 | Ga0209371_1000142 | 3300027312 | Bacteria | 118726 |
| 294 | Ga0209371_1001498 | 3300027312 | Bacteria | 15558 |
| 295 | Ga0209995_1018204 | 3300027471 | Bacteria | 1158 |
| 296 | Ga0209968_1010304 | 3300027526 | Bacteria | 1436 |
| 297 | Ga0209983_1009521 | 3300027665 | Bacteria | 1986 |
| 298 | Ga0209282_1000170 | 3300027666 | Bacteria | 36773 |
| 299 | Ga0209971_1004705 | 3300027682 | Bacteria | 3237 |
| 300 | Ga0207428_10048031 | 3300027907 | Bacteria | 3426 |
| 301 | Ga0207428_10073151 | 3300027907 | Bacteria | 2690 |
| 302 | Ga0207428_10132866 | 3300027907 | Bacteria | 1904 |
| 303 | Ga0207428_10179171 | 3300027907 | Bacteria | 1602 |
| 304 | Ga0268266_10014191 | 3300028379 | Bacteria | 6852 |
| 305 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 306 | Ga0268256_1000111 | 3300030500 | Bacteria | 118726 |
| 307 | Ga0307511_10057721 | 3300030521 | Bacteria | 3013 |
| 308 | Ga0316179_1028803 | 3300030734 | Bacteria | 2047 |
| 309 | Ga0316178_1012925 | 3300030735 | Bacteria | 38154 |
| 310 | Ga0316183_1168598 | 3300030742 | Bacteria | 3772 |
| 311 | Ga0316182_1199107 | 3300030745 | Bacteria | 1911 |
| 312 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 313 | Ga0307408_100003632 | 3300031548 | Bacteria | 10515 |
| 314 | Ga0307408_100022913 | 3300031548 | Bacteria | 4249 |
| 315 | Ga0307408_100231871 | 3300031548 | Bacteria | 1512 |
| 316 | Ga0307516_10349905 | 3300031730 | Bacteria | 1143 |
| 317 | Ga0307405_10013153 | 3300031731 | Bacteria | 4406 |
| 318 | Ga0307405_10015378 | 3300031731 | Bacteria | 4144 |
| 319 | Ga0307413_10077536 | 3300031824 | Bacteria | 2116 |
| 320 | Ga0307407_10230521 | 3300031903 | Bacteria | 1257 |
| 321 | Ga0307412_10001312 | 3300031911 | Bacteria | 13953 |
| 322 | Ga0307412_10008064 | 3300031911 | Bacteria | 6001 |
| 323 | Ga0307412_10009828 | 3300031911 | Bacteria | 5494 |
| 324 | Ga0307412_10012538 | 3300031911 | Bacteria | 4946 |
| 325 | Ga0307412_10073334 | 3300031911 | Bacteria | 2341 |
| 326 | Ga0307412_10124555 | 3300031911 | Bacteria | 1861 |
| 327 | Ga0307412_10209408 | 3300031911 | Bacteria | 1486 |
| 328 | Ga0307409_100042978 | 3300031995 | Bacteria | 3389 |
| 329 | Ga0307409_100196278 | 3300031995 | Bacteria | 1801 |
| 330 | Ga0307416_100101730 | 3300032002 | Bacteria | 2503 |
| 331 | Ga0307416_100527210 | 3300032002 | Bacteria | 1250 |
| 332 | Ga0307414_10057181 | 3300032004 | Bacteria | 2740 |
| 333 | Ga0307414_10062747 | 3300032004 | Bacteria | 2638 |
| 334 | Ga0307411_10224598 | 3300032005 | Bacteria | 1459 |
| 335 | Ga0307411_10348320 | 3300032005 | Bacteria | 1206 |
| 336 | Ga0307510_10012366 | 3300033180 | Bacteria | 10122 |
| 337 | Ga0373946_0200893 | 3300035171 | Bacteria | 955 |
| 338 | Ga0373931_0017312 | 3300035691 | Bacteria | 3562 |
| 339 | Ga0395898_0239091 | 3300037466 | Bacteria | 1732 |
| 340 | Ga0237819_01261 | 3300038705 | Bacteria | 6952 |
| 341 | Ga0436361_0283231 | 3300039447 | Bacteria | 5008 |
| 342 | Ga0436361_1216061 | 3300039447 | Bacteria | 3308 |
| 343 | Ga0439436_0004220 | 3300041404 | Bacteria | 4402 |
| 344 | Ga0439438_001031 | 3300041405 | Bacteria | 12401 |
| 345 | Ga0439438_001794 | 3300041405 | Bacteria | 9427 |
| 346 | Ga0439438_001942 | 3300041405 | Bacteria | 9019 |
| 347 | Ga0439438_003292 | 3300041405 | Bacteria | 6596 |
| 348 | Ga0439438_004756 | 3300041405 | Bacteria | 5129 |
| 349 | Ga0439438_005058 | 3300041405 | Bacteria | 4916 |
| 350 | Ga0439438_009674 | 3300041405 | Bacteria | 3105 |
| 351 | Ga0439438_009748 | 3300041405 | Bacteria | 3087 |
| 352 | Ga0439438_009978 | 3300041405 | Bacteria | 3039 |
| 353 | Ga0439438_027140 | 3300041405 | Bacteria | 1547 |
| 354 | Ga0439447_000250 | 3300041407 | Bacteria | 18833 |
| 355 | Ga0439447_000473 | 3300041407 | Bacteria | 14967 |
| 356 | Ga0439447_003479 | 3300041407 | Bacteria | 5595 |
| 357 | Ga0439447_004245 | 3300041407 | Bacteria | 4966 |
| 358 | Ga0439447_014528 | 3300041407 | Bacteria | 2206 |
| 359 | Ga0439447_014999 | 3300041407 | Bacteria | 2159 |
| 360 | Ga0439447_021111 | 3300041407 | Bacteria | 1718 |
| 361 | Ga0439466_0000285 | 3300041411 | Bacteria | 19708 |
| 362 | Ga0439466_0000469 | 3300041411 | Bacteria | 15341 |
| 363 | Ga0439466_0002434 | 3300041411 | Bacteria | 7297 |
| 364 | Ga0439466_0067166 | 3300041411 | Bacteria | 1147 |
| 365 | Ga0439432_001028 | 3300042006 | Bacteria | 10569 |
| 366 | Ga0439432_001875 | 3300042006 | Bacteria | 7908 |
| 367 | Ga0439432_007235 | 3300042006 | Bacteria | 3942 |
| 368 | Ga0439432_014207 | 3300042006 | Bacteria | 2696 |
| 369 | Ga0439451_001838 | 3300042009 | Bacteria | 4246 |
| 370 | Ga0439452_000170 | 3300042010 | Bacteria | 48261 |
| 371 | Ga0439452_000579 | 3300042010 | Bacteria | 18999 |
| 372 | Ga0439452_001392 | 3300042010 | Bacteria | 9955 |
| 373 | Ga0439452_001470 | 3300042010 | Bacteria | 9604 |
| 374 | Ga0439452_003202 | 3300042010 | Bacteria | 5790 |
| 375 | Ga0439452_026792 | 3300042010 | Bacteria | 1452 |
| 376 | Ga0439456_003065 | 3300042013 | Bacteria | 3375 |
| 377 | Ga0439456_003388 | 3300042013 | Bacteria | 3229 |
| 378 | Ga0439456_004435 | 3300042013 | Bacteria | 2836 |
| 379 | Ga0439463_000840 | 3300042016 | Bacteria | 8431 |
| 380 | Ga0439463_001884 | 3300042016 | Bacteria | 5442 |
| 381 | Ga0450911_000977 | 3300042115 | Bacteria | 7428 |
| 382 | Ga0450911_001425 | 3300042115 | Bacteria | 5512 |
| 383 | Ga0450923_008683 | 3300042125 | Bacteria | 1756 |
| 384 | Ga0450898_035734 | 3300042134 | Bacteria | 926 |
| 385 | Ga0450903_001628 | 3300042138 | Bacteria | 4174 |
| 386 | Ga0450904_000679 | 3300042139 | Bacteria | 6065 |
| 387 | Ga0450904_004753 | 3300042139 | Bacteria | 1401 |
| 388 | Ga0450906_001535 | 3300042145 | Bacteria | 5046 |
| 389 | Ga0450906_007730 | 3300042145 | Bacteria | 2111 |
| 390 | Ga0450907_000115 | 3300042146 | Bacteria | 30452 |
| 391 | Ga0450907_002448 | 3300042146 | Bacteria | 3538 |
| 392 | Ga0450907_008326 | 3300042146 | Bacteria | 1724 |
| 393 | Ga0450910_000503 | 3300042147 | Bacteria | 4636 |
| 394 | Ga0439446_0001469 | 3300042156 | Bacteria | 5384 |
| 395 | Ga0439446_0006297 | 3300042156 | Bacteria | 3089 |
| 396 | Ga0439446_0029699 | 3300042156 | Bacteria | 1577 |
| 397 | Ga0450908_020737 | 3300042184 | Bacteria | 1154 |
| 398 | Ga0450909_000120 | 3300042185 | Bacteria | 7892 |
| 399 | Ga0450909_001343 | 3300042185 | Bacteria | 3417 |
| 400 | Ga0439434_0000211 | 3300042435 | Bacteria | 16127 |
| 401 | Ga0439434_0008481 | 3300042435 | Bacteria | 3013 |
| 402 | Ga0439464_0009432 | 3300042439 | Bacteria | 2569 |
| 403 | Ga0439440_0000155 | 3300042993 | Bacteria | 10144 |
| 404 | Ga0439440_0002765 | 3300042993 | Bacteria | 3330 |
| 405 | Ga0466961_0006453 | 3300044693 | Bacteria | 7447 |
| 406 | Ga0495617_000290 | 3300046452 | Bacteria | 28770 |
| 407 | Ga0495617_001022 | 3300046452 | Bacteria | 12871 |
| 408 | Ga0495617_007496 | 3300046452 | Bacteria | 3786 |
| 409 | Ga0495617_008338 | 3300046452 | Bacteria | 3574 |
| 410 | Ga0495617_008872 | 3300046452 | Bacteria | 3461 |
| 411 | Ga0495617_017847 | 3300046452 | Bacteria | 2398 |
| 412 | Ga0495617_055553 | 3300046452 | Bacteria | 1313 |
| 413 | Ga0495627_001011 | 3300046453 | Bacteria | 18884 |
| 414 | Ga0495627_002989 | 3300046453 | Bacteria | 7735 |
| 415 | Ga0495627_005091 | 3300046453 | Bacteria | 5369 |
| 416 | Ga0495627_007300 | 3300046453 | Bacteria | 4250 |
| 417 | Ga0495627_008337 | 3300046453 | Bacteria | 3896 |
| 418 | Ga0495603_0005711 | 3300046455 | Bacteria | 7438 |
| 419 | Ga0495603_0011221 | 3300046455 | Bacteria | 5427 |
| 420 | Ga0495603_0017156 | 3300046455 | Bacteria | 4383 |
| 421 | Ga0495590_0000888 | 3300046457 | Bacteria | 13406 |
| 422 | Ga0495590_0007244 | 3300046457 | Bacteria | 4287 |
| 423 | Ga0495590_0024068 | 3300046457 | Bacteria | 2147 |
| 424 | Ga0495590_0026143 | 3300046457 | Bacteria | 2050 |
| 425 | Ga0495590_0035808 | 3300046457 | Bacteria | 1732 |
| 426 | Ga0495591_000366 | 3300046458 | Bacteria | 38823 |
| 427 | Ga0495591_000679 | 3300046458 | Bacteria | 24877 |
| 428 | Ga0495591_001742 | 3300046458 | Bacteria | 12967 |
| 429 | Ga0495591_005954 | 3300046458 | Bacteria | 5508 |
| 430 | Ga0495591_007016 | 3300046458 | Bacteria | 4860 |
| 431 | Ga0495591_007385 | 3300046458 | Bacteria | 4680 |
| 432 | Ga0495591_007430 | 3300046458 | Bacteria | 4660 |
| 433 | Ga0495591_008589 | 3300046458 | Bacteria | 4167 |
| 434 | Ga0495591_009235 | 3300046458 | Bacteria | 3939 |
| 435 | Ga0495591_013880 | 3300046458 | Bacteria | 2923 |
| 436 | Ga0495591_016375 | 3300046458 | Bacteria | 2583 |
| 437 | Ga0495591_033523 | 3300046458 | Bacteria | 1518 |
| 438 | Ga0495591_041964 | 3300046458 | Bacteria | 1296 |
| 439 | Ga0495629_0005106 | 3300046459 | Bacteria | 9814 |
| 440 | Ga0495638_0001700 | 3300046460 | Bacteria | 19365 |
| 441 | Ga0495638_0010457 | 3300046460 | Bacteria | 6438 |
| 442 | Ga0495638_0011638 | 3300046460 | Bacteria | 6059 |
| 443 | Ga0495638_0020513 | 3300046460 | Bacteria | 4365 |
| 444 | Ga0495638_0027726 | 3300046460 | Bacteria | 3664 |
| 445 | Ga0495638_0032545 | 3300046460 | Bacteria | 3342 |
| 446 | Ga0495638_0056312 | 3300046460 | Bacteria | 2439 |
| 447 | Ga0495638_0184372 | 3300046460 | Bacteria | 1188 |
| 448 | Ga0495653_0002045 | 3300046463 | Bacteria | 15849 |
| 449 | Ga0495653_0005839 | 3300046463 | Bacteria | 10071 |
| 450 | Ga0495653_0019969 | 3300046463 | Bacteria | 5430 |
| 451 | Ga0495653_0034058 | 3300046463 | Bacteria | 4031 |
| 452 | Ga0495653_0053235 | 3300046463 | Bacteria | 3097 |
| 453 | Ga0495653_0159131 | 3300046463 | Bacteria | 1569 |
| 454 | Ga0495653_0229120 | 3300046463 | Bacteria | 1244 |
| 455 | Ga0495650_0000089 | 3300046471 | Bacteria | 233415 |
| 456 | Ga0495650_0001631 | 3300046471 | Bacteria | 20872 |
| 457 | Ga0495650_0004290 | 3300046471 | Bacteria | 9846 |
| 458 | Ga0495650_0008559 | 3300046471 | Bacteria | 5950 |
| 459 | Ga0495650_0013856 | 3300046471 | Bacteria | 4237 |
| 460 | Ga0495650_0015251 | 3300046471 | Bacteria | 3950 |
| 461 | Ga0495650_0032230 | 3300046471 | Bacteria | 2346 |
| 462 | Ga0495650_0033187 | 3300046471 | Bacteria | 2299 |
| 463 | Ga0495650_0058616 | 3300046471 | Bacteria | 1553 |
| 464 | Ga0495582_0022472 | 3300046473 | Bacteria | 3451 |
| 465 | Ga0495605_0000134 | 3300046474 | Bacteria | 95894 |
| 466 | Ga0495605_0000255 | 3300046474 | Bacteria | 62826 |
| 467 | Ga0495605_0000665 | 3300046474 | Bacteria | 26127 |
| 468 | Ga0495605_0000874 | 3300046474 | Bacteria | 20830 |
| 469 | Ga0495605_0001265 | 3300046474 | Bacteria | 16734 |
| 470 | Ga0495605_0002691 | 3300046474 | Bacteria | 10881 |
| 471 | Ga0495605_0004804 | 3300046474 | Bacteria | 7902 |
| 472 | Ga0495605_0005187 | 3300046474 | Bacteria | 7592 |
| 473 | Ga0495605_0013622 | 3300046474 | Bacteria | 4474 |
| 474 | Ga0495605_0013664 | 3300046474 | Bacteria | 4464 |
| 475 | Ga0495605_0023940 | 3300046474 | Bacteria | 3203 |
| 476 | Ga0495605_0040173 | 3300046474 | Bacteria | 2339 |
| 477 | Ga0495605_0068116 | 3300046474 | Bacteria | 1687 |
| 478 | Ga0495639_0000205 | 3300046475 | Bacteria | 30780 |
| 479 | Ga0495639_0039239 | 3300046475 | Bacteria | 2129 |
| 480 | Ga0495584_0000193 | 3300046491 | Bacteria | 43275 |
| 481 | Ga0495584_0000573 | 3300046491 | Bacteria | 24792 |
| 482 | Ga0495584_0000909 | 3300046491 | Bacteria | 18890 |
| 483 | Ga0495584_0001221 | 3300046491 | Bacteria | 15677 |
| 484 | Ga0495584_0001701 | 3300046491 | Bacteria | 12894 |
| 485 | Ga0495584_0002925 | 3300046491 | Bacteria | 9517 |
| 486 | Ga0495584_0005637 | 3300046491 | Bacteria | 6617 |
| 487 | Ga0495584_0007086 | 3300046491 | Bacteria | 5857 |
| 488 | Ga0495584_0010191 | 3300046491 | Bacteria | 4826 |
| 489 | Ga0495584_0042664 | 3300046491 | Bacteria | 2289 |
| 490 | Ga0495584_0055351 | 3300046491 | Bacteria | 1996 |
| 491 | Ga0495584_0056197 | 3300046491 | Bacteria | 1980 |
| 492 | Ga0495584_0058611 | 3300046491 | Bacteria | 1937 |
| 493 | Ga0495584_0109948 | 3300046491 | Bacteria | 1394 |
| 494 | Ga0495584_0125354 | 3300046491 | Bacteria | 1301 |
| 495 | Ga0495584_0159081 | 3300046491 | Bacteria | 1148 |
| 496 | Ga0495585_0000206 | 3300046492 | Bacteria | 61632 |
| 497 | Ga0495585_0000353 | 3300046492 | Bacteria | 44438 |
| 498 | Ga0495585_0000406 | 3300046492 | Bacteria | 41715 |
| 499 | Ga0495585_0001343 | 3300046492 | Bacteria | 19516 |
| 500 | Ga0495585_0005090 | 3300046492 | Bacteria | 8371 |
| 501 | Ga0495585_0006810 | 3300046492 | Bacteria | 7052 |
| 502 | Ga0495585_0008553 | 3300046492 | Bacteria | 6198 |
| 503 | Ga0495585_0008588 | 3300046492 | Bacteria | 6185 |
| 504 | Ga0495585_0011411 | 3300046492 | Bacteria | 5257 |
| 505 | Ga0495585_0012087 | 3300046492 | Bacteria | 5094 |
| 506 | Ga0495585_0013233 | 3300046492 | Bacteria | 4833 |
| 507 | Ga0495585_0014824 | 3300046492 | Bacteria | 4533 |
| 508 | Ga0495585_0027769 | 3300046492 | Bacteria | 3229 |
| 509 | Ga0495585_0034886 | 3300046492 | Bacteria | 2844 |
| 510 | Ga0495585_0044275 | 3300046492 | Bacteria | 2487 |
| 511 | Ga0495585_0062655 | 3300046492 | Bacteria | 2042 |
| 512 | Ga0495585_0067104 | 3300046492 | Bacteria | 1963 |
| 513 | Ga0495585_0126281 | 3300046492 | Bacteria | 1349 |
| 514 | Ga0495594_0001857 | 3300046499 | Bacteria | 10995 |
| 515 | Ga0495596_0000218 | 3300046500 | Bacteria | 39821 |
| 516 | Ga0495596_0000255 | 3300046500 | Bacteria | 35643 |
| 517 | Ga0495596_0005563 | 3300046500 | Bacteria | 5927 |
| 518 | Ga0495596_0010423 | 3300046500 | Bacteria | 4049 |
| 519 | Ga0495596_0013694 | 3300046500 | Bacteria | 3431 |
| 520 | Ga0495596_0024608 | 3300046500 | Bacteria | 2437 |
| 521 | Ga0495607_0000539 | 3300046501 | Bacteria | 37036 |
| 522 | Ga0495607_0000565 | 3300046501 | Bacteria | 36127 |
| 523 | Ga0495607_0002957 | 3300046501 | Bacteria | 13353 |
| 524 | Ga0495607_0006509 | 3300046501 | Bacteria | 8212 |
| 525 | Ga0495607_0007824 | 3300046501 | Bacteria | 7357 |
| 526 | Ga0495607_0009109 | 3300046501 | Bacteria | 6748 |
| 527 | Ga0495607_0009538 | 3300046501 | Bacteria | 6560 |
| 528 | Ga0495607_0009980 | 3300046501 | Bacteria | 6395 |
| 529 | Ga0495607_0015602 | 3300046501 | Bacteria | 4921 |
| 530 | Ga0495607_0020022 | 3300046501 | Bacteria | 4236 |
| 531 | Ga0495607_0020952 | 3300046501 | Bacteria | 4119 |
| 532 | Ga0495607_0022154 | 3300046501 | Bacteria | 3994 |
| 533 | Ga0495607_0026960 | 3300046501 | Bacteria | 3559 |
| 534 | Ga0495607_0029323 | 3300046501 | Bacteria | 3386 |
| 535 | Ga0495607_0034981 | 3300046501 | Bacteria | 3043 |
| 536 | Ga0495607_0035250 | 3300046501 | Bacteria | 3028 |
| 537 | Ga0495607_0037436 | 3300046501 | Bacteria | 2914 |
| 538 | Ga0495607_0038260 | 3300046501 | Bacteria | 2875 |
| 539 | Ga0495607_0058775 | 3300046501 | Bacteria | 2196 |
| 540 | Ga0495607_0073440 | 3300046501 | Bacteria | 1901 |
| 541 | Ga0495607_0112701 | 3300046501 | Bacteria | 1439 |
| 542 | Ga0495607_0126619 | 3300046501 | Bacteria | 1334 |
| 543 | Ga0495607_0135968 | 3300046501 | Bacteria | 1273 |
| 544 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 545 | Ga0495583_0000374 | 3300046506 | Bacteria | 69535 |
| 546 | Ga0495583_0000424 | 3300046506 | Bacteria | 63938 |
| 547 | Ga0495583_0000920 | 3300046506 | Bacteria | 34707 |
| 548 | Ga0495583_0001217 | 3300046506 | Bacteria | 27414 |
| 549 | Ga0495583_0001546 | 3300046506 | Bacteria | 22803 |
| 550 | Ga0495583_0001716 | 3300046506 | Bacteria | 21053 |
| 551 | Ga0495583_0002426 | 3300046506 | Bacteria | 15971 |
| 552 | Ga0495583_0004450 | 3300046506 | Bacteria | 10025 |
| 553 | Ga0495583_0004610 | 3300046506 | Bacteria | 9750 |
| 554 | Ga0495583_0007279 | 3300046506 | Bacteria | 6995 |
| 555 | Ga0495583_0013708 | 3300046506 | Bacteria | 4502 |
| 556 | Ga0495583_0017168 | 3300046506 | Bacteria | 3855 |
| 557 | Ga0495583_0034515 | 3300046506 | Bacteria | 2422 |
| 558 | Ga0495583_0070755 | 3300046506 | Bacteria | 1533 |
| 559 | Ga0495583_0101621 | 3300046506 | Bacteria | 1226 |
| 560 | Ga0495606_0000836 | 3300046507 | Bacteria | 46402 |
| 561 | Ga0495606_0000890 | 3300046507 | Bacteria | 44577 |
| 562 | Ga0495606_0002088 | 3300046507 | Bacteria | 24359 |
| 563 | Ga0495606_0002861 | 3300046507 | Bacteria | 19096 |
| 564 | Ga0495606_0006026 | 3300046507 | Bacteria | 11353 |
| 565 | Ga0495606_0009866 | 3300046507 | Bacteria | 8007 |
| 566 | Ga0495606_0011514 | 3300046507 | Bacteria | 7207 |
| 567 | Ga0495606_0020527 | 3300046507 | Bacteria | 4866 |
| 568 | Ga0495606_0022853 | 3300046507 | Bacteria | 4543 |
| 569 | Ga0495606_0023703 | 3300046507 | Bacteria | 4439 |
| 570 | Ga0495606_0026076 | 3300046507 | Bacteria | 4169 |
| 571 | Ga0495606_0039524 | 3300046507 | Bacteria | 3177 |
| 572 | Ga0495606_0107517 | 3300046507 | Bacteria | 1687 |
| 573 | Ga0495608_0007521 | 3300046511 | Bacteria | 7690 |
| 574 | Ga0495608_0012547 | 3300046511 | Bacteria | 5879 |
| 575 | Ga0495610_0000200 | 3300046512 | Bacteria | 67114 |
| 576 | Ga0495610_0004934 | 3300046512 | Bacteria | 9673 |
| 577 | Ga0495610_0005820 | 3300046512 | Bacteria | 8664 |
| 578 | Ga0495610_0008501 | 3300046512 | Bacteria | 6633 |
| 579 | Ga0495610_0012618 | 3300046512 | Bacteria | 5072 |
| 580 | Ga0495610_0013917 | 3300046512 | Bacteria | 4753 |
| 581 | Ga0495610_0015656 | 3300046512 | Bacteria | 4397 |
| 582 | Ga0495610_0018976 | 3300046512 | Bacteria | 3863 |
| 583 | Ga0495610_0019193 | 3300046512 | Bacteria | 3833 |
| 584 | Ga0495610_0027491 | 3300046512 | Bacteria | 3021 |
| 585 | Ga0495610_0034264 | 3300046512 | Bacteria | 2616 |
| 586 | Ga0495610_0164502 | 3300046512 | Bacteria | 935 |
| 587 | Ga0495616_0003882 | 3300046513 | Bacteria | 9519 |
| 588 | Ga0495616_0005755 | 3300046513 | Bacteria | 7583 |
| 589 | Ga0495616_0007431 | 3300046513 | Bacteria | 6557 |
| 590 | Ga0495616_0008102 | 3300046513 | Bacteria | 6255 |
| 591 | Ga0495616_0008225 | 3300046513 | Bacteria | 6192 |
| 592 | Ga0495616_0012584 | 3300046513 | Bacteria | 4796 |
| 593 | Ga0495616_0015792 | 3300046513 | Bacteria | 4190 |
| 594 | Ga0495616_0015846 | 3300046513 | Bacteria | 4180 |
| 595 | Ga0495616_0020951 | 3300046513 | Bacteria | 3549 |
| 596 | Ga0495616_0021803 | 3300046513 | Bacteria | 3464 |
| 597 | Ga0495616_0021902 | 3300046513 | Bacteria | 3455 |
| 598 | Ga0495616_0033331 | 3300046513 | Bacteria | 2684 |
| 599 | Ga0495616_0041662 | 3300046513 | Bacteria | 2341 |
| 600 | Ga0495616_0060364 | 3300046513 | Bacteria | 1862 |
| 601 | Ga0495616_0062966 | 3300046513 | Bacteria | 1814 |
| 602 | Ga0495616_0064288 | 3300046513 | Bacteria | 1790 |
| 603 | Ga0495616_0065202 | 3300046513 | Bacteria | 1775 |
| 604 | Ga0495616_0150216 | 3300046513 | Bacteria | 1054 |
| 605 | Ga0495618_0105071 | 3300046514 | Bacteria | 1808 |
| 606 | Ga0495620_0000018 | 3300046515 | Bacteria | 150595 |
| 607 | Ga0495620_0000301 | 3300046515 | Bacteria | 35173 |
| 608 | Ga0495620_0000803 | 3300046515 | Bacteria | 19298 |
| 609 | Ga0495620_0025567 | 3300046515 | Bacteria | 2790 |
| 610 | Ga0495620_0032225 | 3300046515 | Bacteria | 2390 |
| 611 | Ga0495620_0051938 | 3300046515 | Bacteria | 1742 |
| 612 | Ga0495628_0006377 | 3300046516 | Bacteria | 10307 |
| 613 | Ga0495628_0019098 | 3300046516 | Bacteria | 5669 |
| 614 | Ga0495628_0089723 | 3300046516 | Bacteria | 2380 |
| 615 | Ga0495628_0365276 | 3300046516 | Bacteria | 1059 |
| 616 | Ga0495630_0087114 | 3300046517 | Bacteria | 2358 |
| 617 | Ga0495630_0146643 | 3300046517 | Bacteria | 1795 |
| 618 | Ga0495631_0000258 | 3300046518 | Bacteria | 36872 |
| 619 | Ga0495631_0000971 | 3300046518 | Bacteria | 17781 |
| 620 | Ga0495631_0002825 | 3300046518 | Bacteria | 9640 |
| 621 | Ga0495631_0013923 | 3300046518 | Bacteria | 3890 |
| 622 | Ga0495631_0016139 | 3300046518 | Bacteria | 3568 |
| 623 | Ga0495632_0000114 | 3300046519 | Bacteria | 82098 |
| 624 | Ga0495632_0000130 | 3300046519 | Bacteria | 77011 |
| 625 | Ga0495632_0001062 | 3300046519 | Bacteria | 23597 |
| 626 | Ga0495632_0001448 | 3300046519 | Bacteria | 19724 |
| 627 | Ga0495632_0002364 | 3300046519 | Bacteria | 14433 |
| 628 | Ga0495632_0004168 | 3300046519 | Bacteria | 9908 |
| 629 | Ga0495632_0006019 | 3300046519 | Bacteria | 7886 |
| 630 | Ga0495632_0007058 | 3300046519 | Bacteria | 7117 |
| 631 | Ga0495632_0009517 | 3300046519 | Bacteria | 5850 |
| 632 | Ga0495632_0017599 | 3300046519 | Bacteria | 3939 |
| 633 | Ga0495632_0026006 | 3300046519 | Bacteria | 3087 |
| 634 | Ga0495632_0028097 | 3300046519 | Bacteria | 2938 |
| 635 | Ga0495632_0037868 | 3300046519 | Bacteria | 2444 |
| 636 | Ga0495632_0046170 | 3300046519 | Bacteria | 2166 |
| 637 | Ga0495632_0080869 | 3300046519 | Bacteria | 1549 |
| 638 | Ga0495632_0127542 | 3300046519 | Bacteria | 1185 |
| 639 | Ga0495637_0000052 | 3300046520 | Bacteria | 99761 |
| 640 | Ga0495637_0000658 | 3300046520 | Bacteria | 24086 |
| 641 | Ga0495637_0001664 | 3300046520 | Bacteria | 12851 |
| 642 | Ga0495637_0003486 | 3300046520 | Bacteria | 8350 |
| 643 | Ga0495637_0005514 | 3300046520 | Bacteria | 6431 |
| 644 | Ga0495637_0005892 | 3300046520 | Bacteria | 6196 |
| 645 | Ga0495637_0007654 | 3300046520 | Bacteria | 5344 |
| 646 | Ga0495637_0011147 | 3300046520 | Bacteria | 4325 |
| 647 | Ga0495637_0012036 | 3300046520 | Bacteria | 4148 |
| 648 | Ga0495637_0017403 | 3300046520 | Bacteria | 3349 |
| 649 | Ga0495637_0021363 | 3300046520 | Bacteria | 2969 |
| 650 | Ga0495637_0035092 | 3300046520 | Bacteria | 2192 |
| 651 | Ga0495643_0000377 | 3300046522 | Bacteria | 59840 |
| 652 | Ga0495643_0001167 | 3300046522 | Bacteria | 25629 |
| 653 | Ga0495643_0005154 | 3300046522 | Bacteria | 8927 |
| 654 | Ga0495643_0005630 | 3300046522 | Bacteria | 8403 |
| 655 | Ga0495643_0007341 | 3300046522 | Bacteria | 7123 |
| 656 | Ga0495643_0015293 | 3300046522 | Bacteria | 4538 |
| 657 | Ga0495643_0019879 | 3300046522 | Bacteria | 3881 |
| 658 | Ga0495643_0027087 | 3300046522 | Bacteria | 3225 |
| 659 | Ga0495643_0029836 | 3300046522 | Bacteria | 3049 |
| 660 | Ga0495643_0071127 | 3300046522 | Bacteria | 1826 |
| 661 | Ga0495644_0000135 | 3300046523 | Bacteria | 35398 |
| 662 | Ga0495644_0001024 | 3300046523 | Bacteria | 11647 |
| 663 | Ga0495644_0004447 | 3300046523 | Bacteria | 5509 |
| 664 | Ga0495644_0005129 | 3300046523 | Bacteria | 5128 |
| 665 | Ga0495644_0005349 | 3300046523 | Bacteria | 5013 |
| 666 | Ga0495644_0027870 | 3300046523 | Bacteria | 2139 |
| 667 | Ga0495648_0000057 | 3300046524 | Bacteria | 157446 |
| 668 | Ga0495648_0000359 | 3300046524 | Bacteria | 50204 |
| 669 | Ga0495648_0000659 | 3300046524 | Bacteria | 36898 |
| 670 | Ga0495648_0000677 | 3300046524 | Bacteria | 36414 |
| 671 | Ga0495648_0001820 | 3300046524 | Bacteria | 20527 |
| 672 | Ga0495648_0005388 | 3300046524 | Bacteria | 10638 |
| 673 | Ga0495648_0011551 | 3300046524 | Bacteria | 6642 |
| 674 | Ga0495648_0020317 | 3300046524 | Bacteria | 4634 |
| 675 | Ga0495648_0021098 | 3300046524 | Bacteria | 4522 |
| 676 | Ga0495648_0031172 | 3300046524 | Bacteria | 3514 |
| 677 | Ga0495648_0034852 | 3300046524 | Bacteria | 3269 |
| 678 | Ga0495648_0040789 | 3300046524 | Bacteria | 2938 |
| 679 | Ga0495648_0045194 | 3300046524 | Bacteria | 2741 |
| 680 | Ga0495648_0059410 | 3300046524 | Bacteria | 2280 |
| 681 | Ga0495648_0061249 | 3300046524 | Bacteria | 2236 |
| 682 | Ga0495648_0080690 | 3300046524 | Bacteria | 1852 |
| 683 | Ga0495648_0213928 | 3300046524 | Bacteria | 955 |
| 684 | Ga0495663_0000258 | 3300046525 | Bacteria | 20522 |
| 685 | Ga0495666_0014147 | 3300046526 | Bacteria | 3976 |
| 686 | Ga0495642_0000134 | 3300046528 | Bacteria | 42945 |
| 687 | Ga0495642_0004784 | 3300046528 | Bacteria | 5236 |
| 688 | Ga0495642_0005118 | 3300046528 | Bacteria | 5048 |
| 689 | Ga0495642_0007475 | 3300046528 | Bacteria | 4184 |
| 690 | Ga0495642_0078376 | 3300046528 | Bacteria | 1388 |
| 691 | Ga0495652_0004707 | 3300046529 | Bacteria | 13004 |
| 692 | Ga0495652_0047329 | 3300046529 | Bacteria | 3688 |
| 693 | Ga0495652_0097496 | 3300046529 | Bacteria | 2391 |
| 694 | Ga0495652_0116390 | 3300046529 | Bacteria | 2140 |
| 695 | Ga0495654_0000539 | 3300046530 | Bacteria | 30544 |
| 696 | Ga0495654_0000911 | 3300046530 | Bacteria | 21955 |
| 697 | Ga0495654_0001479 | 3300046530 | Bacteria | 16094 |
| 698 | Ga0495654_0007451 | 3300046530 | Bacteria | 6112 |
| 699 | Ga0495654_0008999 | 3300046530 | Bacteria | 5481 |
| 700 | Ga0495654_0009020 | 3300046530 | Bacteria | 5476 |
| 701 | Ga0495654_0012716 | 3300046530 | Bacteria | 4518 |
| 702 | Ga0495654_0012731 | 3300046530 | Bacteria | 4515 |
| 703 | Ga0495654_0014088 | 3300046530 | Bacteria | 4263 |
| 704 | Ga0495654_0029067 | 3300046530 | Bacteria | 2821 |
| 705 | Ga0495654_0032570 | 3300046530 | Bacteria | 2641 |
| 706 | Ga0495654_0040069 | 3300046530 | Bacteria | 2336 |
| 707 | Ga0495654_0047206 | 3300046530 | Bacteria | 2117 |
| 708 | Ga0495654_0048095 | 3300046530 | Bacteria | 2094 |
| 709 | Ga0495665_0242116 | 3300046531 | Bacteria | 929 |
| 710 | Ga0495586_0003995 | 3300046535 | Bacteria | 7906 |
| 711 | Ga0495586_0068438 | 3300046535 | Bacteria | 1936 |
| 712 | Ga0495587_0011563 | 3300046536 | Bacteria | 5588 |
| 713 | Ga0495587_0015053 | 3300046536 | Bacteria | 4834 |
| 714 | Ga0495609_0000192 | 3300046538 | Bacteria | 61042 |
| 715 | Ga0495609_0000267 | 3300046538 | Bacteria | 48889 |
| 716 | Ga0495609_0000368 | 3300046538 | Bacteria | 38899 |
| 717 | Ga0495609_0001212 | 3300046538 | Bacteria | 17772 |
| 718 | Ga0495609_0001321 | 3300046538 | Bacteria | 16836 |
| 719 | Ga0495609_0001788 | 3300046538 | Bacteria | 13793 |
| 720 | Ga0495609_0002958 | 3300046538 | Bacteria | 10047 |
| 721 | Ga0495609_0005222 | 3300046538 | Bacteria | 6907 |
| 722 | Ga0495609_0010263 | 3300046538 | Bacteria | 4499 |
| 723 | Ga0495609_0012848 | 3300046538 | Bacteria | 3964 |
| 724 | Ga0495609_0017897 | 3300046538 | Bacteria | 3288 |
| 725 | Ga0495609_0032611 | 3300046538 | Bacteria | 2365 |
| 726 | Ga0495609_0060245 | 3300046538 | Bacteria | 1678 |
| 727 | Ga0495609_0078435 | 3300046538 | Bacteria | 1445 |
| 728 | Ga0495597_0001180 | 3300046542 | Bacteria | 19588 |
| 729 | Ga0495597_0002458 | 3300046542 | Bacteria | 11722 |
| 730 | Ga0495597_0009101 | 3300046542 | Bacteria | 4931 |
| 731 | Ga0495597_0012866 | 3300046542 | Bacteria | 4026 |
| 732 | Ga0495597_0014714 | 3300046542 | Bacteria | 3721 |
| 733 | Ga0495597_0018552 | 3300046542 | Bacteria | 3264 |
| 734 | Ga0495597_0019636 | 3300046542 | Bacteria | 3158 |
| 735 | Ga0495597_0019823 | 3300046542 | Bacteria | 3141 |
| 736 | Ga0495597_0020928 | 3300046542 | Bacteria | 3042 |
| 737 | Ga0495597_0028781 | 3300046542 | Bacteria | 2540 |
| 738 | Ga0495597_0093404 | 3300046542 | Bacteria | 1274 |
| 739 | Ga0495645_0039677 | 3300046543 | Bacteria | 3434 |
| 740 | Ga0495645_0178975 | 3300046543 | Bacteria | 1454 |
| 741 | Ga0495622_0000947 | 3300046557 | Bacteria | 15557 |
| 742 | Ga0495622_0002080 | 3300046557 | Bacteria | 9785 |
| 743 | Ga0495622_0005014 | 3300046557 | Bacteria | 6135 |
| 744 | Ga0495622_0006676 | 3300046557 | Bacteria | 5350 |
| 745 | Ga0495622_0012286 | 3300046557 | Bacteria | 3960 |
| 746 | Ga0495622_0028339 | 3300046557 | Bacteria | 2615 |
| 747 | Ga0495622_0056988 | 3300046557 | Bacteria | 1812 |
| 748 | Ga0495622_0107241 | 3300046557 | Bacteria | 1279 |
| 749 | Ga0495633_0000349 | 3300046558 | Bacteria | 50979 |
| 750 | Ga0495633_0000373 | 3300046558 | Bacteria | 47781 |
| 751 | Ga0495633_0003533 | 3300046558 | Bacteria | 10351 |
| 752 | Ga0495633_0005272 | 3300046558 | Bacteria | 7962 |
| 753 | Ga0495633_0008372 | 3300046558 | Bacteria | 5834 |
| 754 | Ga0495633_0012392 | 3300046558 | Bacteria | 4536 |
| 755 | Ga0495633_0015607 | 3300046558 | Bacteria | 3937 |
| 756 | Ga0495633_0017796 | 3300046558 | Bacteria | 3622 |
| 757 | Ga0495633_0069986 | 3300046558 | Bacteria | 1637 |
| 758 | Ga0495633_0157657 | 3300046558 | Bacteria | 1047 |
| 759 | Ga0495633_0215559 | 3300046558 | Bacteria | 879 |
| 760 | Ga0495656_0004689 | 3300046615 | Bacteria | 4696 |
| 761 | Ga0495656_0016347 | 3300046615 | Bacteria | 2814 |
| 762 | Ga0495656_0022901 | 3300046615 | Bacteria | 2452 |
| 763 | Ga0495656_0034469 | 3300046615 | Bacteria | 2073 |
| 764 | Ga0495656_0058407 | 3300046615 | Bacteria | 1674 |
| 765 | Ga0495668_0000028 | 3300046616 | Bacteria | 286629 |
| 766 | Ga0495668_0000036 | 3300046616 | Bacteria | 235057 |
| 767 | Ga0495668_0001994 | 3300046616 | Bacteria | 17858 |
| 768 | Ga0495668_0023229 | 3300046616 | Bacteria | 3539 |
| 769 | Ga0495668_0026431 | 3300046616 | Bacteria | 3293 |
| 770 | Ga0495668_0070403 | 3300046616 | Bacteria | 1923 |
| 771 | Ga0495668_0104387 | 3300046616 | Bacteria | 1550 |
| 772 | Ga0495634_0021525 | 3300046642 | Bacteria | 4555 |
| 773 | Ga0495634_0058521 | 3300046642 | Bacteria | 2568 |
| 774 | Ga0495611_0000418 | 3300046648 | Bacteria | 26364 |
| 775 | Ga0495611_0000869 | 3300046648 | Bacteria | 16520 |
| 776 | Ga0495611_0000924 | 3300046648 | Bacteria | 15830 |
| 777 | Ga0495611_0001507 | 3300046648 | Bacteria | 11506 |
| 778 | Ga0495611_0001953 | 3300046648 | Bacteria | 9795 |
| 779 | Ga0495611_0004422 | 3300046648 | Bacteria | 6082 |
| 780 | Ga0495611_0005244 | 3300046648 | Bacteria | 5550 |
| 781 | Ga0495611_0013671 | 3300046648 | Bacteria | 3459 |
| 782 | Ga0495611_0044520 | 3300046648 | Bacteria | 1985 |
| 783 | Ga0495611_0124905 | 3300046648 | Bacteria | 1200 |
| 784 | Ga0495625_0000027 | 3300046660 | Bacteria | 258545 |
| 785 | Ga0495625_0001781 | 3300046660 | Bacteria | 24787 |
| 786 | Ga0495625_0003651 | 3300046660 | Bacteria | 15089 |
| 787 | Ga0495625_0007596 | 3300046660 | Bacteria | 9413 |
| 788 | Ga0495625_0019629 | 3300046660 | Bacteria | 5235 |
| 789 | Ga0495625_0027364 | 3300046660 | Bacteria | 4294 |
| 790 | Ga0495625_0042756 | 3300046660 | Bacteria | 3289 |
| 791 | Ga0495625_0046921 | 3300046660 | Bacteria | 3115 |
| 792 | Ga0495625_0051905 | 3300046660 | Bacteria | 2937 |
| 793 | Ga0495625_0091322 | 3300046660 | Bacteria | 2105 |
| 794 | Ga0495625_0149563 | 3300046660 | Bacteria | 1570 |
| 795 | Ga0495625_0156791 | 3300046660 | Bacteria | 1527 |
| 796 | Ga0495625_0216032 | 3300046660 | Bacteria | 1258 |
| 797 | Ga0495635_0005483 | 3300046663 | Bacteria | 8824 |
| 798 | Ga0495659_0000033 | 3300046664 | Bacteria | 64915 |
| 799 | Ga0495659_0000190 | 3300046664 | Bacteria | 26750 |
| 800 | Ga0495659_0003370 | 3300046664 | Bacteria | 5122 |
| 801 | Ga0495659_0003974 | 3300046664 | Bacteria | 4682 |
| 802 | Ga0495661_0000097 | 3300046665 | Bacteria | 107784 |
| 803 | Ga0495661_0000137 | 3300046665 | Bacteria | 86360 |
| 804 | Ga0495661_0002478 | 3300046665 | Bacteria | 14198 |
| 805 | Ga0495661_0007062 | 3300046665 | Bacteria | 7845 |
| 806 | Ga0495661_0013700 | 3300046665 | Bacteria | 5442 |
| 807 | Ga0495661_0021038 | 3300046665 | Bacteria | 4255 |
| 808 | Ga0495661_0021196 | 3300046665 | Bacteria | 4238 |
| 809 | Ga0495661_0021746 | 3300046665 | Bacteria | 4178 |
| 810 | Ga0495661_0026804 | 3300046665 | Bacteria | 3706 |
| 811 | Ga0495661_0037244 | 3300046665 | Bacteria | 3038 |
| 812 | Ga0495661_0211951 | 3300046665 | Bacteria | 1008 |
| 813 | Ga0495588_0005282 | 3300046674 | Bacteria | 5742 |
| 814 | Ga0495588_0006427 | 3300046674 | Bacteria | 5291 |
| 815 | Ga0495657_0061837 | 3300046675 | Bacteria | 2476 |
| 816 | Ga0495599_0015469 | 3300046678 | Bacteria | 4735 |
| 817 | Ga0495623_0002436 | 3300046679 | Bacteria | 12337 |
| 818 | Ga0495623_0011710 | 3300046679 | Bacteria | 5681 |
| 819 | Ga0495623_0018649 | 3300046679 | Bacteria | 4479 |
| 820 | Ga0495623_0035475 | 3300046679 | Bacteria | 3196 |
| 821 | Ga0495646_0000449 | 3300046680 | Bacteria | 21765 |
| 822 | Ga0495646_0021849 | 3300046680 | Bacteria | 4041 |
| 823 | Ga0495646_0040952 | 3300046680 | Bacteria | 2849 |
| 824 | Ga0495658_0052513 | 3300046683 | Bacteria | 2312 |
| 825 | Ga0495658_0182591 | 3300046683 | Bacteria | 1302 |
| 826 | Ga0495669_0007494 | 3300046684 | Bacteria | 4577 |
| 827 | Ga0495669_0015503 | 3300046684 | Bacteria | 3264 |
| 828 | Ga0495624_0009029 | 3300046690 | Bacteria | 6924 |
| 829 | Ga0495624_0110171 | 3300046690 | Bacteria | 1693 |
| 830 | Ga0495670_0000252 | 3300046691 | Bacteria | 24908 |
| 831 | Ga0495670_0001951 | 3300046691 | Bacteria | 10161 |
| 832 | Ga0495670_0004256 | 3300046691 | Bacteria | 7012 |
| 833 | Ga0495670_0004441 | 3300046691 | Bacteria | 6882 |
| 834 | Ga0495670_0004825 | 3300046691 | Bacteria | 6622 |
| 835 | Ga0495670_0021850 | 3300046691 | Bacteria | 3158 |
| 836 | Ga0495670_0068053 | 3300046691 | Bacteria | 1798 |
| 837 | Ga0495670_0113694 | 3300046691 | Bacteria | 1402 |
| 838 | Ga0495671_0000572 | 3300046692 | Bacteria | 27436 |
| 839 | Ga0495671_0000651 | 3300046692 | Bacteria | 25271 |
| 840 | Ga0495671_0001407 | 3300046692 | Bacteria | 16212 |
| 841 | Ga0495671_0003836 | 3300046692 | Bacteria | 9134 |
| 842 | Ga0495671_0005725 | 3300046692 | Bacteria | 7242 |
| 843 | Ga0495671_0008681 | 3300046692 | Bacteria | 5708 |
| 844 | Ga0495671_0012813 | 3300046692 | Bacteria | 4565 |
| 845 | Ga0495671_0016615 | 3300046692 | Bacteria | 3926 |
| 846 | Ga0495671_0019470 | 3300046692 | Bacteria | 3587 |
| 847 | Ga0495671_0021158 | 3300046692 | Bacteria | 3420 |
| 848 | Ga0495671_0021405 | 3300046692 | Bacteria | 3397 |
| 849 | Ga0495671_0033521 | 3300046692 | Bacteria | 2615 |
| 850 | Ga0495671_0040215 | 3300046692 | Bacteria | 2358 |
| 851 | Ga0495671_0051833 | 3300046692 | Bacteria | 2040 |
| 852 | Ga0495671_0059737 | 3300046692 | Bacteria | 1883 |
| 853 | Ga0495671_0070703 | 3300046692 | Bacteria | 1714 |
| 854 | Ga0495671_0070862 | 3300046692 | Bacteria | 1712 |
| 855 | Ga0495671_0072971 | 3300046692 | Bacteria | 1684 |
| 856 | Ga0495671_0094858 | 3300046692 | Bacteria | 1459 |
| 857 | Ga0495671_0143688 | 3300046692 | Bacteria | 1162 |
| 858 | Ga0495649_0002998 | 3300046694 | Bacteria | 11587 |
| 859 | Ga0495649_0015044 | 3300046694 | Bacteria | 4416 |
| 860 | Ga0495649_0015268 | 3300046694 | Bacteria | 4372 |
| 861 | Ga0495649_0016765 | 3300046694 | Bacteria | 4148 |
| 862 | Ga0495649_0018596 | 3300046694 | Bacteria | 3906 |
| 863 | Ga0495649_0024247 | 3300046694 | Bacteria | 3383 |
| 864 | Ga0495649_0028141 | 3300046694 | Bacteria | 3115 |
| 865 | Ga0495649_0061538 | 3300046694 | Bacteria | 2018 |
| 866 | Ga0495649_0063947 | 3300046694 | Bacteria | 1976 |
| 867 | Ga0495649_0080101 | 3300046694 | Bacteria | 1747 |
| 868 | Ga0495649_0099938 | 3300046694 | Bacteria | 1542 |
| 869 | Ga0495649_0124205 | 3300046694 | Bacteria | 1363 |
| 870 | Ga0495649_0161043 | 3300046694 | Bacteria | 1176 |
| 871 | Ga0495649_0170688 | 3300046694 | Bacteria | 1138 |
| 872 | Ga0495589_0003207 | 3300046794 | Bacteria | 8932 |
| 873 | Ga0495589_0003552 | 3300046794 | Bacteria | 8432 |
| 874 | Ga0495589_0006739 | 3300046794 | Bacteria | 6049 |
| 875 | Ga0495589_0007683 | 3300046794 | Bacteria | 5645 |
| 876 | Ga0495589_0012356 | 3300046794 | Bacteria | 4423 |
| 877 | Ga0495589_0015894 | 3300046794 | Bacteria | 3870 |
| 878 | Ga0495589_0024177 | 3300046794 | Bacteria | 3088 |
| 879 | Ga0495589_0027506 | 3300046794 | Bacteria | 2875 |
| 880 | Ga0495589_0030288 | 3300046794 | Bacteria | 2725 |
| 881 | Ga0495589_0035649 | 3300046794 | Bacteria | 2494 |
| 882 | Ga0495589_0043226 | 3300046794 | Bacteria | 2243 |
| 883 | Ga0495589_0091207 | 3300046794 | Bacteria | 1480 |
| 884 | Ga0495589_0100688 | 3300046794 | Bacteria | 1398 |
| 885 | Ga0495600_0002904 | 3300046809 | Bacteria | 9984 |
| 886 | Ga0495600_0012940 | 3300046809 | Bacteria | 5229 |
| 887 | Ga0495660_0001739 | 3300046810 | Bacteria | 14532 |
| 888 | Ga0495660_0003124 | 3300046810 | Bacteria | 10316 |
| 889 | Ga0495660_0008253 | 3300046810 | Bacteria | 6100 |
| 890 | Ga0495660_0013359 | 3300046810 | Bacteria | 4758 |
| 891 | Ga0495660_0014893 | 3300046810 | Bacteria | 4497 |
| 892 | Ga0495660_0015255 | 3300046810 | Bacteria | 4439 |
| 893 | Ga0495660_0016132 | 3300046810 | Bacteria | 4308 |
| 894 | Ga0495660_0019857 | 3300046810 | Bacteria | 3855 |
| 895 | Ga0495660_0024674 | 3300046810 | Bacteria | 3424 |
| 896 | Ga0495660_0024850 | 3300046810 | Bacteria | 3408 |
| 897 | Ga0495660_0029195 | 3300046810 | Bacteria | 3113 |
| 898 | Ga0495660_0034768 | 3300046810 | Bacteria | 2818 |
| 899 | Ga0495660_0080940 | 3300046810 | Bacteria | 1703 |
| 900 | Ga0495660_0106292 | 3300046810 | Bacteria | 1438 |
| 901 | Ga0495660_0110586 | 3300046810 | Bacteria | 1402 |
| 902 | Ga0495660_0137217 | 3300046810 | Bacteria | 1221 |
| 903 | Ga0495660_0177376 | 3300046810 | Bacteria | 1033 |
| 904 | Ga0495581_0011698 | 3300047315 | Bacteria | 5078 |
| 905 | Ga0495604_0009630 | 3300047317 | Bacteria | 7640 |
| 906 | Ga0495604_0353119 | 3300047317 | Bacteria | 976 |
| 907 | Ga0495636_0000729 | 3300047318 | Bacteria | 12060 |
| 908 | Ga0495636_0000743 | 3300047318 | Bacteria | 11991 |
| 909 | Ga0495636_0001149 | 3300047318 | Bacteria | 9987 |
| 910 | Ga0495636_0009678 | 3300047318 | Bacteria | 3795 |
| 911 | Ga0495636_0121076 | 3300047318 | Bacteria | 1158 |
| 912 | Ga0495674_0456807 | 3300047319 | Bacteria | 1026 |
| 913 | Ga0495672_0000093 | 3300047320 | Bacteria | 145111 |
| 914 | Ga0495672_0000191 | 3300047320 | Bacteria | 88319 |
| 915 | Ga0495672_0000228 | 3300047320 | Bacteria | 80256 |
| 916 | Ga0495672_0000903 | 3300047320 | Bacteria | 31104 |
| 917 | Ga0495672_0001057 | 3300047320 | Bacteria | 28116 |
| 918 | Ga0495672_0002098 | 3300047320 | Bacteria | 18684 |
| 919 | Ga0495672_0002503 | 3300047320 | Bacteria | 16815 |
| 920 | Ga0495672_0002947 | 3300047320 | Bacteria | 14996 |
| 921 | Ga0495672_0003267 | 3300047320 | Bacteria | 14040 |
| 922 | Ga0495672_0003583 | 3300047320 | Bacteria | 13203 |
| 923 | Ga0495672_0006444 | 3300047320 | Bacteria | 9087 |
| 924 | Ga0495672_0007859 | 3300047320 | Bacteria | 7961 |
| 925 | Ga0495672_0011326 | 3300047320 | Bacteria | 6301 |
| 926 | Ga0495672_0015421 | 3300047320 | Bacteria | 5189 |
| 927 | Ga0495672_0015442 | 3300047320 | Bacteria | 5183 |
| 928 | Ga0495672_0022662 | 3300047320 | Bacteria | 4077 |
| 929 | Ga0495672_0023240 | 3300047320 | Bacteria | 4016 |
| 930 | Ga0495672_0038854 | 3300047320 | Bacteria | 2899 |
| 931 | Ga0495672_0061257 | 3300047320 | Bacteria | 2169 |
| 932 | Ga0495672_0070250 | 3300047320 | Bacteria | 1984 |
| 933 | Ga0495672_0094823 | 3300047320 | Bacteria | 1630 |
| 934 | Ga0495672_0103132 | 3300047320 | Bacteria | 1543 |
| 935 | Ga0495672_0132109 | 3300047320 | Bacteria | 1312 |
| 936 | Ga0495676_0000012 | 3300047321 | Bacteria | 230043 |
| 937 | Ga0495676_0015419 | 3300047321 | Bacteria | 6804 |
| 938 | Ga0495676_0028268 | 3300047321 | Bacteria | 4791 |
| 939 | Ga0495676_0052865 | 3300047321 | Bacteria | 3240 |
| 940 | Ga0495676_0105308 | 3300047321 | Bacteria | 2080 |
| 941 | Ga0495676_0110702 | 3300047321 | Bacteria | 2015 |
| 942 | Ga0495680_0002124 | 3300047322 | Bacteria | 20589 |
| 943 | Ga0495680_0049724 | 3300047322 | Bacteria | 3282 |
| 944 | Ga0495680_0072047 | 3300047322 | Bacteria | 2629 |
| 945 | Ga0495683_0000106 | 3300047323 | Bacteria | 86579 |
| 946 | Ga0495683_0000151 | 3300047323 | Bacteria | 68310 |
| 947 | Ga0495683_0000410 | 3300047323 | Bacteria | 34329 |
| 948 | Ga0495683_0002897 | 3300047323 | Bacteria | 10144 |
| 949 | Ga0495683_0003257 | 3300047323 | Bacteria | 9485 |
| 950 | Ga0495683_0011473 | 3300047323 | Bacteria | 4662 |
| 951 | Ga0495683_0012445 | 3300047323 | Bacteria | 4463 |
| 952 | Ga0495683_0014707 | 3300047323 | Bacteria | 4076 |
| 953 | Ga0495683_0016934 | 3300047323 | Bacteria | 3779 |
| 954 | Ga0495683_0024966 | 3300047323 | Bacteria | 3064 |
| 955 | Ga0495683_0040265 | 3300047323 | Bacteria | 2360 |
| 956 | Ga0495683_0054064 | 3300047323 | Bacteria | 2002 |
| 957 | Ga0495683_0098501 | 3300047323 | Bacteria | 1408 |
| 958 | Ga0495683_0153463 | 3300047323 | Bacteria | 1070 |
| 959 | Ga0495687_000677 | 3300047443 | Bacteria | 38715 |
| 960 | Ga0495687_003270 | 3300047443 | Bacteria | 11941 |
| 961 | Ga0495687_003354 | 3300047443 | Bacteria | 11695 |
| 962 | Ga0495687_005605 | 3300047443 | Bacteria | 7938 |
| 963 | Ga0495687_011366 | 3300047443 | Bacteria | 4795 |
| 964 | Ga0495675_0013515 | 3300047444 | Bacteria | 5154 |
| 965 | Ga0495675_0027392 | 3300047444 | Bacteria | 3630 |
| 966 | Ga0495677_0000335 | 3300047445 | Bacteria | 20261 |
| 967 | Ga0495677_0000731 | 3300047445 | Bacteria | 13247 |
| 968 | Ga0495677_0001974 | 3300047445 | Bacteria | 8184 |
| 969 | Ga0495677_0002654 | 3300047445 | Bacteria | 6989 |
| 970 | Ga0495677_0005006 | 3300047445 | Bacteria | 5055 |
| 971 | Ga0495679_000072 | 3300047446 | Bacteria | 97319 |
| 972 | Ga0495679_000371 | 3300047446 | Bacteria | 34489 |
| 973 | Ga0495679_005683 | 3300047446 | Bacteria | 5498 |
| 974 | Ga0495679_007767 | 3300047446 | Bacteria | 4431 |
| 975 | Ga0495679_014906 | 3300047446 | Bacteria | 2861 |
| 976 | Ga0495679_019080 | 3300047446 | Bacteria | 2418 |
| 977 | Ga0495685_000093 | 3300047447 | Bacteria | 32265 |
| 978 | Ga0495685_000321 | 3300047447 | Bacteria | 15451 |
| 979 | Ga0495685_000765 | 3300047447 | Bacteria | 9816 |
| 980 | Ga0495685_079197 | 3300047447 | Bacteria | 1095 |
| 981 | Ga0495673_0001036 | 3300047469 | Bacteria | 24483 |
| 982 | Ga0495673_0001304 | 3300047469 | Bacteria | 20313 |
| 983 | Ga0495673_0001758 | 3300047469 | Bacteria | 16507 |
| 984 | Ga0495673_0001931 | 3300047469 | Bacteria | 15403 |
| 985 | Ga0495673_0003218 | 3300047469 | Bacteria | 10895 |
| 986 | Ga0495673_0003321 | 3300047469 | Bacteria | 10668 |
| 987 | Ga0495673_0003987 | 3300047469 | Bacteria | 9432 |
| 988 | Ga0495673_0006593 | 3300047469 | Bacteria | 6807 |
| 989 | Ga0495673_0006870 | 3300047469 | Bacteria | 6632 |
| 990 | Ga0495673_0010117 | 3300047469 | Bacteria | 5157 |
| 991 | Ga0495673_0011499 | 3300047469 | Bacteria | 4756 |
| 992 | Ga0495673_0012966 | 3300047469 | Bacteria | 4393 |
| 993 | Ga0495673_0013061 | 3300047469 | Bacteria | 4375 |
| 994 | Ga0495673_0013306 | 3300047469 | Bacteria | 4326 |
| 995 | Ga0495673_0016563 | 3300047469 | Bacteria | 3766 |
| 996 | Ga0495673_0017601 | 3300047469 | Bacteria | 3622 |
| 997 | Ga0495673_0027934 | 3300047469 | Bacteria | 2677 |
| 998 | Ga0495673_0028542 | 3300047469 | Bacteria | 2641 |
| 999 | Ga0495673_0049225 | 3300047469 | Bacteria | 1855 |
| 1000 | Ga0495673_0068077 | 3300047469 | Bacteria | 1505 |
| 1001 | Ga0495673_0108439 | 3300047469 | Bacteria | 1113 |
| 1002 | Ga0495681_0001943 | 3300047470 | Bacteria | 15126 |
| 1003 | Ga0495681_0006222 | 3300047470 | Bacteria | 7871 |
| 1004 | Ga0495681_0009007 | 3300047470 | Bacteria | 6194 |
| 1005 | Ga0495681_0009912 | 3300047470 | Bacteria | 5818 |
| 1006 | Ga0495681_0011533 | 3300047470 | Bacteria | 5255 |
| 1007 | Ga0495681_0014653 | 3300047470 | Bacteria | 4480 |
| 1008 | Ga0495681_0015908 | 3300047470 | Bacteria | 4244 |
| 1009 | Ga0495681_0015973 | 3300047470 | Bacteria | 4233 |
| 1010 | Ga0495681_0024598 | 3300047470 | Bacteria | 3168 |
| 1011 | Ga0495681_0032194 | 3300047470 | Bacteria | 2643 |
| 1012 | Ga0495681_0076817 | 3300047470 | Bacteria | 1500 |
| 1013 | Ga0495686_0000760 | 3300047472 | Bacteria | 42551 |
| 1014 | Ga0495686_0005668 | 3300047472 | Bacteria | 9768 |
| 1015 | Ga0495686_0017802 | 3300047472 | Bacteria | 4781 |
| 1016 | Ga0495686_0022780 | 3300047472 | Bacteria | 4139 |
| 1017 | Ga0495686_0029968 | 3300047472 | Bacteria | 3536 |
| 1018 | Ga0495593_0014912 | 3300047673 | Bacteria | 4415 |
| 1019 | Ga0495593_0166572 | 3300047673 | Bacteria | 1111 |
| 1020 | Ga0495602_0037224 | 3300048088 | Bacteria | 4518 |
| 1021 | Ga0495602_0181199 | 3300048088 | Bacteria | 1624 |
| 1022 | Ga0495626_0000136 | 3300048091 | Bacteria | 92951 |
| 1023 | Ga0495626_0001152 | 3300048091 | Bacteria | 22079 |
| 1024 | Ga0495626_0001994 | 3300048091 | Bacteria | 15067 |
| 1025 | Ga0495626_0005043 | 3300048091 | Bacteria | 7881 |
| 1026 | Ga0495626_0005509 | 3300048091 | Bacteria | 7374 |
| 1027 | Ga0495626_0006489 | 3300048091 | Bacteria | 6653 |
| 1028 | Ga0495626_0011203 | 3300048091 | Bacteria | 4749 |
| 1029 | Ga0495626_0011936 | 3300048091 | Bacteria | 4572 |
| 1030 | Ga0495626_0016919 | 3300048091 | Bacteria | 3694 |
| 1031 | Ga0495626_0018063 | 3300048091 | Bacteria | 3549 |
| 1032 | Ga0495626_0034281 | 3300048091 | Bacteria | 2429 |
| 1033 | Ga0495626_0036116 | 3300048091 | Bacteria | 2355 |
| 1034 | Ga0495626_0053294 | 3300048091 | Bacteria | 1862 |
| 1035 | Ga0495626_0093401 | 3300048091 | Bacteria | 1320 |
| 1036 | Ga0496100_0182953 | 3300048903 | Bacteria | 1516 |
| 1037 | Ga0496101_0026906 | 3300048904 | Bacteria | 4000 |
| 1038 | Ga0496102_0000987 | 3300048905 | Bacteria | 26741 |
| 1039 | Ga0496102_0027127 | 3300048905 | Bacteria | 5115 |
| 1040 | Ga0496104_0249937 | 3300048907 | Bacteria | 1686 |
| 1041 | Ga0496104_0518542 | 3300048907 | Bacteria | 1103 |
| 1042 | Ga0496106_0060993 | 3300048909 | Bacteria | 2860 |
| 1043 | Ga0496109_0008944 | 3300048912 | Bacteria | 8531 |
| 1044 | Ga0496110_0129159 | 3300048913 | Bacteria | 2281 |
| 1045 | Ga0496110_0303535 | 3300048913 | Bacteria | 1454 |
| 1046 | Ga0496111_0226914 | 3300048914 | Bacteria | 1387 |
| 1047 | Ga0496112_0096422 | 3300048915 | Bacteria | 2928 |
| 1048 | Ga0496112_0105057 | 3300048915 | Bacteria | 2794 |
| 1049 | Ga0496112_0329313 | 3300048915 | Bacteria | 1471 |
| 1050 | Ga0496113_0057538 | 3300048916 | Bacteria | 2922 |
| 1051 | Ga0496114_0002048 | 3300048917 | Bacteria | 15360 |
| 1052 | Ga0496116_0000330 | 3300048919 | Bacteria | 76562 |
| 1053 | Ga0496116_0002606 | 3300048919 | Bacteria | 18739 |
| 1054 | Ga0496116_0002665 | 3300048919 | Bacteria | 18476 |
| 1055 | Ga0496116_0007076 | 3300048919 | Bacteria | 10046 |
| 1056 | Ga0496116_0011087 | 3300048919 | Bacteria | 7497 |
| 1057 | Ga0496117_0000527 | 3300048920 | Bacteria | 62825 |
| 1058 | Ga0496117_0000567 | 3300048920 | Bacteria | 60752 |
| 1059 | Ga0496117_0001165 | 3300048920 | Bacteria | 39528 |
| 1060 | Ga0496117_0001362 | 3300048920 | Bacteria | 35647 |
| 1061 | Ga0496117_0004152 | 3300048920 | Bacteria | 16187 |
| 1062 | Ga0496117_0037297 | 3300048920 | Bacteria | 3622 |
| 1063 | Ga0496117_0040363 | 3300048920 | Bacteria | 3433 |
| 1064 | Ga0496117_0044538 | 3300048920 | Bacteria | 3213 |
| 1065 | Ga0496117_0051631 | 3300048920 | Bacteria | 2905 |
| 1066 | Ga0496117_0068112 | 3300048920 | Bacteria | 2405 |
| 1067 | Ga0496118_0002142 | 3300048921 | Bacteria | 27564 |
| 1068 | Ga0496118_0003917 | 3300048921 | Bacteria | 18224 |
| 1069 | Ga0496118_0025404 | 3300048921 | Bacteria | 5082 |
| 1070 | Ga0496118_0038459 | 3300048921 | Bacteria | 3834 |
| 1071 | Ga0496118_0054905 | 3300048921 | Bacteria | 3012 |
| 1072 | Ga0496118_0064855 | 3300048921 | Bacteria | 2677 |
| 1073 | Ga0496118_0069590 | 3300048921 | Bacteria | 2547 |
| 1074 | Ga0496118_0198199 | 3300048921 | Bacteria | 1192 |
| 1075 | Ga0496119_0019596 | 3300048922 | Bacteria | 4971 |
| 1076 | Ga0496119_0041808 | 3300048922 | Bacteria | 2913 |
| 1077 | Ga0496119_0049968 | 3300048922 | Bacteria | 2581 |
| 1078 | Ga0496120_0006160 | 3300048923 | Bacteria | 9290 |
| 1079 | Ga0496120_0009103 | 3300048923 | Bacteria | 7088 |
| 1080 | Ga0496121_0001040 | 3300048924 | Bacteria | 49445 |
| 1081 | Ga0496121_0001212 | 3300048924 | Bacteria | 44964 |
| 1082 | Ga0496121_0002253 | 3300048924 | Bacteria | 30075 |
| 1083 | Ga0496121_0034375 | 3300048924 | Bacteria | 4563 |
| 1084 | Ga0496121_0051009 | 3300048924 | Bacteria | 3489 |
| 1085 | Ga0496121_0052494 | 3300048924 | Bacteria | 3423 |
| 1086 | Ga0496121_0053873 | 3300048924 | Bacteria | 3367 |
| 1087 | Ga0496121_0076698 | 3300048924 | Bacteria | 2664 |
| 1088 | Ga0496121_0089990 | 3300048924 | Bacteria | 2401 |
| 1089 | Ga0496121_0196898 | 3300048924 | Bacteria | 1440 |
| 1090 | Ga0496122_0000279 | 3300048925 | Bacteria | 114185 |
| 1091 | Ga0496122_0000398 | 3300048925 | Bacteria | 92491 |
| 1092 | Ga0496122_0001015 | 3300048925 | Bacteria | 49681 |
| 1093 | Ga0496122_0003408 | 3300048925 | Bacteria | 20918 |
| 1094 | Ga0496122_0006658 | 3300048925 | Bacteria | 13169 |
| 1095 | Ga0496122_0024406 | 3300048925 | Bacteria | 5291 |
| 1096 | Ga0496122_0026026 | 3300048925 | Bacteria | 5061 |
| 1097 | Ga0496122_0028603 | 3300048925 | Bacteria | 4723 |
| 1098 | Ga0496122_0041561 | 3300048925 | Bacteria | 3633 |
| 1099 | Ga0496122_0072135 | 3300048925 | Bacteria | 2456 |
| 1100 | Ga0496122_0241173 | 3300048925 | Bacteria | 1019 |
| 1101 | Ga0496123_0000146 | 3300048926 | Bacteria | 143990 |
| 1102 | Ga0496123_0000302 | 3300048926 | Bacteria | 95750 |
| 1103 | Ga0496123_0000466 | 3300048926 | Bacteria | 70916 |
| 1104 | Ga0496123_0000554 | 3300048926 | Bacteria | 64040 |
| 1105 | Ga0496123_0057979 | 3300048926 | Bacteria | 2516 |
| 1106 | Ga0496123_0109531 | 3300048926 | Bacteria | 1582 |
| 1107 | Ga0496124_0000144 | 3300048927 | Bacteria | 146921 |
| 1108 | Ga0496124_0001865 | 3300048927 | Bacteria | 28997 |
| 1109 | Ga0496124_0006360 | 3300048927 | Bacteria | 12890 |
| 1110 | Ga0496124_0008084 | 3300048927 | Bacteria | 11057 |
| 1111 | Ga0496124_0026258 | 3300048927 | Bacteria | 5256 |
| 1112 | Ga0496124_0040447 | 3300048927 | Bacteria | 4031 |
| 1113 | Ga0496124_0042381 | 3300048927 | Bacteria | 3920 |
| 1114 | Ga0496124_0049633 | 3300048927 | Bacteria | 3579 |
| 1115 | Ga0496124_0083664 | 3300048927 | Bacteria | 2617 |
| 1116 | Ga0496124_0094115 | 3300048927 | Bacteria | 2437 |
| 1117 | Ga0496124_0125085 | 3300048927 | Bacteria | 2049 |
| 1118 | Ga0496124_0227711 | 3300048927 | Bacteria | 1396 |
| 1119 | Ga0496125_0000080 | 3300048928 | Bacteria | 228514 |
| 1120 | Ga0496125_0000849 | 3300048928 | Bacteria | 49007 |
| 1121 | Ga0496125_0001556 | 3300048928 | Bacteria | 32734 |
| 1122 | Ga0496125_0032993 | 3300048928 | Bacteria | 4589 |
| 1123 | Ga0496125_0038704 | 3300048928 | Bacteria | 4120 |
| 1124 | Ga0496125_0041788 | 3300048928 | Bacteria | 3914 |
| 1125 | Ga0496125_0060215 | 3300048928 | Bacteria | 3053 |
| 1126 | Ga0496125_0092224 | 3300048928 | Bacteria | 2265 |
| 1127 | Ga0496125_0109736 | 3300048928 | Bacteria | 2002 |
| 1128 | Ga0496126_0085761 | 3300048929 | Bacteria | 2776 |
| 1129 | Ga0496126_0154949 | 3300048929 | Bacteria | 1961 |
| 1130 | Ga0496126_0204453 | 3300048929 | Bacteria | 1665 |
| 1131 | Ga0496126_0363408 | 3300048929 | Bacteria | 1182 |
| 1132 | Ga0495678_000236 | 3300049459 | Bacteria | 62303 |
| 1133 | Ga0495678_001575 | 3300049459 | Bacteria | 17522 |
| 1134 | Ga0495678_002660 | 3300049459 | Bacteria | 11833 |
| 1135 | Ga0495678_003098 | 3300049459 | Bacteria | 10533 |
| 1136 | Ga0495678_004037 | 3300049459 | Bacteria | 8726 |
| 1137 | Ga0495678_006832 | 3300049459 | Bacteria | 6002 |
| 1138 | Ga0495678_007299 | 3300049459 | Bacteria | 5747 |
| 1139 | Ga0495678_007379 | 3300049459 | Bacteria | 5707 |
| 1140 | Ga0495678_009517 | 3300049459 | Bacteria | 4801 |
| 1141 | Ga0495678_015168 | 3300049459 | Bacteria | 3556 |
| 1142 | Ga0495678_016449 | 3300049459 | Bacteria | 3382 |
| 1143 | Ga0495678_017589 | 3300049459 | Bacteria | 3233 |
| 1144 | Ga0495678_019502 | 3300049459 | Bacteria | 3024 |
| 1145 | Ga0495678_043711 | 3300049459 | Bacteria | 1777 |
| 1146 | Ga0495682_0000121 | 3300049460 | Bacteria | 68179 |
| 1147 | Ga0495682_0000195 | 3300049460 | Bacteria | 48762 |
| 1148 | Ga0495682_0000288 | 3300049460 | Bacteria | 38984 |
| 1149 | Ga0495682_0000726 | 3300049460 | Bacteria | 21381 |
| 1150 | Ga0495682_0002163 | 3300049460 | Bacteria | 9515 |
| 1151 | Ga0495682_0007490 | 3300049460 | Bacteria | 4337 |
| 1152 | Ga0495682_0009683 | 3300049460 | Bacteria | 3753 |
| 1153 | Ga0495682_0014355 | 3300049460 | Bacteria | 3005 |
| 1154 | Ga0495682_0017829 | 3300049460 | Bacteria | 2675 |
| 1155 | Ga0495682_0028633 | 3300049460 | Bacteria | 2063 |
| 1156 | Ga0495682_0043747 | 3300049460 | Bacteria | 1640 |
| 1157 | Ga0501032_0012658 | 3300049569 | Bacteria | 6016 |
| 1158 | Ga0501034_0122144 | 3300049571 | Bacteria | 2591 |
| 1159 | Ga0501230_002121 | 3300049667 | Bacteria | 2496 |
| 1160 | Ga0495601_0018644 | 3300053077 | Bacteria | 4225 |
| 1161 | Ga0500572_027512 | 3300053111 | Bacteria | 1558 |
| 1162 | Ga0500595_000637 | 3300053119 | Bacteria | 21015 |
| 1163 | Ga0500618_020449 | 3300053125 | Bacteria | 1621 |
| 1164 | Ga0500574_001395 | 3300053141 | Bacteria | 3580 |
| 1165 | 2510310126 | 2510065058 | Bacteria | 5005894 |
| 1166 | 2511254145 | 2511231004 | Bacteria | 6669789 |
| 1167 | 2511268943 | 2511231006 | Bacteria | 6794709 |
| 1168 | 2511274703 | 2511231007 | Bacteria | 6306603 |
| 1169 | 2511277534 | 2511231008 | Bacteria | 6624100 |
| 1170 | 2511289290 | 2511231010 | Bacteria | 6373152 |
| 1171 | 2511295467 | 2511231011 | Bacteria | 6149768 |
| 1172 | 2511302239 | 2511231012 | Bacteria | 6738011 |
| 1173 | 2511314454 | 2511231014 | Bacteria | 6462302 |
| 1174 | 2511321682 | 2511231015 | Bacteria | 6598026 |
| 1175 | 2511324950 | 2511231016 | Bacteria | 6704427 |
| 1176 | 2511333564 | 2511231017 | Bacteria | 6503007 |
| 1177 | 2511336945 | 2511231018 | Bacteria | 6436256 |
| 1178 | 2511347602 | 2511231019 | Bacteria | 6520662 |
| 1179 | 2511350635 | 2511231020 | Bacteria | 6115223 |
| 1180 | 2511358598 | 2511231021 | Bacteria | 7302637 |
| 1181 | 2511366363 | 2511231022 | Bacteria | 6719296 |
| 1182 | 2511369914 | 2511231023 | Bacteria | 6808468 |
| 1183 | 2511373967 | 2511231024 | Bacteria | 5835885 |
| 1184 | 2511413401 | 2511231031 | Bacteria | 6558529 |
| 1185 | 2511827518 | 2511231156 | Bacteria | 6845832 |
| 1186 | 2512323905 | 2512047018 | Bacteria | 6663241 |
| 1187 | 2514045089 | 2513237165 | Bacteria | 6771773 |
| 1188 | 2555672716 | 2554235341 | Bacteria | 6867980 |
| 1189 | 2583795065 | 2582580891 | Bacteria | 6800976 |
| 1190 | 2597860769 | 2597489887 | Bacteria | 6666321 |
| 1191 | 2597866513 | 2597489888 | Bacteria | 6179543 |
| 1192 | 2599327410 | 2599185155 | Bacteria | 5827168 |
| 1193 | 2599356081 | 2599185160 | Bacteria | 6844013 |
| 1194 | 2599362519 | 2599185161 | Bacteria | 6960462 |
| 1195 | 2599369175 | 2599185162 | Bacteria | 6957254 |
| 1196 | 2599375628 | 2599185163 | Bacteria | 6995158 |
| 1197 | 2599381187 | 2599185164 | Bacteria | 6841688 |
| 1198 | 2599387297 | 2599185165 | Bacteria | 6843250 |
| 1199 | 2599394486 | 2599185166 | Bacteria | 6959206 |
| 1200 | 2599400658 | 2599185167 | Bacteria | 6353609 |
| 1201 | 2599406251 | 2599185168 | Bacteria | 6997636 |
| 1202 | 2599449984 | 2599185179 | Bacteria | 6611171 |
| 1203 | 2599462915 | 2599185181 | Bacteria | 6844519 |
| 1204 | 2599467664 | 2599185182 | Bacteria | 6883168 |
| 1205 | 2599485997 | 2599185185 | Bacteria | 6652270 |
| 1206 | 2599491932 | 2599185186 | Bacteria | 6831633 |
| 1207 | 2599502539 | 2599185188 | Bacteria | 6164180 |
| 1208 | 2599505640 | 2599185189 | Bacteria | 5862825 |
| 1209 | 2599512058 | 2599185190 | Bacteria | 6285678 |
| 1210 | 2599517039 | 2599185191 | Bacteria | 6297582 |
| 1211 | 2599616199 | 2599185212 | Bacteria | 6765997 |
| 1212 | 2599768279 | 2599185248 | Bacteria | 6696816 |
| 1213 | 2599804779 | 2599185257 | Bacteria | 6492581 |
| 1214 | 2599878923 | 2599185288 | Bacteria | 6666191 |
| 1215 | 2599885707 | 2599185289 | Bacteria | 6778765 |
| 1216 | 2599892580 | 2599185290 | Bacteria | 6289611 |
| 1217 | 2599897421 | 2599185291 | Bacteria | 6775623 |
| 1218 | 2599934183 | 2599185300 | Bacteria | 6062622 |
| 1219 | 2599942434 | 2599185302 | Bacteria | 5954930 |
| 1220 | 2599950873 | 2599185303 | Bacteria | 6512725 |
| 1221 | 2599954153 | 2599185304 | Bacteria | 5951361 |
| 1222 | 2599963724 | 2599185305 | Bacteria | 6748700 |
| 1223 | 2599967673 | 2599185306 | Bacteria | 6637356 |
| 1224 | 2599973540 | 2599185307 | Bacteria | 6194719 |
| 1225 | 2599979957 | 2599185308 | Bacteria | 6621546 |
| 1226 | 2599983004 | 2599185309 | Bacteria | 5969593 |
| 1227 | 2599988246 | 2599185310 | Bacteria | 6014457 |
| 1228 | 2599993900 | 2599185311 | Bacteria | 6354990 |
| 1229 | 2599999034 | 2599185312 | Bacteria | 5912071 |
| 1230 | 2600004440 | 2599185313 | Bacteria | 6658188 |
| 1231 | 2600013747 | 2599185314 | Bacteria | 6621749 |
| 1232 | 2600021347 | 2599185315 | Bacteria | 6771107 |
| 1233 | 2600024409 | 2599185316 | Bacteria | 6320029 |
| 1234 | 2600030417 | 2599185317 | Bacteria | 6435722 |
| 1235 | 2600038507 | 2599185318 | Bacteria | 6961590 |
| 1236 | 2600042248 | 2599185319 | Bacteria | 6637840 |
| 1237 | 2600046572 | 2599185320 | Bacteria | 5963263 |
| 1238 | 2600056420 | 2599185321 | Bacteria | 6764560 |
| 1239 | 2600062494 | 2599185322 | Bacteria | 6763055 |
| 1240 | 2600066458 | 2599185323 | Bacteria | 6688755 |
| 1241 | 2600072806 | 2599185324 | Bacteria | 6590677 |
| 1242 | 2600076658 | 2599185325 | Bacteria | 6324919 |
| 1243 | 2600215541 | 2599185356 | Bacteria | 6843884 |
| 1244 | 2600359112 | 2600254930 | Bacteria | 6431253 |
| 1245 | 2600366457 | 2600254931 | Bacteria | 6734225 |
| 1246 | 2600444241 | 2600254954 | Bacteria | 5100516 |
| 1247 | 2601628376 | 2600255283 | Bacteria | 6061572 |
| 1248 | 2601693555 | 2600255296 | Bacteria | 5784754 |
| 1249 | 2601775707 | 2600255313 | Bacteria | 6842543 |
| 1250 | 2601798677 | 2600255318 | Bacteria | 6383414 |
| 1251 | 2602008280 | 2600255389 | Bacteria | 5275336 |
| 1252 | 2606077571 | 2603880185 | Bacteria | 6379190 |
| 1253 | 2606129183 | 2603880199 | Bacteria | 6377649 |
| 1254 | 2621296959 | 2619619299 | Bacteria | 6649820 |
| 1255 | 2624483296 | 2623620443 | Bacteria | 6427864 |
| 1256 | 2624494815 | 2623620446 | Bacteria | 6500345 |
| 1257 | 2643842851 | 2643221565 | Bacteria | 6216018 |
| 1258 | 2643955751 | 2643221589 | Bacteria | 6250934 |
| 1259 | 2644020545 | 2643221602 | Bacteria | 6249926 |
| 1260 | 2644184606 | 2643221633 | Bacteria | 6733554 |
| 1261 | 2644283317 | 2643221650 | Bacteria | 7029547 |
| 1262 | 2652547160 | 2651869719 | Bacteria | 6047974 |
| 1263 | 2671089429 | 2667528170 | Bacteria | 6786960 |
| 1264 | 2671099158 | 2667528171 | Bacteria | 6900659 |
| 1265 | 2671128704 | 2667528176 | Bacteria | 6724917 |
| 1266 | 2671771786 | 2671180172 | Bacteria | 6495783 |
| 1267 | 2677897009 | 2675903420 | Bacteria | 6247433 |
| 1268 | 2678230927 | 2675903507 | Bacteria | 3737791 |
| 1269 | 2678266028 | 2675903515 | Bacteria | 6580491 |
| 1270 | 2715749948 | 2713897148 | Bacteria | 5883533 |
| 1271 | 2715756338 | 2713897149 | Bacteria | 6506249 |
| 1272 | 2718636496 | 2718217725 | Bacteria | 5758958 |
| 1273 | 2723251254 | 2721755607 | Bacteria | 5841722 |
| 1274 | 2738671780 | 2738541265 | Bacteria | 6594665 |
| 1275 | 2738690165 | 2738541271 | Bacteria | 5657310 |
| 1276 | 2738740449 | 2738541280 | Bacteria | 6630198 |
| 1277 | 2738750174 | 2738541282 | Bacteria | 6593925 |
| 1278 | 2738807140 | 2738541294 | Bacteria | 6925949 |
| 1279 | 2738843298 | 2738541300 | Bacteria | 6675882 |
| 1280 | 2738859214 | 2738541303 | Bacteria | 6591772 |
| 1281 | 2738894500 | 2738541309 | Bacteria | 6926455 |
| 1282 | 2739198940 | 2738543004 | Bacteria | 6381073 |
| 1283 | 2739258884 | 2738543015 | Bacteria | 6750701 |
| 1284 | 2739265939 | 2738543016 | Bacteria | 5657564 |
| 1285 | 2739275627 | 2738543018 | Bacteria | 6718814 |
| 1286 | 2739312626 | 2738543025 | Bacteria | 6600348 |
| 1287 | 2739344671 | 2738543030 | Bacteria | 6719714 |
| 1288 | 2745007260 | 2744054620 | Bacteria | 6551379 |
| 1289 | 2765584159 | 2765235841 | Bacteria | 6137024 |
| 1290 | 2774118501 | 2773857670 | Bacteria | 6407454 |
| 1291 | 2774129821 | 2773857672 | Bacteria | 4993178 |
| 1292 | 2774135688 | 2773857673 | Bacteria | 6513460 |
| 1293 | 2774388526 | 2773857761 | Bacteria | 3837365 |
| 1294 | 2774438820 | 2773857770 | Bacteria | 3911866 |
| 1295 | 2784261938 | 2784132063 | Bacteria | 6262788 |
| 1296 | 2784313174 | 2784132072 | Bacteria | 6596533 |
| 1297 | 2794598720 | 2791355520 | Bacteria | 5948615 |
| 1298 | 2808855408 | 2808606361 | Bacteria | 6136259 |
| 1299 | 2808925406 | 2808606376 | Bacteria | 6248667 |
| 1300 | 2808928562 | 2808606377 | Bacteria | 6646337 |
| 1301 | 2808935305 | 2808606378 | Bacteria | 6177535 |
| 1302 | 2808941583 | 2808606379 | Bacteria | 5022697 |
| 1303 | 2808947502 | 2808606380 | Bacteria | 6248705 |
| 1304 | 2808950255 | 2808606381 | Bacteria | 6646461 |
| 1305 | 2808958868 | 2808606382 | Bacteria | 6841132 |
| 1306 | 2808963913 | 2808606383 | Bacteria | 6138645 |
| 1307 | 2808998801 | 2808606389 | Bacteria | 6138126 |
| 1308 | 2809143599 | 2808606418 | Bacteria | 6724496 |
| 1309 | 2809217067 | 2808606445 | Bacteria | 6057339 |
| 1310 | 2812369957 | 2811994881 | Bacteria | 6298475 |
| 1311 | 2817493927 | 2816332298 | Bacteria | 6852809 |
| 1312 | 2819655014 | 2818991456 | Bacteria | 6123676 |
| 1313 | 2819704280 | 2818991464 | Bacteria | 6907494 |
| 1314 | 2825655215 | 2825651385 | Bacteria | 6715909 |
| 1315 | 2826586863 | 2826581358 | Bacteria | 5963467 |
| 1316 | 2842816681 | 2842815866 | Bacteria | 5947510 |
| 1317 | 2842831449 | 2842826826 | Bacteria | 5974129 |
| 1318 | 2842833348 | 2842832357 | Bacteria | 5959113 |
| 1319 | 2842842960 | 2842837860 | Bacteria | 6066181 |
| 1320 | 2842845576 | 2842843487 | Bacteria | 6004777 |
| 1321 | 2842852271 | 2842849001 | Bacteria | 5924277 |
| 1322 | 2842855502 | 2842854478 | Bacteria | 6143501 |
| 1323 | 2844666890 | 2844665904 | Bacteria | 6817974 |
| 1324 | 2852661866 | 2852657418 | Bacteria | 6472974 |
| 1325 | 2857576452 | 2857576091 | Bacteria | 5465855 |
| 1326 | 2860341599 | 2860339153 | Bacteria | 6846989 |
| 1327 | 2878035236 | 2878029506 | Bacteria | 6418441 |
| 1328 | 2880235878 | 2880230671 | Bacteria | 6140320 |
| 1329 | 2901302770 | 2901300506 | Bacteria | 8463898 |
| 1330 | 2904519074 | 2904518522 | Bacteria | 6068986 |
| 1331 | 2904551248 | 2904550169 | Bacteria | 6221258 |
| 1332 | 2908452458 | 2908446538 | Bacteria | 6829095 |
| 1333 | 2917076610 | 2917070673 | Bacteria | 6868303 |
| 1334 | 2917832751 | 2917832318 | Bacteria | 5346010 |
| 1335 | 2919065636 | 2919063839 | Bacteria | 6302690 |
| 1336 | 2919125547 | 2919125081 | Bacteria | 5385106 |
| 1337 | 2919183838 | 2919182534 | Bacteria | 3907101 |
| 1338 | 2919389304 | 2919385768 | Bacteria | 5897293 |
| 1339 | 2919457428 | 2919456309 | Bacteria | 6586567 |
| 1340 | 2919477583 | 2919476304 | Bacteria | 5888696 |
| 1341 | 2919485563 | 2919481497 | Bacteria | 6907839 |
| 1342 | 2919488280 | 2919487758 | Bacteria | 5929766 |
| 1343 | 2919502641 | 2919501602 | Bacteria | 5286340 |
| 1344 | 2919700692 | 2919697872 | Bacteria | 6553725 |
| 1345 | 2923524043 | 2923519811 | Bacteria | 6298479 |
| 1346 | 2926064314 | 2926063275 | Bacteria | 5285848 |
| 1347 | 2929149833 | 2929144301 | Bacteria | 6622272 |
| 1348 | 2931372764 | 2931369376 | Bacteria | 6847892 |
| 1349 | 2931396297 | 2931390751 | Bacteria | 6273349 |
| 1350 | 2931397951 | 2931396565 | Bacteria | 7251677 |
| 1351 | 2935358423 | 2935353572 | Unclassified | 6955622 |
| 1352 | 2939640921 | 2939636861 | Bacteria | 6297853 |
| 1353 | 2945931029 | 2945928738 | Bacteria | 6053221 |
| 1354 | 2945966729 | 2945961074 | Bacteria | 7342064 |
| 1355 | 2946027789 | 2946027586 | Bacteria | 6049274 |
| 1356 | 2969310057 | 2969304461 | Bacteria | 6601805 |
| 1357 | 2974294194 | 2974289157 | Bacteria | 6080362 |
| 1358 | 2984286725 | 2984286254 | Bacteria | 6702062 |
| 1359 | 2984502638 | 2984499530 | Bacteria | 5020881 |
| 1360 | 2984508738 | 2984504281 | Bacteria | 5262371 |
| 1361 | 2984569560 | 2984568884 | Bacteria | 3884413 |
| 1362 | 2988731372 | 2988728565 | Bacteria | 6124362 |
| 1363 | 2998145282 | 2998139840 | Bacteria | 6073514 |
| 1364 | 3007256238 | 3007252601 | Bacteria | 4559114 |
| 1365 | 3007319579 | 3007315729 | Bacteria | 5076637 |
| 1366 | 3007399514 | 3007395558 | Bacteria | 6755444 |
| 1367 | 3007517066 | 3007511990 | Bacteria | 6481491 |
| 1368 | 3007618836 | 3007614139 | Bacteria | 6053559 |
| 1369 | 3007624252 | 3007619802 | Bacteria | 6411688 |
| 1370 | 3007809122 | 3007803356 | Bacteria | 5931491 |
| 1371 | 3007858208 | 3007855910 | Bacteria | 5637581 |
| 1372 | 3007865215 | 3007861166 | Bacteria | 6045338 |
| 1373 | 3007875169 | 3007872151 | Bacteria | 5268868 |
| 1374 | 637323152 | 637000220 | Bacteria | 7074893 |
| 1375 | 8016728978 | 8016728285 | Bacteria | 5263933 |
| 1376 | 8019769890 | 8019769354 | Bacteria | 6924660 |
| 1377 | 8019777799 | 8019775933 | Bacteria | 6858656 |
| 1378 | 8029995619 | 8029995093 | Bacteria | 5990776 |
| 1379 | 8033234676 | 8033232454 | Bacteria | 3202805 |
| 1380 | 8034965223 | 8034962539 | Bacteria | 4884839 |
| 1381 | 8054349692 | 8054347763 | Bacteria | 5901107 |
| 1382 | 8055776747 | 8055770955 | Bacteria | 6827675 |
| 1383 | 8056131488 | 8056125926 | Bacteria | 6228218 |
| 1384 | 8056137197 | 8056131705 | Bacteria | 6107031 |
| 1385 | 8056140075 | 8056137416 | Bacteria | 6147080 |
| 1386 | 8056160734 | 8056155041 | Bacteria | 6486948 |
| 1387 | 8056163512 | 8056161164 | Bacteria | 6106669 |
| 1388 | 8056177525 | 8056172158 | Bacteria | 6133900 |
| 1389 | 8056181888 | 8056177738 | Bacteria | 6748268 |
| 1390 | 8057801817 | 8057798959 | Bacteria | 6713499 |
| 1391 | MRS2a_Contig_7510 | |||
| 1392 | MRS2a_Contig_816 | |||
| 1393 | SwRhRL2b_contig_1777000 | |||
| 1394 | JGI25162J39368_1000159 | |||
| 1395 | JGI25163J39215_1000156 | |||
| 1396 | JGI25163J39215_1000613 | |||
| 1397 | JGI25164J39214_1000038 | |||
| 1398 | JGI25164J39214_1000124 | |||
| 1399 | JGI25151J46595_10039458 | |||
| 1400 | JGI25165J46597_1000126 | |||
| 1401 | JGI25165J46597_1000243 | |||
| 1402 | Ga0055539_1000043 | |||
| 1403 | Ga0055533_1000052 | |||
| 1404 | Ga0055532_1000047 | |||
| 1405 | Ga0055525_1000062 | |||
| 1406 | Ga0055526_1013090 | |||
| 1407 | Ga0055537_1011285 | |||
| 1408 | Ga0055524_1000639 | |||
| 1409 | Ga0055534_1001966 | |||
| 1410 | Ga0055530_10000242 | |||
| 1411 | Ga0055530_10000535 | |||
| 1412 | Ga0055530_10000966 | |||
| 1413 | Ga0055540_1000178 | |||
| 1414 | Ga0055540_1000250 | |||
| 1415 | Ga0055540_1000896 | |||
| 1416 | Ga0055531_10000243 | |||
| 1417 | Ga0055541_1000030 | |||
| 1418 | Ga0065714_10000303 | |||
| 1419 | Ga0065714_10010148 | |||
| 1420 | Ga0065714_10013730 | |||
| 1421 | Ga0065714_10014293 | |||
| 1422 | Ga0065714_10093135 | |||
| 1423 | Ga0065704_10040264 | |||
| 1424 | Ga0065704_10073188 | |||
| 1425 | Ga0065704_10117174 | |||
| 1426 | Ga0065712_10068623 | |||
| 1427 | Ga0065715_10020516 | |||
| 1428 | Ga0070670_100000567 | |||
| 1429 | Ga0070670_100000599 | |||
| 1430 | Ga0068869_100254349 | |||
| 1431 | Ga0068868_100107158 | |||
| 1432 | Ga0070669_100000963 | |||
| 1433 | Ga0070669_100001975 | |||
| 1434 | Ga0070671_100046498 | |||
| 1435 | Ga0070673_100297792 | |||
| 1436 | Ga0070673_100317598 | |||
| 1437 | Ga0070659_100070588 | |||
| 1438 | Ga0070678_100101454 | |||
| 1439 | Ga0070678_100172045 | |||
| 1440 | Ga0070662_100012513 | |||
| 1441 | Ga0070662_100030517 | |||
| 1442 | Ga0070662_100345694 | |||
| 1443 | Ga0068853_100000448 | |||
| 1444 | Ga0068853_100008600 | |||
| 1445 | Ga0070665_100043300 | |||
| 1446 | Ga0070664_100395160 | |||
| 1447 | Ga0068851_10000012 | |||
| 1448 | Ga0075364_10032918 | |||
| 1449 | Ga0075364_10145993 | |||
| 1450 | Ga0075432_10000124 | |||
| 1451 | Ga0075432_10017844 | |||
| 1452 | Ga0075432_10047640 | |||
| 1453 | Ga0075432_10050633 | |||
| 1454 | Ga0075362_10012105 | |||
| 1455 | Ga0068871_100292310 | |||
| 1456 | Ga0079104_1000133 | |||
| 1457 | Ga0079104_1000158 | |||
| 1458 | Ga0079104_1018453 | |||
| 1459 | Ga0079104_1040675 | |||
| 1460 | Ga0079104_1045630 | |||
| 1461 | Ga0099826_10000009 | |||
| 1462 | Ga0099826_10010680 | |||
| 1463 | Ga0105251_10001928 | |||
| 1464 | Ga0105251_10002313 | |||
| 1465 | Ga0105251_10008346 | |||
| 1466 | Ga0105251_10014124 | |||
| 1467 | Ga0105251_10040228 | |||
| 1468 | Ga0105251_10072078 | |||
| 1469 | Ga0105251_10109960 | |||
| 1470 | Ga0105251_10203879 | |||
| 1471 | Ga0105244_10000578 | |||
| 1472 | Ga0105244_10004114 | |||
| 1473 | Ga0105244_10005547 | |||
| 1474 | Ga0105244_10008160 | |||
| 1475 | Ga0105244_10010492 | |||
| 1476 | Ga0105244_10017241 | |||
| 1477 | Ga0105244_10018822 | |||
| 1478 | Ga0105244_10027263 | |||
| 1479 | Ga0105244_10045877 | |||
| 1480 | Ga0105244_10049891 | |||
| 1481 | Ga0105244_10051319 | |||
| 1482 | Ga0105244_10059386 | |||
| 1483 | Ga0105244_10063608 | |||
| 1484 | Ga0105244_10077973 | |||
| 1485 | Ga0105244_10088012 | |||
| 1486 | Ga0105250_10001478 | |||
| 1487 | Ga0105250_10003707 | |||
| 1488 | Ga0105250_10004553 | |||
| 1489 | Ga0105250_10039943 | |||
| 1490 | Ga0105250_10041819 | |||
| 1491 | Ga0105250_10098898 | |||
| 1492 | Ga0105250_10123936 | |||
| 1493 | Ga0105250_10178042 | |||
| 1494 | Ga0105240_10036334 | |||
| 1495 | Ga0105245_10200818 | |||
| 1496 | Ga0105243_10000327 | |||
| 1497 | Ga0105243_10000757 | |||
| 1498 | Ga0105243_10020164 | |||
| 1499 | Ga0105243_10029005 | |||
| 1500 | Ga0105243_10039068 | |||
| 1501 | Ga0105243_10070908 | |||
| 1502 | Ga0105243_10285199 | |||
| 1503 | Ga0105242_10168199 | |||
| 1504 | Ga0105237_10001290 | |||
| 1505 | Ga0105237_10442651 | |||
| 1506 | Ga0105238_10025795 | |||
| 1507 | Ga0105239_10027896 | |||
| 1508 | Ga0105239_10311525 | |||
| 1509 | Ga0105246_10019133 | |||
| 1510 | Ga0105246_10024872 | |||
| 1511 | Ga0157345_1000113 | |||
| 1512 | Ga0157373_10006015 | |||
| 1513 | Ga0157373_10011468 | |||
| 1514 | Ga0157373_10076312 | |||
| 1515 | Ga0157373_10150041 | |||
| 1516 | Ga0157373_10157716 | |||
| 1517 | Ga0157373_10158960 | |||
| 1518 | Ga0157373_10161052 | |||
| 1519 | Ga0157373_10182517 | |||
| 1520 | Ga0157373_10244529 | |||
| 1521 | Ga0157371_10000131 | |||
| 1522 | Ga0157371_10000870 | |||
| 1523 | Ga0157371_10001015 | |||
| 1524 | Ga0157370_10031525 | |||
| 1525 | Ga0157370_10502491 | |||
| 1526 | Ga0157369_10003054 | |||
| 1527 | Ga0157369_10019315 | |||
| 1528 | Ga0157369_10025398 | |||
| 1529 | Ga0157369_10426156 | |||
| 1530 | Ga0157378_10031436 | |||
| 1531 | Ga0163162_10004799 | |||
| 1532 | Ga0163162_10884283 | |||
| 1533 | Ga0157372_10049668 | |||
| 1534 | Ga0157375_10121839 | |||
| 1535 | Ga0182008_10000366 | |||
| 1536 | Ga0182008_10002588 | |||
| 1537 | Ga0182008_10004328 | |||
| 1538 | Ga0182008_10007530 | |||
| 1539 | Ga0182008_10017974 | |||
| 1540 | Ga0182008_10038290 | |||
| 1541 | Ga0182006_1003374 | |||
| 1542 | Ga0182006_1008809 | |||
| 1543 | Ga0182006_1055848 | |||
| 1544 | Ga0182005_1007014 | |||
| 1545 | Ga0182005_1011061 | |||
| 1546 | Ga0182005_1018058 | |||
| 1547 | Ga0182005_1018813 | |||
| 1548 | Ga0163161_10003913 | |||
| 1549 | Ga0163161_10004476 | |||
| 1550 | Ga0163161_10019329 | |||
| 1551 | Ga0163161_10024786 | |||
| 1552 | Ga0163161_10053133 | |||
| 1553 | Ga0163161_10094546 | |||
| 1554 | Ga0163161_10167906 | |||
| 1555 | Ga0163161_10194872 | |||
| 1556 | Ga0163161_10215653 | |||
| 1557 | Ga0163161_10264404 | |||
| 1558 | Ga0163161_10296884 | |||
| 1559 | Ga0163161_10343754 | |||
| 1560 | Ga0209435_101472 | |||
| 1561 | Ga0209760_100036 | |||
| 1562 | Ga0209760_100115 | |||
| 1563 | Ga0209784_100007 | |||
| 1564 | Ga0209566_100009 | |||
| 1565 | Ga0209674_100021 | |||
| 1566 | Ga0209147_100009 | |||
| 1567 | Ga0209563_100018 | |||
| 1568 | Ga0209563_101205 | |||
| 1569 | Ga0207427_100004 | |||
| 1570 | Ga0207427_100005 | |||
| 1571 | Ga0209437_100018 | |||
| 1572 | Ga0209437_100025 | |||
| 1573 | Ga0209258_100365 | |||
| 1574 | Ga0209646_1000867 | |||
| 1575 | Ga0209026_1002897 | |||
| 1576 | Ga0209677_100012 | |||
| 1577 | Ga0209759_1015851 | |||
| 1578 | Ga0209233_1000021 | |||
| 1579 | Ga0209233_1000145 | |||
| 1580 | Ga0209565_1000160 | |||
| 1581 | Ga0209565_1001633 | |||
| 1582 | Ga0209675_1000406 | |||
| 1583 | Ga0209675_1001142 | |||
| 1584 | Ga0209676_1000015 | |||
| 1585 | Ga0209676_1000030 | |||
| 1586 | Ga0209676_1000041 | |||
| 1587 | Ga0209676_1002604 | |||
| 1588 | Ga0209676_1002636 | |||
| 1589 | Ga0209025_1000098 | |||
| 1590 | Ga0209025_1000527 | |||
| 1591 | Ga0209025_1001087 | |||
| 1592 | Ga0209564_1000855 | |||
| 1593 | Ga0209050_1000024 | |||
| 1594 | Ga0209050_1000075 | |||
| 1595 | Ga0209050_1000923 | |||
| 1596 | Ga0209050_1001094 | |||
| 1597 | Ga0209256_1000400 | |||
| 1598 | Ga0209256_1000452 | |||
| 1599 | Ga0209051_1000012 | |||
| 1600 | Ga0209051_1000023 | |||
| 1601 | Ga0209051_1000041 | |||
| 1602 | Ga0209051_1029449 | |||
| 1603 | Ga0209051_1069179 | |||
| 1604 | Ga0209257_1000069 | |||
| 1605 | Ga0209257_1024425 | |||
| 1606 | Ga0207656_10000006 | |||
| 1607 | Ga0207696_1000006 | |||
| 1608 | Ga0207696_1000031 | |||
| 1609 | Ga0207696_1000105 | |||
| 1610 | Ga0207696_1001194 | |||
| 1611 | Ga0207696_1002488 | |||
| 1612 | Ga0207696_1008980 | |||
| 1613 | Ga0207696_1010456 | |||
| 1614 | Ga0207696_1010611 | |||
| 1615 | Ga0207696_1071418 | |||
| 1616 | Ga0207655_1000068 | |||
| 1617 | Ga0207655_1000212 | |||
| 1618 | Ga0207655_1000249 | |||
| 1619 | Ga0207655_1000412 | |||
| 1620 | Ga0207655_1000469 | |||
| 1621 | Ga0207655_1000641 | |||
| 1622 | Ga0207655_1001720 | |||
| 1623 | Ga0207655_1002726 | |||
| 1624 | Ga0207655_1002865 | |||
| 1625 | Ga0207655_1004718 | |||
| 1626 | Ga0207655_1008251 | |||
| 1627 | Ga0207655_1011013 | |||
| 1628 | Ga0207655_1016099 | |||
| 1629 | Ga0207655_1018564 | |||
| 1630 | Ga0207655_1021009 | |||
| 1631 | Ga0207655_1036906 | |||
| 1632 | Ga0207655_1047538 | |||
| 1633 | Ga0207655_1060159 | |||
| 1634 | Ga0207713_1000077 | |||
| 1635 | Ga0207713_1000438 | |||
| 1636 | Ga0207713_1000463 | |||
| 1637 | Ga0207713_1000596 | |||
| 1638 | Ga0207713_1001118 | |||
| 1639 | Ga0207713_1002392 | |||
| 1640 | Ga0207713_1003929 | |||
| 1641 | Ga0207713_1005406 | |||
| 1642 | Ga0207713_1006267 | |||
| 1643 | Ga0207713_1006352 | |||
| 1644 | Ga0207713_1010717 | |||
| 1645 | Ga0207713_1034599 | |||
| 1646 | Ga0207713_1036693 | |||
| 1647 | Ga0207713_1041307 | |||
| 1648 | Ga0207713_1053690 | |||
| 1649 | Ga0207713_1060278 | |||
| 1650 | Ga0207713_1086742 | |||
| 1651 | Ga0207688_10105863 | |||
| 1652 | Ga0207645_10015865 | |||
| 1653 | Ga0207695_10053384 | |||
| 1654 | Ga0207671_10001788 | |||
| 1655 | Ga0207681_10000132 | |||
| 1656 | Ga0207681_10001211 | |||
| 1657 | Ga0207650_10000140 | |||
| 1658 | Ga0207650_10000512 | |||
| 1659 | Ga0207644_10200951 | |||
| 1660 | Ga0207690_10075271 | |||
| 1661 | Ga0207706_10000175 | |||
| 1662 | Ga0207706_10041412 | |||
| 1663 | Ga0207686_10107300 | |||
| 1664 | Ga0207709_10000071 | |||
| 1665 | Ga0207709_10000178 | |||
| 1666 | Ga0207709_10011052 | |||
| 1667 | Ga0207709_10033696 | |||
| 1668 | Ga0207709_10077935 | |||
| 1669 | Ga0207709_10140382 | |||
| 1670 | Ga0207709_10168329 | |||
| 1671 | Ga0207689_10200823 | |||
| 1672 | Ga0207679_10071668 | |||
| 1673 | Ga0207712_10228823 | |||
| 1674 | Ga0207639_10000857 | |||
| 1675 | Ga0207639_10038157 | |||
| 1676 | Ga0207683_10094430 | |||
| 1677 | Ga0209281_1000016 | |||
| 1678 | Ga0209281_1000019 | |||
| 1679 | Ga0209281_1004943 | |||
| 1680 | Ga0209281_1010798 | |||
| 1681 | Ga0209281_1011374 | |||
| 1682 | Ga0209371_1000006 | |||
| 1683 | Ga0209371_1000142 | |||
| 1684 | Ga0209371_1001498 | |||
| 1685 | Ga0209995_1018204 | |||
| 1686 | Ga0209968_1010304 | |||
| 1687 | Ga0209983_1009521 | |||
| 1688 | Ga0209282_1000170 | |||
| 1689 | Ga0209971_1004705 | |||
| 1690 | Ga0207428_10048031 | |||
| 1691 | Ga0207428_10073151 | |||
| 1692 | Ga0207428_10132866 | |||
| 1693 | Ga0207428_10179171 | |||
| 1694 | Ga0268266_10014191 | |||
| 1695 | Ga0268256_1000007 | |||
| 1696 | Ga0268256_1000111 | |||
| 1697 | Ga0307511_10057721 | |||
| 1698 | Ga0316179_1028803 | |||
| 1699 | Ga0316178_1012925 | |||
| 1700 | Ga0316183_1168598 | |||
| 1701 | Ga0316182_1199107 | |||
| 1702 | Ga0307408_100000002 | |||
| 1703 | Ga0307408_100003632 | |||
| 1704 | Ga0307408_100022913 | |||
| 1705 | Ga0307408_100231871 | |||
| 1706 | Ga0307516_10349905 | |||
| 1707 | Ga0307405_10013153 | |||
| 1708 | Ga0307405_10015378 | |||
| 1709 | Ga0307413_10077536 | |||
| 1710 | Ga0307407_10230521 | |||
| 1711 | Ga0307412_10001312 | |||
| 1712 | Ga0307412_10008064 | |||
| 1713 | Ga0307412_10009828 | |||
| 1714 | Ga0307412_10012538 | |||
| 1715 | Ga0307412_10073334 | |||
| 1716 | Ga0307412_10124555 | |||
| 1717 | Ga0307412_10209408 | |||
| 1718 | Ga0307409_100042978 | |||
| 1719 | Ga0307409_100196278 | |||
| 1720 | Ga0307416_100101730 | |||
| 1721 | Ga0307416_100527210 | |||
| 1722 | Ga0307414_10057181 | |||
| 1723 | Ga0307414_10062747 | |||
| 1724 | Ga0307411_10224598 | |||
| 1725 | Ga0307411_10348320 | |||
| 1726 | Ga0307510_10012366 | |||
| 1727 | Ga0373946_0200893 | |||
| 1728 | Ga0373931_0017312 | |||
| 1729 | Ga0395898_0239091 | |||
| 1730 | Ga0237819_01261 | |||
| 1731 | Ga0436361_0283231 | |||
| 1732 | Ga0436361_1216061 | |||
| 1733 | Ga0439436_0004220 | |||
| 1734 | Ga0439438_001031 | |||
| 1735 | Ga0439438_001794 | |||
| 1736 | Ga0439438_001942 | |||
| 1737 | Ga0439438_003292 | |||
| 1738 | Ga0439438_004756 | |||
| 1739 | Ga0439438_005058 | |||
| 1740 | Ga0439438_009674 | |||
| 1741 | Ga0439438_009748 | |||
| 1742 | Ga0439438_009978 | |||
| 1743 | Ga0439438_027140 | |||
| 1744 | Ga0439447_000250 | |||
| 1745 | Ga0439447_000473 | |||
| 1746 | Ga0439447_003479 | |||
| 1747 | Ga0439447_004245 | |||
| 1748 | Ga0439447_014528 | |||
| 1749 | Ga0439447_014999 | |||
| 1750 | Ga0439447_021111 | |||
| 1751 | Ga0439466_0000285 | |||
| 1752 | Ga0439466_0000469 | |||
| 1753 | Ga0439466_0002434 | |||
| 1754 | Ga0439466_0067166 | |||
| 1755 | Ga0439432_001028 | |||
| 1756 | Ga0439432_001875 | |||
| 1757 | Ga0439432_007235 | |||
| 1758 | Ga0439432_014207 | |||
| 1759 | Ga0439451_001838 | |||
| 1760 | Ga0439452_000170 | |||
| 1761 | Ga0439452_000579 | |||
| 1762 | Ga0439452_001392 | |||
| 1763 | Ga0439452_001470 | |||
| 1764 | Ga0439452_003202 | |||
| 1765 | Ga0439452_026792 | |||
| 1766 | Ga0439456_003065 | |||
| 1767 | Ga0439456_003388 | |||
| 1768 | Ga0439456_004435 | |||
| 1769 | Ga0439463_000840 | |||
| 1770 | Ga0439463_001884 | |||
| 1771 | Ga0450911_000977 | |||
| 1772 | Ga0450911_001425 | |||
| 1773 | Ga0450923_008683 | |||
| 1774 | Ga0450898_035734 | |||
| 1775 | Ga0450903_001628 | |||
| 1776 | Ga0450904_000679 | |||
| 1777 | Ga0450904_004753 | |||
| 1778 | Ga0450906_001535 | |||
| 1779 | Ga0450906_007730 | |||
| 1780 | Ga0450907_000115 | |||
| 1781 | Ga0450907_002448 | |||
| 1782 | Ga0450907_008326 | |||
| 1783 | Ga0450910_000503 | |||
| 1784 | Ga0439446_0001469 | |||
| 1785 | Ga0439446_0006297 | |||
| 1786 | Ga0439446_0029699 | |||
| 1787 | Ga0450908_020737 | |||
| 1788 | Ga0450909_000120 | |||
| 1789 | Ga0450909_001343 | |||
| 1790 | Ga0439434_0000211 | |||
| 1791 | Ga0439434_0008481 | |||
| 1792 | Ga0439464_0009432 | |||
| 1793 | Ga0439440_0000155 | |||
| 1794 | Ga0439440_0002765 | |||
| 1795 | Ga0466961_0006453 | |||
| 1796 | Ga0495617_000290 | |||
| 1797 | Ga0495617_001022 | |||
| 1798 | Ga0495617_007496 | |||
| 1799 | Ga0495617_008338 | |||
| 1800 | Ga0495617_008872 | |||
| 1801 | Ga0495617_017847 | |||
| 1802 | Ga0495617_055553 | |||
| 1803 | Ga0495627_001011 | |||
| 1804 | Ga0495627_002989 | |||
| 1805 | Ga0495627_005091 | |||
| 1806 | Ga0495627_007300 | |||
| 1807 | Ga0495627_008337 | |||
| 1808 | Ga0495603_0005711 | |||
| 1809 | Ga0495603_0011221 | |||
| 1810 | Ga0495603_0017156 | |||
| 1811 | Ga0495590_0000888 | |||
| 1812 | Ga0495590_0007244 | |||
| 1813 | Ga0495590_0024068 | |||
| 1814 | Ga0495590_0026143 | |||
| 1815 | Ga0495590_0035808 | |||
| 1816 | Ga0495591_000366 | |||
| 1817 | Ga0495591_000679 | |||
| 1818 | Ga0495591_001742 | |||
| 1819 | Ga0495591_005954 | |||
| 1820 | Ga0495591_007016 | |||
| 1821 | Ga0495591_007385 | |||
| 1822 | Ga0495591_007430 | |||
| 1823 | Ga0495591_008589 | |||
| 1824 | Ga0495591_009235 | |||
| 1825 | Ga0495591_013880 | |||
| 1826 | Ga0495591_016375 | |||
| 1827 | Ga0495591_033523 | |||
| 1828 | Ga0495591_041964 | |||
| 1829 | Ga0495629_0005106 | |||
| 1830 | Ga0495638_0001700 | |||
| 1831 | Ga0495638_0010457 | |||
| 1832 | Ga0495638_0011638 | |||
| 1833 | Ga0495638_0020513 | |||
| 1834 | Ga0495638_0027726 | |||
| 1835 | Ga0495638_0032545 | |||
| 1836 | Ga0495638_0056312 | |||
| 1837 | Ga0495638_0184372 | |||
| 1838 | Ga0495653_0002045 | |||
| 1839 | Ga0495653_0005839 | |||
| 1840 | Ga0495653_0019969 | |||
| 1841 | Ga0495653_0034058 | |||
| 1842 | Ga0495653_0053235 | |||
| 1843 | Ga0495653_0159131 | |||
| 1844 | Ga0495653_0229120 | |||
| 1845 | Ga0495650_0000089 | |||
| 1846 | Ga0495650_0001631 | |||
| 1847 | Ga0495650_0004290 | |||
| 1848 | Ga0495650_0008559 | |||
| 1849 | Ga0495650_0013856 | |||
| 1850 | Ga0495650_0015251 | |||
| 1851 | Ga0495650_0032230 | |||
| 1852 | Ga0495650_0033187 | |||
| 1853 | Ga0495650_0058616 | |||
| 1854 | Ga0495582_0022472 | |||
| 1855 | Ga0495605_0000134 | |||
| 1856 | Ga0495605_0000255 | |||
| 1857 | Ga0495605_0000665 | |||
| 1858 | Ga0495605_0000874 | |||
| 1859 | Ga0495605_0001265 | |||
| 1860 | Ga0495605_0002691 | |||
| 1861 | Ga0495605_0004804 | |||
| 1862 | Ga0495605_0005187 | |||
| 1863 | Ga0495605_0013622 | |||
| 1864 | Ga0495605_0013664 | |||
| 1865 | Ga0495605_0023940 | |||
| 1866 | Ga0495605_0040173 | |||
| 1867 | Ga0495605_0068116 | |||
| 1868 | Ga0495639_0000205 | |||
| 1869 | Ga0495639_0039239 | |||
| 1870 | Ga0495584_0000193 | |||
| 1871 | Ga0495584_0000573 | |||
| 1872 | Ga0495584_0000909 | |||
| 1873 | Ga0495584_0001221 | |||
| 1874 | Ga0495584_0001701 | |||
| 1875 | Ga0495584_0002925 | |||
| 1876 | Ga0495584_0005637 | |||
| 1877 | Ga0495584_0007086 | |||
| 1878 | Ga0495584_0010191 | |||
| 1879 | Ga0495584_0042664 | |||
| 1880 | Ga0495584_0055351 | |||
| 1881 | Ga0495584_0056197 | |||
| 1882 | Ga0495584_0058611 | |||
| 1883 | Ga0495584_0109948 | |||
| 1884 | Ga0495584_0125354 | |||
| 1885 | Ga0495584_0159081 | |||
| 1886 | Ga0495585_0000206 | |||
| 1887 | Ga0495585_0000353 | |||
| 1888 | Ga0495585_0000406 | |||
| 1889 | Ga0495585_0001343 | |||
| 1890 | Ga0495585_0005090 | |||
| 1891 | Ga0495585_0006810 | |||
| 1892 | Ga0495585_0008553 | |||
| 1893 | Ga0495585_0008588 | |||
| 1894 | Ga0495585_0011411 | |||
| 1895 | Ga0495585_0012087 | |||
| 1896 | Ga0495585_0013233 | |||
| 1897 | Ga0495585_0014824 | |||
| 1898 | Ga0495585_0027769 | |||
| 1899 | Ga0495585_0034886 | |||
| 1900 | Ga0495585_0044275 | |||
| 1901 | Ga0495585_0062655 | |||
| 1902 | Ga0495585_0067104 | |||
| 1903 | Ga0495585_0126281 | |||
| 1904 | Ga0495594_0001857 | |||
| 1905 | Ga0495596_0000218 | |||
| 1906 | Ga0495596_0000255 | |||
| 1907 | Ga0495596_0005563 | |||
| 1908 | Ga0495596_0010423 | |||
| 1909 | Ga0495596_0013694 | |||
| 1910 | Ga0495596_0024608 | |||
| 1911 | Ga0495607_0000539 | |||
| 1912 | Ga0495607_0000565 | |||
| 1913 | Ga0495607_0002957 | |||
| 1914 | Ga0495607_0006509 | |||
| 1915 | Ga0495607_0007824 | |||
| 1916 | Ga0495607_0009109 | |||
| 1917 | Ga0495607_0009538 | |||
| 1918 | Ga0495607_0009980 | |||
| 1919 | Ga0495607_0015602 | |||
| 1920 | Ga0495607_0020022 | |||
| 1921 | Ga0495607_0020952 | |||
| 1922 | Ga0495607_0022154 | |||
| 1923 | Ga0495607_0026960 | |||
| 1924 | Ga0495607_0029323 | |||
| 1925 | Ga0495607_0034981 | |||
| 1926 | Ga0495607_0035250 | |||
| 1927 | Ga0495607_0037436 | |||
| 1928 | Ga0495607_0038260 | |||
| 1929 | Ga0495607_0058775 | |||
| 1930 | Ga0495607_0073440 | |||
| 1931 | Ga0495607_0112701 | |||
| 1932 | Ga0495607_0126619 | |||
| 1933 | Ga0495607_0135968 | |||
| 1934 | Ga0495583_0000015 | |||
| 1935 | Ga0495583_0000374 | |||
| 1936 | Ga0495583_0000424 | |||
| 1937 | Ga0495583_0000920 | |||
| 1938 | Ga0495583_0001217 | |||
| 1939 | Ga0495583_0001546 | |||
| 1940 | Ga0495583_0001716 | |||
| 1941 | Ga0495583_0002426 | |||
| 1942 | Ga0495583_0004450 | |||
| 1943 | Ga0495583_0004610 | |||
| 1944 | Ga0495583_0007279 | |||
| 1945 | Ga0495583_0013708 | |||
| 1946 | Ga0495583_0017168 | |||
| 1947 | Ga0495583_0034515 | |||
| 1948 | Ga0495583_0070755 | |||
| 1949 | Ga0495583_0101621 | |||
| 1950 | Ga0495606_0000836 | |||
| 1951 | Ga0495606_0000890 | |||
| 1952 | Ga0495606_0002088 | |||
| 1953 | Ga0495606_0002861 | |||
| 1954 | Ga0495606_0006026 | |||
| 1955 | Ga0495606_0009866 | |||
| 1956 | Ga0495606_0011514 | |||
| 1957 | Ga0495606_0020527 | |||
| 1958 | Ga0495606_0022853 | |||
| 1959 | Ga0495606_0023703 | |||
| 1960 | Ga0495606_0026076 | |||
| 1961 | Ga0495606_0039524 | |||
| 1962 | Ga0495606_0107517 | |||
| 1963 | Ga0495608_0007521 | |||
| 1964 | Ga0495608_0012547 | |||
| 1965 | Ga0495610_0000200 | |||
| 1966 | Ga0495610_0004934 | |||
| 1967 | Ga0495610_0005820 | |||
| 1968 | Ga0495610_0008501 | |||
| 1969 | Ga0495610_0012618 | |||
| 1970 | Ga0495610_0013917 | |||
| 1971 | Ga0495610_0015656 | |||
| 1972 | Ga0495610_0018976 | |||
| 1973 | Ga0495610_0019193 | |||
| 1974 | Ga0495610_0027491 | |||
| 1975 | Ga0495610_0034264 | |||
| 1976 | Ga0495610_0164502 | |||
| 1977 | Ga0495616_0003882 | |||
| 1978 | Ga0495616_0005755 | |||
| 1979 | Ga0495616_0007431 | |||
| 1980 | Ga0495616_0008102 | |||
| 1981 | Ga0495616_0008225 | |||
| 1982 | Ga0495616_0012584 | |||
| 1983 | Ga0495616_0015792 | |||
| 1984 | Ga0495616_0015846 | |||
| 1985 | Ga0495616_0020951 | |||
| 1986 | Ga0495616_0021803 | |||
| 1987 | Ga0495616_0021902 | |||
| 1988 | Ga0495616_0033331 | |||
| 1989 | Ga0495616_0041662 | |||
| 1990 | Ga0495616_0060364 | |||
| 1991 | Ga0495616_0062966 | |||
| 1992 | Ga0495616_0064288 | |||
| 1993 | Ga0495616_0065202 | |||
| 1994 | Ga0495616_0150216 | |||
| 1995 | Ga0495618_0105071 | |||
| 1996 | Ga0495620_0000018 | |||
| 1997 | Ga0495620_0000301 | |||
| 1998 | Ga0495620_0000803 | |||
| 1999 | Ga0495620_0025567 | |||
| 2000 | Ga0495620_0032225 | |||
| 2001 | Ga0495620_0051938 | |||
| 2002 | Ga0495628_0006377 | |||
| 2003 | Ga0495628_0019098 | |||
| 2004 | Ga0495628_0089723 | |||
| 2005 | Ga0495628_0365276 | |||
| 2006 | Ga0495630_0087114 | |||
| 2007 | Ga0495630_0146643 | |||
| 2008 | Ga0495631_0000258 | |||
| 2009 | Ga0495631_0000971 | |||
| 2010 | Ga0495631_0002825 | |||
| 2011 | Ga0495631_0013923 | |||
| 2012 | Ga0495631_0016139 | |||
| 2013 | Ga0495632_0000114 | |||
| 2014 | Ga0495632_0000130 | |||
| 2015 | Ga0495632_0001062 | |||
| 2016 | Ga0495632_0001448 | |||
| 2017 | Ga0495632_0002364 | |||
| 2018 | Ga0495632_0004168 | |||
| 2019 | Ga0495632_0006019 | |||
| 2020 | Ga0495632_0007058 | |||
| 2021 | Ga0495632_0009517 | |||
| 2022 | Ga0495632_0017599 | |||
| 2023 | Ga0495632_0026006 | |||
| 2024 | Ga0495632_0028097 | |||
| 2025 | Ga0495632_0037868 | |||
| 2026 | Ga0495632_0046170 | |||
| 2027 | Ga0495632_0080869 | |||
| 2028 | Ga0495632_0127542 | |||
| 2029 | Ga0495637_0000052 | |||
| 2030 | Ga0495637_0000658 | |||
| 2031 | Ga0495637_0001664 | |||
| 2032 | Ga0495637_0003486 | |||
| 2033 | Ga0495637_0005514 | |||
| 2034 | Ga0495637_0005892 | |||
| 2035 | Ga0495637_0007654 | |||
| 2036 | Ga0495637_0011147 | |||
| 2037 | Ga0495637_0012036 | |||
| 2038 | Ga0495637_0017403 | |||
| 2039 | Ga0495637_0021363 | |||
| 2040 | Ga0495637_0035092 | |||
| 2041 | Ga0495643_0000377 | |||
| 2042 | Ga0495643_0001167 | |||
| 2043 | Ga0495643_0005154 | |||
| 2044 | Ga0495643_0005630 | |||
| 2045 | Ga0495643_0007341 | |||
| 2046 | Ga0495643_0015293 | |||
| 2047 | Ga0495643_0019879 | |||
| 2048 | Ga0495643_0027087 | |||
| 2049 | Ga0495643_0029836 | |||
| 2050 | Ga0495643_0071127 | |||
| 2051 | Ga0495644_0000135 | |||
| 2052 | Ga0495644_0001024 | |||
| 2053 | Ga0495644_0004447 | |||
| 2054 | Ga0495644_0005129 | |||
| 2055 | Ga0495644_0005349 | |||
| 2056 | Ga0495644_0027870 | |||
| 2057 | Ga0495648_0000057 | |||
| 2058 | Ga0495648_0000359 | |||
| 2059 | Ga0495648_0000659 | |||
| 2060 | Ga0495648_0000677 | |||
| 2061 | Ga0495648_0001820 | |||
| 2062 | Ga0495648_0005388 | |||
| 2063 | Ga0495648_0011551 | |||
| 2064 | Ga0495648_0020317 | |||
| 2065 | Ga0495648_0021098 | |||
| 2066 | Ga0495648_0031172 | |||
| 2067 | Ga0495648_0034852 | |||
| 2068 | Ga0495648_0040789 | |||
| 2069 | Ga0495648_0045194 | |||
| 2070 | Ga0495648_0059410 | |||
| 2071 | Ga0495648_0061249 | |||
| 2072 | Ga0495648_0080690 | |||
| 2073 | Ga0495648_0213928 | |||
| 2074 | Ga0495663_0000258 | |||
| 2075 | Ga0495666_0014147 | |||
| 2076 | Ga0495642_0000134 | |||
| 2077 | Ga0495642_0004784 | |||
| 2078 | Ga0495642_0005118 | |||
| 2079 | Ga0495642_0007475 | |||
| 2080 | Ga0495642_0078376 | |||
| 2081 | Ga0495652_0004707 | |||
| 2082 | Ga0495652_0047329 | |||
| 2083 | Ga0495652_0097496 | |||
| 2084 | Ga0495652_0116390 | |||
| 2085 | Ga0495654_0000539 | |||
| 2086 | Ga0495654_0000911 | |||
| 2087 | Ga0495654_0001479 | |||
| 2088 | Ga0495654_0007451 | |||
| 2089 | Ga0495654_0008999 | |||
| 2090 | Ga0495654_0009020 | |||
| 2091 | Ga0495654_0012716 | |||
| 2092 | Ga0495654_0012731 | |||
| 2093 | Ga0495654_0014088 | |||
| 2094 | Ga0495654_0029067 | |||
| 2095 | Ga0495654_0032570 | |||
| 2096 | Ga0495654_0040069 | |||
| 2097 | Ga0495654_0047206 | |||
| 2098 | Ga0495654_0048095 | |||
| 2099 | Ga0495665_0242116 | |||
| 2100 | Ga0495586_0003995 | |||
| 2101 | Ga0495586_0068438 | |||
| 2102 | Ga0495587_0011563 | |||
| 2103 | Ga0495587_0015053 | |||
| 2104 | Ga0495609_0000192 | |||
| 2105 | Ga0495609_0000267 | |||
| 2106 | Ga0495609_0000368 | |||
| 2107 | Ga0495609_0001212 | |||
| 2108 | Ga0495609_0001321 | |||
| 2109 | Ga0495609_0001788 | |||
| 2110 | Ga0495609_0002958 | |||
| 2111 | Ga0495609_0005222 | |||
| 2112 | Ga0495609_0010263 | |||
| 2113 | Ga0495609_0012848 | |||
| 2114 | Ga0495609_0017897 | |||
| 2115 | Ga0495609_0032611 | |||
| 2116 | Ga0495609_0060245 | |||
| 2117 | Ga0495609_0078435 | |||
| 2118 | Ga0495597_0001180 | |||
| 2119 | Ga0495597_0002458 | |||
| 2120 | Ga0495597_0009101 | |||
| 2121 | Ga0495597_0012866 | |||
| 2122 | Ga0495597_0014714 | |||
| 2123 | Ga0495597_0018552 | |||
| 2124 | Ga0495597_0019636 | |||
| 2125 | Ga0495597_0019823 | |||
| 2126 | Ga0495597_0020928 | |||
| 2127 | Ga0495597_0028781 | |||
| 2128 | Ga0495597_0093404 | |||
| 2129 | Ga0495645_0039677 | |||
| 2130 | Ga0495645_0178975 | |||
| 2131 | Ga0495622_0000947 | |||
| 2132 | Ga0495622_0002080 | |||
| 2133 | Ga0495622_0005014 | |||
| 2134 | Ga0495622_0006676 | |||
| 2135 | Ga0495622_0012286 | |||
| 2136 | Ga0495622_0028339 | |||
| 2137 | Ga0495622_0056988 | |||
| 2138 | Ga0495622_0107241 | |||
| 2139 | Ga0495633_0000349 | |||
| 2140 | Ga0495633_0000373 | |||
| 2141 | Ga0495633_0003533 | |||
| 2142 | Ga0495633_0005272 | |||
| 2143 | Ga0495633_0008372 | |||
| 2144 | Ga0495633_0012392 | |||
| 2145 | Ga0495633_0015607 | |||
| 2146 | Ga0495633_0017796 | |||
| 2147 | Ga0495633_0069986 | |||
| 2148 | Ga0495633_0157657 | |||
| 2149 | Ga0495633_0215559 | |||
| 2150 | Ga0495656_0004689 | |||
| 2151 | Ga0495656_0016347 | |||
| 2152 | Ga0495656_0022901 | |||
| 2153 | Ga0495656_0034469 | |||
| 2154 | Ga0495656_0058407 | |||
| 2155 | Ga0495668_0000028 | |||
| 2156 | Ga0495668_0000036 | |||
| 2157 | Ga0495668_0001994 | |||
| 2158 | Ga0495668_0023229 | |||
| 2159 | Ga0495668_0026431 | |||
| 2160 | Ga0495668_0070403 | |||
| 2161 | Ga0495668_0104387 | |||
| 2162 | Ga0495634_0021525 | |||
| 2163 | Ga0495634_0058521 | |||
| 2164 | Ga0495611_0000418 | |||
| 2165 | Ga0495611_0000869 | |||
| 2166 | Ga0495611_0000924 | |||
| 2167 | Ga0495611_0001507 | |||
| 2168 | Ga0495611_0001953 | |||
| 2169 | Ga0495611_0004422 | |||
| 2170 | Ga0495611_0005244 | |||
| 2171 | Ga0495611_0013671 | |||
| 2172 | Ga0495611_0044520 | |||
| 2173 | Ga0495611_0124905 | |||
| 2174 | Ga0495625_0000027 | |||
| 2175 | Ga0495625_0001781 | |||
| 2176 | Ga0495625_0003651 | |||
| 2177 | Ga0495625_0007596 | |||
| 2178 | Ga0495625_0019629 | |||
| 2179 | Ga0495625_0027364 | |||
| 2180 | Ga0495625_0042756 | |||
| 2181 | Ga0495625_0046921 | |||
| 2182 | Ga0495625_0051905 | |||
| 2183 | Ga0495625_0091322 | |||
| 2184 | Ga0495625_0149563 | |||
| 2185 | Ga0495625_0156791 | |||
| 2186 | Ga0495625_0216032 | |||
| 2187 | Ga0495635_0005483 | |||
| 2188 | Ga0495659_0000033 | |||
| 2189 | Ga0495659_0000190 | |||
| 2190 | Ga0495659_0003370 | |||
| 2191 | Ga0495659_0003974 | |||
| 2192 | Ga0495661_0000097 | |||
| 2193 | Ga0495661_0000137 | |||
| 2194 | Ga0495661_0002478 | |||
| 2195 | Ga0495661_0007062 | |||
| 2196 | Ga0495661_0013700 | |||
| 2197 | Ga0495661_0021038 | |||
| 2198 | Ga0495661_0021196 | |||
| 2199 | Ga0495661_0021746 | |||
| 2200 | Ga0495661_0026804 | |||
| 2201 | Ga0495661_0037244 | |||
| 2202 | Ga0495661_0211951 | |||
| 2203 | Ga0495588_0005282 | |||
| 2204 | Ga0495588_0006427 | |||
| 2205 | Ga0495657_0061837 | |||
| 2206 | Ga0495599_0015469 | |||
| 2207 | Ga0495623_0002436 | |||
| 2208 | Ga0495623_0011710 | |||
| 2209 | Ga0495623_0018649 | |||
| 2210 | Ga0495623_0035475 | |||
| 2211 | Ga0495646_0000449 | |||
| 2212 | Ga0495646_0021849 | |||
| 2213 | Ga0495646_0040952 | |||
| 2214 | Ga0495658_0052513 | |||
| 2215 | Ga0495658_0182591 | |||
| 2216 | Ga0495669_0007494 | |||
| 2217 | Ga0495669_0015503 | |||
| 2218 | Ga0495624_0009029 | |||
| 2219 | Ga0495624_0110171 | |||
| 2220 | Ga0495670_0000252 | |||
| 2221 | Ga0495670_0001951 | |||
| 2222 | Ga0495670_0004256 | |||
| 2223 | Ga0495670_0004441 | |||
| 2224 | Ga0495670_0004825 | |||
| 2225 | Ga0495670_0021850 | |||
| 2226 | Ga0495670_0068053 | |||
| 2227 | Ga0495670_0113694 | |||
| 2228 | Ga0495671_0000572 | |||
| 2229 | Ga0495671_0000651 | |||
| 2230 | Ga0495671_0001407 | |||
| 2231 | Ga0495671_0003836 | |||
| 2232 | Ga0495671_0005725 | |||
| 2233 | Ga0495671_0008681 | |||
| 2234 | Ga0495671_0012813 | |||
| 2235 | Ga0495671_0016615 | |||
| 2236 | Ga0495671_0019470 | |||
| 2237 | Ga0495671_0021158 | |||
| 2238 | Ga0495671_0021405 | |||
| 2239 | Ga0495671_0033521 | |||
| 2240 | Ga0495671_0040215 | |||
| 2241 | Ga0495671_0051833 | |||
| 2242 | Ga0495671_0059737 | |||
| 2243 | Ga0495671_0070703 | |||
| 2244 | Ga0495671_0070862 | |||
| 2245 | Ga0495671_0072971 | |||
| 2246 | Ga0495671_0094858 | |||
| 2247 | Ga0495671_0143688 | |||
| 2248 | Ga0495649_0002998 | |||
| 2249 | Ga0495649_0015044 | |||
| 2250 | Ga0495649_0015268 | |||
| 2251 | Ga0495649_0016765 | |||
| 2252 | Ga0495649_0018596 | |||
| 2253 | Ga0495649_0024247 | |||
| 2254 | Ga0495649_0028141 | |||
| 2255 | Ga0495649_0061538 | |||
| 2256 | Ga0495649_0063947 | |||
| 2257 | Ga0495649_0080101 | |||
| 2258 | Ga0495649_0099938 | |||
| 2259 | Ga0495649_0124205 | |||
| 2260 | Ga0495649_0161043 | |||
| 2261 | Ga0495649_0170688 | |||
| 2262 | Ga0495589_0003207 | |||
| 2263 | Ga0495589_0003552 | |||
| 2264 | Ga0495589_0006739 | |||
| 2265 | Ga0495589_0007683 | |||
| 2266 | Ga0495589_0012356 | |||
| 2267 | Ga0495589_0015894 | |||
| 2268 | Ga0495589_0024177 | |||
| 2269 | Ga0495589_0027506 | |||
| 2270 | Ga0495589_0030288 | |||
| 2271 | Ga0495589_0035649 | |||
| 2272 | Ga0495589_0043226 | |||
| 2273 | Ga0495589_0091207 | |||
| 2274 | Ga0495589_0100688 | |||
| 2275 | Ga0495600_0002904 | |||
| 2276 | Ga0495600_0012940 | |||
| 2277 | Ga0495660_0001739 | |||
| 2278 | Ga0495660_0003124 | |||
| 2279 | Ga0495660_0008253 | |||
| 2280 | Ga0495660_0013359 | |||
| 2281 | Ga0495660_0014893 | |||
| 2282 | Ga0495660_0015255 | |||
| 2283 | Ga0495660_0016132 | |||
| 2284 | Ga0495660_0019857 | |||
| 2285 | Ga0495660_0024674 | |||
| 2286 | Ga0495660_0024850 | |||
| 2287 | Ga0495660_0029195 | |||
| 2288 | Ga0495660_0034768 | |||
| 2289 | Ga0495660_0080940 | |||
| 2290 | Ga0495660_0106292 | |||
| 2291 | Ga0495660_0110586 | |||
| 2292 | Ga0495660_0137217 | |||
| 2293 | Ga0495660_0177376 | |||
| 2294 | Ga0495581_0011698 | |||
| 2295 | Ga0495604_0009630 | |||
| 2296 | Ga0495604_0353119 | |||
| 2297 | Ga0495636_0000729 | |||
| 2298 | Ga0495636_0000743 | |||
| 2299 | Ga0495636_0001149 | |||
| 2300 | Ga0495636_0009678 | |||
| 2301 | Ga0495636_0121076 | |||
| 2302 | Ga0495674_0456807 | |||
| 2303 | Ga0495672_0000093 | |||
| 2304 | Ga0495672_0000191 | |||
| 2305 | Ga0495672_0000228 | |||
| 2306 | Ga0495672_0000903 | |||
| 2307 | Ga0495672_0001057 | |||
| 2308 | Ga0495672_0002098 | |||
| 2309 | Ga0495672_0002503 | |||
| 2310 | Ga0495672_0002947 | |||
| 2311 | Ga0495672_0003267 | |||
| 2312 | Ga0495672_0003583 | |||
| 2313 | Ga0495672_0006444 | |||
| 2314 | Ga0495672_0007859 | |||
| 2315 | Ga0495672_0011326 | |||
| 2316 | Ga0495672_0015421 | |||
| 2317 | Ga0495672_0015442 | |||
| 2318 | Ga0495672_0022662 | |||
| 2319 | Ga0495672_0023240 | |||
| 2320 | Ga0495672_0038854 | |||
| 2321 | Ga0495672_0061257 | |||
| 2322 | Ga0495672_0070250 | |||
| 2323 | Ga0495672_0094823 | |||
| 2324 | Ga0495672_0103132 | |||
| 2325 | Ga0495672_0132109 | |||
| 2326 | Ga0495676_0000012 | |||
| 2327 | Ga0495676_0015419 | |||
| 2328 | Ga0495676_0028268 | |||
| 2329 | Ga0495676_0052865 | |||
| 2330 | Ga0495676_0105308 | |||
| 2331 | Ga0495676_0110702 | |||
| 2332 | Ga0495680_0002124 | |||
| 2333 | Ga0495680_0049724 | |||
| 2334 | Ga0495680_0072047 | |||
| 2335 | Ga0495683_0000106 | |||
| 2336 | Ga0495683_0000151 | |||
| 2337 | Ga0495683_0000410 | |||
| 2338 | Ga0495683_0002897 | |||
| 2339 | Ga0495683_0003257 | |||
| 2340 | Ga0495683_0011473 | |||
| 2341 | Ga0495683_0012445 | |||
| 2342 | Ga0495683_0014707 | |||
| 2343 | Ga0495683_0016934 | |||
| 2344 | Ga0495683_0024966 | |||
| 2345 | Ga0495683_0040265 | |||
| 2346 | Ga0495683_0054064 | |||
| 2347 | Ga0495683_0098501 | |||
| 2348 | Ga0495683_0153463 | |||
| 2349 | Ga0495687_000677 | |||
| 2350 | Ga0495687_003270 | |||
| 2351 | Ga0495687_003354 | |||
| 2352 | Ga0495687_005605 | |||
| 2353 | Ga0495687_011366 | |||
| 2354 | Ga0495675_0013515 | |||
| 2355 | Ga0495675_0027392 | |||
| 2356 | Ga0495677_0000335 | |||
| 2357 | Ga0495677_0000731 | |||
| 2358 | Ga0495677_0001974 | |||
| 2359 | Ga0495677_0002654 | |||
| 2360 | Ga0495677_0005006 | |||
| 2361 | Ga0495679_000072 | |||
| 2362 | Ga0495679_000371 | |||
| 2363 | Ga0495679_005683 | |||
| 2364 | Ga0495679_007767 | |||
| 2365 | Ga0495679_014906 | |||
| 2366 | Ga0495679_019080 | |||
| 2367 | Ga0495685_000093 | |||
| 2368 | Ga0495685_000321 | |||
| 2369 | Ga0495685_000765 | |||
| 2370 | Ga0495685_079197 | |||
| 2371 | Ga0495673_0001036 | |||
| 2372 | Ga0495673_0001304 | |||
| 2373 | Ga0495673_0001758 | |||
| 2374 | Ga0495673_0001931 | |||
| 2375 | Ga0495673_0003218 | |||
| 2376 | Ga0495673_0003321 | |||
| 2377 | Ga0495673_0003987 | |||
| 2378 | Ga0495673_0006593 | |||
| 2379 | Ga0495673_0006870 | |||
| 2380 | Ga0495673_0010117 | |||
| 2381 | Ga0495673_0011499 | |||
| 2382 | Ga0495673_0012966 | |||
| 2383 | Ga0495673_0013061 | |||
| 2384 | Ga0495673_0013306 | |||
| 2385 | Ga0495673_0016563 | |||
| 2386 | Ga0495673_0017601 | |||
| 2387 | Ga0495673_0027934 | |||
| 2388 | Ga0495673_0028542 | |||
| 2389 | Ga0495673_0049225 | |||
| 2390 | Ga0495673_0068077 | |||
| 2391 | Ga0495673_0108439 | |||
| 2392 | Ga0495681_0001943 | |||
| 2393 | Ga0495681_0006222 | |||
| 2394 | Ga0495681_0009007 | |||
| 2395 | Ga0495681_0009912 | |||
| 2396 | Ga0495681_0011533 | |||
| 2397 | Ga0495681_0014653 | |||
| 2398 | Ga0495681_0015908 | |||
| 2399 | Ga0495681_0015973 | |||
| 2400 | Ga0495681_0024598 | |||
| 2401 | Ga0495681_0032194 | |||
| 2402 | Ga0495681_0076817 | |||
| 2403 | Ga0495686_0000760 | |||
| 2404 | Ga0495686_0005668 | |||
| 2405 | Ga0495686_0017802 | |||
| 2406 | Ga0495686_0022780 | |||
| 2407 | Ga0495686_0029968 | |||
| 2408 | Ga0495593_0014912 | |||
| 2409 | Ga0495593_0166572 | |||
| 2410 | Ga0495602_0037224 | |||
| 2411 | Ga0495602_0181199 | |||
| 2412 | Ga0495626_0000136 | |||
| 2413 | Ga0495626_0001152 | |||
| 2414 | Ga0495626_0001994 | |||
| 2415 | Ga0495626_0005043 | |||
| 2416 | Ga0495626_0005509 | |||
| 2417 | Ga0495626_0006489 | |||
| 2418 | Ga0495626_0011203 | |||
| 2419 | Ga0495626_0011936 | |||
| 2420 | Ga0495626_0016919 | |||
| 2421 | Ga0495626_0018063 | |||
| 2422 | Ga0495626_0034281 | |||
| 2423 | Ga0495626_0036116 | |||
| 2424 | Ga0495626_0053294 | |||
| 2425 | Ga0495626_0093401 | |||
| 2426 | Ga0496100_0182953 | |||
| 2427 | Ga0496101_0026906 | |||
| 2428 | Ga0496102_0000987 | |||
| 2429 | Ga0496102_0027127 | |||
| 2430 | Ga0496104_0249937 | |||
| 2431 | Ga0496104_0518542 | |||
| 2432 | Ga0496106_0060993 | |||
| 2433 | Ga0496109_0008944 | |||
| 2434 | Ga0496110_0129159 | |||
| 2435 | Ga0496110_0303535 | |||
| 2436 | Ga0496111_0226914 | |||
| 2437 | Ga0496112_0096422 | |||
| 2438 | Ga0496112_0105057 | |||
| 2439 | Ga0496112_0329313 | |||
| 2440 | Ga0496113_0057538 | |||
| 2441 | Ga0496114_0002048 | |||
| 2442 | Ga0496116_0000330 | |||
| 2443 | Ga0496116_0002606 | |||
| 2444 | Ga0496116_0002665 | |||
| 2445 | Ga0496116_0007076 | |||
| 2446 | Ga0496116_0011087 | |||
| 2447 | Ga0496117_0000527 | |||
| 2448 | Ga0496117_0000567 | |||
| 2449 | Ga0496117_0001165 | |||
| 2450 | Ga0496117_0001362 | |||
| 2451 | Ga0496117_0004152 | |||
| 2452 | Ga0496117_0037297 | |||
| 2453 | Ga0496117_0040363 | |||
| 2454 | Ga0496117_0044538 | |||
| 2455 | Ga0496117_0051631 | |||
| 2456 | Ga0496117_0068112 | |||
| 2457 | Ga0496118_0002142 | |||
| 2458 | Ga0496118_0003917 | |||
| 2459 | Ga0496118_0025404 | |||
| 2460 | Ga0496118_0038459 | |||
| 2461 | Ga0496118_0054905 | |||
| 2462 | Ga0496118_0064855 | |||
| 2463 | Ga0496118_0069590 | |||
| 2464 | Ga0496118_0198199 | |||
| 2465 | Ga0496119_0019596 | |||
| 2466 | Ga0496119_0041808 | |||
| 2467 | Ga0496119_0049968 | |||
| 2468 | Ga0496120_0006160 | |||
| 2469 | Ga0496120_0009103 | |||
| 2470 | Ga0496121_0001040 | |||
| 2471 | Ga0496121_0001212 | |||
| 2472 | Ga0496121_0002253 | |||
| 2473 | Ga0496121_0034375 | |||
| 2474 | Ga0496121_0051009 | |||
| 2475 | Ga0496121_0052494 | |||
| 2476 | Ga0496121_0053873 | |||
| 2477 | Ga0496121_0076698 | |||
| 2478 | Ga0496121_0089990 | |||
| 2479 | Ga0496121_0196898 | |||
| 2480 | Ga0496122_0000279 | |||
| 2481 | Ga0496122_0000398 | |||
| 2482 | Ga0496122_0001015 | |||
| 2483 | Ga0496122_0003408 | |||
| 2484 | Ga0496122_0006658 | |||
| 2485 | Ga0496122_0024406 | |||
| 2486 | Ga0496122_0026026 | |||
| 2487 | Ga0496122_0028603 | |||
| 2488 | Ga0496122_0041561 | |||
| 2489 | Ga0496122_0072135 | |||
| 2490 | Ga0496122_0241173 | |||
| 2491 | Ga0496123_0000146 | |||
| 2492 | Ga0496123_0000302 | |||
| 2493 | Ga0496123_0000466 | |||
| 2494 | Ga0496123_0000554 | |||
| 2495 | Ga0496123_0057979 | |||
| 2496 | Ga0496123_0109531 | |||
| 2497 | Ga0496124_0000144 | |||
| 2498 | Ga0496124_0001865 | |||
| 2499 | Ga0496124_0006360 | |||
| 2500 | Ga0496124_0008084 | |||
| 2501 | Ga0496124_0026258 | |||
| 2502 | Ga0496124_0040447 | |||
| 2503 | Ga0496124_0042381 | |||
| 2504 | Ga0496124_0049633 | |||
| 2505 | Ga0496124_0083664 | |||
| 2506 | Ga0496124_0094115 | |||
| 2507 | Ga0496124_0125085 | |||
| 2508 | Ga0496124_0227711 | |||
| 2509 | Ga0496125_0000080 | |||
| 2510 | Ga0496125_0000849 | |||
| 2511 | Ga0496125_0001556 | |||
| 2512 | Ga0496125_0032993 | |||
| 2513 | Ga0496125_0038704 | |||
| 2514 | Ga0496125_0041788 | |||
| 2515 | Ga0496125_0060215 | |||
| 2516 | Ga0496125_0092224 | |||
| 2517 | Ga0496125_0109736 | |||
| 2518 | Ga0496126_0085761 | |||
| 2519 | Ga0496126_0154949 | |||
| 2520 | Ga0496126_0204453 | |||
| 2521 | Ga0496126_0363408 | |||
| 2522 | Ga0495678_000236 | |||
| 2523 | Ga0495678_001575 | |||
| 2524 | Ga0495678_002660 | |||
| 2525 | Ga0495678_003098 | |||
| 2526 | Ga0495678_004037 | |||
| 2527 | Ga0495678_006832 | |||
| 2528 | Ga0495678_007299 | |||
| 2529 | Ga0495678_007379 | |||
| 2530 | Ga0495678_009517 | |||
| 2531 | Ga0495678_015168 | |||
| 2532 | Ga0495678_016449 | |||
| 2533 | Ga0495678_017589 | |||
| 2534 | Ga0495678_019502 | |||
| 2535 | Ga0495678_043711 | |||
| 2536 | Ga0495682_0000121 | |||
| 2537 | Ga0495682_0000195 | |||
| 2538 | Ga0495682_0000288 | |||
| 2539 | Ga0495682_0000726 | |||
| 2540 | Ga0495682_0002163 | |||
| 2541 | Ga0495682_0007490 | |||
| 2542 | Ga0495682_0009683 | |||
| 2543 | Ga0495682_0014355 | |||
| 2544 | Ga0495682_0017829 | |||
| 2545 | Ga0495682_0028633 | |||
| 2546 | Ga0495682_0043747 | |||
| 2547 | Ga0501032_0012658 | |||
| 2548 | Ga0501034_0122144 | |||
| 2549 | Ga0501230_002121 | |||
| 2550 | Ga0495601_0018644 | |||
| 2551 | Ga0500572_027512 | |||
| 2552 | Ga0500595_000637 | |||
| 2553 | Ga0500618_020449 | |||
| 2554 | Ga0500574_001395 | |||
| 2555 | 2510310126 | |||
| 2556 | 2511254145 | |||
| 2557 | 2511268943 | |||
| 2558 | 2511274703 | |||
| 2559 | 2511277534 | |||
| 2560 | 2511289290 | |||
| 2561 | 2511295467 | |||
| 2562 | 2511302239 | |||
| 2563 | 2511314454 | |||
| 2564 | 2511321682 | |||
| 2565 | 2511324950 | |||
| 2566 | 2511333564 | |||
| 2567 | 2511336945 | |||
| 2568 | 2511347602 | |||
| 2569 | 2511350635 | |||
| 2570 | 2511358598 | |||
| 2571 | 2511366363 | |||
| 2572 | 2511369914 | |||
| 2573 | 2511373967 | |||
| 2574 | 2511413401 | |||
| 2575 | 2511827518 | |||
| 2576 | 2512323905 | |||
| 2577 | 2514045089 | |||
| 2578 | 2555672716 | |||
| 2579 | 2583795065 | |||
| 2580 | 2597860769 | |||
| 2581 | 2597866513 | |||
| 2582 | 2599327410 | |||
| 2583 | 2599356081 | |||
| 2584 | 2599362519 | |||
| 2585 | 2599369175 | |||
| 2586 | 2599375628 | |||
| 2587 | 2599381187 | |||
| 2588 | 2599387297 | |||
| 2589 | 2599394486 | |||
| 2590 | 2599400658 | |||
| 2591 | 2599406251 | |||
| 2592 | 2599449984 | |||
| 2593 | 2599462915 | |||
| 2594 | 2599467664 | |||
| 2595 | 2599485997 | |||
| 2596 | 2599491932 | |||
| 2597 | 2599502539 | |||
| 2598 | 2599505640 | |||
| 2599 | 2599512058 | |||
| 2600 | 2599517039 | |||
| 2601 | 2599616199 | |||
| 2602 | 2599768279 | |||
| 2603 | 2599804779 | |||
| 2604 | 2599878923 | |||
| 2605 | 2599885707 | |||
| 2606 | 2599892580 | |||
| 2607 | 2599897421 | |||
| 2608 | 2599934183 | |||
| 2609 | 2599942434 | |||
| 2610 | 2599950873 | |||
| 2611 | 2599954153 | |||
| 2612 | 2599963724 | |||
| 2613 | 2599967673 | |||
| 2614 | 2599973540 | |||
| 2615 | 2599979957 | |||
| 2616 | 2599983004 | |||
| 2617 | 2599988246 | |||
| 2618 | 2599993900 | |||
| 2619 | 2599999034 | |||
| 2620 | 2600004440 | |||
| 2621 | 2600013747 | |||
| 2622 | 2600021347 | |||
| 2623 | 2600024409 | |||
| 2624 | 2600030417 | |||
| 2625 | 2600038507 | |||
| 2626 | 2600042248 | |||
| 2627 | 2600046572 | |||
| 2628 | 2600056420 | |||
| 2629 | 2600062494 | |||
| 2630 | 2600066458 | |||
| 2631 | 2600072806 | |||
| 2632 | 2600076658 | |||
| 2633 | 2600215541 | |||
| 2634 | 2600359112 | |||
| 2635 | 2600366457 | |||
| 2636 | 2600444241 | |||
| 2637 | 2601628376 | |||
| 2638 | 2601693555 | |||
| 2639 | 2601775707 | |||
| 2640 | 2601798677 | |||
| 2641 | 2602008280 | |||
| 2642 | 2606077571 | |||
| 2643 | 2606129183 | |||
| 2644 | 2621296959 | |||
| 2645 | 2624483296 | |||
| 2646 | 2624494815 | |||
| 2647 | 2643842851 | |||
| 2648 | 2643955751 | |||
| 2649 | 2644020545 | |||
| 2650 | 2644184606 | |||
| 2651 | 2644283317 | |||
| 2652 | 2652547160 | |||
| 2653 | 2671089429 | |||
| 2654 | 2671099158 | |||
| 2655 | 2671128704 | |||
| 2656 | 2671771786 | |||
| 2657 | 2677897009 | |||
| 2658 | 2678230927 | |||
| 2659 | 2678266028 | |||
| 2660 | 2715749948 | |||
| 2661 | 2715756338 | |||
| 2662 | 2718636496 | |||
| 2663 | 2723251254 | |||
| 2664 | 2738671780 | |||
| 2665 | 2738690165 | |||
| 2666 | 2738740449 | |||
| 2667 | 2738750174 | |||
| 2668 | 2738807140 | |||
| 2669 | 2738843298 | |||
| 2670 | 2738859214 | |||
| 2671 | 2738894500 | |||
| 2672 | 2739198940 | |||
| 2673 | 2739258884 | |||
| 2674 | 2739265939 | |||
| 2675 | 2739275627 | |||
| 2676 | 2739312626 | |||
| 2677 | 2739344671 | |||
| 2678 | 2745007260 | |||
| 2679 | 2765584159 | |||
| 2680 | 2774118501 | |||
| 2681 | 2774129821 | |||
| 2682 | 2774135688 | |||
| 2683 | 2774388526 | |||
| 2684 | 2774438820 | |||
| 2685 | 2784261938 | |||
| 2686 | 2784313174 | |||
| 2687 | 2794598720 | |||
| 2688 | 2808855408 | |||
| 2689 | 2808925406 | |||
| 2690 | 2808928562 | |||
| 2691 | 2808935305 | |||
| 2692 | 2808941583 | |||
| 2693 | 2808947502 | |||
| 2694 | 2808950255 | |||
| 2695 | 2808958868 | |||
| 2696 | 2808963913 | |||
| 2697 | 2808998801 | |||
| 2698 | 2809143599 | |||
| 2699 | 2809217067 | |||
| 2700 | 2812369957 | |||
| 2701 | 2817493927 | |||
| 2702 | 2819655014 | |||
| 2703 | 2819704280 | |||
| 2704 | 2825655215 | |||
| 2705 | 2826586863 | |||
| 2706 | 2842816681 | |||
| 2707 | 2842831449 | |||
| 2708 | 2842833348 | |||
| 2709 | 2842842960 | |||
| 2710 | 2842845576 | |||
| 2711 | 2842852271 | |||
| 2712 | 2842855502 | |||
| 2713 | 2844666890 | |||
| 2714 | 2852661866 | |||
| 2715 | 2857576452 | |||
| 2716 | 2860341599 | |||
| 2717 | 2878035236 | |||
| 2718 | 2880235878 | |||
| 2719 | 2901302770 | |||
| 2720 | 2904519074 | |||
| 2721 | 2904551248 | |||
| 2722 | 2908452458 | |||
| 2723 | 2917076610 | |||
| 2724 | 2917832751 | |||
| 2725 | 2919065636 | |||
| 2726 | 2919125547 | |||
| 2727 | 2919183838 | |||
| 2728 | 2919389304 | |||
| 2729 | 2919457428 | |||
| 2730 | 2919477583 | |||
| 2731 | 2919485563 | |||
| 2732 | 2919488280 | |||
| 2733 | 2919502641 | |||
| 2734 | 2919700692 | |||
| 2735 | 2923524043 | |||
| 2736 | 2926064314 | |||
| 2737 | 2929149833 | |||
| 2738 | 2931372764 | |||
| 2739 | 2931396297 | |||
| 2740 | 2931397951 | |||
| 2741 | 2935358423 | |||
| 2742 | 2939640921 | |||
| 2743 | 2945931029 | |||
| 2744 | 2945966729 | |||
| 2745 | 2946027789 | |||
| 2746 | 2969310057 | |||
| 2747 | 2974294194 | |||
| 2748 | 2984286725 | |||
| 2749 | 2984502638 | |||
| 2750 | 2984508738 | |||
| 2751 | 2984569560 | |||
| 2752 | 2988731372 | |||
| 2753 | 2998145282 | |||
| 2754 | 3007256238 | |||
| 2755 | 3007319579 | |||
| 2756 | 3007399514 | |||
| 2757 | 3007517066 | |||
| 2758 | 3007618836 | |||
| 2759 | 3007624252 | |||
| 2760 | 3007809122 | |||
| 2761 | 3007858208 | |||
| 2762 | 3007865215 | |||
| 2763 | 3007875169 | |||
| 2764 | 637323152 | |||
| 2765 | 8016728978 | |||
| 2766 | 8019769890 | |||
| 2767 | 8019777799 | |||
| 2768 | 8029995619 | |||
| 2769 | 8033234676 | |||
| 2770 | 8034965223 | |||
| 2771 | 8054349692 | |||
| 2772 | 8055776747 | |||
| 2773 | 8056131488 | |||
| 2774 | 8056137197 | |||
| 2775 | 8056140075 | |||
| 2776 | 8056160734 | |||
| 2777 | 8056163512 | |||
| 2778 | 8056177525 | |||
| 2779 | 8056181888 | |||
| 2780 | 8057801817 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vit-assembly1.cif.gz_D | crystal structure of a pseudomonas malonate decarboxylase hetero-tetramer in complex with malonate | 0.8976 | 3 | 250 |
| 5vit-assembly1.cif.gz_D | crystal structure of a pseudomonas malonate decarboxylase hetero-tetramer in complex with malonate | 0.8706 | 3 | 250 |
| 5vip-assembly1.cif.gz_B | crystal structure of pseudomonas malonate decarboxylase mdcd-mdce hetero-dimer | 0.8646 | 12 | 233 |
| 5vip-assembly1.cif.gz_B | crystal structure of pseudomonas malonate decarboxylase mdcd-mdce hetero-dimer | 0.8319 | 12 | 233 |
| 1uyv-assembly1.cif.gz_A-2 | acetyl-coa carboxylase carboxyltransferase domain l1705i/v1967i mutant | 0.8193 | 60 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76594_126_282_3.40.50.261 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains | 0.7853 | 70 | 128 | 3.40.50.261 |
| 3h0sB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7814 | 60 | 211 | 3.90.226.10 |
| af_Q38970_526_2254_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7575 | 60 | 211 | 3.90.226.10 |
| 4fb8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7355 | 60 | 212 | 3.90.226.10 |
| af_Q20676_22_285_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7161 | 4 | 208 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I7XWZ5-F1-model_v4 | Malonate decarboxylase subunit beta | 0.9653 | 142 | 247 |
|
| AF-A0A367LWH1-F1-model_v4 | Biotin-independent malonate decarboxylase subunit beta | 0.9503 | 114 | 224 |
GO:0016020
|
| AF-A0A6D0EKI9-F1-model_v4 | deleted | 0.9458 | 173 | 250 |
|
| AF-A0A352MKX3-F1-model_v4 | deleted | 0.9424 | 113 | 197 |
|
| AF-A0A120G8D1-F1-model_v4 | Malonyl-S-ACP:biotin-protein carboxyltransferase MADC (EC 2.1.3.10) | 0.941 | 140 | 255 |
GO:0016740
|