F493586

General Info

Members Datasets Scaffolds Average Seq Length
1390 430 1380 329

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10178496|Ga0207706_101784962
Length 388
Sequence VQKRTLGKSNLEVSAIGLGCMGMSISYGPPKDRQEMSALLRSAVERGVTFFDTAEAYGPYINEELVGQALVPFRKQVVIATKFGFDFSGGDTRPGAAGLNSRPEHIKEVADASLKRLKTDVIDLFYQHRVDPNVPIEDVAGAVKELIQLGKVKHFGLSEAGVQTIRRAHAVQPVTALQNEYSLWWRKPEAEVLPTLEELGIGLVPYSPLGRGFLTGKIDEKTTFDKTDFRNTLPRFTPEALKANQALIDLLGMIARRKKATPAQIALAWLLAQKPWIVPIPGTTKLNRLDENIGAVSVELNADDLYEINDAASEITVQGARYPDKLEEMTGRQLRVAIYLAENGVPAVDEDFVLCLLSSACLFALGHRASSAYRCSGGLRGWRRNGIP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
8 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
9 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
232 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
233 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
236 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
237 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
238 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
241 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
291 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
303 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
306 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
338 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
339 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
418 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
419 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
420 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
421 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
422 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
423 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
424 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
427 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
428 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
429 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
430 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.07
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 1.58
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3934553 2162886011 Bacteria 1360
2 JGI25152J39213_1000873 3300002773 Bacteria 14860
3 JGI25150J39212_1000279 3300002774 Bacteria 26965
4 JGI25159J45721_1000773 3300002987 Bacteria 13918
5 JGI25151J46595_10000736 3300003187 Bacteria 26965
6 JGI25406J46586_10000567 3300003203 Bacteria 17440
7 JGI25153J46596_10000433 3300003215 Bacteria 26965
8 rootH1_10039424 3300003323 Bacteria 18307
9 JGI25161J50226_1000135 3300003374 Bacteria 51243
10 Ga0055539_1005054 3300003752 Bacteria 1726
11 Ga0055540_1027540 3300003792 Bacteria 1358
12 Ga0055531_10000532 3300003794 Bacteria 34007
13 Ga0055543_1000219 3300004625 Bacteria 45978
14 Ga0065165_1004055 3300005262 Bacteria 9512
15 Ga0065165_1026554 3300005262 Bacteria 1903
16 Ga0065704_10083021 3300005289 Bacteria 3519
17 Ga0065704_10111613 3300005289 Bacteria 1953
18 Ga0065704_10165902 3300005289 Bacteria 1322
19 Ga0065704_10170473 3300005289 Bacteria 1295
20 Ga0065712_10158336 3300005290 Bacteria 1319
21 Ga0065715_10005182 3300005293 Bacteria 3265
22 Ga0065715_10113923 3300005293 Bacteria 2470
23 Ga0065715_10138188 3300005293 Bacteria 1891
24 Ga0065707_10005580 3300005295 Bacteria 4678
25 Ga0065707_10197593 3300005295 Bacteria 1311
26 Ga0070676_10041149 3300005328 Bacteria 2678
27 Ga0070676_10214199 3300005328 Bacteria 1269
28 Ga0070683_100025190 3300005329 Bacteria 5339
29 Ga0070683_100124060 3300005329 Bacteria 2441
30 Ga0070683_100337730 3300005329 Bacteria 1434
31 Ga0070690_100017216 3300005330 Bacteria 4342
32 Ga0070690_100086926 3300005330 Bacteria 2053
33 Ga0070690_100095431 3300005330 Bacteria 1964
34 Ga0070670_100000042 3300005331 Bacteria 143266
35 Ga0070670_100038640 3300005331 Bacteria 4104
36 Ga0070670_100050479 3300005331 Bacteria 3574
37 Ga0070670_100087212 3300005331 Bacteria 2682
38 Ga0068869_100023676 3300005334 Bacteria 4246
39 Ga0070666_10000945 3300005335 Bacteria 17686
40 Ga0070666_10006040 3300005335 Bacteria 7440
41 Ga0070666_10008833 3300005335 Bacteria 6265
42 Ga0070666_10023823 3300005335 Bacteria 3985
43 Ga0070666_10066056 3300005335 Bacteria 2454
44 Ga0070680_100003407 3300005336 Bacteria 11866
45 Ga0070680_100358366 3300005336 Bacteria 1241
46 Ga0068868_100016034 3300005338 Bacteria 5557
47 Ga0068868_100149068 3300005338 Bacteria 1925
48 Ga0068868_100200784 3300005338 Bacteria 1662
49 Ga0070689_100024445 3300005340 Bacteria 4532
50 Ga0070689_100081360 3300005340 Bacteria 2543
51 Ga0070691_10103642 3300005341 Bacteria 1416
52 Ga0070687_100156760 3300005343 Bacteria 1342
53 Ga0070661_100092045 3300005344 Bacteria 2246
54 Ga0070668_100000094 3300005347 Bacteria 56388
55 Ga0070668_100000528 3300005347 Bacteria 25415
56 Ga0070668_100014490 3300005347 Bacteria 5892
57 Ga0070668_100041334 3300005347 Bacteria 3532
58 Ga0070668_100083508 3300005347 Bacteria 2507
59 Ga0070668_100141152 3300005347 Bacteria 1941
60 Ga0070668_100179692 3300005347 Bacteria 1728
61 Ga0070669_100006891 3300005353 Bacteria 8166
62 Ga0070669_100023733 3300005353 Bacteria 4395
63 Ga0070669_100094939 3300005353 Bacteria 2241
64 Ga0070669_100285182 3300005353 Bacteria 1324
65 Ga0070669_100300399 3300005353 Bacteria 1291
66 Ga0070675_100024122 3300005354 Bacteria 4870
67 Ga0070675_100132987 3300005354 Bacteria 2121
68 Ga0070675_100506619 3300005354 Bacteria 1088
69 Ga0070671_100017898 3300005355 Bacteria 5746
70 Ga0070671_100023577 3300005355 Bacteria 5038
71 Ga0070671_100037659 3300005355 Bacteria 4012
72 Ga0070671_100127962 3300005355 Bacteria 2138
73 Ga0070674_100036954 3300005356 Bacteria 3282
74 Ga0070674_100369954 3300005356 Bacteria 1163
75 Ga0070673_100057027 3300005364 Bacteria 3085
76 Ga0070673_100082677 3300005364 Bacteria 2607
77 Ga0070673_100125126 3300005364 Unclassified 2150
78 Ga0070673_100192887 3300005364 Bacteria 1751
79 Ga0070673_100304384 3300005364 Bacteria 1404
80 Ga0070688_100007829 3300005365 Bacteria 5775
81 Ga0070688_100035564 3300005365 Bacteria 3026
82 Ga0070659_100023605 3300005366 Bacteria 4709
83 Ga0070659_100233092 3300005366 Bacteria 1522
84 Ga0070667_100000025 3300005367 Bacteria 190744
85 Ga0070667_100000152 3300005367 Bacteria 86556
86 Ga0070667_100015801 3300005367 Bacteria 6245
87 Ga0070667_100025354 3300005367 Bacteria 4930
88 Ga0070667_100118136 3300005367 Bacteria 2305
89 Ga0070667_100140381 3300005367 Bacteria 2115
90 Ga0070667_100285950 3300005367 Bacteria 1482
91 Ga0070667_100447740 3300005367 Bacteria 1180
92 Ga0070709_10022083 3300005434 Bacteria 3717
93 Ga0070709_10036277 3300005434 Bacteria 3002
94 Ga0070714_100000442 3300005435 Bacteria 30121
95 Ga0070714_100158732 3300005435 Bacteria 2044
96 Ga0070714_100164628 3300005435 Bacteria 2009
97 Ga0070714_100274517 3300005435 Bacteria 1564
98 Ga0070713_100059186 3300005436 Bacteria 3198
99 Ga0070713_100106565 3300005436 Bacteria 2437
100 Ga0070713_100221213 3300005436 Bacteria 1718
101 Ga0070710_10029056 3300005437 Bacteria 2963
102 Ga0070701_10013510 3300005438 Bacteria 3717
103 Ga0070701_10069831 3300005438 Bacteria 1875
104 Ga0070701_10087848 3300005438 Bacteria 1697
105 Ga0070701_10193954 3300005438 Bacteria 1197
106 Ga0070711_100118470 3300005439 Bacteria 1954
107 Ga0070705_100000014 3300005440 Bacteria 94384
108 Ga0070705_100012957 3300005440 Bacteria 4252
109 Ga0070705_100067958 3300005440 Bacteria 2143
110 Ga0070700_100011346 3300005441 Bacteria 4933
111 Ga0070700_100015551 3300005441 Bacteria 4318
112 Ga0070700_100026479 3300005441 Unclassified 3425
113 Ga0070700_100057000 3300005441 Bacteria 2451
114 Ga0070700_100118018 3300005441 Bacteria 1773
115 Ga0070694_100083286 3300005444 Bacteria 2229
116 Ga0070694_100171660 3300005444 Bacteria 1598
117 Ga0070694_100385840 3300005444 Bacteria 1093
118 Ga0070708_100000081 3300005445 Bacteria 61675
119 Ga0070708_100004936 3300005445 Bacteria 10549
120 Ga0070708_100009454 3300005445 Bacteria 7857
121 Ga0070708_100009638 3300005445 Bacteria 7789
122 Ga0070708_100025052 3300005445 Bacteria 5097
123 Ga0070708_100085686 3300005445 Bacteria 2860
124 Ga0070708_100152428 3300005445 Bacteria 2150
125 Ga0070708_100321608 3300005445 Bacteria 1457
126 Ga0070708_100323129 3300005445 Bacteria 1454
127 Ga0070708_100352193 3300005445 Bacteria 1388
128 Ga0070663_100337099 3300005455 Bacteria 1217
129 Ga0070678_100031727 3300005456 Bacteria 3649
130 Ga0070678_100122618 3300005456 Bacteria 2052
131 Ga0070678_100233246 3300005456 Bacteria 1535
132 Ga0070662_100296814 3300005457 Bacteria 1312
133 Ga0070681_10061358 3300005458 Bacteria 3735
134 Ga0070681_10182050 3300005458 Bacteria 2022
135 Ga0068867_100013996 3300005459 Bacteria 5680
136 Ga0068867_100022000 3300005459 Bacteria 4555
137 Ga0068867_100027081 3300005459 Bacteria 4118
138 Ga0068867_100036724 3300005459 Bacteria 3559
139 Ga0068867_100174031 3300005459 Bacteria 1707
140 Ga0068867_100275778 3300005459 Bacteria 1377
141 Ga0070706_100000131 3300005467 Bacteria 92723
142 Ga0070706_100012832 3300005467 Bacteria 7756
143 Ga0070706_100018749 3300005467 Bacteria 6380
144 Ga0070706_100035062 3300005467 Bacteria 4633
145 Ga0070706_100036024 3300005467 Bacteria 4570
146 Ga0070706_100037393 3300005467 Bacteria 4483
147 Ga0070706_100046630 3300005467 Bacteria 4000
148 Ga0070706_100074914 3300005467 Bacteria 3132
149 Ga0070706_100096274 3300005467 Bacteria 2748
150 Ga0070706_100097346 3300005467 Bacteria 2733
151 Ga0070706_100124456 3300005467 Bacteria 2404
152 Ga0070706_100203195 3300005467 Bacteria 1851
153 Ga0070706_100218227 3300005467 Bacteria 1780
154 Ga0070706_100302386 3300005467 Bacteria 1492
155 Ga0070706_100357609 3300005467 Bacteria 1361
156 Ga0070706_100415817 3300005467 Bacteria 1252
157 Ga0070707_100001910 3300005468 Bacteria 19970
158 Ga0070707_100001950 3300005468 Bacteria 19793
159 Ga0070707_100004258 3300005468 Bacteria 13397
160 Ga0070707_100024680 3300005468 Bacteria 5696
161 Ga0070707_100047847 3300005468 Bacteria 4095
162 Ga0070707_100064697 3300005468 Bacteria 3512
163 Ga0070707_100081481 3300005468 Bacteria 3124
164 Ga0070707_100111840 3300005468 Bacteria 2649
165 Ga0070707_100121282 3300005468 Bacteria 2539
166 Ga0070707_100174162 3300005468 Bacteria 2097
167 Ga0070707_100180495 3300005468 Bacteria 2058
168 Ga0070707_100180983 3300005468 Bacteria 2055
169 Ga0070707_100252117 3300005468 Bacteria 1718
170 Ga0070698_100010335 3300005471 Bacteria 9964
171 Ga0070698_100025039 3300005471 Bacteria 6220
172 Ga0070698_100028598 3300005471 Bacteria 5789
173 Ga0070698_100034638 3300005471 Bacteria 5226
174 Ga0070698_100066447 3300005471 Bacteria 3629
175 Ga0070698_100193193 3300005471 Bacteria 1973
176 Ga0070698_100235411 3300005471 Bacteria 1764
177 Ga0070698_100275998 3300005471 Bacteria 1612
178 Ga0070699_100024549 3300005518 Bacteria 5196
179 Ga0070699_100025989 3300005518 Bacteria 5049
180 Ga0070699_100101035 3300005518 Bacteria 2528
181 Ga0070699_100153722 3300005518 Bacteria 2036
182 Ga0070699_100187467 3300005518 Bacteria 1837
183 Ga0070699_100259108 3300005518 Bacteria 1555
184 Ga0070699_100425121 3300005518 Bacteria 1203
185 Ga0070679_100000108 3300005530 Bacteria 65441
186 Ga0070679_100009239 3300005530 Bacteria 9318
187 Ga0070679_100171697 3300005530 Bacteria 2141
188 Ga0070684_100050684 3300005535 Bacteria 3606
189 Ga0070697_100024194 3300005536 Bacteria 4834
190 Ga0070697_100030109 3300005536 Bacteria 4358
191 Ga0070697_100047904 3300005536 Bacteria 3465
192 Ga0070697_100059674 3300005536 Bacteria 3107
193 Ga0070697_100099228 3300005536 Bacteria 2417
194 Ga0070697_100126082 3300005536 Bacteria 2144
195 Ga0070697_100335691 3300005536 Bacteria 1304
196 Ga0070697_100438078 3300005536 Bacteria 1137
197 Ga0070672_100018779 3300005543 Bacteria 5007
198 Ga0070672_100024551 3300005543 Bacteria 4458
199 Ga0070672_100027117 3300005543 Bacteria 4271
200 Ga0070672_100070637 3300005543 Bacteria 2775
201 Ga0070686_100025144 3300005544 Bacteria 3579
202 Ga0070695_100004286 3300005545 Bacteria 8345
203 Ga0070695_100087976 3300005545 Bacteria 2067
204 Ga0070695_100259488 3300005545 Bacteria 1268
205 Ga0070696_100010482 3300005546 Bacteria 6212
206 Ga0070696_100123220 3300005546 Bacteria 1878
207 Ga0070693_100007368 3300005547 Bacteria 5376
208 Ga0070665_100000925 3300005548 Bacteria 37583
209 Ga0070665_100011376 3300005548 Bacteria 8997
210 Ga0070665_100014932 3300005548 Bacteria 7797
211 Ga0070665_100277477 3300005548 Bacteria 1678
212 Ga0070665_100290589 3300005548 Bacteria 1637
213 Ga0070704_100025461 3300005549 Bacteria 3896
214 Ga0070704_100044152 3300005549 Bacteria 3095
215 Ga0070704_100107089 3300005549 Bacteria 2119
216 Ga0070704_100107772 3300005549 Bacteria 2114
217 Ga0070704_100200212 3300005549 Bacteria 1612
218 Ga0070704_100293070 3300005549 Bacteria 1353
219 Ga0068855_100000676 3300005563 Bacteria 41621
220 Ga0068855_100071671 3300005563 Bacteria 4028
221 Ga0068855_100117700 3300005563 Bacteria 3043
222 Ga0070664_100078735 3300005564 Bacteria 2835
223 Ga0070664_100094832 3300005564 Bacteria 2588
224 Ga0070664_100121982 3300005564 Bacteria 2283
225 Ga0068857_100007676 3300005577 Bacteria 9292
226 Ga0068857_100036654 3300005577 Bacteria 4346
227 Ga0068857_100252613 3300005577 Bacteria 1617
228 Ga0068854_100226486 3300005578 Bacteria 1482
229 Ga0068854_100294002 3300005578 Bacteria 1312
230 Ga0068856_100000175 3300005614 Bacteria 66501
231 Ga0068856_100000619 3300005614 Bacteria 38918
232 Ga0068856_100006148 3300005614 Bacteria 11781
233 Ga0068856_100057382 3300005614 Bacteria 3843
234 Ga0070702_100003277 3300005615 Bacteria 7212
235 Ga0068852_100058320 3300005616 Bacteria 3344
236 Ga0068859_100046569 3300005617 Bacteria 4355
237 Ga0068859_100082510 3300005617 Bacteria 3257
238 Ga0068859_100101097 3300005617 Bacteria 2939
239 Ga0068859_100109494 3300005617 Bacteria 2824
240 Ga0068859_100150968 3300005617 Bacteria 2399
241 Ga0068859_100551993 3300005617 Bacteria 1246
242 Ga0068859_100621767 3300005617 Bacteria 1173
243 Ga0068864_100000245 3300005618 Bacteria 48553
244 Ga0068864_100004297 3300005618 Bacteria 11712
245 Ga0068864_100008811 3300005618 Bacteria 8318
246 Ga0068864_100069472 3300005618 Bacteria 3063
247 Ga0068864_100084126 3300005618 Bacteria 2795
248 Ga0068866_10270531 3300005718 Bacteria 1048
249 Ga0068861_100003344 3300005719 Bacteria 10623
250 Ga0068863_100000067 3300005841 Bacteria 117275
251 Ga0068863_100000516 3300005841 Bacteria 39335
252 Ga0068863_100000774 3300005841 Bacteria 32090
253 Ga0068863_100001330 3300005841 Bacteria 24613
254 Ga0068863_100018669 3300005841 Bacteria 6636
255 Ga0068863_100047740 3300005841 Bacteria 4061
256 Ga0068863_100080856 3300005841 Bacteria 3078
257 Ga0068863_100187968 3300005841 Bacteria 1985
258 Ga0068858_100000821 3300005842 Bacteria 32408
259 Ga0068858_100008212 3300005842 Bacteria 10036
260 Ga0068858_100011531 3300005842 Bacteria 8339
261 Ga0068858_100013587 3300005842 Bacteria 7684
262 Ga0068858_100017223 3300005842 Bacteria 6781
263 Ga0068858_100027163 3300005842 Bacteria 5317
264 Ga0068858_100159862 3300005842 Bacteria 2121
265 Ga0068858_100222018 3300005842 Bacteria 1790
266 Ga0068858_100321649 3300005842 Bacteria 1478
267 Ga0068858_100532457 3300005842 Bacteria 1137
268 Ga0068860_100000653 3300005843 Bacteria 40425
269 Ga0068860_100001987 3300005843 Bacteria 21593
270 Ga0068860_100005680 3300005843 Bacteria 12596
271 Ga0068860_100011708 3300005843 Bacteria 8645
272 Ga0068860_100033743 3300005843 Bacteria 4911
273 Ga0068860_100265596 3300005843 Bacteria 1674
274 Ga0068860_100293719 3300005843 Bacteria 1591
275 Ga0068862_100000638 3300005844 Bacteria 36283
276 Ga0068862_100042698 3300005844 Bacteria 3863
277 Ga0068862_100130433 3300005844 Bacteria 2223
278 Ga0068862_100257536 3300005844 Bacteria 1592
279 Ga0068862_100421296 3300005844 Bacteria 1253
280 Ga0081455_10000121 3300005937 Bacteria 89580
281 Ga0081455_10021293 3300005937 Bacteria 6084
282 Ga0081538_10009837 3300005981 Bacteria 7912
283 Ga0081540_1000560 3300005983 Bacteria 36099
284 Ga0081540_1094642 3300005983 Bacteria 1304
285 Ga0081539_10000302 3300005985 Bacteria 111364
286 Ga0081539_10000360 3300005985 Bacteria 100156
287 Ga0081539_10003420 3300005985 Bacteria 19537
288 Ga0081539_10023323 3300005985 Bacteria 4057
289 Ga0070717_10025341 3300006028 Bacteria 4716
290 Ga0070717_10125937 3300006028 Bacteria 2199
291 Ga0070717_10136397 3300006028 Bacteria 2114
292 Ga0070716_100000018 3300006173 Bacteria 84686
293 Ga0070716_100013701 3300006173 Bacteria 4137
294 Ga0070712_100003472 3300006175 Bacteria 9703
295 Ga0070712_100049473 3300006175 Bacteria 2919
296 Ga0070712_100053327 3300006175 Bacteria 2823
297 Ga0075362_10044180 3300006177 Bacteria 1975
298 Ga0097621_100000094 3300006237 Bacteria 49275
299 Ga0097621_100002285 3300006237 Bacteria 13129
300 Ga0097621_100052967 3300006237 Bacteria 3307
301 Ga0097621_100115597 3300006237 Bacteria 2271
302 Ga0097621_100115672 3300006237 Bacteria 2270
303 Ga0097621_100226979 3300006237 Bacteria 1629
304 Ga0097621_100248763 3300006237 Bacteria 1556
305 Ga0097621_100309803 3300006237 Bacteria 1396
306 Ga0097621_100508614 3300006237 Bacteria 1092
307 Ga0068871_100000169 3300006358 Bacteria 43542
308 Ga0068871_100000326 3300006358 Bacteria 33216
309 Ga0068871_100018636 3300006358 Bacteria 5282
310 Ga0068871_100049824 3300006358 Bacteria 3387
311 Ga0068871_100084647 3300006358 Bacteria 2632
312 Ga0068871_100146260 3300006358 Bacteria 2012
313 Ga0068871_100226047 3300006358 Bacteria 1623
314 Ga0068871_100231540 3300006358 Bacteria 1604
315 Ga0075428_100025614 3300006844 Bacteria 6532
316 Ga0075428_100193203 3300006844 Bacteria 2201
317 Ga0075430_100095981 3300006846 Bacteria 2478
318 Ga0075430_100437424 3300006846 Bacteria 1080
319 Ga0075431_100007259 3300006847 Bacteria 11032
320 Ga0075431_100023088 3300006847 Bacteria 6360
321 Ga0075431_100061930 3300006847 Bacteria 3861
322 Ga0075431_100195437 3300006847 Bacteria 2071
323 Ga0075431_100253255 3300006847 Bacteria 1788
324 Ga0075433_10015832 3300006852 Bacteria 6200
325 Ga0075433_10023831 3300006852 Bacteria 5156
326 Ga0075433_10224108 3300006852 Bacteria 1670
327 Ga0075433_10351547 3300006852 Bacteria 1302
328 Ga0075434_100019493 3300006871 Bacteria 6566
329 Ga0075434_100131015 3300006871 Bacteria 2526
330 Ga0075434_100173561 3300006871 Bacteria 2176
331 Ga0075434_100276334 3300006871 Bacteria 1699
332 Ga0075429_100017107 3300006880 Bacteria 6270
333 Ga0075429_100327840 3300006880 Bacteria 1340
334 Ga0075429_100500418 3300006880 Bacteria 1065
335 Ga0068865_100000488 3300006881 Bacteria 22225
336 Ga0068865_100002615 3300006881 Bacteria 10705
337 Ga0068865_100040424 3300006881 Bacteria 3169
338 Ga0068865_100050307 3300006881 Bacteria 2878
339 Ga0068865_100076906 3300006881 Bacteria 2384
340 Ga0068865_100255402 3300006881 Bacteria 1385
341 Ga0075436_100021577 3300006914 Bacteria 4421
342 Ga0097620_100046569 3300006931 Bacteria 4355
343 Ga0097620_100082510 3300006931 Bacteria 3257
344 Ga0097620_100101094 3300006931 Bacteria 2939
345 Ga0097620_100109491 3300006931 Bacteria 2824
346 Ga0097620_100150954 3300006931 Bacteria 2399
347 Ga0097620_100551999 3300006931 Bacteria 1246
348 Ga0097620_100621816 3300006931 Bacteria 1173
349 Ga0075435_100073624 3300007076 Bacteria 2793
350 Ga0075435_100185628 3300007076 Bacteria 1758
351 Ga0099794_10107622 3300007265 Bacteria 1395
352 Ga0105250_10061330 3300009092 Bacteria 1512
353 Ga0105240_10002302 3300009093 Bacteria 30894
354 Ga0105240_10013037 3300009093 Bacteria 11442
355 Ga0105240_10037277 3300009093 Bacteria 6250
356 Ga0105240_10061473 3300009093 Bacteria 4681
357 Ga0105240_10102349 3300009093 Bacteria 3481
358 Ga0105240_10138573 3300009093 Bacteria 2911
359 Ga0105240_10217481 3300009093 Bacteria 2228
360 Ga0105240_10392687 3300009093 Bacteria 1564
361 Ga0111539_10023074 3300009094 Bacteria 7642
362 Ga0111539_10031603 3300009094 Bacteria 6431
363 Ga0111539_10034338 3300009094 Bacteria 6151
364 Ga0111539_10060920 3300009094 Bacteria 4471
365 Ga0111539_10144709 3300009094 Bacteria 2783
366 Ga0111539_10147490 3300009094 Bacteria 2755
367 Ga0111539_10300741 3300009094 Bacteria 1867
368 Ga0111539_10623082 3300009094 Bacteria 1256
369 Ga0105245_10001007 3300009098 Bacteria 25602
370 Ga0105245_10006821 3300009098 Bacteria 10021
371 Ga0105245_10013166 3300009098 Bacteria 7208
372 Ga0105245_10020968 3300009098 Bacteria 5730
373 Ga0105245_10075127 3300009098 Bacteria 3076
374 Ga0105245_10113952 3300009098 Bacteria 2518
375 Ga0105245_10115049 3300009098 Bacteria 2506
376 Ga0105245_10145287 3300009098 Bacteria 2237
377 Ga0105245_10217889 3300009098 Bacteria 1840
378 Ga0105245_10269941 3300009098 Bacteria 1659
379 Ga0105247_10003586 3300009101 Bacteria 10071
380 Ga0105247_10013835 3300009101 Bacteria 4837
381 Ga0105247_10213503 3300009101 Bacteria 1302
382 Ga0114129_10011770 3300009147 Bacteria 12446
383 Ga0114129_10028295 3300009147 Bacteria 7941
384 Ga0114129_10090506 3300009147 Bacteria 4241
385 Ga0114129_10281187 3300009147 Bacteria 2223
386 Ga0114129_10341594 3300009147 Bacteria 1986
387 Ga0114129_10466684 3300009147 Bacteria 1654
388 Ga0105243_10000207 3300009148 Bacteria 68914
389 Ga0105243_10013230 3300009148 Bacteria 6239
390 Ga0105243_10467799 3300009148 Bacteria 1187
391 Ga0105243_10489908 3300009148 Bacteria 1162
392 Ga0105241_10012872 3300009174 Bacteria 6139
393 Ga0105241_10138906 3300009174 Bacteria 1976
394 Ga0105241_10224312 3300009174 Bacteria 1581
395 Ga0105241_10430297 3300009174 Bacteria 1163
396 Ga0105242_10000431 3300009176 Bacteria 33417
397 Ga0105242_10003053 3300009176 Bacteria 13084
398 Ga0105242_10004976 3300009176 Bacteria 10275
399 Ga0105242_10016170 3300009176 Bacteria 5795
400 Ga0105242_10027786 3300009176 Bacteria 4497
401 Ga0105242_10167930 3300009176 Bacteria 1926
402 Ga0105242_10262736 3300009176 Bacteria 1560
403 Ga0105242_10288922 3300009176 Bacteria 1492
404 Ga0105248_10003181 3300009177 Bacteria 18199
405 Ga0105248_10004870 3300009177 Bacteria 14858
406 Ga0105248_10007994 3300009177 Bacteria 11616
407 Ga0105248_10031609 3300009177 Bacteria 5915
408 Ga0105248_10043722 3300009177 Bacteria 5024
409 Ga0105248_10139357 3300009177 Bacteria 2736
410 Ga0105248_10192850 3300009177 Bacteria 2296
411 Ga0105248_10207944 3300009177 Bacteria 2205
412 Ga0105248_10422052 3300009177 Bacteria 1502
413 Ga0105237_10051336 3300009545 Bacteria 4142
414 Ga0105237_10063025 3300009545 Bacteria 3706
415 Ga0105237_10175589 3300009545 Bacteria 2142
416 Ga0105238_10040741 3300009551 Bacteria 4706
417 Ga0105249_10001876 3300009553 Bacteria 18203
418 Ga0105249_10042710 3300009553 Bacteria 4124
419 Ga0105249_10128325 3300009553 Bacteria 2418
420 Ga0105249_10175955 3300009553 Bacteria 2078
421 Ga0105249_10268381 3300009553 Bacteria 1699
422 Ga0105249_10302979 3300009553 Bacteria 1603
423 Ga0105249_10376210 3300009553 Bacteria 1445
424 Ga0099796_10044015 3300010159 Bacteria 1523
425 Ga0099796_10062557 3300010159 Bacteria 1323
426 Ga0105239_10016181 3300010375 Bacteria 8252
427 Ga0105239_10023785 3300010375 Bacteria 6746
428 Ga0105239_10046310 3300010375 Bacteria 4766
429 Ga0105239_10318326 3300010375 Bacteria 1754
430 Ga0105239_10341298 3300010375 Bacteria 1690
431 Ga0105246_10004349 3300011119 Bacteria 8618
432 Ga0105246_10006754 3300011119 Bacteria 7015
433 Ga0105246_10332515 3300011119 Bacteria 1239
434 Ga0157373_10064765 3300013100 Bacteria 2587
435 Ga0157371_10068647 3300013102 Bacteria 2509
436 Ga0157370_10004699 3300013104 Bacteria 15568
437 Ga0157370_10405263 3300013104 Bacteria 1255
438 Ga0157369_10001835 3300013105 Bacteria 25661
439 Ga0157369_10042303 3300013105 Bacteria 4971
440 Ga0157369_10047715 3300013105 Bacteria 4648
441 Ga0157369_10556154 3300013105 Bacteria 1186
442 Ga0157374_10000564 3300013296 Bacteria 32849
443 Ga0157374_10007811 3300013296 Bacteria 9133
444 Ga0157374_10023256 3300013296 Bacteria 5541
445 Ga0157374_10045920 3300013296 Bacteria 4043
446 Ga0157374_10126403 3300013296 Bacteria 2471
447 Ga0157374_10311572 3300013296 Bacteria 1558
448 Ga0157374_10446994 3300013296 Bacteria 1294
449 Ga0157374_10629435 3300013296 Bacteria 1084
450 Ga0157378_10000011 3300013297 Bacteria 158889
451 Ga0157378_10000377 3300013297 Bacteria 44150
452 Ga0157378_10005727 3300013297 Bacteria 10877
453 Ga0157378_10006046 3300013297 Bacteria 10604
454 Ga0157378_10009183 3300013297 Bacteria 8610
455 Ga0157378_10009405 3300013297 Bacteria 8514
456 Ga0157378_10022214 3300013297 Bacteria 5584
457 Ga0157378_10036544 3300013297 Bacteria 4346
458 Ga0157378_10078813 3300013297 Bacteria 2973
459 Ga0157378_10175562 3300013297 Bacteria 2012
460 Ga0157378_10195024 3300013297 Bacteria 1913
461 Ga0157378_10250271 3300013297 Bacteria 1696
462 Ga0157378_10276199 3300013297 Bacteria 1618
463 Ga0163162_10054941 3300013306 Bacteria 4007
464 Ga0163162_10062020 3300013306 Bacteria 3778
465 Ga0163162_10065971 3300013306 Bacteria 3668
466 Ga0163162_10072278 3300013306 Bacteria 3504
467 Ga0163162_10073665 3300013306 Bacteria 3472
468 Ga0163162_10081001 3300013306 Bacteria 3316
469 Ga0163162_10163118 3300013306 Bacteria 2351
470 Ga0163162_10401630 3300013306 Bacteria 1503
471 Ga0163162_10560477 3300013306 Bacteria 1270
472 Ga0163162_10594682 3300013306 Bacteria 1233
473 Ga0157372_10002431 3300013307 Bacteria 20169
474 Ga0157372_10025670 3300013307 Bacteria 6408
475 Ga0157372_10029505 3300013307 Bacteria 5990
476 Ga0157372_10083914 3300013307 Bacteria 3609
477 Ga0157372_10402338 3300013307 Bacteria 1595
478 Ga0157375_10002472 3300013308 Bacteria 15994
479 Ga0157375_10004276 3300013308 Bacteria 12387
480 Ga0157375_10011650 3300013308 Bacteria 7768
481 Ga0157375_10043115 3300013308 Bacteria 4373
482 Ga0157375_10065826 3300013308 Bacteria 3614
483 Ga0157375_10065975 3300013308 Bacteria 3611
484 Ga0157375_10075868 3300013308 Bacteria 3387
485 Ga0157375_10089268 3300013308 Bacteria 3138
486 Ga0157375_10092613 3300013308 Bacteria 3086
487 Ga0157375_10119927 3300013308 Bacteria 2738
488 Ga0157375_10161096 3300013308 Bacteria 2385
489 Ga0157375_10214137 3300013308 Bacteria 2084
490 Ga0157375_10275692 3300013308 Bacteria 1844
491 Ga0157375_10562482 3300013308 Bacteria 1301
492 Ga0163163_10000790 3300014325 Bacteria 26827
493 Ga0163163_10001411 3300014325 Bacteria 20302
494 Ga0163163_10469210 3300014325 Bacteria 1319
495 Ga0157380_10000242 3300014326 Bacteria 32787
496 Ga0157380_10004273 3300014326 Bacteria 9891
497 Ga0157380_10009738 3300014326 Bacteria 6896
498 Ga0157380_10015267 3300014326 Bacteria 5642
499 Ga0157380_10057902 3300014326 Bacteria 3088
500 Ga0157380_10340001 3300014326 Bacteria 1400
501 Ga0157380_10483861 3300014326 Bacteria 1198
502 Ga0182008_10009809 3300014497 Bacteria 5152
503 Ga0157379_10003248 3300014968 Bacteria 13778
504 Ga0157379_10011184 3300014968 Bacteria 7822
505 Ga0157379_10017912 3300014968 Bacteria 6239
506 Ga0157379_10038636 3300014968 Bacteria 4257
507 Ga0157379_10043475 3300014968 Bacteria 4011
508 Ga0157379_10152443 3300014968 Bacteria 2085
509 Ga0157379_10188189 3300014968 Bacteria 1866
510 Ga0157379_10225076 3300014968 Bacteria 1700
511 Ga0157376_10002543 3300014969 Bacteria 12365
512 Ga0157376_10011896 3300014969 Bacteria 6435
513 Ga0157376_10017159 3300014969 Bacteria 5514
514 Ga0157376_10021516 3300014969 Bacteria 5010
515 Ga0157376_10102711 3300014969 Bacteria 2501
516 Ga0157376_10108020 3300014969 Bacteria 2444
517 Ga0157376_10168041 3300014969 Bacteria 1995
518 Ga0157376_10172574 3300014969 Bacteria 1970
519 Ga0157376_10370836 3300014969 Bacteria 1376
520 Ga0182005_1002199 3300015265 Bacteria 7163
521 Ga0163161_10312709 3300017792 Bacteria 1240
522 Ga0213873_10022896 3300021358 Bacteria 1484
523 Ga0213872_10008858 3300021361 Bacteria 4846
524 Ga0213872_10009787 3300021361 Bacteria 4582
525 Ga0213874_10000402 3300021377 Bacteria 8612
526 Ga0213876_10035870 3300021384 Bacteria 2615
527 Ga0213876_10042032 3300021384 Bacteria 2415
528 Ga0213876_10072411 3300021384 Bacteria 1820
529 Ga0213875_10000062 3300021388 Bacteria 130710
530 Ga0213875_10000712 3300021388 Bacteria 25532
531 Ga0213875_10001965 3300021388 Bacteria 12721
532 Ga0213875_10004962 3300021388 Bacteria 7217
533 Ga0213875_10009151 3300021388 Bacteria 5028
534 Ga0213875_10091018 3300021388 Bacteria 1423
535 Ga0213875_10097957 3300021388 Bacteria 1368
536 Ga0213875_10126729 3300021388 Bacteria 1193
537 Ga0209436_100059 3300025208 Bacteria 60623
538 Ga0207425_1000002 3300025245 Bacteria 1362590
539 Ga0209026_1000201 3300025250 Bacteria 82838
540 Ga0209677_101796 3300025253 Bacteria 8814
541 Ga0209129_1000002 3300025258 Bacteria 1359086
542 Ga0209455_1001047 3300025272 Bacteria 13720
543 Ga0209130_1000004 3300025284 Bacteria 633436
544 Ga0209130_1000319 3300025284 Bacteria 56344
545 Ga0207673_1008795 3300025290 Bacteria 1283
546 Ga0209025_1000004 3300025294 Bacteria 1361782
547 Ga0209758_1000006 3300025297 Bacteria 1359562
548 Ga0207426_1000003 3300025302 Bacteria 1063212
549 Ga0207426_1000235 3300025302 Bacteria 126601
550 Ga0209051_1010378 3300025303 Bacteria 4713
551 Ga0209257_1000001 3300025304 Bacteria 2274655
552 Ga0207697_10000670 3300025315 Bacteria 19484
553 Ga0207697_10004903 3300025315 Bacteria 6309
554 Ga0207697_10005583 3300025315 Bacteria 5826
555 Ga0207697_10013161 3300025315 Bacteria 3454
556 Ga0207653_10000070 3300025885 Bacteria 76652
557 Ga0207692_10046150 3300025898 Bacteria 2183
558 Ga0207642_10212743 3300025899 Bacteria 1075
559 Ga0207710_10010838 3300025900 Bacteria 3839
560 Ga0207688_10049094 3300025901 Bacteria 2358
561 Ga0207688_10050911 3300025901 Bacteria 2320
562 Ga0207680_10001961 3300025903 Bacteria 9627
563 Ga0207680_10002655 3300025903 Bacteria 8360
564 Ga0207680_10005038 3300025903 Bacteria 6294
565 Ga0207680_10053642 3300025903 Bacteria 2421
566 Ga0207680_10196937 3300025903 Bacteria 1371
567 Ga0207647_10033734 3300025904 Bacteria 3274
568 Ga0207647_10097989 3300025904 Bacteria 1743
569 Ga0207647_10144012 3300025904 Bacteria 1396
570 Ga0207685_10128175 3300025905 Bacteria 1123
571 Ga0207699_10059293 3300025906 Bacteria 2293
572 Ga0207699_10094491 3300025906 Bacteria 1883
573 Ga0207699_10175091 3300025906 Bacteria 1438
574 Ga0207645_10001182 3300025907 Bacteria 21553
575 Ga0207645_10005592 3300025907 Bacteria 9086
576 Ga0207645_10062305 3300025907 Bacteria 2382
577 Ga0207645_10081460 3300025907 Bacteria 2075
578 Ga0207645_10098287 3300025907 Bacteria 1887
579 Ga0207643_10066442 3300025908 Bacteria 2068
580 Ga0207684_10000102 3300025910 Bacteria 162120
581 Ga0207684_10000186 3300025910 Bacteria 98342
582 Ga0207684_10009607 3300025910 Bacteria 8532
583 Ga0207684_10029510 3300025910 Bacteria 4670
584 Ga0207684_10029794 3300025910 Bacteria 4646
585 Ga0207684_10029824 3300025910 Bacteria 4644
586 Ga0207684_10043780 3300025910 Bacteria 3796
587 Ga0207684_10048747 3300025910 Bacteria 3593
588 Ga0207684_10085152 3300025910 Bacteria 2692
589 Ga0207684_10150267 3300025910 Bacteria 2004
590 Ga0207684_10153024 3300025910 Bacteria 1985
591 Ga0207684_10195942 3300025910 Bacteria 1743
592 Ga0207684_10200653 3300025910 Bacteria 1721
593 Ga0207654_10000162 3300025911 Bacteria 42927
594 Ga0207654_10033529 3300025911 Bacteria 2847
595 Ga0207654_10080852 3300025911 Bacteria 1955
596 Ga0207707_10000053 3300025912 Bacteria 116823
597 Ga0207707_10058983 3300025912 Bacteria 3339
598 Ga0207695_10020342 3300025913 Bacteria 7606
599 Ga0207695_10030709 3300025913 Bacteria 5912
600 Ga0207695_10055211 3300025913 Bacteria 4141
601 Ga0207695_10091449 3300025913 Bacteria 3057
602 Ga0207695_10328364 3300025913 Bacteria 1418
603 Ga0207671_10000333 3300025914 Bacteria 69547
604 Ga0207671_10002406 3300025914 Bacteria 20068
605 Ga0207671_10050964 3300025914 Bacteria 3066
606 Ga0207693_10014642 3300025915 Bacteria 6302
607 Ga0207693_10021180 3300025915 Bacteria 5168
608 Ga0207693_10027230 3300025915 Bacteria 4520
609 Ga0207693_10068800 3300025915 Bacteria 2771
610 Ga0207693_10310294 3300025915 Bacteria 1235
611 Ga0207663_10180361 3300025916 Bacteria 1507
612 Ga0207660_10004262 3300025917 Bacteria 9323
613 Ga0207660_10060696 3300025917 Bacteria 2720
614 Ga0207662_10033961 3300025918 Bacteria 2976
615 Ga0207662_10195142 3300025918 Bacteria 1308
616 Ga0207652_10000069 3300025921 Bacteria 109874
617 Ga0207652_10006680 3300025921 Bacteria 9296
618 Ga0207652_10092325 3300025921 Bacteria 2663
619 Ga0207646_10000039 3300025922 Bacteria 188453
620 Ga0207646_10000137 3300025922 Bacteria 99650
621 Ga0207646_10001929 3300025922 Bacteria 24924
622 Ga0207646_10005086 3300025922 Bacteria 13956
623 Ga0207646_10007690 3300025922 Bacteria 10910
624 Ga0207646_10007730 3300025922 Bacteria 10883
625 Ga0207646_10028276 3300025922 Bacteria 5105
626 Ga0207646_10058917 3300025922 Bacteria 3429
627 Ga0207646_10060954 3300025922 Bacteria 3368
628 Ga0207646_10069657 3300025922 Bacteria 3141
629 Ga0207646_10132905 3300025922 Bacteria 2240
630 Ga0207646_10229845 3300025922 Bacteria 1676
631 Ga0207646_10262487 3300025922 Bacteria 1561
632 Ga0207646_10406482 3300025922 Bacteria 1229
633 Ga0207681_10081170 3300025923 Bacteria 2289
634 Ga0207681_10152826 3300025923 Bacteria 1731
635 Ga0207681_10169587 3300025923 Bacteria 1653
636 Ga0207694_10015339 3300025924 Bacteria 5781
637 Ga0207694_10031659 3300025924 Bacteria 4043
638 Ga0207694_10040627 3300025924 Bacteria 3582
639 Ga0207694_10149937 3300025924 Bacteria 1878
640 Ga0207650_10000378 3300025925 Bacteria 41832
641 Ga0207650_10152105 3300025925 Bacteria 1827
642 Ga0207659_10057697 3300025926 Bacteria 2785
643 Ga0207659_10079876 3300025926 Bacteria 2415
644 Ga0207659_10140906 3300025926 Bacteria 1872
645 Ga0207659_10449600 3300025926 Bacteria 1085
646 Ga0207687_10000054 3300025927 Bacteria 89031
647 Ga0207687_10001558 3300025927 Bacteria 15752
648 Ga0207687_10004253 3300025927 Bacteria 9575
649 Ga0207687_10004757 3300025927 Bacteria 9033
650 Ga0207687_10017997 3300025927 Bacteria 4661
651 Ga0207687_10020124 3300025927 Bacteria 4426
652 Ga0207687_10032519 3300025927 Bacteria 3533
653 Ga0207687_10042969 3300025927 Bacteria 3113
654 Ga0207700_10010940 3300025928 Bacteria 5759
655 Ga0207700_10034163 3300025928 Bacteria 3648
656 Ga0207700_10066248 3300025928 Bacteria 2760
657 Ga0207664_10007887 3300025929 Bacteria 7397
658 Ga0207664_10018858 3300025929 Bacteria 5087
659 Ga0207664_10144080 3300025929 Bacteria 2019
660 Ga0207644_10089974 3300025931 Bacteria 2286
661 Ga0207690_10013047 3300025932 Bacteria 4984
662 Ga0207706_10022300 3300025933 Bacteria 5681
663 Ga0207706_10040724 3300025933 Bacteria 4118
664 Ga0207706_10081506 3300025933 Bacteria 2843
665 Ga0207706_10159208 3300025933 Bacteria 1985
666 Ga0207706_10178496 3300025933 Bacteria 1865
667 Ga0207706_10318770 3300025933 Bacteria 1353
668 Ga0207686_10014640 3300025934 Bacteria 4372
669 Ga0207686_10039017 3300025934 Bacteria 2878
670 Ga0207686_10043297 3300025934 Bacteria 2758
671 Ga0207686_10169815 3300025934 Bacteria 1537
672 Ga0207709_10001828 3300025935 Bacteria 14210
673 Ga0207669_10053181 3300025937 Bacteria 2437
674 Ga0207669_10247088 3300025937 Bacteria 1326
675 Ga0207669_10336036 3300025937 Bacteria 1161
676 Ga0207704_10001204 3300025938 Bacteria 11529
677 Ga0207704_10173503 3300025938 Bacteria 1549
678 Ga0207704_10192502 3300025938 Bacteria 1485
679 Ga0207704_10209006 3300025938 Bacteria 1435
680 Ga0207704_10220289 3300025938 Bacteria 1404
681 Ga0207665_10000022 3300025939 Bacteria 109003
682 Ga0207665_10043026 3300025939 Bacteria 3019
683 Ga0207665_10066925 3300025939 Bacteria 2446
684 Ga0207665_10240923 3300025939 Bacteria 1332
685 Ga0207691_10000930 3300025940 Bacteria 29068
686 Ga0207691_10019641 3300025940 Bacteria 6392
687 Ga0207691_10072804 3300025940 Bacteria 3099
688 Ga0207691_10072968 3300025940 Bacteria 3095
689 Ga0207691_10207364 3300025940 Bacteria 1704
690 Ga0207711_10003495 3300025941 Bacteria 13600
691 Ga0207711_10006914 3300025941 Bacteria 9528
692 Ga0207711_10072765 3300025941 Bacteria 2986
693 Ga0207711_10083721 3300025941 Bacteria 2791
694 Ga0207711_10211204 3300025941 Bacteria 1773
695 Ga0207689_10022517 3300025942 Bacteria 5297
696 Ga0207689_10046788 3300025942 Bacteria 3574
697 Ga0207689_10109204 3300025942 Bacteria 2273
698 Ga0207689_10148549 3300025942 Bacteria 1932
699 Ga0207661_10012720 3300025944 Bacteria 6129
700 Ga0207679_10031145 3300025945 Bacteria 3732
701 Ga0207679_10296701 3300025945 Bacteria 1391
702 Ga0207679_10342623 3300025945 Bacteria 1300
703 Ga0207667_10003550 3300025949 Bacteria 19287
704 Ga0207651_10012927 3300025960 Bacteria 4750
705 Ga0207651_10039954 3300025960 Bacteria 3099
706 Ga0207651_10053533 3300025960 Bacteria 2759
707 Ga0207651_10060424 3300025960 Bacteria 2631
708 Ga0207651_10077027 3300025960 Bacteria 2386
709 Ga0207712_10001595 3300025961 Bacteria 15261
710 Ga0207712_10030943 3300025961 Bacteria 3602
711 Ga0207712_10064208 3300025961 Bacteria 2617
712 Ga0207668_10000052 3300025972 Bacteria 97819
713 Ga0207668_10000058 3300025972 Bacteria 92179
714 Ga0207668_10003586 3300025972 Bacteria 9121
715 Ga0207668_10081312 3300025972 Bacteria 2350
716 Ga0207668_10211716 3300025972 Bacteria 1551
717 Ga0207668_10229219 3300025972 Bacteria 1497
718 Ga0207640_10067579 3300025981 Bacteria 2392
719 Ga0207640_10209782 3300025981 Bacteria 1483
720 Ga0207658_10000023 3300025986 Bacteria 190806
721 Ga0207658_10000189 3300025986 Bacteria 65788
722 Ga0207658_10021940 3300025986 Bacteria 4439
723 Ga0207658_10028997 3300025986 Bacteria 3903
724 Ga0207658_10059169 3300025986 Bacteria 2854
725 Ga0207677_10012493 3300026023 Bacteria 4885
726 Ga0207677_10076037 3300026023 Bacteria 2389
727 Ga0207677_10102995 3300026023 Bacteria 2106
728 Ga0207677_10188558 3300026023 Bacteria 1629
729 Ga0207677_10227838 3300026023 Bacteria 1499
730 Ga0207703_10000278 3300026035 Bacteria 56746
731 Ga0207703_10005599 3300026035 Bacteria 10087
732 Ga0207703_10008722 3300026035 Bacteria 8003
733 Ga0207703_10027909 3300026035 Bacteria 4445
734 Ga0207703_10054173 3300026035 Bacteria 3261
735 Ga0207703_10055428 3300026035 Bacteria 3225
736 Ga0207703_10085355 3300026035 Bacteria 2641
737 Ga0207703_10088129 3300026035 Bacteria 2604
738 Ga0207703_10093917 3300026035 Bacteria 2527
739 Ga0207703_10124548 3300026035 Bacteria 2217
740 Ga0207639_10016650 3300026041 Bacteria 5206
741 Ga0207639_10331608 3300026041 Bacteria 1354
742 Ga0207678_10007664 3300026067 Bacteria 9535
743 Ga0207708_10002885 3300026075 Bacteria 12662
744 Ga0207708_10007069 3300026075 Bacteria 8292
745 Ga0207708_10074334 3300026075 Bacteria 2605
746 Ga0207708_10118912 3300026075 Bacteria 2058
747 Ga0207702_10001714 3300026078 Bacteria 21591
748 Ga0207702_10009495 3300026078 Bacteria 8171
749 Ga0207702_10033602 3300026078 Unclassified 4285
750 Ga0207702_10066144 3300026078 Bacteria 3097
751 Ga0207641_10000119 3300026088 Bacteria 117312
752 Ga0207641_10000260 3300026088 Bacteria 66830
753 Ga0207641_10011968 3300026088 Bacteria 7116
754 Ga0207641_10013935 3300026088 Bacteria 6593
755 Ga0207641_10021257 3300026088 Bacteria 5335
756 Ga0207641_10021798 3300026088 Bacteria 5267
757 Ga0207641_10132739 3300026088 Bacteria 2238
758 Ga0207648_10006549 3300026089 Bacteria 11563
759 Ga0207648_10043872 3300026089 Bacteria 3925
760 Ga0207648_10051862 3300026089 Bacteria 3586
761 Ga0207648_10108164 3300026089 Bacteria 2440
762 Ga0207648_10145494 3300026089 Bacteria 2090
763 Ga0207648_10344059 3300026089 Bacteria 1343
764 Ga0207676_10000233 3300026095 Bacteria 48533
765 Ga0207676_10045533 3300026095 Bacteria 3390
766 Ga0207676_10058307 3300026095 Bacteria 3045
767 Ga0207676_10124015 3300026095 Bacteria 2184
768 Ga0207676_10271631 3300026095 Bacteria 1535
769 Ga0207676_10396307 3300026095 Bacteria 1289
770 Ga0207676_10475700 3300026095 Bacteria 1182
771 Ga0207674_10024255 3300026116 Bacteria 6484
772 Ga0207674_10036723 3300026116 Bacteria 5101
773 Ga0207674_10040171 3300026116 Bacteria 4849
774 Ga0207674_10101450 3300026116 Bacteria 2859
775 Ga0207675_100001308 3300026118 Bacteria 24941
776 Ga0207675_100139654 3300026118 Bacteria 2301
777 Ga0207675_100175450 3300026118 Bacteria 2050
778 Ga0207675_100179358 3300026118 Bacteria 2028
779 Ga0207675_100254808 3300026118 Bacteria 1699
780 Ga0207675_100378510 3300026118 Bacteria 1392
781 Ga0207675_100428726 3300026118 Bacteria 1307
782 Ga0207683_10001725 3300026121 Bacteria 19490
783 Ga0207683_10004620 3300026121 Bacteria 11866
784 Ga0207683_10093019 3300026121 Bacteria 2687
785 Ga0207683_10155111 3300026121 Bacteria 2068
786 Ga0207698_10451872 3300026142 Bacteria 1241
787 Ga0209588_1010591 3300027671 Bacteria 2775
788 Ga0209974_10019229 3300027876 Bacteria 2264
789 Ga0207428_10015915 3300027907 Bacteria 6486
790 Ga0207428_10116347 3300027907 Bacteria 2053
791 Ga0207428_10191425 3300027907 Bacteria 1542
792 Ga0268266_10000805 3300028379 Bacteria 41604
793 Ga0268266_10054343 3300028379 Bacteria 3441
794 Ga0268266_10193289 3300028379 Bacteria 1859
795 Ga0268266_10377924 3300028379 Bacteria 1336
796 Ga0268265_10000445 3300028380 Bacteria 43689
797 Ga0268265_10035414 3300028380 Bacteria 3647
798 Ga0268265_10485241 3300028380 Bacteria 1162
799 Ga0268264_10000248 3300028381 Bacteria 101501
800 Ga0268264_10002037 3300028381 Bacteria 18071
801 Ga0268264_10004215 3300028381 Bacteria 12271
802 Ga0268264_10038750 3300028381 Bacteria 3935
803 Ga0268264_10136603 3300028381 Bacteria 2181
804 Ga0268264_10167000 3300028381 Bacteria 1987
805 Ga0268264_10298835 3300028381 Bacteria 1515
806 Ga0268264_10465257 3300028381 Bacteria 1227
807 Ga0268264_10551416 3300028381 Bacteria 1130
808 Ga0265337_1000149 3300028556 Bacteria 35191
809 Ga0265337_1002538 3300028556 Bacteria 8320
810 Ga0265326_10010565 3300028558 Bacteria 2736
811 Ga0265326_10012544 3300028558 Bacteria 2489
812 Ga0265319_1001902 3300028563 Bacteria 11865
813 Ga0265319_1024016 3300028563 Bacteria 2201
814 Ga0265334_10040501 3300028573 Bacteria 1824
815 Ga0265334_10049055 3300028573 Bacteria 1625
816 Ga0265334_10050736 3300028573 Bacteria 1592
817 Ga0265318_10077307 3300028577 Bacteria 1230
818 Ga0265323_10000599 3300028653 Bacteria 19860
819 Ga0265323_10005044 3300028653 Bacteria 5638
820 Ga0265323_10010368 3300028653 Bacteria 3779
821 Ga0265323_10064813 3300028653 Bacteria 1262
822 Ga0265322_10052320 3300028654 Bacteria 1159
823 Ga0265336_10000409 3300028666 Bacteria 26780
824 Ga0265338_10000062 3300028800 Bacteria 196060
825 Ga0265338_10002023 3300028800 Bacteria 31446
826 Ga0265338_10004683 3300028800 Bacteria 18349
827 Ga0265338_10008409 3300028800 Bacteria 12533
828 Ga0265338_10012651 3300028800 Bacteria 9606
829 Ga0265338_10021059 3300028800 Bacteria 6818
830 Ga0265338_10021594 3300028800 Bacteria 6706
831 Ga0265338_10031900 3300028800 Bacteria 5155
832 Ga0265338_10088679 3300028800 Bacteria 2566
833 Ga0265338_10159431 3300028800 Bacteria 1744
834 Ga0265338_10160653 3300028800 Bacteria 1735
835 Ga0265324_10000199 3300029957 Bacteria 45762
836 Ga0265324_10014675 3300029957 Bacteria 2893
837 Ga0265324_10021977 3300029957 Bacteria 2285
838 Ga0265324_10024205 3300029957 Bacteria 2158
839 Ga0265324_10089062 3300029957 Bacteria 1049
840 Ga0265762_1002363 3300030760 Bacteria 3415
841 Ga0265330_10016813 3300031235 Bacteria 3372
842 Ga0265332_10001044 3300031238 Bacteria 16239
843 Ga0265332_10022031 3300031238 Bacteria 2812
844 Ga0265332_10041629 3300031238 Bacteria 1987
845 Ga0265328_10005751 3300031239 Bacteria 5294
846 Ga0265320_10001826 3300031240 Bacteria 15098
847 Ga0265320_10020964 3300031240 Bacteria 3527
848 Ga0265320_10075377 3300031240 Bacteria 1583
849 Ga0265320_10095456 3300031240 Bacteria 1374
850 Ga0265320_10095598 3300031240 Bacteria 1372
851 Ga0265325_10044983 3300031241 Bacteria 2295
852 Ga0265329_10013901 3300031242 Bacteria 2856
853 Ga0265329_10035815 3300031242 Bacteria 1601
854 Ga0265340_10000171 3300031247 Bacteria 32529
855 Ga0265340_10043923 3300031247 Bacteria 2188
856 Ga0265339_10001357 3300031249 Bacteria 18292
857 Ga0265339_10007592 3300031249 Bacteria 6989
858 Ga0265339_10149649 3300031249 Bacteria 1182
859 Ga0265331_10000200 3300031250 Bacteria 73158
860 Ga0265327_10013977 3300031251 Bacteria 5288
861 Ga0265327_10097588 3300031251 Bacteria 1423
862 Ga0265316_10000250 3300031344 Bacteria 61955
863 Ga0265316_10007660 3300031344 Bacteria 10130
864 Ga0265316_10010404 3300031344 Bacteria 8481
865 Ga0265316_10021111 3300031344 Bacteria 5525
866 Ga0265316_10032762 3300031344 Bacteria 4239
867 Ga0265316_10037916 3300031344 Bacteria 3886
868 Ga0265316_10052037 3300031344 Bacteria 3214
869 Ga0265316_10112363 3300031344 Bacteria 2062
870 Ga0265316_10174957 3300031344 Bacteria 1600
871 Ga0265316_10256329 3300031344 Bacteria 1283
872 Ga0307513_10279879 3300031456 Bacteria 1446
873 Ga0307509_10010313 3300031507 Bacteria 11476
874 Ga0265313_10000998 3300031595 Bacteria 27775
875 Ga0265313_10036212 3300031595 Bacteria 2478
876 Ga0265313_10045869 3300031595 Bacteria 2125
877 Ga0265314_10000287 3300031711 Bacteria 73159
878 Ga0265314_10000496 3300031711 Bacteria 50844
879 Ga0265314_10006476 3300031711 Bacteria 10356
880 Ga0265314_10007222 3300031711 Bacteria 9661
881 Ga0265314_10012818 3300031711 Bacteria 6811
882 Ga0265314_10037430 3300031711 Bacteria 3516
883 Ga0265314_10041586 3300031711 Bacteria 3287
884 Ga0265342_10006458 3300031712 Bacteria 8731
885 Ga0265342_10017769 3300031712 Bacteria 4618
886 Ga0265342_10033904 3300031712 Bacteria 3135
887 Ga0307405_10022308 3300031731 Bacteria 3577
888 Ga0307413_10021968 3300031824 Bacteria 3428
889 Ga0307413_10122710 3300031824 Bacteria 1763
890 Ga0307410_10317763 3300031852 Bacteria 1234
891 Ga0307406_10267914 3300031901 Bacteria 1296
892 Ga0307406_10291050 3300031901 Bacteria 1250
893 Ga0307407_10042208 3300031903 Bacteria 2556
894 Ga0307409_100141770 3300031995 Bacteria 2072
895 Ga0307409_100199564 3300031995 Bacteria 1788
896 Ga0307416_100558560 3300032002 Bacteria 1219
897 Ga0307414_10269110 3300032004 Bacteria 1426
898 Ga0307411_10033453 3300032005 Bacteria 3189
899 Ga0307415_100080569 3300032126 Bacteria 2323
900 Ga0307415_100168694 3300032126 Bacteria 1705
901 Ga0307415_100277372 3300032126 Bacteria 1377
902 Ga0307507_10020537 3300033179 Bacteria 7392
903 Ga0307510_10133595 3300033180 Bacteria 2146
904 Ga0373926_0005463 3300035083 Bacteria 4192
905 Ga0373926_0030779 3300035083 Bacteria 1891
906 Ga0373928_0000544 3300035084 Bacteria 7345
907 Ga0373934_0000356 3300035086 Bacteria 15977
908 Ga0373951_0000349 3300035091 Bacteria 14031
909 Ga0373923_0021240 3300035111 Bacteria 2532
910 Ga0373932_0035492 3300035112 Bacteria 1410
911 Ga0373936_0034917 3300035113 Bacteria 2000
912 Ga0373936_0152999 3300035113 Bacteria 1001
913 Ga0373939_0052516 3300035114 Bacteria 1271
914 Ga0373939_0064035 3300035114 Bacteria 1179
915 Ga0373954_0000320 3300035118 Bacteria 17537
916 Ga0373954_0011728 3300035118 Bacteria 3888
917 Ga0373954_0056981 3300035118 Bacteria 1840
918 Ga0373954_0114452 3300035118 Bacteria 1306
919 Ga0373956_0103874 3300035119 Bacteria 1320
920 Ga0373943_0009535 3300035170 Bacteria 4352
921 Ga0373943_0031701 3300035170 Bacteria 2509
922 Ga0373943_0074538 3300035170 Bacteria 1726
923 Ga0373946_0001205 3300035171 Bacteria 8965
924 Ga0373946_0033021 3300035171 Bacteria 2081
925 Ga0373946_0065034 3300035171 Bacteria 1561
926 Ga0373955_0000887 3300035172 Bacteria 12852
927 Ga0373924_0027164 3300035410 Bacteria 2275
928 Ga0373931_0040711 3300035691 Bacteria 2439
929 Ga0373931_0069639 3300035691 Bacteria 1917
930 Ga0373935_0001842 3300035692 Bacteria 11894
931 Ga0373935_0002526 3300035692 Bacteria 10482
932 Ga0373935_0003271 3300035692 Bacteria 9368
933 Ga0373935_0015186 3300035692 Bacteria 4652
934 Ga0373935_0087145 3300035692 Bacteria 2038
935 Ga0373935_0092105 3300035692 Bacteria 1986
936 Ga0373927_0003908 3300035695 Bacteria 10570
937 Ga0373927_0004821 3300035695 Bacteria 9379
938 Ga0373927_0080345 3300035695 Bacteria 2113
939 Ga0373933_0000605 3300035724 Bacteria 22416
940 Ga0373933_0027979 3300035724 Bacteria 3250
941 Ga0373933_0071030 3300035724 Bacteria 2119
942 Ga0373947_0000507 3300035725 Bacteria 22617
943 Ga0373947_0002949 3300035725 Bacteria 10154
944 Ga0373947_0008787 3300035725 Bacteria 5807
945 Ga0373947_0018213 3300035725 Bacteria 4042
946 Ga0373947_0320075 3300035725 Bacteria 1037
947 Ga0373937_0000865 3300036401 Bacteria 26028
948 Ga0373937_0004802 3300036401 Bacteria 11481
949 Ga0373937_0017297 3300036401 Bacteria 6421
950 Ga0373937_0039010 3300036401 Bacteria 4328
951 Ga0373937_0041707 3300036401 Bacteria 4187
952 Ga0373937_0087370 3300036401 Bacteria 2886
953 Ga0373937_0107137 3300036401 Bacteria 2598
954 Ga0373937_0142331 3300036401 Bacteria 2244
955 Ga0373937_0151635 3300036401 Bacteria 2171
956 Ga0373937_0179329 3300036401 Bacteria 1989
957 Ga0373937_0327123 3300036401 Bacteria 1450
958 Ga0373937_0499645 3300036401 Bacteria 1156
959 Ga0316584_0074581 3300036712 Bacteria 2543
960 Ga0373925_0000612 3300037068 Bacteria 34051
961 Ga0373925_0003562 3300037068 Bacteria 12001
962 Ga0373925_0010345 3300037068 Bacteria 6769
963 Ga0373925_0023125 3300037068 Bacteria 4535
964 Ga0373925_0025660 3300037068 Bacteria 4308
965 Ga0373925_0159208 3300037068 Bacteria 1777
966 Ga0395899_0030383 3300037312 Bacteria 4064
967 Ga0395900_0001621 3300037418 Bacteria 26442
968 Ga0395900_0011582 3300037418 Bacteria 9027
969 Ga0395898_0003152 3300037466 Bacteria 18624
970 Ga0395898_0060658 3300037466 Bacteria 3675
971 Ga0395898_0062711 3300037466 Bacteria 3610
972 Ga0395898_0207989 3300037466 Bacteria 1867
973 Ga0395905_0007261 3300037471 Bacteria 11041
974 Ga0436364_0133217 3300037853 Bacteria 1364
975 Ga0436364_0370592 3300037853 Bacteria 18758
976 Ga0436364_0373624 3300037853 Bacteria 1577
977 Ga0436364_0487501 3300037853 Bacteria 5781
978 Ga0436364_0536254 3300037853 Bacteria 19799
979 Ga0436364_0604091 3300037853 Bacteria 4141
980 Ga0436364_1091631 3300037853 Bacteria 18124
981 Ga0436364_1332997 3300037853 Bacteria 379560
982 Ga0436364_1380142 3300037853 Bacteria 5391
983 Ga0395901_0011354 3300038443 Bacteria 9026
984 Ga0395901_0239310 3300038443 Bacteria 1893
985 Ga0395901_0389523 3300038443 Bacteria 1433
986 Ga0436365_0371105 3300039437 Bacteria 2418
987 Ga0436365_0538371 3300039437 Bacteria 1645
988 Ga0436365_0570153 3300039437 Bacteria 3172
989 Ga0436365_1219656 3300039437 Bacteria 1900
990 Ga0436365_1888099 3300039437 Bacteria 7490
991 Ga0436360_0291192 3300039438 Bacteria 1327
992 Ga0436360_0429766 3300039438 Bacteria 1690
993 Ga0436360_0726393 3300039438 Bacteria 23002
994 Ga0436361_0229082 3300039447 Bacteria 32516
995 Ga0436361_0317667 3300039447 Bacteria 7858
996 Ga0436361_0581469 3300039447 Bacteria 14069
997 Ga0436361_0701016 3300039447 Bacteria 6688
998 Ga0436363_0054131 3300039450 Bacteria 10763
999 Ga0436363_1349028 3300039450 Bacteria 3063
1000 Ga0436363_1394143 3300039450 Bacteria 2217
1001 Ga0436362_1286717 3300039453 Bacteria 2170
1002 Ga0439448_0001932 3300042005 Bacteria 5520
1003 Ga0439448_0051395 3300042005 Bacteria 1349
1004 Ga0439455_0030351 3300042012 Bacteria 1341
1005 Ga0450896_007516 3300042133 Bacteria 1503
1006 Ga0439458_0004304 3300042157 Bacteria 3279
1007 Ga0451577_0001929 3300042876 Bacteria 26186
1008 Ga0451577_0012657 3300042876 Bacteria 7915
1009 Ga0451577_0018774 3300042876 Bacteria 6362
1010 Ga0451577_0098264 3300042876 Bacteria 2615
1011 Ga0451577_0260324 3300042876 Bacteria 1571
1012 Ga0453683_0000083 3300044673 Bacteria 143013
1013 Ga0453683_0000413 3300044673 Bacteria 49889
1014 Ga0453683_0012580 3300044673 Bacteria 5544
1015 Ga0453683_0014972 3300044673 Bacteria 5033
1016 Ga0453683_0023315 3300044673 Bacteria 3945
1017 Ga0453683_0195162 3300044673 Bacteria 1285
1018 Ga0466961_0245827 3300044693 Bacteria 1099
1019 Ga0453684_0000031 3300044712 Bacteria 752632
1020 Ga0453684_0000176 3300044712 Bacteria 283097
1021 Ga0453684_0000378 3300044712 Bacteria 183374
1022 Ga0453684_0018006 3300044712 Bacteria 10879
1023 Ga0453684_0026060 3300044712 Bacteria 8464
1024 Ga0453684_0029656 3300044712 Bacteria 7757
1025 Ga0453684_0069666 3300044712 Bacteria 4459
1026 Ga0453684_0196291 3300044712 Bacteria 2357
1027 Ga0453684_0247205 3300044712 Bacteria 2050
1028 Ga0453684_0367959 3300044712 Bacteria 1617
1029 Ga0453684_0669034 3300044712 Bacteria 1131
1030 Ga0451576_0000492 3300045051 Bacteria 87364
1031 Ga0451576_0022281 3300045051 Bacteria 6872
1032 Ga0451576_0060606 3300045051 Bacteria 3947
1033 Ga0451576_0372030 3300045051 Bacteria 1497
1034 Ga0451576_0466969 3300045051 Bacteria 1325
1035 Ga0466958_0122384 3300045836 Bacteria 1630
1036 Ga0466967_0136204 3300045976 Bacteria 2284
1037 Ga0466967_0341596 3300045976 Bacteria 1448
1038 Ga0495592_0006890 3300046454 Bacteria 8487
1039 Ga0495592_0033565 3300046454 Bacteria 3870
1040 Ga0495592_0091053 3300046454 Bacteria 2187
1041 Ga0495592_0098677 3300046454 Bacteria 2084
1042 Ga0495592_0119993 3300046454 Bacteria 1851
1043 Ga0495603_0067126 3300046455 Bacteria 2112
1044 Ga0495603_0104079 3300046455 Bacteria 1656
1045 Ga0495603_0115944 3300046455 Bacteria 1562
1046 Ga0495591_035116 3300046458 Bacteria 1470
1047 Ga0495629_0065810 3300046459 Bacteria 2529
1048 Ga0495629_0290844 3300046459 Bacteria 1120
1049 Ga0495641_0006504 3300046461 Bacteria 7553
1050 Ga0495651_0001881 3300046462 Bacteria 16232
1051 Ga0495651_0005822 3300046462 Bacteria 9405
1052 Ga0495651_0007904 3300046462 Bacteria 8148
1053 Ga0495651_0025796 3300046462 Bacteria 4576
1054 Ga0495651_0028110 3300046462 Bacteria 4383
1055 Ga0495651_0045409 3300046462 Bacteria 3404
1056 Ga0495651_0059436 3300046462 Bacteria 2931
1057 Ga0495651_0086151 3300046462 Bacteria 2364
1058 Ga0495651_0093146 3300046462 Bacteria 2256
1059 Ga0495651_0152192 3300046462 Bacteria 1666
1060 Ga0495651_0223551 3300046462 Bacteria 1301
1061 Ga0495653_0005872 3300046463 Bacteria 10047
1062 Ga0495653_0030629 3300046463 Bacteria 4283
1063 Ga0495653_0033646 3300046463 Bacteria 4059
1064 Ga0495653_0041250 3300046463 Bacteria 3603
1065 Ga0495653_0081683 3300046463 Bacteria 2388
1066 Ga0495653_0105402 3300046463 Bacteria 2035
1067 Ga0495653_0287306 3300046463 Bacteria 1077
1068 Ga0495650_0001148 3300046471 Bacteria 28561
1069 Ga0495580_0000005 3300046472 Bacteria 107243
1070 Ga0495580_0012772 3300046472 Bacteria 6436
1071 Ga0495580_0014051 3300046472 Bacteria 6089
1072 Ga0495580_0016045 3300046472 Bacteria 5631
1073 Ga0495580_0020839 3300046472 Bacteria 4845
1074 Ga0495580_0022435 3300046472 Bacteria 4646
1075 Ga0495580_0031927 3300046472 Bacteria 3802
1076 Ga0495582_0000069 3300046473 Bacteria 52545
1077 Ga0495582_0046079 3300046473 Bacteria 2401
1078 Ga0495582_0049681 3300046473 Bacteria 2310
1079 Ga0495639_0030998 3300046475 Bacteria 2378
1080 Ga0495639_0052392 3300046475 Bacteria 1857
1081 Ga0495662_0009401 3300046476 Bacteria 4795
1082 Ga0495662_0153635 3300046476 Bacteria 1133
1083 Ga0495664_0000216 3300046477 Bacteria 27589
1084 Ga0495664_0000862 3300046477 Bacteria 15556
1085 Ga0495664_0017805 3300046477 Bacteria 4062
1086 Ga0495664_0027607 3300046477 Bacteria 3310
1087 Ga0495585_0036748 3300046492 Bacteria 2760
1088 Ga0495594_0000383 3300046499 Bacteria 22193
1089 Ga0495594_0000482 3300046499 Bacteria 20316
1090 Ga0495594_0004767 3300046499 Bacteria 6987
1091 Ga0495594_0143330 3300046499 Bacteria 1356
1092 Ga0495583_0003963 3300046506 Bacteria 10932
1093 Ga0495606_0121365 3300046507 Bacteria 1564
1094 Ga0495608_0008788 3300046511 Bacteria 7067
1095 Ga0495608_0023856 3300046511 Bacteria 4186
1096 Ga0495608_0068885 3300046511 Bacteria 2313
1097 Ga0495608_0074525 3300046511 Bacteria 2212
1098 Ga0495608_0075383 3300046511 Bacteria 2198
1099 Ga0495608_0087227 3300046511 Bacteria 2022
1100 Ga0495610_0000265 3300046512 Bacteria 54569
1101 Ga0495618_0008303 3300046514 Bacteria 6289
1102 Ga0495618_0017329 3300046514 Bacteria 4415
1103 Ga0495618_0047286 3300046514 Bacteria 2716
1104 Ga0495618_0096307 3300046514 Bacteria 1893
1105 Ga0495618_0135208 3300046514 Bacteria 1577
1106 Ga0495618_0157208 3300046514 Bacteria 1450
1107 Ga0495618_0202461 3300046514 Bacteria 1256
1108 Ga0495628_0018249 3300046516 Bacteria 5817
1109 Ga0495628_0038738 3300046516 Bacteria 3814
1110 Ga0495628_0052039 3300046516 Bacteria 3235
1111 Ga0495628_0062914 3300046516 Bacteria 2908
1112 Ga0495628_0138606 3300046516 Bacteria 1857
1113 Ga0495630_0003042 3300046517 Bacteria 11636
1114 Ga0495630_0003586 3300046517 Bacteria 10809
1115 Ga0495630_0024936 3300046517 Bacteria 4421
1116 Ga0495630_0036191 3300046517 Bacteria 3690
1117 Ga0495644_0000012 3300046523 Bacteria 94927
1118 Ga0495663_0000033 3300046525 Bacteria 78025
1119 Ga0495666_0002245 3300046526 Bacteria 9613
1120 Ga0495666_0008619 3300046526 Bacteria 5108
1121 Ga0495666_0030447 3300046526 Bacteria 2648
1122 Ga0495642_0042856 3300046528 Bacteria 1845
1123 Ga0495652_0017584 3300046529 Bacteria 6378
1124 Ga0495652_0023631 3300046529 Bacteria 5448
1125 Ga0495652_0035703 3300046529 Bacteria 4326
1126 Ga0495652_0040180 3300046529 Bacteria 4042
1127 Ga0495652_0049745 3300046529 Bacteria 3587
1128 Ga0495652_0066152 3300046529 Bacteria 3035
1129 Ga0495652_0096413 3300046529 Bacteria 2408
1130 Ga0495652_0142918 3300046529 Bacteria 1880
1131 Ga0495665_0003556 3300046531 Bacteria 8464
1132 Ga0495665_0024280 3300046531 Bacteria 3256
1133 Ga0495665_0026992 3300046531 Bacteria 3083
1134 Ga0495665_0037118 3300046531 Bacteria 2601
1135 Ga0495665_0065223 3300046531 Bacteria 1922
1136 Ga0495640_0009211 3300046533 Bacteria 7701
1137 Ga0495640_0034451 3300046533 Bacteria 3590
1138 Ga0495640_0046776 3300046533 Bacteria 2996
1139 Ga0495640_0058208 3300046533 Bacteria 2636
1140 Ga0495640_0139067 3300046533 Bacteria 1566
1141 Ga0495640_0158546 3300046533 Bacteria 1451
1142 Ga0495586_0000795 3300046535 Bacteria 18157
1143 Ga0495586_0003395 3300046535 Bacteria 8538
1144 Ga0495586_0025354 3300046535 Bacteria 3173
1145 Ga0495586_0092992 3300046535 Bacteria 1667
1146 Ga0495586_0107870 3300046535 Bacteria 1549
1147 Ga0495586_0129140 3300046535 Bacteria 1415
1148 Ga0495587_0002734 3300046536 Bacteria 11764
1149 Ga0495587_0023653 3300046536 Bacteria 3775
1150 Ga0495587_0038560 3300046536 Bacteria 2864
1151 Ga0495587_0039068 3300046536 Bacteria 2843
1152 Ga0495587_0043007 3300046536 Bacteria 2692
1153 Ga0495587_0053621 3300046536 Bacteria 2377
1154 Ga0495587_0061050 3300046536 Bacteria 2209
1155 Ga0495587_0072533 3300046536 Bacteria 2001
1156 Ga0495598_0015004 3300046537 Bacteria 1947
1157 Ga0495645_0006117 3300046543 Bacteria 8329
1158 Ga0495645_0009545 3300046543 Bacteria 6784
1159 Ga0495645_0029979 3300046543 Bacteria 3963
1160 Ga0495645_0031063 3300046543 Bacteria 3891
1161 Ga0495645_0041386 3300046543 Bacteria 3361
1162 Ga0495667_0002418 3300046559 Bacteria 12466
1163 Ga0495667_0072699 3300046559 Bacteria 2241
1164 Ga0495667_0095380 3300046559 Bacteria 1926
1165 Ga0495667_0116318 3300046559 Bacteria 1727
1166 Ga0495667_0128390 3300046559 Bacteria 1635
1167 Ga0495667_0179480 3300046559 Bacteria 1359
1168 Ga0495667_0273722 3300046559 Bacteria 1072
1169 Ga0495634_0006223 3300046642 Bacteria 9094
1170 Ga0495634_0016956 3300046642 Bacteria 5202
1171 Ga0495634_0018600 3300046642 Bacteria 4943
1172 Ga0495634_0028589 3300046642 Bacteria 3869
1173 Ga0495634_0070688 3300046642 Bacteria 2300
1174 Ga0495625_0014137 3300046660 Bacteria 6388
1175 Ga0495625_0027398 3300046660 Bacteria 4291
1176 Ga0495625_0035786 3300046660 Bacteria 3656
1177 Ga0495625_0040680 3300046660 Bacteria 3387
1178 Ga0495635_0004619 3300046663 Bacteria 9554
1179 Ga0495635_0006363 3300046663 Bacteria 8226
1180 Ga0495635_0014361 3300046663 Bacteria 5539
1181 Ga0495635_0017110 3300046663 Bacteria 5064
1182 Ga0495635_0026814 3300046663 Bacteria 4008
1183 Ga0495635_0045599 3300046663 Bacteria 3025
1184 Ga0495635_0054795 3300046663 Bacteria 2746
1185 Ga0495635_0144725 3300046663 Bacteria 1618
1186 Ga0495635_0156442 3300046663 Bacteria 1551
1187 Ga0495659_0054197 3300046664 Bacteria 1467
1188 Ga0495657_0012734 3300046675 Bacteria 6237
1189 Ga0495657_0058842 3300046675 Bacteria 2550
1190 Ga0495657_0080928 3300046675 Bacteria 2101
1191 Ga0495657_0152753 3300046675 Bacteria 1432
1192 Ga0495599_0001612 3300046678 Bacteria 13001
1193 Ga0495599_0003150 3300046678 Bacteria 9612
1194 Ga0495599_0039902 3300046678 Bacteria 2949
1195 Ga0495599_0151054 3300046678 Bacteria 1438
1196 Ga0495623_0004871 3300046679 Bacteria 8802
1197 Ga0495623_0009951 3300046679 Bacteria 6161
1198 Ga0495623_0017662 3300046679 Bacteria 4608
1199 Ga0495623_0205618 3300046679 Bacteria 1129
1200 Ga0495646_0003046 3300046680 Bacteria 10387
1201 Ga0495646_0003994 3300046680 Bacteria 9237
1202 Ga0495646_0008129 3300046680 Bacteria 6667
1203 Ga0495646_0019786 3300046680 Bacteria 4257
1204 Ga0495669_0055505 3300046684 Bacteria 1784
1205 Ga0495613_0005396 3300046689 Bacteria 9603
1206 Ga0495613_0009476 3300046689 Bacteria 7224
1207 Ga0495613_0175973 3300046689 Bacteria 1517
1208 Ga0495624_0004930 3300046690 Bacteria 9677
1209 Ga0495624_0006474 3300046690 Bacteria 8309
1210 Ga0495624_0054859 3300046690 Bacteria 2512
1211 Ga0495670_0084253 3300046691 Bacteria 1622
1212 Ga0495670_0127292 3300046691 Bacteria 1326
1213 Ga0495600_0017512 3300046809 Bacteria 4559
1214 Ga0495600_0066872 3300046809 Bacteria 2349
1215 Ga0495600_0129209 3300046809 Bacteria 1643
1216 Ga0495600_0233198 3300046809 Bacteria 1174
1217 Ga0495600_0247299 3300046809 Bacteria 1135
1218 Ga0495600_0288469 3300046809 Bacteria 1037
1219 Ga0495581_0005607 3300047315 Bacteria 7275
1220 Ga0495581_0006451 3300047315 Bacteria 6806
1221 Ga0495581_0117353 3300047315 Bacteria 1547
1222 Ga0495604_0001103 3300047317 Bacteria 22417
1223 Ga0495604_0005017 3300047317 Bacteria 10478
1224 Ga0495604_0037613 3300047317 Bacteria 3810
1225 Ga0495604_0040906 3300047317 Bacteria 3637
1226 Ga0495604_0044454 3300047317 Bacteria 3470
1227 Ga0495604_0082467 3300047317 Bacteria 2405
1228 Ga0495674_0000912 3300047319 Bacteria 28257
1229 Ga0495674_0007439 3300047319 Bacteria 10466
1230 Ga0495674_0028334 3300047319 Bacteria 5109
1231 Ga0495674_0037507 3300047319 Bacteria 4355
1232 Ga0495674_0042768 3300047319 Bacteria 4038
1233 Ga0495674_0080128 3300047319 Bacteria 2802
1234 Ga0495676_0016450 3300047321 Bacteria 6566
1235 Ga0495676_0016996 3300047321 Bacteria 6441
1236 Ga0495676_0095099 3300047321 Bacteria 2218
1237 Ga0495676_0122192 3300047321 Bacteria 1892
1238 Ga0495680_0002369 3300047322 Bacteria 19308
1239 Ga0495680_0004393 3300047322 Bacteria 13495
1240 Ga0495680_0011828 3300047322 Bacteria 7707
1241 Ga0495680_0045174 3300047322 Bacteria 3479
1242 Ga0495680_0087530 3300047322 Bacteria 2343
1243 Ga0495680_0101994 3300047322 Bacteria 2137
1244 Ga0495680_0111643 3300047322 Bacteria 2025
1245 Ga0495680_0192461 3300047322 Bacteria 1467
1246 Ga0495680_0194159 3300047322 Bacteria 1459
1247 Ga0495683_0044672 3300047323 Bacteria 2228
1248 Ga0495675_0001196 3300047444 Bacteria 15724
1249 Ga0495675_0001458 3300047444 Bacteria 14312
1250 Ga0495677_0043299 3300047445 Bacteria 1650
1251 Ga0495677_0045585 3300047445 Bacteria 1609
1252 Ga0495684_0006500 3300047471 Bacteria 9073
1253 Ga0495684_0008177 3300047471 Bacteria 8095
1254 Ga0495684_0009817 3300047471 Bacteria 7387
1255 Ga0495684_0016290 3300047471 Bacteria 5723
1256 Ga0495684_0042837 3300047471 Bacteria 3466
1257 Ga0495684_0049566 3300047471 Bacteria 3208
1258 Ga0495684_0060950 3300047471 Bacteria 2871
1259 Ga0495686_0002950 3300047472 Bacteria 15218
1260 Ga0495686_0015012 3300047472 Bacteria 5309
1261 Ga0495686_0081955 3300047472 Bacteria 1969
1262 Ga0495593_0002720 3300047673 Bacteria 10641
1263 Ga0495593_0034123 3300047673 Bacteria 2769
1264 Ga0495602_0013888 3300048088 Bacteria 8208
1265 Ga0495602_0035465 3300048088 Bacteria 4651
1266 Ga0495602_0046043 3300048088 Bacteria 3944
1267 Ga0495602_0063468 3300048088 Bacteria 3200
1268 Ga0495602_0065150 3300048088 Bacteria 3146
1269 Ga0495602_0082466 3300048088 Bacteria 2698
1270 Ga0495614_0000198 3300048089 Bacteria 23064
1271 Ga0495614_0005949 3300048089 Bacteria 5496
1272 Ga0496100_0016385 3300048903 Bacteria 4352
1273 Ga0496102_0050198 3300048905 Bacteria 3798
1274 Ga0496102_0198817 3300048905 Bacteria 1889
1275 Ga0496103_0035231 3300048906 Bacteria 3064
1276 Ga0496103_0036123 3300048906 Bacteria 3026
1277 Ga0496103_0109609 3300048906 Bacteria 1753
1278 Ga0496105_0003703 3300048908 Bacteria 11375
1279 Ga0496106_0013197 3300048909 Bacteria 6096
1280 Ga0496106_0060961 3300048909 Bacteria 2861
1281 Ga0496106_0063213 3300048909 Bacteria 2813
1282 Ga0496106_0194237 3300048909 Bacteria 1614
1283 Ga0496107_0155270 3300048910 Bacteria 1694
1284 Ga0496108_0295354 3300048911 Bacteria 1411
1285 Ga0496111_0074613 3300048914 Bacteria 2471
1286 Ga0496111_0168349 3300048914 Bacteria 1628
1287 Ga0496112_0070151 3300048915 Bacteria 3463
1288 Ga0496112_0097830 3300048915 Bacteria 2905
1289 Ga0496112_0131171 3300048915 Bacteria 2477
1290 Ga0496112_0243602 3300048915 Bacteria 1750
1291 Ga0496114_0011141 3300048917 Bacteria 7178
1292 Ga0496115_0020895 3300048918 Bacteria 5052
1293 Ga0496115_0164618 3300048918 Bacteria 1834
1294 Ga0496121_0024678 3300048924 Bacteria 5739
1295 Ga0496125_0037733 3300048928 Bacteria 4197
1296 Ga0496126_0049743 3300048929 Bacteria 3825
1297 Ga0496126_0056393 3300048929 Bacteria 3552
1298 Ga0495682_0004828 3300049460 Bacteria 5692
1299 Ga0495682_0034538 3300049460 Bacteria 1864
1300 Ga0501039_0233466 3300049575 Bacteria 1446
1301 Ga0501042_0168353 3300049578 Bacteria 1581
1302 Ga0501046_0282185 3300049580 Bacteria 1216
1303 Ga0501047_0312864 3300049581 Bacteria 1411
1304 Ga0501048_0025299 3300049582 Bacteria 4326
1305 Ga0501074_0131124 3300049590 Bacteria 1793
1306 Ga0501075_0038275 3300049591 Bacteria 3584
1307 Ga0501076_0081885 3300049592 Bacteria 2591
1308 Ga0501076_0217474 3300049592 Bacteria 1562
1309 Ga0501243_010672 3300049675 Bacteria 1436
1310 Ga0501080_0242373 3300049742 Bacteria 1645
1311 Ga0501080_0411658 3300049742 Bacteria 1216
1312 Ga0501035_0313226 3300049822 Bacteria 1320
1313 Ga0501044_0015871 3300049823 Bacteria 8105
1314 Ga0501044_0063489 3300049823 Bacteria 3773
1315 Ga0501045_0023940 3300049824 Bacteria 4383
1316 nmdc:mga06z11_1152_c1 3300050494 Bacteria 9668
1317 nmdc:mga04h51_23032_c1 3300050495 Bacteria 1892
1318 nmdc:mga05p37_130095_c1 3300050507 Bacteria 3089
1319 nmdc:mga05p37_137720_c1 3300050507 Bacteria 2992
1320 nmdc:mga05p37_150658_c1 3300050507 Bacteria 2845
1321 nmdc:mga05p37_172972_c1 3300050507 Bacteria 2633
1322 nmdc:mga05p37_177877_c1 3300050507 Bacteria 2591
1323 nmdc:mga05p37_321425_c1 3300050507 Bacteria 1831
1324 nmdc:mga05p37_36329_c1 3300050507 Bacteria 6044
1325 nmdc:mga05p37_44683_c1 3300050507 Bacteria 5451
1326 nmdc:mga05p37_57342_c1 3300050507 Bacteria 4797
1327 nmdc:mga09592_26822_c1 3300050508 Bacteria 4775
1328 nmdc:mga09592_294676_c1 3300050508 Bacteria 1406
1329 nmdc:mga09592_75820_c1 3300050508 Bacteria 2860
1330 nmdc:mga09592_96752_c1 3300050508 Bacteria 2526
1331 nmdc:mga0qj67_13243_c1 3300050509 Bacteria 2621
1332 nmdc:mga0qj67_66633_c1 3300050509 Bacteria 2868
1333 nmdc:mga0qj67_86160_c1 3300050509 Bacteria 2520
1334 nmdc:mga06r32_19899_c1 3300050510 Bacteria 6170
1335 nmdc:mga06r32_226115_c1 3300050510 Bacteria 1860
1336 nmdc:mga06r32_2295_c1 3300050510 Bacteria 17117
1337 nmdc:mga06r32_27073_c1 3300050510 Bacteria 5352
1338 nmdc:mga06r32_44349_c1 3300050510 Bacteria 4235
1339 nmdc:mga06r32_54053_c1 3300050510 Bacteria 3850
1340 nmdc:mga06r32_82487_c1 3300050510 Bacteria 3132
1341 nmdc:mga08y16_118505_c1 3300050511 Bacteria 2755
1342 nmdc:mga08y16_142269_c1 3300050511 Bacteria 2494
1343 nmdc:mga08y16_198243_c1 3300050511 Bacteria 2081
1344 nmdc:mga08y16_659677_c1 3300050511 Bacteria 1049
1345 nmdc:mga08y16_68575_c1 3300050511 Bacteria 3698
1346 nmdc:mga08y16_74282_c1 3300050511 Bacteria 3542
1347 nmdc:mga0n895_176626_c1 3300050512 Bacteria 2166
1348 nmdc:mga0n895_45674_c1 3300050512 Bacteria 4275
1349 nmdc:mga0n895_62619_c1 3300050512 Bacteria 3677
1350 nmdc:mga08x19_121460_c1 3300050514 Bacteria 1752
1351 nmdc:mga0a205_116816_c1 3300050515 Bacteria 2566
1352 nmdc:mga0a205_141836_c1 3300050515 Bacteria 2303
1353 nmdc:mga0a205_23177_c1 3300050515 Bacteria 5887
1354 nmdc:mga0a205_342959_c1 3300050515 Bacteria 1362
1355 nmdc:mga0a205_377078_c1 3300050515 Bacteria 1284
1356 nmdc:mga0a205_95256_c1 3300050515 Bacteria 2875
1357 Ga0495601_0007954 3300053077 Bacteria 6244
1358 Ga0495601_0014465 3300053077 Bacteria 4756
1359 Ga0495601_0078545 3300053077 Bacteria 2115
1360 Ga0495612_0003186 3300053078 Bacteria 6795
1361 Ga0495595_0150078 3300053084 Bacteria 1147
1362 Ga0495619_0000889 3300053085 Bacteria 19600
1363 Ga0495619_0007289 3300053085 Bacteria 7003
1364 Ga0500643_005785 3300053087 Bacteria 5276
1365 Ga0500651_0033294 3300053093 Bacteria 3250
1366 Ga0500641_0006567 3300053096 Bacteria 4128
1367 Ga0500555_000080 3300053103 Bacteria 46241
1368 Ga0500556_0000010 3300053104 Bacteria 258288
1369 Ga0500556_0001547 3300053104 Bacteria 9386
1370 Ga0500618_008647 3300053125 Bacteria 2827
1371 Ga0500642_0022100 3300053130 Bacteria 2531
1372 Ga0500642_0043608 3300053130 Bacteria 1950
1373 Ga0500658_0000019 3300053134 Bacteria 141013
1374 Ga0500573_0026489 3300053140 Bacteria 3332
1375 Ga0500616_0002767 3300053153 Bacteria 14162
1376 Ga0500616_0006185 3300053153 Bacteria 7906
1377 Ga0500637_0005551 3300053178 Bacteria 6119
1378 Ga0500599_005215 3300053736 Bacteria 1628
1379 Ga0500599_006425 3300053736 Bacteria 1497
1380 Ga0530510_0141597 3300061734 Bacteria 1772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0158546 Ga0495640_0158546_11_805 262
2 3300005577 Ga0068857_100252613 Ga0068857_1002526131 269
3 3300009098 Ga0105245_10217889 Ga0105245_102178893 275
4 3300046679 Ga0495623_0009951 Ga0495623_0009951_1309_2166 282
5 3300031901 Ga0307406_10267914 Ga0307406_102679142 293
6 3300046458 Ga0495591_035116 Ga0495591_035116_285_1175 293
7 3300046664 Ga0495659_0054197 Ga0495659_0054197_29_919 293
8 3300046691 Ga0495670_0127292 Ga0495670_0127292_35_925 293
9 3300006358 Ga0068871_100018636 Ga0068871_1000186362 295
10 3300009553 Ga0105249_10175955 Ga0105249_101759551 295
11 3300025315 Ga0207697_10000670 Ga0207697_100006705 295
12 3300025940 Ga0207691_10000930 Ga0207691_1000093012 295
13 3300025945 Ga0207679_10296701 Ga0207679_102967012 295
14 3300026121 Ga0207683_10004620 Ga0207683_1000462012 295
15 3300005468 Ga0070707_100180983 Ga0070707_1001809832 296
16 3300048908 Ga0496105_0003703 Ga0496105_0003703_6721_7740 304
17 3300045051 Ga0451576_0372030 Ga0451576_0372030_401_1348 306
18 3300035113 Ga0373936_0034917 Ga0373936_0034917_488_1420 307
19 3300046471 Ga0495650_0001148 Ga0495650_0001148_15227_16168 307
20 3300047317 Ga0495604_0082467 Ga0495604_0082467_15_944 307
21 3300047472 Ga0495686_0015012 Ga0495686_0015012_988_1926 307
22 3300053125 Ga0500618_008647 Ga0500618_008647_1865_2803 307
23 3300009177 Ga0105248_10207944 Ga0105248_102079442 308
24 3300013306 Ga0163162_10594682 Ga0163162_105946821 308
25 3300025910 Ga0207684_10009607 Ga0207684_100096073 308
26 3300025927 Ga0207687_10004757 Ga0207687_100047577 308
27 3300035084 Ga0373928_0000544 Ga0373928_0000544_12_956 308
28 3300037853 Ga0436364_0373624 Ga0436364_0373624_630_1565 308
29 3300038443 Ga0395901_0389523 Ga0395901_0389523_443_1378 308
30 3300044673 Ga0453683_0012580 Ga0453683_0012580_452_1396 308
31 3300044712 Ga0453684_0069666 Ga0453684_0069666_16_960 308
32 3300044712 Ga0453684_0247205 Ga0453684_0247205_1008_1952 308
33 3300053736 Ga0500599_005215 Ga0500599_005215_177_1112 308
34 3300005338 Ga0068868_100200784 Ga0068868_1002007842 309
35 3300005353 Ga0070669_100285182 Ga0070669_1002851822 309
36 3300005354 Ga0070675_100132987 Ga0070675_1001329872 309
37 3300005355 Ga0070671_100127962 Ga0070671_1001279622 309
38 3300009147 Ga0114129_10281187 Ga0114129_102811872 309
39 3300009545 Ga0105237_10175589 Ga0105237_101755892 309
40 3300013296 Ga0157374_10629435 Ga0157374_106294351 309
41 3300013297 Ga0157378_10009405 Ga0157378_100094054 309
42 3300035113 Ga0373936_0152999 Ga0373936_0152999_21_959 309
43 3300035119 Ga0373956_0103874 Ga0373956_0103874_348_1286 309
44 3300035691 Ga0373931_0040711 Ga0373931_0040711_1452_2390 309
45 3300035725 Ga0373947_0320075 Ga0373947_0320075_75_1013 309
46 3300037853 Ga0436364_0133217 Ga0436364_0133217_299_1234 309
47 3300039447 Ga0436361_0317667 Ga0436361_0317667_10_948 309
48 3300046463 Ga0495653_0287306 Ga0495653_0287306_97_1035 309
49 3300046559 Ga0495667_0273722 Ga0495667_0273722_27_965 309
50 3300050511 nmdc:mga08y16_659677_c1 nmdc:mga08y16_659677_c1_56_994 309
51 iso_pu_bacteria 2901300506 2901303685 309
52 3300005329 Ga0070683_100025190 Ga0070683_1000251901 310
53 3300005367 Ga0070667_100015801 Ga0070667_1000158011 310
54 3300005459 Ga0068867_100027081 Ga0068867_1000270811 310
55 3300005563 Ga0068855_100117700 Ga0068855_1001177001 310
56 3300005564 Ga0070664_100121982 Ga0070664_1001219822 310
57 3300006237 Ga0097621_100226979 Ga0097621_1002269792 310
58 3300006358 Ga0068871_100084647 Ga0068871_1000846472 310
59 3300006881 Ga0068865_100002615 Ga0068865_1000026159 310
60 3300025911 Ga0207654_10033529 Ga0207654_100335292 310
61 3300025914 Ga0207671_10050964 Ga0207671_100509641 310
62 3300025924 Ga0207694_10015339 Ga0207694_100153393 310
63 3300025927 Ga0207687_10020124 Ga0207687_100201244 310
64 3300025934 Ga0207686_10043297 Ga0207686_100432972 310
65 3300031824 Ga0307413_10021968 Ga0307413_100219681 310
66 3300032126 Ga0307415_100080569 Ga0307415_1000805692 310
67 3300050510 nmdc:mga06r32_54053_c1 nmdc:mga06r32_54053_c1_1968_2969 310
68 3300005458 Ga0070681_10182050 Ga0070681_101820503 312
69 3300003752 Ga0055539_1005054 Ga0055539_10050541 313
70 3300005577 Ga0068857_100036654 Ga0068857_1000366542 313
71 3300006847 Ga0075431_100061930 Ga0075431_1000619302 313
72 3300025253 Ga0209677_101796 Ga0209677_1017967 313
73 3300026116 Ga0207674_10040171 Ga0207674_100401715 313
74 3300046536 Ga0495587_0043007 Ga0495587_0043007_1655_2605 313
75 3300005536 Ga0070697_100030109 Ga0070697_1000301095 314
76 3300005545 Ga0070695_100259488 Ga0070695_1002594881 314
77 3300031238 Ga0265332_10001044 Ga0265332_100010447 314
78 3300031239 Ga0265328_10005751 Ga0265328_100057511 314
79 3300031240 Ga0265320_10020964 Ga0265320_100209644 314
80 3300031242 Ga0265329_10013901 Ga0265329_100139012 314
81 3300031247 Ga0265340_10043923 Ga0265340_100439231 314
82 3300031249 Ga0265339_10149649 Ga0265339_101496491 314
83 3300031250 Ga0265331_10000200 Ga0265331_100002006 314
84 3300031251 Ga0265327_10097588 Ga0265327_100975881 314
85 3300031344 Ga0265316_10007660 Ga0265316_100076607 314
86 3300031711 Ga0265314_10000287 Ga0265314_100002876 314
87 3300031712 Ga0265342_10017769 Ga0265342_100177691 314
88 3300046455 Ga0495603_0104079 Ga0495603_0104079_446_1441 314
89 3300046472 Ga0495580_0000005 Ga0495580_0000005_49654_50649 314
90 3300046506 Ga0495583_0003963 Ga0495583_0003963_4938_5933 314
91 3300047323 Ga0495683_0044672 Ga0495683_0044672_873_1868 314
92 3300049460 Ga0495682_0004828 Ga0495682_0004828_2142_3137 314
93 3300009177 Ga0105248_10004870 Ga0105248_100048705 315
94 3300046462 Ga0495651_0059436 Ga0495651_0059436_268_1224 315
95 3300005617 Ga0068859_100101097 Ga0068859_1001010971 316
96 3300006931 Ga0097620_100101094 Ga0097620_1001010941 316
97 3300050509 nmdc:mga0qj67_66633_c1 nmdc:mga0qj67_66633_c1_1846_2799 316
98 3300050510 nmdc:mga06r32_82487_c1 nmdc:mga06r32_82487_c1_1803_2756 316
99 3300005983 Ga0081540_1094642 Ga0081540_10946421 317
100 3300044712 Ga0453684_0669034 Ga0453684_0669034_63_1025 317
101 3300050510 nmdc:mga06r32_226115_c1 nmdc:mga06r32_226115_c1_303_1259 317
102 3300005518 Ga0070699_100259108 Ga0070699_1002591082 318
103 3300028800 Ga0265338_10021059 Ga0265338_100210595 318
104 3300036401 Ga0373937_0087370 Ga0373937_0087370_554_1546 318
105 3300045836 Ga0466958_0122384 Ga0466958_0122384_89_1054 318
106 3300046511 Ga0495608_0068885 Ga0495608_0068885_322_1314 318
107 3300046663 Ga0495635_0045599 Ga0495635_0045599_704_1696 318
108 3300047471 Ga0495684_0016290 Ga0495684_0016290_1727_2719 318
109 3300048088 Ga0495602_0035465 Ga0495602_0035465_1982_2974 318
110 3300005293 Ga0065715_10005182 Ga0065715_100051822 319
111 3300005340 Ga0070689_100081360 Ga0070689_1000813604 319
112 3300005355 Ga0070671_100037659 Ga0070671_1000376593 319
113 3300005364 Ga0070673_100082677 Ga0070673_1000826772 319
114 3300005468 Ga0070707_100064697 Ga0070707_1000646972 319
115 3300005618 Ga0068864_100084126 Ga0068864_1000841263 319
116 3300006237 Ga0097621_100309803 Ga0097621_1003098031 319
117 3300013297 Ga0157378_10005727 Ga0157378_100057273 319
118 3300013306 Ga0163162_10062020 Ga0163162_100620205 319
119 3300021388 Ga0213875_10000712 Ga0213875_100007129 319
120 3300025922 Ga0207646_10028276 Ga0207646_100282766 319
121 3300025942 Ga0207689_10148549 Ga0207689_101485492 319
122 3300025960 Ga0207651_10060424 Ga0207651_100604242 319
123 3300026095 Ga0207676_10271631 Ga0207676_102716312 319
124 3300028379 Ga0268266_10377924 Ga0268266_103779241 319
125 3300037418 Ga0395900_0011582 Ga0395900_0011582_566_1534 319
126 3300037466 Ga0395898_0207989 Ga0395898_0207989_775_1743 319
127 3300037853 Ga0436364_1332997 Ga0436364_1332997_117956_118924 319
128 3300009147 Ga0114129_10341594 Ga0114129_103415942 320
129 3300036712 Ga0316584_0074581 Ga0316584_0074581_1147_2163 320
130 3300009093 Ga0105240_10061473 Ga0105240_100614736 321
131 3300031456 Ga0307513_10279879 Ga0307513_102798791 321
132 3300053104 Ga0500556_0001547 Ga0500556_0001547_2743_3732 321
133 3300053153 Ga0500616_0006185 Ga0500616_0006185_5659_6648 321
134 3300053736 Ga0500599_006425 Ga0500599_006425_127_1116 321
135 iso_pu_bacteria 2585427530 2585555194 321
136 iso_pu_bacteria 2842903701 2842909068 321
137 iso_pu_bacteria 3003233435 3003235422 321
138 iso_pu_bacteria 8020938398 8020943853 321
139 iso_pu_bacteria 8020953355 8020955913 321
140 3300003203 JGI25406J46586_10000567 JGI25406J46586_100005674 322
141 3300005467 Ga0070706_100302386 Ga0070706_1003023862 322
142 3300005937 Ga0081455_10000121 Ga0081455_1000012154 322
143 3300005985 Ga0081539_10000302 Ga0081539_1000030234 322
144 3300053134 Ga0500658_0000019 Ga0500658_0000019_78079_79053 322
145 iso_pu_bacteria 2738543023 2739300416 322
146 3300005262 Ga0065165_1004055 Ga0065165_10040553 323
147 3300005467 Ga0070706_100037393 Ga0070706_1000373932 323
148 3300005536 Ga0070697_100099228 Ga0070697_1000992281 323
149 3300005549 Ga0070704_100044152 Ga0070704_1000441524 323
150 3300013308 Ga0157375_10065826 Ga0157375_100658264 323
151 3300014969 Ga0157376_10102711 Ga0157376_101027111 323
152 3300025910 Ga0207684_10085152 Ga0207684_100851522 323
153 3300031711 Ga0265314_10037430 Ga0265314_100374302 323
154 3300031731 Ga0307405_10022308 Ga0307405_100223086 323
155 3300031824 Ga0307413_10122710 Ga0307413_101227101 323
156 3300049823 Ga0501044_0015871 Ga0501044_0015871_7021_7998 323
157 3300053087 Ga0500643_005785 Ga0500643_005785_3413_4390 323
158 iso_pu_bacteria 2515154155 2515854855 323
159 iso_pu_bacteria 2751185782 2753269911 323
160 3300005367 Ga0070667_100025354 Ga0070667_1000253545 324
161 3300006177 Ga0075362_10044180 Ga0075362_100441802 324
162 3300009176 Ga0105242_10003053 Ga0105242_100030539 324
163 3300048903 Ga0496100_0016385 Ga0496100_0016385_2811_3791 324
164 3300048905 Ga0496102_0198817 Ga0496102_0198817_592_1572 324
165 3300048906 Ga0496103_0035231 Ga0496103_0035231_1951_2931 324
166 3300048909 Ga0496106_0013197 Ga0496106_0013197_1487_2467 324
167 3300048917 Ga0496114_0011141 Ga0496114_0011141_2215_3195 324
168 3300050494 nmdc:mga06z11_1152_c1 nmdc:mga06z11_1152_c1_6804_7823 324
169 3300050495 nmdc:mga04h51_23032_c1 nmdc:mga04h51_23032_c1_291_1310 324
170 iso_pu_bacteria 2887478801 2887485205 324
171 3300002773 JGI25152J39213_1000873 JGI25152J39213_100087317 325
172 3300002774 JGI25150J39212_1000279 JGI25150J39212_100027923 325
173 3300002987 JGI25159J45721_1000773 JGI25159J45721_10007734 325
174 3300003187 JGI25151J46595_10000736 JGI25151J46595_1000073623 325
175 3300003215 JGI25153J46596_10000433 JGI25153J46596_1000043323 325
176 3300003374 JGI25161J50226_1000135 JGI25161J50226_100013510 325
177 3300003792 Ga0055540_1027540 Ga0055540_10275402 325
178 3300003794 Ga0055531_10000532 Ga0055531_1000053213 325
179 3300004625 Ga0055543_1000219 Ga0055543_100021912 325
180 3300005262 Ga0065165_1026554 Ga0065165_10265541 325
181 3300005289 Ga0065704_10111613 Ga0065704_101116132 325
182 3300005293 Ga0065715_10113923 Ga0065715_101139232 325
183 3300005295 Ga0065707_10005580 Ga0065707_100055803 325
184 3300005331 Ga0070670_100000042 Ga0070670_10000004236 325
185 3300005341 Ga0070691_10103642 Ga0070691_101036422 325
186 3300005343 Ga0070687_100156760 Ga0070687_1001567601 325
187 3300005347 Ga0070668_100000528 Ga0070668_10000052818 325
188 3300005347 Ga0070668_100083508 Ga0070668_1000835083 325
189 3300005355 Ga0070671_100017898 Ga0070671_1000178986 325
190 3300005356 Ga0070674_100369954 Ga0070674_1003699541 325
191 3300005364 Ga0070673_100125126 Ga0070673_1001251261 325
192 3300005364 Ga0070673_100192887 Ga0070673_1001928871 325
193 3300005367 Ga0070667_100000152 Ga0070667_10000015262 325
194 3300005435 Ga0070714_100000442 Ga0070714_1000004429 325
195 3300005438 Ga0070701_10087848 Ga0070701_100878482 325
196 3300005441 Ga0070700_100026479 Ga0070700_1000264793 325
197 3300005441 Ga0070700_100057000 Ga0070700_1000570002 325
198 3300005444 Ga0070694_100083286 Ga0070694_1000832862 325
199 3300005459 Ga0068867_100174031 Ga0068867_1001740312 325
200 3300005459 Ga0068867_100275778 Ga0068867_1002757781 325
201 3300005530 Ga0070679_100009239 Ga0070679_1000092396 325
202 3300005543 Ga0070672_100070637 Ga0070672_1000706374 325
203 3300005548 Ga0070665_100000925 Ga0070665_10000092534 325
204 3300005549 Ga0070704_100200212 Ga0070704_1002002122 325
205 3300005614 Ga0068856_100000619 Ga0068856_1000006197 325
206 3300005617 Ga0068859_100046569 Ga0068859_1000465695 325
207 3300005617 Ga0068859_100109494 Ga0068859_1001094943 325
208 3300005617 Ga0068859_100150968 Ga0068859_1001509682 325
209 3300005618 Ga0068864_100000245 Ga0068864_10000024529 325
210 3300005718 Ga0068866_10270531 Ga0068866_102705311 325
211 3300005841 Ga0068863_100000516 Ga0068863_10000051618 325
212 3300005842 Ga0068858_100000821 Ga0068858_10000082121 325
213 3300005843 Ga0068860_100000653 Ga0068860_10000065321 325
214 3300005844 Ga0068862_100000638 Ga0068862_1000006382 325
215 3300005844 Ga0068862_100130433 Ga0068862_1001304332 325
216 3300006844 Ga0075428_100193203 Ga0075428_1001932032 325
217 3300006846 Ga0075430_100095981 Ga0075430_1000959812 325
218 3300006931 Ga0097620_100046569 Ga0097620_1000465695 325
219 3300006931 Ga0097620_100109491 Ga0097620_1001094913 325
220 3300006931 Ga0097620_100150954 Ga0097620_1001509542 325
221 3300009094 Ga0111539_10023074 Ga0111539_100230746 325
222 3300009094 Ga0111539_10060920 Ga0111539_100609202 325
223 3300009094 Ga0111539_10144709 Ga0111539_101447092 325
224 3300009098 Ga0105245_10001007 Ga0105245_1000100711 325
225 3300009101 Ga0105247_10013835 Ga0105247_100138355 325
226 3300009148 Ga0105243_10489908 Ga0105243_104899081 325
227 3300009177 Ga0105248_10031609 Ga0105248_100316092 325
228 3300009553 Ga0105249_10001876 Ga0105249_1000187614 325
229 3300009553 Ga0105249_10302979 Ga0105249_103029791 325
230 3300013104 Ga0157370_10405263 Ga0157370_104052631 325
231 3300013297 Ga0157378_10006046 Ga0157378_100060462 325
232 3300013306 Ga0163162_10065971 Ga0163162_100659712 325
233 3300013308 Ga0157375_10161096 Ga0157375_101610962 325
234 3300014326 Ga0157380_10004273 Ga0157380_100042733 325
235 3300014326 Ga0157380_10057902 Ga0157380_100579022 325
236 3300014326 Ga0157380_10483861 Ga0157380_104838611 325
237 3300014497 Ga0182008_10009809 Ga0182008_100098092 325
238 3300014968 Ga0157379_10011184 Ga0157379_100111848 325
239 3300014968 Ga0157379_10152443 Ga0157379_101524432 325
240 3300025208 Ga0209436_100059 Ga0209436_10005957 325
241 3300025245 Ga0207425_1000002 Ga0207425_10000021173 325
242 3300025250 Ga0209026_1000201 Ga0209026_100020139 325
243 3300025258 Ga0209129_1000002 Ga0209129_10000021173 325
244 3300025284 Ga0209130_1000004 Ga0209130_1000004372 325
245 3300025294 Ga0209025_1000004 Ga0209025_100000419 325
246 3300025297 Ga0209758_1000006 Ga0209758_100000619 325
247 3300025302 Ga0207426_1000003 Ga0207426_1000003355 325
248 3300025303 Ga0209051_1010378 Ga0209051_10103782 325
249 3300025304 Ga0209257_1000001 Ga0209257_100000168 325
250 3300025899 Ga0207642_10212743 Ga0207642_102127431 325
251 3300025903 Ga0207680_10196937 Ga0207680_101969372 325
252 3300025921 Ga0207652_10006680 Ga0207652_100066806 325
253 3300025922 Ga0207646_10007690 Ga0207646_100076909 325
254 3300025925 Ga0207650_10000378 Ga0207650_1000037837 325
255 3300025926 Ga0207659_10140906 Ga0207659_101409062 325
256 3300025927 Ga0207687_10000054 Ga0207687_1000005441 325
257 3300025929 Ga0207664_10007887 Ga0207664_100078872 325
258 3300025931 Ga0207644_10089974 Ga0207644_100899742 325
259 3300025940 Ga0207691_10072804 Ga0207691_100728043 325
260 3300025941 Ga0207711_10006914 Ga0207711_100069147 325
261 3300025960 Ga0207651_10077027 Ga0207651_100770272 325
262 3300025961 Ga0207712_10001595 Ga0207712_1000159514 325
263 3300025972 Ga0207668_10000052 Ga0207668_100000527 325
264 3300025972 Ga0207668_10003586 Ga0207668_1000358610 325
265 3300025981 Ga0207640_10209782 Ga0207640_102097822 325
266 3300025986 Ga0207658_10000189 Ga0207658_1000018953 325
267 3300026035 Ga0207703_10000278 Ga0207703_1000027833 325
268 3300026075 Ga0207708_10074334 Ga0207708_100743342 325
269 3300026078 Ga0207702_10009495 Ga0207702_100094957 325
270 3300026088 Ga0207641_10000260 Ga0207641_1000026049 325
271 3300026089 Ga0207648_10051862 Ga0207648_100518622 325
272 3300026089 Ga0207648_10145494 Ga0207648_101454942 325
273 3300026095 Ga0207676_10000233 Ga0207676_1000023326 325
274 3300026118 Ga0207675_100139654 Ga0207675_1001396542 325
275 3300026121 Ga0207683_10093019 Ga0207683_100930192 325
276 3300027907 Ga0207428_10191425 Ga0207428_101914251 325
277 3300028379 Ga0268266_10000805 Ga0268266_1000080520 325
278 3300028380 Ga0268265_10000445 Ga0268265_1000044525 325
279 3300028380 Ga0268265_10035414 Ga0268265_100354143 325
280 3300028381 Ga0268264_10000248 Ga0268264_1000024847 325
281 3300028381 Ga0268264_10038750 Ga0268264_100387504 325
282 3300031344 Ga0265316_10174957 Ga0265316_101749572 325
283 3300031903 Ga0307407_10042208 Ga0307407_100422081 325
284 3300032002 Ga0307416_100558560 Ga0307416_1005585601 325
285 3300037466 Ga0395898_0062711 Ga0395898_0062711_41_1024 325
286 3300039438 Ga0436360_0291192 Ga0436360_0291192_126_1121 325
287 3300044673 Ga0453683_0195162 Ga0453683_0195162_71_1051 325
288 3300046507 Ga0495606_0121365 Ga0495606_0121365_564_1547 325
289 3300046512 Ga0495610_0000265 Ga0495610_0000265_44174_45157 325
290 3300046525 Ga0495663_0000033 Ga0495663_0000033_41540_42523 325
291 3300046660 Ga0495625_0040680 Ga0495625_0040680_2315_3298 325
292 3300048924 Ga0496121_0024678 Ga0496121_0024678_907_1890 325
293 3300048928 Ga0496125_0037733 Ga0496125_0037733_196_1179 325
294 3300049460 Ga0495682_0034538 Ga0495682_0034538_52_1035 325
295 3300049575 Ga0501039_0233466 Ga0501039_0233466_368_1348 325
296 3300049590 Ga0501074_0131124 Ga0501074_0131124_396_1376 325
297 3300049592 Ga0501076_0081885 Ga0501076_0081885_149_1129 325
298 3300049742 Ga0501080_0242373 Ga0501080_0242373_363_1343 325
299 3300050508 nmdc:mga09592_96752_c1 nmdc:mga09592_96752_c1_550_1533 325
300 3300050509 nmdc:mga0qj67_13243_c1 nmdc:mga0qj67_13243_c1_797_1780 325
301 3300050511 nmdc:mga08y16_142269_c1 nmdc:mga08y16_142269_c1_307_1290 325
302 3300050511 nmdc:mga08y16_198243_c1 nmdc:mga08y16_198243_c1_557_1540 325
303 3300050515 nmdc:mga0a205_116816_c1 nmdc:mga0a205_116816_c1_993_1976 325
304 3300053096 Ga0500641_0006567 Ga0500641_0006567_922_1905 325
305 3300053140 Ga0500573_0026489 Ga0500573_0026489_691_1746 325
306 3300061734 Ga0530510_0141597 Ga0530510_0141597_716_1696 325
307 3300005437 Ga0070710_10029056 Ga0070710_100290563 326
308 3300005444 Ga0070694_100385840 Ga0070694_1003858401 326
309 3300005445 Ga0070708_100321608 Ga0070708_1003216082 326
310 3300005471 Ga0070698_100275998 Ga0070698_1002759981 326
311 3300005545 Ga0070695_100087976 Ga0070695_1000879762 326
312 3300005578 Ga0068854_100294002 Ga0068854_1002940022 326
313 3300005617 Ga0068859_100551993 Ga0068859_1005519931 326
314 3300005618 Ga0068864_100008811 Ga0068864_1000088115 326
315 3300005841 Ga0068863_100080856 Ga0068863_1000808562 326
316 3300005985 Ga0081539_10003420 Ga0081539_100034207 326
317 3300006173 Ga0070716_100013701 Ga0070716_1000137012 326
318 3300006237 Ga0097621_100248763 Ga0097621_1002487631 326
319 3300006847 Ga0075431_100195437 Ga0075431_1001954372 326
320 3300006847 Ga0075431_100253255 Ga0075431_1002532552 326
321 3300006931 Ga0097620_100551999 Ga0097620_1005519991 326
322 3300009092 Ga0105250_10061330 Ga0105250_100613301 326
323 3300009101 Ga0105247_10213503 Ga0105247_102135032 326
324 3300009148 Ga0105243_10013230 Ga0105243_100132302 326
325 3300009176 Ga0105242_10288922 Ga0105242_102889221 326
326 3300009177 Ga0105248_10043722 Ga0105248_100437224 326
327 3300009553 Ga0105249_10376210 Ga0105249_103762101 326
328 3300011119 Ga0105246_10332515 Ga0105246_103325151 326
329 3300013100 Ga0157373_10064765 Ga0157373_100647652 326
330 3300014968 Ga0157379_10003248 Ga0157379_100032485 326
331 3300014968 Ga0157379_10225076 Ga0157379_102250762 326
332 3300015265 Ga0182005_1002199 Ga0182005_10021992 326
333 3300021388 Ga0213875_10009151 Ga0213875_100091515 326
334 3300021388 Ga0213875_10097957 Ga0213875_100979572 326
335 3300025904 Ga0207647_10144012 Ga0207647_101440122 326
336 3300025918 Ga0207662_10195142 Ga0207662_101951421 326
337 3300025926 Ga0207659_10079876 Ga0207659_100798763 326
338 3300025941 Ga0207711_10072765 Ga0207711_100727652 326
339 3300026035 Ga0207703_10124548 Ga0207703_101245482 326
340 3300026089 Ga0207648_10108164 Ga0207648_101081642 326
341 3300026095 Ga0207676_10045533 Ga0207676_100455332 326
342 3300026118 Ga0207675_100254808 Ga0207675_1002548082 326
343 3300027907 Ga0207428_10015915 Ga0207428_100159154 326
344 3300028653 Ga0265323_10010368 Ga0265323_100103683 326
345 3300032126 Ga0307415_100277372 Ga0307415_1002773721 326
346 3300037853 Ga0436364_0604091 Ga0436364_0604091_1929_2957 326
347 3300046454 Ga0495592_0033565 Ga0495592_0033565_359_1345 326
348 3300046462 Ga0495651_0028110 Ga0495651_0028110_2150_3136 326
349 3300046463 Ga0495653_0030629 Ga0495653_0030629_3052_4035 326
350 3300046473 Ga0495582_0049681 Ga0495582_0049681_1298_2284 326
351 3300046514 Ga0495618_0017329 Ga0495618_0017329_853_1839 326
352 3300046516 Ga0495628_0138606 Ga0495628_0138606_206_1192 326
353 3300046517 Ga0495630_0003586 Ga0495630_0003586_262_1248 326
354 3300046528 Ga0495642_0042856 Ga0495642_0042856_839_1831 326
355 3300046535 Ga0495586_0092992 Ga0495586_0092992_549_1535 326
356 3300046642 Ga0495634_0016956 Ga0495634_0016956_808_1794 326
357 3300046663 Ga0495635_0017110 Ga0495635_0017110_446_1429 326
358 3300046663 Ga0495635_0156442 Ga0495635_0156442_104_1090 326
359 3300046675 Ga0495657_0152753 Ga0495657_0152753_398_1384 326
360 3300046689 Ga0495613_0175973 Ga0495613_0175973_269_1255 326
361 3300046809 Ga0495600_0288469 Ga0495600_0288469_11_997 326
362 3300047319 Ga0495674_0007439 Ga0495674_0007439_6631_7617 326
363 3300047322 Ga0495680_0002369 Ga0495680_0002369_11856_12842 326
364 3300047322 Ga0495680_0194159 Ga0495680_0194159_245_1228 326
365 3300048909 Ga0496106_0063213 Ga0496106_0063213_1163_2152 326
366 3300049822 Ga0501035_0313226 Ga0501035_0313226_231_1217 326
367 3300050507 nmdc:mga05p37_44683_c1 nmdc:mga05p37_44683_c1_1900_2886 326
368 3300050510 nmdc:mga06r32_27073_c1 nmdc:mga06r32_27073_c1_332_1318 326
369 3300050511 nmdc:mga08y16_68575_c1 nmdc:mga08y16_68575_c1_1075_2061 326
370 3300053085 Ga0495619_0007289 Ga0495619_0007289_4634_5617 326
371 3300005289 Ga0065704_10165902 Ga0065704_101659022 327
372 3300005328 Ga0070676_10041149 Ga0070676_100411492 327
373 3300005328 Ga0070676_10214199 Ga0070676_102141991 327
374 3300005331 Ga0070670_100087212 Ga0070670_1000872122 327
375 3300005334 Ga0068869_100023676 Ga0068869_1000236762 327
376 3300005335 Ga0070666_10008833 Ga0070666_100088332 327
377 3300005336 Ga0070680_100358366 Ga0070680_1003583662 327
378 3300005338 Ga0068868_100016034 Ga0068868_1000160346 327
379 3300005347 Ga0070668_100000094 Ga0070668_1000000949 327
380 3300005347 Ga0070668_100141152 Ga0070668_1001411522 327
381 3300005353 Ga0070669_100006891 Ga0070669_1000068918 327
382 3300005353 Ga0070669_100023733 Ga0070669_1000237334 327
383 3300005353 Ga0070669_100300399 Ga0070669_1003003991 327
384 3300005354 Ga0070675_100506619 Ga0070675_1005066191 327
385 3300005364 Ga0070673_100057027 Ga0070673_1000570272 327
386 3300005364 Ga0070673_100304384 Ga0070673_1003043842 327
387 3300005366 Ga0070659_100023605 Ga0070659_1000236055 327
388 3300005367 Ga0070667_100000025 Ga0070667_1000000259 327
389 3300005367 Ga0070667_100140381 Ga0070667_1001403812 327
390 3300005436 Ga0070713_100106565 Ga0070713_1001065653 327
391 3300005438 Ga0070701_10069831 Ga0070701_100698312 327
392 3300005438 Ga0070701_10193954 Ga0070701_101939541 327
393 3300005441 Ga0070700_100011346 Ga0070700_1000113464 327
394 3300005441 Ga0070700_100118018 Ga0070700_1001180182 327
395 3300005445 Ga0070708_100000081 Ga0070708_10000008132 327
396 3300005445 Ga0070708_100009638 Ga0070708_1000096387 327
397 3300005445 Ga0070708_100352193 Ga0070708_1003521932 327
398 3300005456 Ga0070678_100122618 Ga0070678_1001226182 327
399 3300005458 Ga0070681_10061358 Ga0070681_100613583 327
400 3300005459 Ga0068867_100036724 Ga0068867_1000367244 327
401 3300005467 Ga0070706_100357609 Ga0070706_1003576091 327
402 3300005467 Ga0070706_100415817 Ga0070706_1004158171 327
403 3300005468 Ga0070707_100001950 Ga0070707_10000195015 327
404 3300005468 Ga0070707_100121282 Ga0070707_1001212822 327
405 3300005518 Ga0070699_100101035 Ga0070699_1001010353 327
406 3300005530 Ga0070679_100171697 Ga0070679_1001716973 327
407 3300005536 Ga0070697_100335691 Ga0070697_1003356911 327
408 3300005543 Ga0070672_100024551 Ga0070672_1000245512 327
409 3300005544 Ga0070686_100025144 Ga0070686_1000251443 327
410 3300005545 Ga0070695_100004286 Ga0070695_1000042865 327
411 3300005547 Ga0070693_100007368 Ga0070693_1000073683 327
412 3300005548 Ga0070665_100011376 Ga0070665_1000113765 327
413 3300005548 Ga0070665_100014932 Ga0070665_1000149326 327
414 3300005549 Ga0070704_100025461 Ga0070704_1000254611 327
415 3300005549 Ga0070704_100107089 Ga0070704_1001070891 327
416 3300005549 Ga0070704_100293070 Ga0070704_1002930702 327
417 3300005563 Ga0068855_100000676 Ga0068855_10000067631 327
418 3300005578 Ga0068854_100226486 Ga0068854_1002264862 327
419 3300005614 Ga0068856_100000175 Ga0068856_10000017527 327
420 3300005615 Ga0070702_100003277 Ga0070702_1000032774 327
421 3300005617 Ga0068859_100621767 Ga0068859_1006217671 327
422 3300005618 Ga0068864_100069472 Ga0068864_1000694721 327
423 3300005719 Ga0068861_100003344 Ga0068861_1000033446 327
424 3300005841 Ga0068863_100000067 Ga0068863_1000000679 327
425 3300005841 Ga0068863_100018669 Ga0068863_1000186694 327
426 3300005842 Ga0068858_100017223 Ga0068858_1000172232 327
427 3300005842 Ga0068858_100159862 Ga0068858_1001598622 327
428 3300005843 Ga0068860_100005680 Ga0068860_10000568013 327
429 3300005844 Ga0068862_100257536 Ga0068862_1002575362 327
430 3300005844 Ga0068862_100421296 Ga0068862_1004212961 327
431 3300006237 Ga0097621_100000094 Ga0097621_10000009430 327
432 3300006358 Ga0068871_100000169 Ga0068871_10000016930 327
433 3300006358 Ga0068871_100226047 Ga0068871_1002260472 327
434 3300006844 Ga0075428_100025614 Ga0075428_1000256145 327
435 3300006846 Ga0075430_100437424 Ga0075430_1004374241 327
436 3300006847 Ga0075431_100023088 Ga0075431_1000230886 327
437 3300006852 Ga0075433_10351547 Ga0075433_103515472 327
438 3300006871 Ga0075434_100019493 Ga0075434_1000194934 327
439 3300006871 Ga0075434_100131015 Ga0075434_1001310152 327
440 3300006880 Ga0075429_100500418 Ga0075429_1005004181 327
441 3300006881 Ga0068865_100050307 Ga0068865_1000503073 327
442 3300006881 Ga0068865_100076906 Ga0068865_1000769063 327
443 3300006931 Ga0097620_100621816 Ga0097620_1006218161 327
444 3300007076 Ga0075435_100073624 Ga0075435_1000736242 327
445 3300007076 Ga0075435_100185628 Ga0075435_1001856282 327
446 3300009094 Ga0111539_10147490 Ga0111539_101474902 327
447 3300009094 Ga0111539_10300741 Ga0111539_103007412 327
448 3300009098 Ga0105245_10113952 Ga0105245_101139522 327
449 3300009148 Ga0105243_10000207 Ga0105243_1000020750 327
450 3300009148 Ga0105243_10467799 Ga0105243_104677991 327
451 3300009174 Ga0105241_10430297 Ga0105241_104302971 327
452 3300009176 Ga0105242_10000431 Ga0105242_100004318 327
453 3300009176 Ga0105242_10262736 Ga0105242_102627362 327
454 3300009177 Ga0105248_10007994 Ga0105248_100079949 327
455 3300009177 Ga0105248_10422052 Ga0105248_104220522 327
456 3300009553 Ga0105249_10268381 Ga0105249_102683811 327
457 3300010159 Ga0099796_10044015 Ga0099796_100440151 327
458 3300013296 Ga0157374_10000564 Ga0157374_100005646 327
459 3300013297 Ga0157378_10000011 Ga0157378_100000115 327
460 3300013297 Ga0157378_10000377 Ga0157378_1000037729 327
461 3300013297 Ga0157378_10036544 Ga0157378_100365442 327
462 3300013297 Ga0157378_10175562 Ga0157378_101755622 327
463 3300013297 Ga0157378_10250271 Ga0157378_102502712 327
464 3300013306 Ga0163162_10163118 Ga0163162_101631182 327
465 3300013307 Ga0157372_10002431 Ga0157372_1000243112 327
466 3300013307 Ga0157372_10402338 Ga0157372_104023382 327
467 3300013308 Ga0157375_10002472 Ga0157375_100024726 327
468 3300013308 Ga0157375_10275692 Ga0157375_102756922 327
469 3300014326 Ga0157380_10000242 Ga0157380_1000024210 327
470 3300014326 Ga0157380_10340001 Ga0157380_103400011 327
471 3300014968 Ga0157379_10188189 Ga0157379_101881892 327
472 3300014969 Ga0157376_10002543 Ga0157376_1000254310 327
473 3300017792 Ga0163161_10312709 Ga0163161_103127092 327
474 3300025315 Ga0207697_10005583 Ga0207697_100055837 327
475 3300025903 Ga0207680_10005038 Ga0207680_100050387 327
476 3300025907 Ga0207645_10001182 Ga0207645_100011825 327
477 3300025907 Ga0207645_10081460 Ga0207645_100814602 327
478 3300025907 Ga0207645_10098287 Ga0207645_100982872 327
479 3300025908 Ga0207643_10066442 Ga0207643_100664422 327
480 3300025912 Ga0207707_10058983 Ga0207707_100589833 327
481 3300025917 Ga0207660_10060696 Ga0207660_100606962 327
482 3300025918 Ga0207662_10033961 Ga0207662_100339612 327
483 3300025921 Ga0207652_10092325 Ga0207652_100923252 327
484 3300025922 Ga0207646_10001929 Ga0207646_1000192912 327
485 3300025922 Ga0207646_10132905 Ga0207646_101329052 327
486 3300025923 Ga0207681_10081170 Ga0207681_100811702 327
487 3300025923 Ga0207681_10152826 Ga0207681_101528262 327
488 3300025926 Ga0207659_10449600 Ga0207659_104496001 327
489 3300025932 Ga0207690_10013047 Ga0207690_100130473 327
490 3300025933 Ga0207706_10022300 Ga0207706_100223002 327
491 3300025933 Ga0207706_10040724 Ga0207706_100407241 327
492 3300025935 Ga0207709_10001828 Ga0207709_100018286 327
493 3300025937 Ga0207669_10247088 Ga0207669_102470881 327
494 3300025938 Ga0207704_10192502 Ga0207704_101925022 327
495 3300025940 Ga0207691_10072968 Ga0207691_100729683 327
496 3300025941 Ga0207711_10083721 Ga0207711_100837214 327
497 3300025942 Ga0207689_10046788 Ga0207689_100467882 327
498 3300025942 Ga0207689_10109204 Ga0207689_101092043 327
499 3300025945 Ga0207679_10031145 Ga0207679_100311454 327
500 3300025949 Ga0207667_10003550 Ga0207667_1000355015 327
501 3300025960 Ga0207651_10039954 Ga0207651_100399542 327
502 3300025961 Ga0207712_10030943 Ga0207712_100309432 327
503 3300025972 Ga0207668_10000058 Ga0207668_1000005884 327
504 3300025972 Ga0207668_10081312 Ga0207668_100813122 327
505 3300025981 Ga0207640_10067579 Ga0207640_100675793 327
506 3300025986 Ga0207658_10000023 Ga0207658_100000239 327
507 3300026023 Ga0207677_10012493 Ga0207677_100124934 327
508 3300026023 Ga0207677_10227838 Ga0207677_102278382 327
509 3300026035 Ga0207703_10054173 Ga0207703_100541732 327
510 3300026075 Ga0207708_10002885 Ga0207708_100028856 327
511 3300026075 Ga0207708_10118912 Ga0207708_101189121 327
512 3300026078 Ga0207702_10001714 Ga0207702_100017143 327
513 3300026088 Ga0207641_10000119 Ga0207641_10000119109 327
514 3300026088 Ga0207641_10132739 Ga0207641_101327392 327
515 3300026089 Ga0207648_10043872 Ga0207648_100438725 327
516 3300026116 Ga0207674_10101450 Ga0207674_101014502 327
517 3300026118 Ga0207675_100001308 Ga0207675_1000013084 327
518 3300026118 Ga0207675_100175450 Ga0207675_1001754501 327
519 3300026118 Ga0207675_100179358 Ga0207675_1001793581 327
520 3300026118 Ga0207675_100378510 Ga0207675_1003785101 327
521 3300026118 Ga0207675_100428726 Ga0207675_1004287262 327
522 3300026121 Ga0207683_10155111 Ga0207683_101551113 327
523 3300028380 Ga0268265_10485241 Ga0268265_104852411 327
524 3300028381 Ga0268264_10002037 Ga0268264_100020377 327
525 3300028800 Ga0265338_10004683 Ga0265338_100046839 327
526 3300029957 Ga0265324_10014675 Ga0265324_100146752 327
527 3300031249 Ga0265339_10001357 Ga0265339_100013578 327
528 3300031344 Ga0265316_10052037 Ga0265316_100520373 327
529 3300031507 Ga0307509_10010313 Ga0307509_100103135 327
530 3300031711 Ga0265314_10007222 Ga0265314_100072221 327
531 3300033179 Ga0307507_10020537 Ga0307507_100205377 327
532 3300033180 Ga0307510_10133595 Ga0307510_101335952 327
533 3300035091 Ga0373951_0000349 Ga0373951_0000349_7893_8879 327
534 3300035114 Ga0373939_0064035 Ga0373939_0064035_180_1166 327
535 3300035170 Ga0373943_0074538 Ga0373943_0074538_556_1542 327
536 3300035171 Ga0373946_0065034 Ga0373946_0065034_391_1377 327
537 3300037466 Ga0395898_0060658 Ga0395898_0060658_595_1632 327
538 3300038443 Ga0395901_0239310 Ga0395901_0239310_492_1529 327
539 3300039437 Ga0436365_1219656 Ga0436365_1219656_574_1566 327
540 3300042005 Ga0439448_0001932 Ga0439448_0001932_3081_4073 327
541 3300042005 Ga0439448_0051395 Ga0439448_0051395_194_1186 327
542 3300042012 Ga0439455_0030351 Ga0439455_0030351_288_1280 327
543 3300042157 Ga0439458_0004304 Ga0439458_0004304_555_1547 327
544 3300042876 Ga0451577_0098264 Ga0451577_0098264_1338_2330 327
545 3300044712 Ga0453684_0367959 Ga0453684_0367959_374_1366 327
546 3300045051 Ga0451576_0022281 Ga0451576_0022281_2117_3112 327
547 3300045051 Ga0451576_0060606 Ga0451576_0060606_117_1109 327
548 3300045976 Ga0466967_0136204 Ga0466967_0136204_886_1872 327
549 3300046454 Ga0495592_0119993 Ga0495592_0119993_205_1194 327
550 3300046462 Ga0495651_0025796 Ga0495651_0025796_302_1291 327
551 3300046463 Ga0495653_0033646 Ga0495653_0033646_2617_3606 327
552 3300046511 Ga0495608_0075383 Ga0495608_0075383_54_1043 327
553 3300046511 Ga0495608_0087227 Ga0495608_0087227_317_1306 327
554 3300046514 Ga0495618_0202461 Ga0495618_0202461_31_1020 327
555 3300046516 Ga0495628_0018249 Ga0495628_0018249_1828_2817 327
556 3300046529 Ga0495652_0017584 Ga0495652_0017584_3246_4235 327
557 3300046529 Ga0495652_0096413 Ga0495652_0096413_1390_2379 327
558 3300046531 Ga0495665_0065223 Ga0495665_0065223_70_1059 327
559 3300046535 Ga0495586_0107870 Ga0495586_0107870_173_1162 327
560 3300046535 Ga0495586_0129140 Ga0495586_0129140_292_1278 327
561 3300046536 Ga0495587_0038560 Ga0495587_0038560_113_1102 327
562 3300046536 Ga0495587_0053621 Ga0495587_0053621_1138_2127 327
563 3300046543 Ga0495645_0029979 Ga0495645_0029979_1015_2004 327
564 3300046543 Ga0495645_0041386 Ga0495645_0041386_640_1629 327
565 3300046559 Ga0495667_0116318 Ga0495667_0116318_355_1344 327
566 3300046559 Ga0495667_0179480 Ga0495667_0179480_69_1058 327
567 3300046642 Ga0495634_0070688 Ga0495634_0070688_793_1782 327
568 3300046663 Ga0495635_0026814 Ga0495635_0026814_392_1381 327
569 3300046663 Ga0495635_0054795 Ga0495635_0054795_51_1040 327
570 3300046675 Ga0495657_0058842 Ga0495657_0058842_398_1387 327
571 3300046678 Ga0495599_0003150 Ga0495599_0003150_1923_2912 327
572 3300046678 Ga0495599_0151054 Ga0495599_0151054_144_1133 327
573 3300046679 Ga0495623_0205618 Ga0495623_0205618_103_1092 327
574 3300046809 Ga0495600_0017512 Ga0495600_0017512_3249_4238 327
575 3300046809 Ga0495600_0066872 Ga0495600_0066872_1003_1992 327
576 3300046809 Ga0495600_0247299 Ga0495600_0247299_98_1090 327
577 3300047317 Ga0495604_0044454 Ga0495604_0044454_182_1171 327
578 3300047322 Ga0495680_0045174 Ga0495680_0045174_1849_2838 327
579 3300047322 Ga0495680_0111643 Ga0495680_0111643_982_1971 327
580 3300047471 Ga0495684_0060950 Ga0495684_0060950_454_1443 327
581 3300048088 Ga0495602_0063468 Ga0495602_0063468_144_1133 327
582 3300048088 Ga0495602_0065150 Ga0495602_0065150_768_1757 327
583 3300048914 Ga0496111_0168349 Ga0496111_0168349_592_1578 327
584 3300048915 Ga0496112_0070151 Ga0496112_0070151_202_1293 327
585 3300048915 Ga0496112_0131171 Ga0496112_0131171_610_1596 327
586 3300048929 Ga0496126_0056393 Ga0496126_0056393_872_1861 327
587 3300050507 nmdc:mga05p37_130095_c1 nmdc:mga05p37_130095_c1_765_1751 327
588 3300050507 nmdc:mga05p37_321425_c1 nmdc:mga05p37_321425_c1_727_1713 327
589 3300050507 nmdc:mga05p37_36329_c1 nmdc:mga05p37_36329_c1_2171_3172 327
590 3300050508 nmdc:mga09592_75820_c1 nmdc:mga09592_75820_c1_216_1202 327
591 3300050509 nmdc:mga0qj67_86160_c1 nmdc:mga0qj67_86160_c1_58_1044 327
592 3300050510 nmdc:mga06r32_44349_c1 nmdc:mga06r32_44349_c1_102_1088 327
593 3300050511 nmdc:mga08y16_74282_c1 nmdc:mga08y16_74282_c1_2483_3511 327
594 3300050512 nmdc:mga0n895_176626_c1 nmdc:mga0n895_176626_c1_679_1665 327
595 3300050512 nmdc:mga0n895_45674_c1 nmdc:mga0n895_45674_c1_1064_2056 327
596 3300050515 nmdc:mga0a205_23177_c1 nmdc:mga0a205_23177_c1_250_1242 327
597 3300050515 nmdc:mga0a205_95256_c1 nmdc:mga0a205_95256_c1_611_1597 327
598 3300053077 Ga0495601_0078545 Ga0495601_0078545_655_1644 327
599 3300053093 Ga0500651_0033294 Ga0500651_0033294_37_1038 327
600 3300005289 Ga0065704_10083021 Ga0065704_100830213 328
601 3300005335 Ga0070666_10006040 Ga0070666_100060403 328
602 3300005336 Ga0070680_100003407 Ga0070680_1000034074 328
603 3300005366 Ga0070659_100233092 Ga0070659_1002330921 328
604 3300005367 Ga0070667_100285950 Ga0070667_1002859502 328
605 3300005434 Ga0070709_10022083 Ga0070709_100220833 328
606 3300005434 Ga0070709_10036277 Ga0070709_100362773 328
607 3300005436 Ga0070713_100059186 Ga0070713_1000591864 328
608 3300005439 Ga0070711_100118470 Ga0070711_1001184703 328
609 3300005440 Ga0070705_100000014 Ga0070705_10000001479 328
610 3300005440 Ga0070705_100012957 Ga0070705_1000129577 328
611 3300005445 Ga0070708_100004936 Ga0070708_10000493615 328
612 3300005445 Ga0070708_100009454 Ga0070708_1000094542 328
613 3300005456 Ga0070678_100233246 Ga0070678_1002332461 328
614 3300005459 Ga0068867_100013996 Ga0068867_1000139964 328
615 3300005467 Ga0070706_100000131 Ga0070706_10000013124 328
616 3300005467 Ga0070706_100012832 Ga0070706_1000128324 328
617 3300005467 Ga0070706_100018749 Ga0070706_1000187496 328
618 3300005467 Ga0070706_100203195 Ga0070706_1002031952 328
619 3300005467 Ga0070706_100218227 Ga0070706_1002182271 328
620 3300005468 Ga0070707_100024680 Ga0070707_1000246802 328
621 3300005468 Ga0070707_100111840 Ga0070707_1001118402 328
622 3300005468 Ga0070707_100174162 Ga0070707_1001741621 328
623 3300005471 Ga0070698_100010335 Ga0070698_10001033510 328
624 3300005471 Ga0070698_100025039 Ga0070698_1000250397 328
625 3300005471 Ga0070698_100034638 Ga0070698_1000346386 328
626 3300005471 Ga0070698_100193193 Ga0070698_1001931932 328
627 3300005471 Ga0070698_100235411 Ga0070698_1002354111 328
628 3300005518 Ga0070699_100025989 Ga0070699_1000259894 328
629 3300005518 Ga0070699_100153722 Ga0070699_1001537221 328
630 3300005518 Ga0070699_100425121 Ga0070699_1004251211 328
631 3300005530 Ga0070679_100000108 Ga0070679_1000001084 328
632 3300005536 Ga0070697_100059674 Ga0070697_1000596743 328
633 3300005536 Ga0070697_100126082 Ga0070697_1001260822 328
634 3300005536 Ga0070697_100438078 Ga0070697_1004380781 328
635 3300005546 Ga0070696_100010482 Ga0070696_1000104822 328
636 3300005546 Ga0070696_100123220 Ga0070696_1001232202 328
637 3300005564 Ga0070664_100078735 Ga0070664_1000787352 328
638 3300005577 Ga0068857_100007676 Ga0068857_1000076764 328
639 3300005614 Ga0068856_100006148 Ga0068856_10000614814 328
640 3300005618 Ga0068864_100004297 Ga0068864_1000042971 328
641 3300005841 Ga0068863_100000774 Ga0068863_10000077427 328
642 3300005841 Ga0068863_100001330 Ga0068863_10000133018 328
643 3300005842 Ga0068858_100008212 Ga0068858_1000082124 328
644 3300005842 Ga0068858_100222018 Ga0068858_1002220182 328
645 3300005842 Ga0068858_100321649 Ga0068858_1003216492 328
646 3300005842 Ga0068858_100532457 Ga0068858_1005324571 328
647 3300005843 Ga0068860_100001987 Ga0068860_1000019878 328
648 3300005843 Ga0068860_100265596 Ga0068860_1002655962 328
649 3300005844 Ga0068862_100042698 Ga0068862_1000426983 328
650 3300005981 Ga0081538_10009837 Ga0081538_100098372 328
651 3300005983 Ga0081540_1000560 Ga0081540_100056025 328
652 3300006028 Ga0070717_10025341 Ga0070717_100253414 328
653 3300006173 Ga0070716_100000018 Ga0070716_10000001856 328
654 3300006175 Ga0070712_100003472 Ga0070712_1000034727 328
655 3300006175 Ga0070712_100049473 Ga0070712_1000494732 328
656 3300006237 Ga0097621_100115597 Ga0097621_1001155972 328
657 3300006358 Ga0068871_100000326 Ga0068871_1000003266 328
658 3300006358 Ga0068871_100146260 Ga0068871_1001462601 328
659 3300006358 Ga0068871_100231540 Ga0068871_1002315401 328
660 3300006847 Ga0075431_100007259 Ga0075431_1000072598 328
661 3300006852 Ga0075433_10015832 Ga0075433_100158329 328
662 3300006852 Ga0075433_10023831 Ga0075433_100238312 328
663 3300006871 Ga0075434_100173561 Ga0075434_1001735612 328
664 3300006871 Ga0075434_100276334 Ga0075434_1002763341 328
665 3300006881 Ga0068865_100000488 Ga0068865_10000048812 328
666 3300006881 Ga0068865_100255402 Ga0068865_1002554022 328
667 3300006914 Ga0075436_100021577 Ga0075436_1000215774 328
668 3300007265 Ga0099794_10107622 Ga0099794_101076221 328
669 3300009093 Ga0105240_10102349 Ga0105240_101023493 328
670 3300009094 Ga0111539_10034338 Ga0111539_100343383 328
671 3300009098 Ga0105245_10013166 Ga0105245_100131664 328
672 3300009098 Ga0105245_10020968 Ga0105245_100209682 328
673 3300009098 Ga0105245_10115049 Ga0105245_101150493 328
674 3300009098 Ga0105245_10269941 Ga0105245_102699412 328
675 3300009101 Ga0105247_10003586 Ga0105247_100035864 328
676 3300009147 Ga0114129_10011770 Ga0114129_100117706 328
677 3300009147 Ga0114129_10028295 Ga0114129_100282959 328
678 3300009147 Ga0114129_10090506 Ga0114129_100905062 328
679 3300009174 Ga0105241_10138906 Ga0105241_101389062 328
680 3300009176 Ga0105242_10027786 Ga0105242_100277864 328
681 3300009176 Ga0105242_10167930 Ga0105242_101679302 328
682 3300009545 Ga0105237_10063025 Ga0105237_100630253 328
683 3300009553 Ga0105249_10042710 Ga0105249_100427103 328
684 3300010159 Ga0099796_10062557 Ga0099796_100625571 328
685 3300010375 Ga0105239_10023785 Ga0105239_100237855 328
686 3300010375 Ga0105239_10318326 Ga0105239_103183262 328
687 3300010375 Ga0105239_10341298 Ga0105239_103412982 328
688 3300011119 Ga0105246_10004349 Ga0105246_100043496 328
689 3300013102 Ga0157371_10068647 Ga0157371_100686475 328
690 3300013105 Ga0157369_10042303 Ga0157369_100423034 328
691 3300013296 Ga0157374_10007811 Ga0157374_100078115 328
692 3300013296 Ga0157374_10126403 Ga0157374_101264031 328
693 3300013296 Ga0157374_10311572 Ga0157374_103115722 328
694 3300013297 Ga0157378_10276199 Ga0157378_102761991 328
695 3300013306 Ga0163162_10081001 Ga0163162_100810012 328
696 3300013307 Ga0157372_10025670 Ga0157372_100256703 328
697 3300013307 Ga0157372_10029505 Ga0157372_100295055 328
698 3300013307 Ga0157372_10083914 Ga0157372_100839142 328
699 3300013308 Ga0157375_10004276 Ga0157375_100042766 328
700 3300013308 Ga0157375_10089268 Ga0157375_100892684 328
701 3300013308 Ga0157375_10092613 Ga0157375_100926132 328
702 3300013308 Ga0157375_10214137 Ga0157375_102141371 328
703 3300014325 Ga0163163_10001411 Ga0163163_100014119 328
704 3300014326 Ga0157380_10015267 Ga0157380_100152672 328
705 3300014968 Ga0157379_10017912 Ga0157379_100179126 328
706 3300014968 Ga0157379_10043475 Ga0157379_100434754 328
707 3300014969 Ga0157376_10011896 Ga0157376_100118962 328
708 3300014969 Ga0157376_10168041 Ga0157376_101680412 328
709 3300014969 Ga0157376_10172574 Ga0157376_101725741 328
710 3300014969 Ga0157376_10370836 Ga0157376_103708362 328
711 3300021361 Ga0213872_10008858 Ga0213872_100088583 328
712 3300021361 Ga0213872_10009787 Ga0213872_100097873 328
713 3300021377 Ga0213874_10000402 Ga0213874_100004029 328
714 3300021388 Ga0213875_10001965 Ga0213875_100019656 328
715 3300025272 Ga0209455_1001047 Ga0209455_10010473 328
716 3300025315 Ga0207697_10004903 Ga0207697_100049037 328
717 3300025885 Ga0207653_10000070 Ga0207653_1000007061 328
718 3300025898 Ga0207692_10046150 Ga0207692_100461503 328
719 3300025900 Ga0207710_10010838 Ga0207710_100108384 328
720 3300025901 Ga0207688_10049094 Ga0207688_100490942 328
721 3300025903 Ga0207680_10002655 Ga0207680_100026555 328
722 3300025904 Ga0207647_10097989 Ga0207647_100979892 328
723 3300025905 Ga0207685_10128175 Ga0207685_101281751 328
724 3300025906 Ga0207699_10059293 Ga0207699_100592932 328
725 3300025906 Ga0207699_10175091 Ga0207699_101750912 328
726 3300025907 Ga0207645_10005592 Ga0207645_100055921 328
727 3300025907 Ga0207645_10062305 Ga0207645_100623053 328
728 3300025910 Ga0207684_10000102 Ga0207684_10000102124 328
729 3300025910 Ga0207684_10000186 Ga0207684_100001866 328
730 3300025910 Ga0207684_10029794 Ga0207684_100297941 328
731 3300025910 Ga0207684_10029824 Ga0207684_100298245 328
732 3300025910 Ga0207684_10043780 Ga0207684_100437802 328
733 3300025910 Ga0207684_10048747 Ga0207684_100487471 328
734 3300025910 Ga0207684_10200653 Ga0207684_102006532 328
735 3300025912 Ga0207707_10000053 Ga0207707_1000005337 328
736 3300025913 Ga0207695_10020342 Ga0207695_100203425 328
737 3300025913 Ga0207695_10091449 Ga0207695_100914494 328
738 3300025914 Ga0207671_10000333 Ga0207671_1000033375 328
739 3300025914 Ga0207671_10002406 Ga0207671_1000240611 328
740 3300025915 Ga0207693_10014642 Ga0207693_100146425 328
741 3300025915 Ga0207693_10027230 Ga0207693_100272302 328
742 3300025915 Ga0207693_10068800 Ga0207693_100688002 328
743 3300025915 Ga0207693_10310294 Ga0207693_103102942 328
744 3300025916 Ga0207663_10180361 Ga0207663_101803611 328
745 3300025917 Ga0207660_10004262 Ga0207660_100042622 328
746 3300025921 Ga0207652_10000069 Ga0207652_1000006935 328
747 3300025922 Ga0207646_10007730 Ga0207646_1000773011 328
748 3300025922 Ga0207646_10058917 Ga0207646_100589172 328
749 3300025922 Ga0207646_10060954 Ga0207646_100609542 328
750 3300025922 Ga0207646_10069657 Ga0207646_100696574 328
751 3300025922 Ga0207646_10406482 Ga0207646_104064821 328
752 3300025923 Ga0207681_10169587 Ga0207681_101695871 328
753 3300025924 Ga0207694_10031659 Ga0207694_100316591 328
754 3300025924 Ga0207694_10040627 Ga0207694_100406274 328
755 3300025924 Ga0207694_10149937 Ga0207694_101499372 328
756 3300025927 Ga0207687_10004253 Ga0207687_100042534 328
757 3300025927 Ga0207687_10017997 Ga0207687_100179974 328
758 3300025927 Ga0207687_10032519 Ga0207687_100325194 328
759 3300025927 Ga0207687_10042969 Ga0207687_100429693 328
760 3300025928 Ga0207700_10010940 Ga0207700_100109404 328
761 3300025928 Ga0207700_10034163 Ga0207700_100341633 328
762 3300025928 Ga0207700_10066248 Ga0207700_100662483 328
763 3300025929 Ga0207664_10018858 Ga0207664_100188584 328
764 3300025929 Ga0207664_10144080 Ga0207664_101440802 328
765 3300025933 Ga0207706_10081506 Ga0207706_100815064 328
766 3300025933 Ga0207706_10159208 Ga0207706_101592082 328
767 3300025934 Ga0207686_10014640 Ga0207686_100146404 328
768 3300025934 Ga0207686_10169815 Ga0207686_101698151 328
769 3300025937 Ga0207669_10336036 Ga0207669_103360361 328
770 3300025938 Ga0207704_10001204 Ga0207704_100012043 328
771 3300025938 Ga0207704_10173503 Ga0207704_101735032 328
772 3300025938 Ga0207704_10209006 Ga0207704_102090062 328
773 3300025939 Ga0207665_10000022 Ga0207665_1000002284 328
774 3300025939 Ga0207665_10043026 Ga0207665_100430262 328
775 3300025939 Ga0207665_10066925 Ga0207665_100669252 328
776 3300025939 Ga0207665_10240923 Ga0207665_102409232 328
777 3300025940 Ga0207691_10019641 Ga0207691_100196416 328
778 3300025940 Ga0207691_10207364 Ga0207691_102073642 328
779 3300025942 Ga0207689_10022517 Ga0207689_100225175 328
780 3300025944 Ga0207661_10012720 Ga0207661_100127204 328
781 3300025960 Ga0207651_10012927 Ga0207651_100129272 328
782 3300025961 Ga0207712_10064208 Ga0207712_100642082 328
783 3300025972 Ga0207668_10211716 Ga0207668_102117161 328
784 3300026023 Ga0207677_10076037 Ga0207677_100760372 328
785 3300026023 Ga0207677_10188558 Ga0207677_101885582 328
786 3300026035 Ga0207703_10005599 Ga0207703_100055995 328
787 3300026035 Ga0207703_10055428 Ga0207703_100554282 328
788 3300026035 Ga0207703_10088129 Ga0207703_100881292 328
789 3300026035 Ga0207703_10093917 Ga0207703_100939173 328
790 3300026041 Ga0207639_10016650 Ga0207639_100166502 328
791 3300026041 Ga0207639_10331608 Ga0207639_103316082 328
792 3300026078 Ga0207702_10033602 Ga0207702_100336022 328
793 3300026078 Ga0207702_10066144 Ga0207702_100661443 328
794 3300026088 Ga0207641_10011968 Ga0207641_100119685 328
795 3300026088 Ga0207641_10013935 Ga0207641_100139352 328
796 3300026089 Ga0207648_10344059 Ga0207648_103440591 328
797 3300026095 Ga0207676_10058307 Ga0207676_100583073 328
798 3300026095 Ga0207676_10124015 Ga0207676_101240153 328
799 3300026095 Ga0207676_10396307 Ga0207676_103963071 328
800 3300026116 Ga0207674_10024255 Ga0207674_100242555 328
801 3300026116 Ga0207674_10036723 Ga0207674_100367231 328
802 3300026121 Ga0207683_10001725 Ga0207683_1000172512 328
803 3300026142 Ga0207698_10451872 Ga0207698_104518721 328
804 3300028381 Ga0268264_10167000 Ga0268264_101670002 328
805 3300028381 Ga0268264_10465257 Ga0268264_104652571 328
806 3300028800 Ga0265338_10000062 Ga0265338_100000629 328
807 3300028800 Ga0265338_10088679 Ga0265338_100886792 328
808 3300029957 Ga0265324_10000199 Ga0265324_1000019941 328
809 3300031595 Ga0265313_10000998 Ga0265313_1000099813 328
810 3300031595 Ga0265313_10045869 Ga0265313_100458691 328
811 3300031711 Ga0265314_10012818 Ga0265314_100128187 328
812 3300031901 Ga0307406_10291050 Ga0307406_102910502 328
813 3300031995 Ga0307409_100141770 Ga0307409_1001417703 328
814 3300032126 Ga0307415_100168694 Ga0307415_1001686942 328
815 3300035083 Ga0373926_0005463 Ga0373926_0005463_647_1639 328
816 3300035111 Ga0373923_0021240 Ga0373923_0021240_561_1553 328
817 3300035112 Ga0373932_0035492 Ga0373932_0035492_175_1179 328
818 3300035118 Ga0373954_0011728 Ga0373954_0011728_2518_3510 328
819 3300035118 Ga0373954_0056981 Ga0373954_0056981_775_1767 328
820 3300035170 Ga0373943_0009535 Ga0373943_0009535_3148_4137 328
821 3300035170 Ga0373943_0031701 Ga0373943_0031701_846_1838 328
822 3300035171 Ga0373946_0001205 Ga0373946_0001205_2490_3482 328
823 3300035171 Ga0373946_0033021 Ga0373946_0033021_577_1566 328
824 3300035692 Ga0373935_0001842 Ga0373935_0001842_586_1578 328
825 3300035692 Ga0373935_0015186 Ga0373935_0015186_3631_4626 328
826 3300035692 Ga0373935_0087145 Ga0373935_0087145_400_1392 328
827 3300035692 Ga0373935_0092105 Ga0373935_0092105_753_1745 328
828 3300035695 Ga0373927_0080345 Ga0373927_0080345_1109_2098 328
829 3300035724 Ga0373933_0071030 Ga0373933_0071030_1063_2055 328
830 3300035725 Ga0373947_0000507 Ga0373947_0000507_1133_2125 328
831 3300035725 Ga0373947_0008787 Ga0373947_0008787_4410_5399 328
832 3300036401 Ga0373937_0039010 Ga0373937_0039010_2997_3992 328
833 3300036401 Ga0373937_0041707 Ga0373937_0041707_1216_2211 328
834 3300036401 Ga0373937_0179329 Ga0373937_0179329_801_1793 328
835 3300037068 Ga0373925_0010345 Ga0373925_0010345_921_1913 328
836 3300037068 Ga0373925_0023125 Ga0373925_0023125_91_1083 328
837 3300037068 Ga0373925_0025660 Ga0373925_0025660_1248_2240 328
838 3300037068 Ga0373925_0159208 Ga0373925_0159208_191_1180 328
839 3300037312 Ga0395899_0030383 Ga0395899_0030383_105_1100 328
840 3300037418 Ga0395900_0001621 Ga0395900_0001621_23292_24287 328
841 3300037466 Ga0395898_0003152 Ga0395898_0003152_6449_7444 328
842 3300037471 Ga0395905_0007261 Ga0395905_0007261_165_1160 328
843 3300037853 Ga0436364_1091631 Ga0436364_1091631_6878_7873 328
844 3300038443 Ga0395901_0011354 Ga0395901_0011354_5405_6400 328
845 3300039447 Ga0436361_0229082 Ga0436361_0229082_21791_22789 328
846 3300039447 Ga0436361_0581469 Ga0436361_0581469_7255_8253 328
847 3300039447 Ga0436361_0701016 Ga0436361_0701016_3786_4775 328
848 3300039450 Ga0436363_0054131 Ga0436363_0054131_5750_6739 328
849 3300042876 Ga0451577_0001929 Ga0451577_0001929_18716_19720 328
850 3300042876 Ga0451577_0012657 Ga0451577_0012657_1404_2396 328
851 3300042876 Ga0451577_0018774 Ga0451577_0018774_1072_2076 328
852 3300042876 Ga0451577_0260324 Ga0451577_0260324_524_1528 328
853 3300044673 Ga0453683_0000083 Ga0453683_0000083_51789_52793 328
854 3300044673 Ga0453683_0000413 Ga0453683_0000413_38785_39789 328
855 3300044673 Ga0453683_0014972 Ga0453683_0014972_969_1964 328
856 3300044673 Ga0453683_0023315 Ga0453683_0023315_1175_2167 328
857 3300044693 Ga0466961_0245827 Ga0466961_0245827_42_1034 328
858 3300044712 Ga0453684_0000031 Ga0453684_0000031_680801_681796 328
859 3300044712 Ga0453684_0000176 Ga0453684_0000176_132235_133239 328
860 3300044712 Ga0453684_0000378 Ga0453684_0000378_92583_93587 328
861 3300044712 Ga0453684_0026060 Ga0453684_0026060_777_1772 328
862 3300044712 Ga0453684_0029656 Ga0453684_0029656_5183_6175 328
863 3300044712 Ga0453684_0196291 Ga0453684_0196291_613_1608 328
864 3300045051 Ga0451576_0000492 Ga0451576_0000492_10497_11501 328
865 3300045051 Ga0451576_0466969 Ga0451576_0466969_13_1008 328
866 3300046454 Ga0495592_0006890 Ga0495592_0006890_5809_6801 328
867 3300046455 Ga0495603_0067126 Ga0495603_0067126_655_1650 328
868 3300046455 Ga0495603_0115944 Ga0495603_0115944_550_1542 328
869 3300046461 Ga0495641_0006504 Ga0495641_0006504_5075_6067 328
870 3300046462 Ga0495651_0005822 Ga0495651_0005822_6405_7397 328
871 3300046462 Ga0495651_0007904 Ga0495651_0007904_35_1030 328
872 3300046462 Ga0495651_0045409 Ga0495651_0045409_1403_2395 328
873 3300046462 Ga0495651_0086151 Ga0495651_0086151_228_1220 328
874 3300046462 Ga0495651_0152192 Ga0495651_0152192_554_1543 328
875 3300046462 Ga0495651_0223551 Ga0495651_0223551_87_1079 328
876 3300046463 Ga0495653_0041250 Ga0495653_0041250_608_1600 328
877 3300046463 Ga0495653_0105402 Ga0495653_0105402_918_1910 328
878 3300046472 Ga0495580_0012772 Ga0495580_0012772_946_1941 328
879 3300046473 Ga0495582_0046079 Ga0495582_0046079_571_1566 328
880 3300046475 Ga0495639_0030998 Ga0495639_0030998_961_1956 328
881 3300046475 Ga0495639_0052392 Ga0495639_0052392_658_1650 328
882 3300046476 Ga0495662_0009401 Ga0495662_0009401_3535_4530 328
883 3300046476 Ga0495662_0153635 Ga0495662_0153635_118_1110 328
884 3300046477 Ga0495664_0000216 Ga0495664_0000216_479_1471 328
885 3300046477 Ga0495664_0000862 Ga0495664_0000862_5142_6134 328
886 3300046477 Ga0495664_0027607 Ga0495664_0027607_1905_2900 328
887 3300046492 Ga0495585_0036748 Ga0495585_0036748_742_1773 328
888 3300046499 Ga0495594_0000383 Ga0495594_0000383_10163_11194 328
889 3300046499 Ga0495594_0000482 Ga0495594_0000482_9190_10185 328
890 3300046499 Ga0495594_0004767 Ga0495594_0004767_5775_6770 328
891 3300046499 Ga0495594_0143330 Ga0495594_0143330_120_1112 328
892 3300046511 Ga0495608_0023856 Ga0495608_0023856_1056_2048 328
893 3300046511 Ga0495608_0074525 Ga0495608_0074525_760_1752 328
894 3300046514 Ga0495618_0008303 Ga0495618_0008303_4104_5096 328
895 3300046514 Ga0495618_0096307 Ga0495618_0096307_402_1397 328
896 3300046516 Ga0495628_0038738 Ga0495628_0038738_1375_2367 328
897 3300046516 Ga0495628_0062914 Ga0495628_0062914_598_1593 328
898 3300046517 Ga0495630_0024936 Ga0495630_0024936_1093_2085 328
899 3300046517 Ga0495630_0036191 Ga0495630_0036191_1730_2722 328
900 3300046523 Ga0495644_0000012 Ga0495644_0000012_36239_37270 328
901 3300046526 Ga0495666_0002245 Ga0495666_0002245_3988_4980 328
902 3300046526 Ga0495666_0008619 Ga0495666_0008619_1056_2051 328
903 3300046529 Ga0495652_0023631 Ga0495652_0023631_3126_4121 328
904 3300046529 Ga0495652_0040180 Ga0495652_0040180_198_1190 328
905 3300046529 Ga0495652_0049745 Ga0495652_0049745_1695_2684 328
906 3300046531 Ga0495665_0024280 Ga0495665_0024280_808_1800 328
907 3300046531 Ga0495665_0037118 Ga0495665_0037118_1008_2006 328
908 3300046533 Ga0495640_0009211 Ga0495640_0009211_4640_5635 328
909 3300046533 Ga0495640_0034451 Ga0495640_0034451_421_1410 328
910 3300046533 Ga0495640_0046776 Ga0495640_0046776_1774_2766 328
911 3300046533 Ga0495640_0058208 Ga0495640_0058208_1184_2176 328
912 3300046535 Ga0495586_0000795 Ga0495586_0000795_16744_17736 328
913 3300046535 Ga0495586_0025354 Ga0495586_0025354_1773_2765 328
914 3300046536 Ga0495587_0023653 Ga0495587_0023653_126_1118 328
915 3300046536 Ga0495587_0061050 Ga0495587_0061050_723_1715 328
916 3300046543 Ga0495645_0009545 Ga0495645_0009545_2271_3263 328
917 3300046543 Ga0495645_0031063 Ga0495645_0031063_1806_2798 328
918 3300046559 Ga0495667_0002418 Ga0495667_0002418_5188_6180 328
919 3300046559 Ga0495667_0128390 Ga0495667_0128390_471_1463 328
920 3300046642 Ga0495634_0006223 Ga0495634_0006223_7502_8497 328
921 3300046642 Ga0495634_0018600 Ga0495634_0018600_2067_3059 328
922 3300046660 Ga0495625_0014137 Ga0495625_0014137_1204_2199 328
923 3300046660 Ga0495625_0027398 Ga0495625_0027398_2085_3116 328
924 3300046660 Ga0495625_0035786 Ga0495625_0035786_849_1844 328
925 3300046663 Ga0495635_0004619 Ga0495635_0004619_8031_9023 328
926 3300046663 Ga0495635_0014361 Ga0495635_0014361_299_1291 328
927 3300046663 Ga0495635_0144725 Ga0495635_0144725_610_1605 328
928 3300046675 Ga0495657_0080928 Ga0495657_0080928_591_1583 328
929 3300046678 Ga0495599_0001612 Ga0495599_0001612_1051_2043 328
930 3300046680 Ga0495646_0003046 Ga0495646_0003046_6292_7287 328
931 3300046680 Ga0495646_0008129 Ga0495646_0008129_3191_4183 328
932 3300046684 Ga0495669_0055505 Ga0495669_0055505_45_1040 328
933 3300046689 Ga0495613_0005396 Ga0495613_0005396_3069_4064 328
934 3300046690 Ga0495624_0006474 Ga0495624_0006474_2487_3479 328
935 3300046690 Ga0495624_0054859 Ga0495624_0054859_1437_2432 328
936 3300046691 Ga0495670_0084253 Ga0495670_0084253_153_1184 328
937 3300046809 Ga0495600_0233198 Ga0495600_0233198_80_1072 328
938 3300047315 Ga0495581_0005607 Ga0495581_0005607_3354_4349 328
939 3300047315 Ga0495581_0006451 Ga0495581_0006451_5592_6584 328
940 3300047315 Ga0495581_0117353 Ga0495581_0117353_454_1446 328
941 3300047317 Ga0495604_0037613 Ga0495604_0037613_2794_3786 328
942 3300047317 Ga0495604_0040906 Ga0495604_0040906_1108_2103 328
943 3300047319 Ga0495674_0000912 Ga0495674_0000912_625_1617 328
944 3300047319 Ga0495674_0028334 Ga0495674_0028334_2529_3518 328
945 3300047319 Ga0495674_0037507 Ga0495674_0037507_2057_3049 328
946 3300047319 Ga0495674_0080128 Ga0495674_0080128_1663_2658 328
947 3300047321 Ga0495676_0016996 Ga0495676_0016996_4787_5779 328
948 3300047321 Ga0495676_0095099 Ga0495676_0095099_1140_2132 328
949 3300047321 Ga0495676_0122192 Ga0495676_0122192_107_1102 328
950 3300047322 Ga0495680_0004393 Ga0495680_0004393_5267_6259 328
951 3300047322 Ga0495680_0087530 Ga0495680_0087530_193_1188 328
952 3300047322 Ga0495680_0101994 Ga0495680_0101994_1092_2084 328
953 3300047444 Ga0495675_0001458 Ga0495675_0001458_7115_8110 328
954 3300047445 Ga0495677_0043299 Ga0495677_0043299_135_1166 328
955 3300047445 Ga0495677_0045585 Ga0495677_0045585_539_1534 328
956 3300047471 Ga0495684_0009817 Ga0495684_0009817_5718_6710 328
957 3300047471 Ga0495684_0042837 Ga0495684_0042837_1332_2324 328
958 3300047472 Ga0495686_0002950 Ga0495686_0002950_10577_11572 328
959 3300047472 Ga0495686_0081955 Ga0495686_0081955_591_1586 328
960 3300047673 Ga0495593_0034123 Ga0495593_0034123_1087_2079 328
961 3300048088 Ga0495602_0046043 Ga0495602_0046043_1731_2723 328
962 3300048089 Ga0495614_0000198 Ga0495614_0000198_15180_16175 328
963 3300048905 Ga0496102_0050198 Ga0496102_0050198_1526_2515 328
964 3300048906 Ga0496103_0036123 Ga0496103_0036123_956_1945 328
965 3300048909 Ga0496106_0194237 Ga0496106_0194237_325_1314 328
966 3300048910 Ga0496107_0155270 Ga0496107_0155270_604_1593 328
967 3300048918 Ga0496115_0164618 Ga0496115_0164618_665_1654 328
968 3300048929 Ga0496126_0049743 Ga0496126_0049743_1450_2439 328
969 3300049580 Ga0501046_0282185 Ga0501046_0282185_54_1040 328
970 3300049582 Ga0501048_0025299 Ga0501048_0025299_3086_4072 328
971 3300049591 Ga0501075_0038275 Ga0501075_0038275_498_1484 328
972 3300049675 Ga0501243_010672 Ga0501243_010672_306_1295 328
973 3300049824 Ga0501045_0023940 Ga0501045_0023940_476_1462 328
974 3300050507 nmdc:mga05p37_137720_c1 nmdc:mga05p37_137720_c1_1106_2095 328
975 3300050507 nmdc:mga05p37_172972_c1 nmdc:mga05p37_172972_c1_1013_2002 328
976 3300050507 nmdc:mga05p37_177877_c1 nmdc:mga05p37_177877_c1_1143_2132 328
977 3300050507 nmdc:mga05p37_57342_c1 nmdc:mga05p37_57342_c1_344_1333 328
978 3300050510 nmdc:mga06r32_19899_c1 nmdc:mga06r32_19899_c1_4462_5451 328
979 3300050510 nmdc:mga06r32_2295_c1 nmdc:mga06r32_2295_c1_13502_14497 328
980 3300050512 nmdc:mga0n895_62619_c1 nmdc:mga0n895_62619_c1_1188_2183 328
981 3300050514 nmdc:mga08x19_121460_c1 nmdc:mga08x19_121460_c1_98_1093 328
982 3300050515 nmdc:mga0a205_141836_c1 nmdc:mga0a205_141836_c1_1194_2183 328
983 3300050515 nmdc:mga0a205_342959_c1 nmdc:mga0a205_342959_c1_132_1121 328
984 3300053077 Ga0495601_0007954 Ga0495601_0007954_2727_3716 328
985 3300053085 Ga0495619_0000889 Ga0495619_0000889_2405_3394 328
986 3300053103 Ga0500555_000080 Ga0500555_000080_26793_27788 328
987 3300053104 Ga0500556_0000010 Ga0500556_0000010_218819_219814 328
988 3300053130 Ga0500642_0043608 Ga0500642_0043608_392_1387 328
989 3300053153 Ga0500616_0002767 Ga0500616_0002767_9851_10873 328
990 3300053178 Ga0500637_0005551 Ga0500637_0005551_2263_3258 328
991 3300003323 rootH1_10039424 rootH1_100394244 329
992 3300005290 Ga0065712_10158336 Ga0065712_101583361 329
993 3300005293 Ga0065715_10138188 Ga0065715_101381882 329
994 3300005295 Ga0065707_10197593 Ga0065707_101975931 329
995 3300005329 Ga0070683_100124060 Ga0070683_1001240602 329
996 3300005331 Ga0070670_100038640 Ga0070670_1000386405 329
997 3300005335 Ga0070666_10066056 Ga0070666_100660562 329
998 3300005347 Ga0070668_100041334 Ga0070668_1000413344 329
999 3300005347 Ga0070668_100179692 Ga0070668_1001796922 329
1000 3300005353 Ga0070669_100094939 Ga0070669_1000949392 329
1001 3300005365 Ga0070688_100007829 Ga0070688_1000078292 329
1002 3300005367 Ga0070667_100447740 Ga0070667_1004477401 329
1003 3300005435 Ga0070714_100158732 Ga0070714_1001587324 329
1004 3300005435 Ga0070714_100164628 Ga0070714_1001646282 329
1005 3300005435 Ga0070714_100274517 Ga0070714_1002745171 329
1006 3300005436 Ga0070713_100221213 Ga0070713_1002212132 329
1007 3300005438 Ga0070701_10013510 Ga0070701_100135103 329
1008 3300005440 Ga0070705_100067958 Ga0070705_1000679582 329
1009 3300005441 Ga0070700_100015551 Ga0070700_1000155512 329
1010 3300005444 Ga0070694_100171660 Ga0070694_1001716602 329
1011 3300005445 Ga0070708_100025052 Ga0070708_1000250524 329
1012 3300005445 Ga0070708_100085686 Ga0070708_1000856863 329
1013 3300005445 Ga0070708_100152428 Ga0070708_1001524281 329
1014 3300005457 Ga0070662_100296814 Ga0070662_1002968142 329
1015 3300005467 Ga0070706_100035062 Ga0070706_1000350622 329
1016 3300005467 Ga0070706_100046630 Ga0070706_1000466304 329
1017 3300005467 Ga0070706_100074914 Ga0070706_1000749142 329
1018 3300005467 Ga0070706_100096274 Ga0070706_1000962742 329
1019 3300005467 Ga0070706_100097346 Ga0070706_1000973463 329
1020 3300005467 Ga0070706_100124456 Ga0070706_1001244562 329
1021 3300005468 Ga0070707_100004258 Ga0070707_10000425814 329
1022 3300005468 Ga0070707_100047847 Ga0070707_1000478474 329
1023 3300005468 Ga0070707_100081481 Ga0070707_1000814812 329
1024 3300005468 Ga0070707_100180495 Ga0070707_1001804953 329
1025 3300005468 Ga0070707_100252117 Ga0070707_1002521172 329
1026 3300005471 Ga0070698_100028598 Ga0070698_1000285983 329
1027 3300005471 Ga0070698_100066447 Ga0070698_1000664473 329
1028 3300005518 Ga0070699_100024549 Ga0070699_1000245495 329
1029 3300005518 Ga0070699_100187467 Ga0070699_1001874671 329
1030 3300005535 Ga0070684_100050684 Ga0070684_1000506842 329
1031 3300005536 Ga0070697_100024194 Ga0070697_1000241942 329
1032 3300005536 Ga0070697_100047904 Ga0070697_1000479045 329
1033 3300005543 Ga0070672_100018779 Ga0070672_1000187794 329
1034 3300005549 Ga0070704_100107772 Ga0070704_1001077722 329
1035 3300005563 Ga0068855_100071671 Ga0068855_1000716714 329
1036 3300005614 Ga0068856_100057382 Ga0068856_1000573822 329
1037 3300005616 Ga0068852_100058320 Ga0068852_1000583203 329
1038 3300005617 Ga0068859_100082510 Ga0068859_1000825102 329
1039 3300005841 Ga0068863_100047740 Ga0068863_1000477403 329
1040 3300005842 Ga0068858_100011531 Ga0068858_1000115314 329
1041 3300005842 Ga0068858_100027163 Ga0068858_1000271635 329
1042 3300005843 Ga0068860_100033743 Ga0068860_1000337432 329
1043 3300005843 Ga0068860_100293719 Ga0068860_1002937192 329
1044 3300005937 Ga0081455_10021293 Ga0081455_100212936 329
1045 3300005985 Ga0081539_10000360 Ga0081539_1000036053 329
1046 3300005985 Ga0081539_10023323 Ga0081539_100233234 329
1047 3300006028 Ga0070717_10125937 Ga0070717_101259372 329
1048 3300006175 Ga0070712_100053327 Ga0070712_1000533272 329
1049 3300006237 Ga0097621_100115672 Ga0097621_1001156723 329
1050 3300006852 Ga0075433_10224108 Ga0075433_102241082 329
1051 3300006880 Ga0075429_100017107 Ga0075429_1000171074 329
1052 3300006880 Ga0075429_100327840 Ga0075429_1003278402 329
1053 3300006931 Ga0097620_100082510 Ga0097620_1000825102 329
1054 3300009093 Ga0105240_10002302 Ga0105240_1000230228 329
1055 3300009093 Ga0105240_10037277 Ga0105240_100372776 329
1056 3300009093 Ga0105240_10217481 Ga0105240_102174812 329
1057 3300009093 Ga0105240_10392687 Ga0105240_103926872 329
1058 3300009094 Ga0111539_10031603 Ga0111539_100316035 329
1059 3300009094 Ga0111539_10623082 Ga0111539_106230821 329
1060 3300009553 Ga0105249_10128325 Ga0105249_101283252 329
1061 3300010375 Ga0105239_10046310 Ga0105239_100463103 329
1062 3300013104 Ga0157370_10004699 Ga0157370_1000469910 329
1063 3300013105 Ga0157369_10001835 Ga0157369_100018353 329
1064 3300013105 Ga0157369_10047715 Ga0157369_100477152 329
1065 3300013105 Ga0157369_10556154 Ga0157369_105561541 329
1066 3300013296 Ga0157374_10446994 Ga0157374_104469942 329
1067 3300013297 Ga0157378_10078813 Ga0157378_100788133 329
1068 3300013297 Ga0157378_10195024 Ga0157378_101950242 329
1069 3300013306 Ga0163162_10401630 Ga0163162_104016302 329
1070 3300013308 Ga0157375_10043115 Ga0157375_100431153 329
1071 3300013308 Ga0157375_10065975 Ga0157375_100659752 329
1072 3300014325 Ga0163163_10000790 Ga0163163_100007902 329
1073 3300014326 Ga0157380_10009738 Ga0157380_100097382 329
1074 3300014969 Ga0157376_10017159 Ga0157376_100171596 329
1075 3300021384 Ga0213876_10072411 Ga0213876_100724113 329
1076 3300021388 Ga0213875_10000062 Ga0213875_10000062110 329
1077 3300021388 Ga0213875_10091018 Ga0213875_100910182 329
1078 3300021388 Ga0213875_10126729 Ga0213875_101267291 329
1079 3300025284 Ga0209130_1000319 Ga0209130_100031936 329
1080 3300025290 Ga0207673_1008795 Ga0207673_10087951 329
1081 3300025302 Ga0207426_1000235 Ga0207426_100023536 329
1082 3300025315 Ga0207697_10013161 Ga0207697_100131612 329
1083 3300025904 Ga0207647_10033734 Ga0207647_100337342 329
1084 3300025906 Ga0207699_10094491 Ga0207699_100944912 329
1085 3300025910 Ga0207684_10029510 Ga0207684_100295101 329
1086 3300025910 Ga0207684_10150267 Ga0207684_101502672 329
1087 3300025910 Ga0207684_10153024 Ga0207684_101530242 329
1088 3300025910 Ga0207684_10195942 Ga0207684_101959422 329
1089 3300025911 Ga0207654_10000162 Ga0207654_1000016242 329
1090 3300025913 Ga0207695_10030709 Ga0207695_100307096 329
1091 3300025913 Ga0207695_10055211 Ga0207695_100552116 329
1092 3300025913 Ga0207695_10328364 Ga0207695_103283642 329
1093 3300025915 Ga0207693_10021180 Ga0207693_100211805 329
1094 3300025922 Ga0207646_10000039 Ga0207646_10000039120 329
1095 3300025922 Ga0207646_10005086 Ga0207646_100050868 329
1096 3300025922 Ga0207646_10229845 Ga0207646_102298452 329
1097 3300025922 Ga0207646_10262487 Ga0207646_102624873 329
1098 3300025925 Ga0207650_10152105 Ga0207650_101521052 329
1099 3300025933 Ga0207706_10178496 Ga0207706_101784962 329
1100 3300025933 Ga0207706_10318770 Ga0207706_103187701 329
1101 3300025945 Ga0207679_10342623 Ga0207679_103426232 329
1102 3300025972 Ga0207668_10229219 Ga0207668_102292192 329
1103 3300025986 Ga0207658_10021940 Ga0207658_100219403 329
1104 3300026035 Ga0207703_10008722 Ga0207703_100087224 329
1105 3300026035 Ga0207703_10085355 Ga0207703_100853552 329
1106 3300026067 Ga0207678_10007664 Ga0207678_100076647 329
1107 3300026075 Ga0207708_10007069 Ga0207708_100070695 329
1108 3300026088 Ga0207641_10021257 Ga0207641_100212576 329
1109 3300026095 Ga0207676_10475700 Ga0207676_104757001 329
1110 3300027671 Ga0209588_1010591 Ga0209588_10105913 329
1111 3300027876 Ga0209974_10019229 Ga0209974_100192292 329
1112 3300027907 Ga0207428_10116347 Ga0207428_101163472 329
1113 3300028379 Ga0268266_10054343 Ga0268266_100543432 329
1114 3300028379 Ga0268266_10193289 Ga0268266_101932892 329
1115 3300028381 Ga0268264_10136603 Ga0268264_101366032 329
1116 3300028381 Ga0268264_10298835 Ga0268264_102988352 329
1117 3300028381 Ga0268264_10551416 Ga0268264_105514161 329
1118 3300028556 Ga0265337_1000149 Ga0265337_100014922 329
1119 3300028556 Ga0265337_1002538 Ga0265337_10025382 329
1120 3300028558 Ga0265326_10010565 Ga0265326_100105652 329
1121 3300028558 Ga0265326_10012544 Ga0265326_100125442 329
1122 3300028563 Ga0265319_1001902 Ga0265319_10019025 329
1123 3300028563 Ga0265319_1024016 Ga0265319_10240163 329
1124 3300028573 Ga0265334_10040501 Ga0265334_100405012 329
1125 3300028573 Ga0265334_10049055 Ga0265334_100490553 329
1126 3300028573 Ga0265334_10050736 Ga0265334_100507362 329
1127 3300028577 Ga0265318_10077307 Ga0265318_100773071 329
1128 3300028653 Ga0265323_10000599 Ga0265323_1000059917 329
1129 3300028653 Ga0265323_10005044 Ga0265323_100050445 329
1130 3300028653 Ga0265323_10064813 Ga0265323_100648132 329
1131 3300028654 Ga0265322_10052320 Ga0265322_100523201 329
1132 3300028666 Ga0265336_10000409 Ga0265336_1000040920 329
1133 3300028800 Ga0265338_10002023 Ga0265338_1000202327 329
1134 3300028800 Ga0265338_10008409 Ga0265338_100084093 329
1135 3300028800 Ga0265338_10012651 Ga0265338_100126515 329
1136 3300028800 Ga0265338_10021594 Ga0265338_100215943 329
1137 3300028800 Ga0265338_10031900 Ga0265338_100319007 329
1138 3300028800 Ga0265338_10159431 Ga0265338_101594312 329
1139 3300028800 Ga0265338_10160653 Ga0265338_101606531 329
1140 3300029957 Ga0265324_10021977 Ga0265324_100219773 329
1141 3300029957 Ga0265324_10024205 Ga0265324_100242052 329
1142 3300029957 Ga0265324_10089062 Ga0265324_100890621 329
1143 3300031235 Ga0265330_10016813 Ga0265330_100168132 329
1144 3300031238 Ga0265332_10022031 Ga0265332_100220313 329
1145 3300031238 Ga0265332_10041629 Ga0265332_100416292 329
1146 3300031240 Ga0265320_10001826 Ga0265320_100018265 329
1147 3300031240 Ga0265320_10075377 Ga0265320_100753772 329
1148 3300031240 Ga0265320_10095456 Ga0265320_100954561 329
1149 3300031240 Ga0265320_10095598 Ga0265320_100955982 329
1150 3300031241 Ga0265325_10044983 Ga0265325_100449831 329
1151 3300031242 Ga0265329_10035815 Ga0265329_100358152 329
1152 3300031247 Ga0265340_10000171 Ga0265340_1000017114 329
1153 3300031249 Ga0265339_10007592 Ga0265339_100075929 329
1154 3300031251 Ga0265327_10013977 Ga0265327_100139773 329
1155 3300031344 Ga0265316_10000250 Ga0265316_1000025018 329
1156 3300031344 Ga0265316_10010404 Ga0265316_100104044 329
1157 3300031344 Ga0265316_10032762 Ga0265316_100327621 329
1158 3300031344 Ga0265316_10037916 Ga0265316_100379164 329
1159 3300031344 Ga0265316_10256329 Ga0265316_102563292 329
1160 3300031595 Ga0265313_10036212 Ga0265313_100362122 329
1161 3300031711 Ga0265314_10000496 Ga0265314_1000049624 329
1162 3300031711 Ga0265314_10041586 Ga0265314_100415861 329
1163 3300031712 Ga0265342_10006458 Ga0265342_100064589 329
1164 3300031712 Ga0265342_10033904 Ga0265342_100339045 329
1165 3300035083 Ga0373926_0030779 Ga0373926_0030779_858_1856 329
1166 3300035086 Ga0373934_0000356 Ga0373934_0000356_524_1591 329
1167 3300035118 Ga0373954_0000320 Ga0373954_0000320_9089_10156 329
1168 3300035118 Ga0373954_0114452 Ga0373954_0114452_22_1020 329
1169 3300035172 Ga0373955_0000887 Ga0373955_0000887_9190_10257 329
1170 3300035410 Ga0373924_0027164 Ga0373924_0027164_1091_2089 329
1171 3300035691 Ga0373931_0069639 Ga0373931_0069639_393_1391 329
1172 3300035692 Ga0373935_0003271 Ga0373935_0003271_5881_6879 329
1173 3300035695 Ga0373927_0003908 Ga0373927_0003908_813_1811 329
1174 3300035695 Ga0373927_0004821 Ga0373927_0004821_8225_9223 329
1175 3300035724 Ga0373933_0000605 Ga0373933_0000605_12155_13222 329
1176 3300035725 Ga0373947_0002949 Ga0373947_0002949_498_1496 329
1177 3300036401 Ga0373937_0000865 Ga0373937_0000865_7694_8761 329
1178 3300036401 Ga0373937_0004802 Ga0373937_0004802_3871_4869 329
1179 3300036401 Ga0373937_0107137 Ga0373937_0107137_1413_2411 329
1180 3300036401 Ga0373937_0142331 Ga0373937_0142331_1118_2137 329
1181 3300036401 Ga0373937_0151635 Ga0373937_0151635_346_1338 329
1182 3300036401 Ga0373937_0499645 Ga0373937_0499645_86_1084 329
1183 3300037068 Ga0373925_0000612 Ga0373925_0000612_15699_16697 329
1184 3300037853 Ga0436364_0370592 Ga0436364_0370592_11883_12878 329
1185 3300037853 Ga0436364_0487501 Ga0436364_0487501_839_1834 329
1186 3300037853 Ga0436364_1380142 Ga0436364_1380142_1131_2126 329
1187 3300039437 Ga0436365_0538371 Ga0436365_0538371_563_1558 329
1188 3300039437 Ga0436365_1888099 Ga0436365_1888099_5890_6885 329
1189 3300039438 Ga0436360_0726393 Ga0436360_0726393_16679_17674 329
1190 3300039450 Ga0436363_1349028 Ga0436363_1349028_164_1159 329
1191 3300042133 Ga0450896_007516 Ga0450896_007516_129_1121 329
1192 3300044712 Ga0453684_0018006 Ga0453684_0018006_5790_6785 329
1193 3300045976 Ga0466967_0341596 Ga0466967_0341596_231_1226 329
1194 3300046454 Ga0495592_0091053 Ga0495592_0091053_50_1048 329
1195 3300046454 Ga0495592_0098677 Ga0495592_0098677_922_1914 329
1196 3300046459 Ga0495629_0290844 Ga0495629_0290844_94_1086 329
1197 3300046462 Ga0495651_0001881 Ga0495651_0001881_7874_8872 329
1198 3300046462 Ga0495651_0093146 Ga0495651_0093146_300_1292 329
1199 3300046463 Ga0495653_0005872 Ga0495653_0005872_3702_4700 329
1200 3300046463 Ga0495653_0081683 Ga0495653_0081683_514_1581 329
1201 3300046472 Ga0495580_0014051 Ga0495580_0014051_3773_4771 329
1202 3300046472 Ga0495580_0016045 Ga0495580_0016045_1554_2546 329
1203 3300046472 Ga0495580_0020839 Ga0495580_0020839_970_1968 329
1204 3300046472 Ga0495580_0022435 Ga0495580_0022435_171_1229 329
1205 3300046473 Ga0495582_0000069 Ga0495582_0000069_48393_49385 329
1206 3300046477 Ga0495664_0017805 Ga0495664_0017805_2074_3072 329
1207 3300046511 Ga0495608_0008788 Ga0495608_0008788_3456_4454 329
1208 3300046514 Ga0495618_0047286 Ga0495618_0047286_744_1742 329
1209 3300046514 Ga0495618_0135208 Ga0495618_0135208_287_1279 329
1210 3300046514 Ga0495618_0157208 Ga0495618_0157208_229_1227 329
1211 3300046516 Ga0495628_0052039 Ga0495628_0052039_2051_3043 329
1212 3300046517 Ga0495630_0003042 Ga0495630_0003042_6998_7996 329
1213 3300046526 Ga0495666_0030447 Ga0495666_0030447_1582_2580 329
1214 3300046529 Ga0495652_0035703 Ga0495652_0035703_1631_2629 329
1215 3300046529 Ga0495652_0066152 Ga0495652_0066152_571_1638 329
1216 3300046529 Ga0495652_0142918 Ga0495652_0142918_210_1205 329
1217 3300046531 Ga0495665_0003556 Ga0495665_0003556_3771_4769 329
1218 3300046533 Ga0495640_0139067 Ga0495640_0139067_248_1246 329
1219 3300046535 Ga0495586_0003395 Ga0495586_0003395_6007_7005 329
1220 3300046536 Ga0495587_0002734 Ga0495587_0002734_138_1205 329
1221 3300046536 Ga0495587_0039068 Ga0495587_0039068_841_1839 329
1222 3300046536 Ga0495587_0072533 Ga0495587_0072533_761_1756 329
1223 3300046537 Ga0495598_0015004 Ga0495598_0015004_302_1303 329
1224 3300046543 Ga0495645_0006117 Ga0495645_0006117_3439_4431 329
1225 3300046559 Ga0495667_0095380 Ga0495667_0095380_489_1487 329
1226 3300046642 Ga0495634_0028589 Ga0495634_0028589_2425_3423 329
1227 3300046663 Ga0495635_0006363 Ga0495635_0006363_2531_3529 329
1228 3300046675 Ga0495657_0012734 Ga0495657_0012734_3834_4832 329
1229 3300046678 Ga0495599_0039902 Ga0495599_0039902_240_1232 329
1230 3300046679 Ga0495623_0004871 Ga0495623_0004871_1801_2799 329
1231 3300046679 Ga0495623_0017662 Ga0495623_0017662_1348_2343 329
1232 3300046680 Ga0495646_0003994 Ga0495646_0003994_4891_5889 329
1233 3300046680 Ga0495646_0019786 Ga0495646_0019786_1030_2022 329
1234 3300046689 Ga0495613_0009476 Ga0495613_0009476_6170_7168 329
1235 3300046690 Ga0495624_0004930 Ga0495624_0004930_1802_2800 329
1236 3300046809 Ga0495600_0129209 Ga0495600_0129209_547_1545 329
1237 3300047317 Ga0495604_0001103 Ga0495604_0001103_19910_20977 329
1238 3300047317 Ga0495604_0005017 Ga0495604_0005017_3936_4934 329
1239 3300047319 Ga0495674_0042768 Ga0495674_0042768_2491_3489 329
1240 3300047321 Ga0495676_0016450 Ga0495676_0016450_2047_3045 329
1241 3300047322 Ga0495680_0011828 Ga0495680_0011828_1350_2348 329
1242 3300047322 Ga0495680_0192461 Ga0495680_0192461_68_1135 329
1243 3300047444 Ga0495675_0001196 Ga0495675_0001196_6375_7373 329
1244 3300047471 Ga0495684_0006500 Ga0495684_0006500_4588_5586 329
1245 3300047471 Ga0495684_0008177 Ga0495684_0008177_1854_2852 329
1246 3300047471 Ga0495684_0049566 Ga0495684_0049566_2031_3098 329
1247 3300047673 Ga0495593_0002720 Ga0495593_0002720_7437_8435 329
1248 3300048088 Ga0495602_0013888 Ga0495602_0013888_1571_2638 329
1249 3300048088 Ga0495602_0082466 Ga0495602_0082466_1406_2404 329
1250 3300048089 Ga0495614_0005949 Ga0495614_0005949_1533_2531 329
1251 3300048906 Ga0496103_0109609 Ga0496103_0109609_373_1374 329
1252 3300048909 Ga0496106_0060961 Ga0496106_0060961_1537_2538 329
1253 3300048914 Ga0496111_0074613 Ga0496111_0074613_523_1524 329
1254 3300048915 Ga0496112_0097830 Ga0496112_0097830_912_1910 329
1255 3300048918 Ga0496115_0020895 Ga0496115_0020895_1777_2775 329
1256 3300049578 Ga0501042_0168353 Ga0501042_0168353_16_1008 329
1257 3300049581 Ga0501047_0312864 Ga0501047_0312864_399_1394 329
1258 3300049592 Ga0501076_0217474 Ga0501076_0217474_542_1534 329
1259 3300049742 Ga0501080_0411658 Ga0501080_0411658_149_1144 329
1260 3300049823 Ga0501044_0063489 Ga0501044_0063489_537_1532 329
1261 3300050507 nmdc:mga05p37_150658_c1 nmdc:mga05p37_150658_c1_1369_2388 329
1262 3300050508 nmdc:mga09592_26822_c1 nmdc:mga09592_26822_c1_3307_4302 329
1263 3300050508 nmdc:mga09592_294676_c1 nmdc:mga09592_294676_c1_265_1260 329
1264 3300050511 nmdc:mga08y16_118505_c1 nmdc:mga08y16_118505_c1_375_1370 329
1265 3300050515 nmdc:mga0a205_377078_c1 nmdc:mga0a205_377078_c1_110_1111 329
1266 3300053077 Ga0495601_0014465 Ga0495601_0014465_3697_4689 329
1267 3300053078 Ga0495612_0003186 Ga0495612_0003186_2490_3488 329
1268 3300053130 Ga0500642_0022100 Ga0500642_0022100_778_1770 329
1269 2162886011 MRS1b_contig_3934553 MRS1b_0860.00000750 330
1270 3300005289 Ga0065704_10170473 Ga0065704_101704731 330
1271 3300005329 Ga0070683_100337730 Ga0070683_1003377302 330
1272 3300005330 Ga0070690_100017216 Ga0070690_1000172165 330
1273 3300005330 Ga0070690_100086926 Ga0070690_1000869263 330
1274 3300005330 Ga0070690_100095431 Ga0070690_1000954312 330
1275 3300005331 Ga0070670_100050479 Ga0070670_1000504793 330
1276 3300005335 Ga0070666_10000945 Ga0070666_1000094511 330
1277 3300005335 Ga0070666_10023823 Ga0070666_100238233 330
1278 3300005338 Ga0068868_100149068 Ga0068868_1001490682 330
1279 3300005340 Ga0070689_100024445 Ga0070689_1000244453 330
1280 3300005344 Ga0070661_100092045 Ga0070661_1000920453 330
1281 3300005347 Ga0070668_100014490 Ga0070668_1000144902 330
1282 3300005354 Ga0070675_100024122 Ga0070675_1000241224 330
1283 3300005355 Ga0070671_100023577 Ga0070671_1000235773 330
1284 3300005356 Ga0070674_100036954 Ga0070674_1000369545 330
1285 3300005365 Ga0070688_100035564 Ga0070688_1000355642 330
1286 3300005367 Ga0070667_100118136 Ga0070667_1001181361 330
1287 3300005445 Ga0070708_100323129 Ga0070708_1003231292 330
1288 3300005455 Ga0070663_100337099 Ga0070663_1003370991 330
1289 3300005456 Ga0070678_100031727 Ga0070678_1000317275 330
1290 3300005459 Ga0068867_100022000 Ga0068867_1000220003 330
1291 3300005467 Ga0070706_100036024 Ga0070706_1000360246 330
1292 3300005468 Ga0070707_100001910 Ga0070707_10000191011 330
1293 3300005543 Ga0070672_100027117 Ga0070672_1000271173 330
1294 3300005548 Ga0070665_100277477 Ga0070665_1002774771 330
1295 3300005548 Ga0070665_100290589 Ga0070665_1002905891 330
1296 3300005564 Ga0070664_100094832 Ga0070664_1000948323 330
1297 3300005841 Ga0068863_100187968 Ga0068863_1001879683 330
1298 3300005842 Ga0068858_100013587 Ga0068858_1000135876 330
1299 3300005843 Ga0068860_100011708 Ga0068860_1000117083 330
1300 3300006028 Ga0070717_10136397 Ga0070717_101363972 330
1301 3300006237 Ga0097621_100002285 Ga0097621_1000022857 330
1302 3300006237 Ga0097621_100052967 Ga0097621_1000529672 330
1303 3300006237 Ga0097621_100508614 Ga0097621_1005086141 330
1304 3300006358 Ga0068871_100049824 Ga0068871_1000498243 330
1305 3300006881 Ga0068865_100040424 Ga0068865_1000404242 330
1306 3300009093 Ga0105240_10013037 Ga0105240_100130375 330
1307 3300009093 Ga0105240_10138573 Ga0105240_101385732 330
1308 3300009098 Ga0105245_10006821 Ga0105245_100068219 330
1309 3300009098 Ga0105245_10075127 Ga0105245_100751273 330
1310 3300009098 Ga0105245_10145287 Ga0105245_101452872 330
1311 3300009147 Ga0114129_10466684 Ga0114129_104666841 330
1312 3300009174 Ga0105241_10012872 Ga0105241_100128722 330
1313 3300009174 Ga0105241_10224312 Ga0105241_102243122 330
1314 3300009176 Ga0105242_10004976 Ga0105242_100049765 330
1315 3300009176 Ga0105242_10016170 Ga0105242_100161702 330
1316 3300009177 Ga0105248_10003181 Ga0105248_100031817 330
1317 3300009177 Ga0105248_10139357 Ga0105248_101393572 330
1318 3300009177 Ga0105248_10192850 Ga0105248_101928503 330
1319 3300009545 Ga0105237_10051336 Ga0105237_100513362 330
1320 3300009551 Ga0105238_10040741 Ga0105238_100407412 330
1321 3300010375 Ga0105239_10016181 Ga0105239_100161813 330
1322 3300011119 Ga0105246_10006754 Ga0105246_100067542 330
1323 3300013296 Ga0157374_10023256 Ga0157374_100232564 330
1324 3300013296 Ga0157374_10045920 Ga0157374_100459204 330
1325 3300013297 Ga0157378_10009183 Ga0157378_100091833 330
1326 3300013297 Ga0157378_10022214 Ga0157378_100222143 330
1327 3300013306 Ga0163162_10054941 Ga0163162_100549413 330
1328 3300013306 Ga0163162_10072278 Ga0163162_100722782 330
1329 3300013306 Ga0163162_10073665 Ga0163162_100736653 330
1330 3300013306 Ga0163162_10560477 Ga0163162_105604771 330
1331 3300013308 Ga0157375_10011650 Ga0157375_100116502 330
1332 3300013308 Ga0157375_10075868 Ga0157375_100758685 330
1333 3300013308 Ga0157375_10119927 Ga0157375_101199272 330
1334 3300013308 Ga0157375_10562482 Ga0157375_105624822 330
1335 3300014325 Ga0163163_10469210 Ga0163163_104692102 330
1336 3300014968 Ga0157379_10038636 Ga0157379_100386365 330
1337 3300014969 Ga0157376_10021516 Ga0157376_100215163 330
1338 3300014969 Ga0157376_10108020 Ga0157376_101080201 330
1339 3300021358 Ga0213873_10022896 Ga0213873_100228962 330
1340 3300021384 Ga0213876_10035870 Ga0213876_100358702 330
1341 3300021384 Ga0213876_10042032 Ga0213876_100420321 330
1342 3300021388 Ga0213875_10004962 Ga0213875_100049622 330
1343 3300025901 Ga0207688_10050911 Ga0207688_100509112 330
1344 3300025903 Ga0207680_10001961 Ga0207680_100019619 330
1345 3300025903 Ga0207680_10053642 Ga0207680_100536423 330
1346 3300025911 Ga0207654_10080852 Ga0207654_100808522 330
1347 3300025922 Ga0207646_10000137 Ga0207646_1000013711 330
1348 3300025926 Ga0207659_10057697 Ga0207659_100576973 330
1349 3300025927 Ga0207687_10001558 Ga0207687_100015589 330
1350 3300025934 Ga0207686_10039017 Ga0207686_100390172 330
1351 3300025937 Ga0207669_10053181 Ga0207669_100531812 330
1352 3300025938 Ga0207704_10220289 Ga0207704_102202892 330
1353 3300025941 Ga0207711_10003495 Ga0207711_100034957 330
1354 3300025941 Ga0207711_10211204 Ga0207711_102112043 330
1355 3300025960 Ga0207651_10053533 Ga0207651_100535333 330
1356 3300025986 Ga0207658_10028997 Ga0207658_100289975 330
1357 3300025986 Ga0207658_10059169 Ga0207658_100591693 330
1358 3300026023 Ga0207677_10102995 Ga0207677_101029951 330
1359 3300026035 Ga0207703_10027909 Ga0207703_100279095 330
1360 3300026088 Ga0207641_10021798 Ga0207641_100217982 330
1361 3300026089 Ga0207648_10006549 Ga0207648_100065498 330
1362 3300028381 Ga0268264_10004215 Ga0268264_100042157 330
1363 3300030760 Ga0265762_1002363 Ga0265762_10023632 330
1364 3300031344 Ga0265316_10021111 Ga0265316_100211116 330
1365 3300031344 Ga0265316_10112363 Ga0265316_101123632 330
1366 3300031711 Ga0265314_10006476 Ga0265314_100064765 330
1367 3300031852 Ga0307410_10317763 Ga0307410_103177631 330
1368 3300031995 Ga0307409_100199564 Ga0307409_1001995642 330
1369 3300032004 Ga0307414_10269110 Ga0307414_102691101 330
1370 3300032005 Ga0307411_10033453 Ga0307411_100334532 330
1371 3300035114 Ga0373939_0052516 Ga0373939_0052516_205_1212 330
1372 3300035692 Ga0373935_0002526 Ga0373935_0002526_6721_7728 330
1373 3300035724 Ga0373933_0027979 Ga0373933_0027979_110_1117 330
1374 3300035725 Ga0373947_0018213 Ga0373947_0018213_2145_3152 330
1375 3300036401 Ga0373937_0017297 Ga0373937_0017297_4041_5087 330
1376 3300036401 Ga0373937_0327123 Ga0373937_0327123_10_1074 330
1377 3300037068 Ga0373925_0003562 Ga0373925_0003562_8701_9708 330
1378 3300037853 Ga0436364_0536254 Ga0436364_0536254_10718_11725 330
1379 3300039437 Ga0436365_0371105 Ga0436365_0371105_1245_2246 330
1380 3300039437 Ga0436365_0570153 Ga0436365_0570153_1886_2881 330
1381 3300039438 Ga0436360_0429766 Ga0436360_0429766_545_1546 330
1382 3300039450 Ga0436363_1394143 Ga0436363_1394143_655_1650 330
1383 3300039453 Ga0436362_1286717 Ga0436362_1286717_781_1776 330
1384 3300046459 Ga0495629_0065810 Ga0495629_0065810_213_1220 330
1385 3300046472 Ga0495580_0031927 Ga0495580_0031927_2144_3151 330
1386 3300046531 Ga0495665_0026992 Ga0495665_0026992_865_1896 330
1387 3300046559 Ga0495667_0072699 Ga0495667_0072699_250_1257 330
1388 3300048911 Ga0496108_0295354 Ga0496108_0295354_355_1347 330
1389 3300048915 Ga0496112_0243602 Ga0496112_0243602_679_1671 330
1390 3300053084 Ga0495595_0150078 Ga0495595_0150078_83_1090 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

313

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9548 1 310
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9391 1 321
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9293 1 321
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9211 2 312
3uyi-assembly1.cif.gz_A-2 crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9192 1 309
ID Description Score Start End Superfamily
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9556 1 226 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9539 74 328 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9528 2 257 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9459 1 330 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9418 4 330 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 1.001 124 207 GO:0004033
GO:0005737
AF-A0A2V8YW19-F1-model_v4 Aldo/keto reductase 0.9945 100 330 GO:0004033
GO:0005737
AF-A0A1I2DYD0-F1-model_v4 Predicted oxidoreductase 0.9916 1 330 GO:0004033
GO:0005737
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9913 98 199 GO:0004033
GO:0005737
AF-A0A2V8YW19-F1-model_v4 Aldo/keto reductase 0.986 100 330 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
95.31 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map