F493589

General Info

Members Datasets Scaffolds Average Seq Length
1391 483 1384 155

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100031602|Ga0070690_1000316023
Length 157
Sequence MRRSAAKPRKIDPDPIFRNRLVTKLINRAMYDGKKSVIQREVYGAFDLIAKKGEDPMQVFSLAMENVKPQMEVRARRIGGAAYQVPQPVRGVRKEALAIRWIVASSRARSNSEFHTYAEKLATELLEASKNEGGAVRKKQDMEKTADANRAFSHFRW

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
3 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
4 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
5 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
6 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
7 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
140 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
141 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
253 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
267 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
268 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
269 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
275 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
276 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
277 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
282 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
291 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
294 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
295 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
296 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
297 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
298 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
306 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
307 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
316 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
321 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
322 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
323 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
329 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
343 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
365 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
366 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
367 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
368 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
408 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
425 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
426 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
429 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
432 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
433 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
434 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
435 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
445 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
446 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
458 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
461 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
462 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
466 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
467 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
468 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
469 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
470 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
471 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
472 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
473 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
474 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
475 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
476 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
477 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
480 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.01
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0.14
Rhizoplane 8.91
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003680 3300001989 Bacteria 5846
2 JGI24744J21845_10009957 3300002077 Bacteria 1949
3 JGI24034J26672_10026341 3300002239 Bacteria 932
4 JGI24751J29686_10002788 3300002459 Bacteria 3515
5 JGI25153J46596_10019740 3300003215 Bacteria 2570
6 Ga0055536_1002518 3300003781 Bacteria 10276
7 Ga0055530_10015497 3300003791 Bacteria 2484
8 Ga0055540_1016845 3300003792 Bacteria 2059
9 Ga0055531_10016122 3300003794 Bacteria 3244
10 Ga0065165_1052002 3300005262 Bacteria 1159
11 Ga0065712_10221854 3300005290 Bacteria 1035
12 Ga0065715_10120074 3300005293 Bacteria 2268
13 Ga0070658_10117184 3300005327 Bacteria 2211
14 Ga0070676_10003697 3300005328 Bacteria 8017
15 Ga0070683_100066664 3300005329 Bacteria 3354
16 Ga0070690_100000669 3300005330 Bacteria 17468
17 Ga0070690_100031602 3300005330 Bacteria 3299
18 Ga0070690_100437829 3300005330 Bacteria 967
19 Ga0070670_100000376 3300005331 Bacteria 37212
20 Ga0070677_10061351 3300005333 Bacteria 1552
21 Ga0070677_10217266 3300005333 Bacteria 932
22 Ga0068869_100017443 3300005334 Bacteria 4866
23 Ga0068869_100350225 3300005334 Bacteria 1204
24 Ga0068869_100792907 3300005334 Bacteria 814
25 Ga0070666_10010589 3300005335 Bacteria 5770
26 Ga0070666_10238426 3300005335 Bacteria 1286
27 Ga0070680_100002865 3300005336 Bacteria 12804
28 Ga0070680_100022142 3300005336 Bacteria 5055
29 Ga0070680_100045100 3300005336 Bacteria 3583
30 Ga0070680_100063280 3300005336 Bacteria 3030
31 Ga0070682_100000906 3300005337 Bacteria 17327
32 Ga0070682_100002069 3300005337 Bacteria 11170
33 Ga0070682_100080167 3300005337 Bacteria 2110
34 Ga0070682_100457835 3300005337 Bacteria 979
35 Ga0068868_100002279 3300005338 Bacteria 13258
36 Ga0068868_101195933 3300005338 Bacteria 703
37 Ga0070660_100000686 3300005339 Bacteria 22383
38 Ga0070660_100025853 3300005339 Bacteria 4367
39 Ga0070660_100980122 3300005339 Bacteria 714
40 Ga0070689_100000122 3300005340 Bacteria 44668
41 Ga0070689_100001563 3300005340 Bacteria 14593
42 Ga0070689_100561436 3300005340 Bacteria 985
43 Ga0070689_100636419 3300005340 Bacteria 927
44 Ga0070689_100806752 3300005340 Bacteria 826
45 Ga0070689_101300264 3300005340 Bacteria 655
46 Ga0070691_10000490 3300005341 Bacteria 14859
47 Ga0070691_10071705 3300005341 Bacteria 1682
48 Ga0070691_10112071 3300005341 Bacteria 1366
49 Ga0070691_10122218 3300005341 Bacteria 1312
50 Ga0070691_10491655 3300005341 Bacteria 708
51 Ga0070687_100021008 3300005343 Bacteria 3061
52 Ga0070687_100633737 3300005343 Bacteria 739
53 Ga0070661_100000385 3300005344 Bacteria 34633
54 Ga0070661_100113169 3300005344 Bacteria 2028
55 Ga0070692_10001302 3300005345 Bacteria 8967
56 Ga0070692_10087562 3300005345 Bacteria 1688
57 Ga0070692_10135442 3300005345 Bacteria 1388
58 Ga0070692_10188993 3300005345 Bacteria 1198
59 Ga0070692_10350890 3300005345 Bacteria 917
60 Ga0070692_10404232 3300005345 Bacteria 863
61 Ga0070668_100005991 3300005347 Bacteria 9018
62 Ga0070668_100097873 3300005347 Bacteria 2321
63 Ga0070668_100630128 3300005347 Bacteria 940
64 Ga0070668_100717684 3300005347 Bacteria 883
65 Ga0070668_100901193 3300005347 Bacteria 790
66 Ga0070668_101757251 3300005347 Bacteria 570
67 Ga0070669_100002082 3300005353 Bacteria 14453
68 Ga0070669_100832448 3300005353 Bacteria 786
69 Ga0070669_101013596 3300005353 Bacteria 713
70 Ga0070675_100005878 3300005354 Bacteria 9400
71 Ga0070675_101154866 3300005354 Bacteria 713
72 Ga0070671_100001283 3300005355 Bacteria 18858
73 Ga0070671_100302239 3300005355 Bacteria 1362
74 Ga0070674_100000649 3300005356 Bacteria 17518
75 Ga0070674_100097379 3300005356 Bacteria 2136
76 Ga0070674_100530538 3300005356 Bacteria 985
77 Ga0070673_100121391 3300005364 Bacteria 2180
78 Ga0070688_100000217 3300005365 Bacteria 30556
79 Ga0070688_100028311 3300005365 Bacteria 3343
80 Ga0070688_100202736 3300005365 Bacteria 1389
81 Ga0070688_100965974 3300005365 Bacteria 675
82 Ga0070659_100002236 3300005366 Bacteria 13760
83 Ga0070659_100023489 3300005366 Bacteria 4719
84 Ga0070659_100045573 3300005366 Bacteria 3435
85 Ga0070659_100227582 3300005366 Bacteria 1540
86 Ga0070659_100270890 3300005366 Bacteria 1411
87 Ga0070659_100859937 3300005366 Bacteria 791
88 Ga0070667_100002610 3300005367 Bacteria 15628
89 Ga0070667_100092102 3300005367 Bacteria 2607
90 Ga0070667_100128893 3300005367 Bacteria 2207
91 Ga0070667_100226989 3300005367 Bacteria 1664
92 Ga0070667_101605522 3300005367 Unclassified 611
93 Ga0070703_10004053 3300005406 Bacteria 4136
94 Ga0070709_10001232 3300005434 Bacteria 14032
95 Ga0070709_10288704 3300005434 Bacteria 1194
96 Ga0070709_10735828 3300005434 Bacteria 770
97 Ga0070714_100018042 3300005435 Bacteria 5725
98 Ga0070713_100001927 3300005436 Bacteria 13398
99 Ga0070713_100078299 3300005436 Bacteria 2814
100 Ga0070710_10166478 3300005437 Bacteria 1371
101 Ga0070701_10004381 3300005438 Bacteria 5709
102 Ga0070711_100000834 3300005439 Bacteria 16154
103 Ga0070711_100512272 3300005439 Bacteria 991
104 Ga0070711_100752604 3300005439 Bacteria 824
105 Ga0070705_100001704 3300005440 Bacteria 11456
106 Ga0070705_100004368 3300005440 Bacteria 6882
107 Ga0070705_100461106 3300005440 Bacteria 956
108 Ga0070700_100002377 3300005441 Bacteria 9585
109 Ga0070700_100065396 3300005441 Bacteria 2306
110 Ga0070700_100091434 3300005441 Bacteria 1987
111 Ga0070700_100091728 3300005441 Bacteria 1984
112 Ga0070700_100098903 3300005441 Bacteria 1918
113 Ga0070700_100353274 3300005441 Bacteria 1090
114 Ga0070700_100711397 3300005441 Bacteria 800
115 Ga0070694_100000195 3300005444 Bacteria 32086
116 Ga0070694_100036040 3300005444 Bacteria 3274
117 Ga0070694_100133401 3300005444 Bacteria 1797
118 Ga0070694_100202098 3300005444 Bacteria 1482
119 Ga0070694_100389255 3300005444 Bacteria 1089
120 Ga0070694_100637231 3300005444 Bacteria 861
121 Ga0070708_100056503 3300005445 Bacteria 3492
122 Ga0070708_100093871 3300005445 Bacteria 2737
123 Ga0070663_100000352 3300005455 Bacteria 24139
124 Ga0070663_100001782 3300005455 Bacteria 11977
125 Ga0070663_100071693 3300005455 Bacteria 2522
126 Ga0070663_100192549 3300005455 Bacteria 1587
127 Ga0070663_100350786 3300005455 Bacteria 1195
128 Ga0070678_100001137 3300005456 Bacteria 14044
129 Ga0070662_100000412 3300005457 Bacteria 25384
130 Ga0070662_100550682 3300005457 Bacteria 967
131 Ga0070662_100836164 3300005457 Bacteria 784
132 Ga0070662_101037584 3300005457 Bacteria 703
133 Ga0070681_10005865 3300005458 Bacteria 11891
134 Ga0070681_10023484 3300005458 Bacteria 6202
135 Ga0070681_10042377 3300005458 Bacteria 4561
136 Ga0070681_10164070 3300005458 Bacteria 2145
137 Ga0070681_10185822 3300005458 Bacteria 1999
138 Ga0070681_10250538 3300005458 Bacteria 1684
139 Ga0068867_100070990 3300005459 Bacteria 2604
140 Ga0070685_10005479 3300005466 Bacteria 6429
141 Ga0070685_10679033 3300005466 Bacteria 749
142 Ga0070706_100334391 3300005467 Bacteria 1412
143 Ga0070706_100991629 3300005467 Bacteria 775
144 Ga0070706_102146987 3300005467 Bacteria 505
145 Ga0070707_100045980 3300005468 Bacteria 4177
146 Ga0070707_100689963 3300005468 Bacteria 984
147 Ga0070707_100858955 3300005468 Bacteria 872
148 Ga0070698_100105371 3300005471 Bacteria 2790
149 Ga0070698_100271798 3300005471 Bacteria 1626
150 Ga0070698_101452714 3300005471 Bacteria 637
151 Ga0070699_100002571 3300005518 Bacteria 16279
152 Ga0070699_100613012 3300005518 Bacteria 993
153 Ga0070679_100014791 3300005530 Bacteria 7498
154 Ga0070679_100068971 3300005530 Bacteria 3527
155 Ga0070679_100728392 3300005530 Bacteria 934
156 Ga0070684_100225818 3300005535 Bacteria 1709
157 Ga0070697_100000391 3300005536 Bacteria 34002
158 Ga0070697_100066290 3300005536 Bacteria 2952
159 Ga0070697_100330332 3300005536 Bacteria 1314
160 Ga0068853_100001595 3300005539 Bacteria 16513
161 Ga0068853_100095708 3300005539 Bacteria 2619
162 Ga0068853_101329379 3300005539 Bacteria 695
163 Ga0070672_100008680 3300005543 Bacteria 6968
164 Ga0070686_100000853 3300005544 Bacteria 17703
165 Ga0070686_100000940 3300005544 Bacteria 16774
166 Ga0070695_100000238 3300005545 Bacteria 27265
167 Ga0070695_100013344 3300005545 Bacteria 4935
168 Ga0070695_100028804 3300005545 Bacteria 3448
169 Ga0070695_100069546 3300005545 Bacteria 2301
170 Ga0070695_100180109 3300005545 Bacteria 1497
171 Ga0070695_100226022 3300005545 Bacteria 1351
172 Ga0070695_100328434 3300005545 Bacteria 1139
173 Ga0070695_100559307 3300005545 Bacteria 893
174 Ga0070696_100000815 3300005546 Bacteria 20059
175 Ga0070696_100006241 3300005546 Bacteria 7976
176 Ga0070696_100200406 3300005546 Bacteria 1490
177 Ga0070696_100290248 3300005546 Bacteria 1249
178 Ga0070693_100089116 3300005547 Bacteria 1856
179 Ga0070693_100231277 3300005547 Bacteria 1216
180 Ga0070665_100052313 3300005548 Bacteria 4097
181 Ga0070665_101071652 3300005548 Bacteria 818
182 Ga0070704_100000124 3300005549 Bacteria 27978
183 Ga0070704_100006261 3300005549 Bacteria 7001
184 Ga0070704_100280374 3300005549 Bacteria 1380
185 Ga0068855_100002691 3300005563 Bacteria 21916
186 Ga0068855_100069700 3300005563 Bacteria 4092
187 Ga0070664_100186343 3300005564 Bacteria 1847
188 Ga0068857_100034156 3300005577 Bacteria 4500
189 Ga0068857_100310077 3300005577 Bacteria 1456
190 Ga0068857_100332947 3300005577 Bacteria 1403
191 Ga0068854_100022328 3300005578 Bacteria 4308
192 Ga0068854_100095464 3300005578 Bacteria 2220
193 Ga0068854_100325520 3300005578 Bacteria 1251
194 Ga0068854_100453359 3300005578 Bacteria 1072
195 Ga0068854_100458028 3300005578 Bacteria 1067
196 Ga0068856_100002821 3300005614 Bacteria 17787
197 Ga0068856_100743676 3300005614 Bacteria 1001
198 Ga0070702_100000018 3300005615 Bacteria 47204
199 Ga0070702_100020165 3300005615 Bacteria 3488
200 Ga0070702_100095027 3300005615 Bacteria 1816
201 Ga0070702_100450512 3300005615 Bacteria 933
202 Ga0068852_100067019 3300005616 Bacteria 3138
203 Ga0068852_100544065 3300005616 Bacteria 1161
204 Ga0068852_101766950 3300005616 Bacteria 641
205 Ga0068859_100006726 3300005617 Bacteria 11681
206 Ga0068859_100019657 3300005617 Bacteria 6783
207 Ga0068859_100073753 3300005617 Bacteria 3451
208 Ga0068859_100224454 3300005617 Bacteria 1967
209 Ga0068859_100591668 3300005617 Bacteria 1203
210 Ga0068859_101558607 3300005617 Bacteria 729
211 Ga0068859_101828721 3300005617 Bacteria 671
212 Ga0068864_100002243 3300005618 Bacteria 15978
213 Ga0068864_100144705 3300005618 Bacteria 2148
214 Ga0068864_100347956 3300005618 Bacteria 1398
215 Ga0068864_101084319 3300005618 Bacteria 797
216 Ga0068866_10016535 3300005718 Bacteria 3299
217 Ga0068866_10162137 3300005718 Bacteria 1305
218 Ga0068866_10371120 3300005718 Bacteria 915
219 Ga0068866_10547415 3300005718 Bacteria 773
220 Ga0068861_100021853 3300005719 Bacteria 4602
221 Ga0068861_100052445 3300005719 Bacteria 3100
222 Ga0068861_100059827 3300005719 Bacteria 2918
223 Ga0068861_100121537 3300005719 Bacteria 2107
224 Ga0068861_100128342 3300005719 Bacteria 2055
225 Ga0068861_100199791 3300005719 Bacteria 1677
226 Ga0068851_10290140 3300005834 Bacteria 938
227 Ga0068870_10142969 3300005840 Bacteria 1402
228 Ga0068870_10379296 3300005840 Bacteria 915
229 Ga0068863_100035631 3300005841 Bacteria 4738
230 Ga0068863_101263919 3300005841 Bacteria 745
231 Ga0068863_101553316 3300005841 Bacteria 671
232 Ga0068858_100014450 3300005842 Bacteria 7439
233 Ga0068858_100059439 3300005842 Bacteria 3533
234 Ga0068858_100102790 3300005842 Bacteria 2666
235 Ga0068858_100231289 3300005842 Bacteria 1753
236 Ga0068858_100818811 3300005842 Bacteria 909
237 Ga0068858_101058738 3300005842 Bacteria 796
238 Ga0068860_100000598 3300005843 Bacteria 43069
239 Ga0068860_100730924 3300005843 Bacteria 1001
240 Ga0068860_100735572 3300005843 Bacteria 997
241 Ga0068860_100747308 3300005843 Bacteria 990
242 Ga0068860_100768968 3300005843 Bacteria 976
243 Ga0068860_101148659 3300005843 Bacteria 796
244 Ga0068862_100002462 3300005844 Bacteria 16405
245 Ga0068862_100008039 3300005844 Bacteria 8730
246 Ga0068862_100021045 3300005844 Bacteria 5450
247 Ga0068862_100355084 3300005844 Bacteria 1361
248 Ga0068862_100516980 3300005844 Bacteria 1135
249 Ga0068862_101384035 3300005844 Bacteria 706
250 Ga0081455_10004292 3300005937 Bacteria 16046
251 Ga0081455_10007585 3300005937 Bacteria 11406
252 Ga0081455_10308714 3300005937 Bacteria 1131
253 Ga0081540_1001954 3300005983 Bacteria 17230
254 Ga0081540_1039855 3300005983 Bacteria 2457
255 Ga0081539_10046146 3300005985 Bacteria 2499
256 Ga0081539_10050726 3300005985 Bacteria 2345
257 Ga0070717_10330910 3300006028 Bacteria 1359
258 Ga0075365_10003505 3300006038 Bacteria 8109
259 Ga0075365_10078853 3300006038 Bacteria 2228
260 Ga0075368_10007190 3300006042 Bacteria 3923
261 Ga0075368_10088331 3300006042 Bacteria 1266
262 Ga0075368_10164231 3300006042 Bacteria 931
263 Ga0075363_100004707 3300006048 Bacteria 6005
264 Ga0075363_100133533 3300006048 Bacteria 1393
265 Ga0075363_100254370 3300006048 Bacteria 1012
266 Ga0075363_100279414 3300006048 Bacteria 966
267 Ga0075364_10589678 3300006051 Bacteria 759
268 Ga0075432_10009193 3300006058 Bacteria 3366
269 Ga0075432_10024708 3300006058 Bacteria 2060
270 Ga0070715_10009598 3300006163 Bacteria 3417
271 Ga0070716_100004896 3300006173 Bacteria 6440
272 Ga0070716_100205373 3300006173 Bacteria 1313
273 Ga0070716_100274689 3300006173 Bacteria 1160
274 Ga0070716_100510710 3300006173 Bacteria 888
275 Ga0070716_100739079 3300006173 Bacteria 756
276 Ga0070712_100002909 3300006175 Bacteria 10615
277 Ga0070712_100034164 3300006175 Bacteria 3445
278 Ga0070712_100236495 3300006175 Bacteria 1453
279 Ga0070712_100800337 3300006175 Bacteria 809
280 Ga0075362_10184200 3300006177 Bacteria 1012
281 Ga0075367_10113166 3300006178 Bacteria 1667
282 Ga0075367_10254589 3300006178 Bacteria 1101
283 Ga0075366_10107355 3300006195 Bacteria 1679
284 Ga0075366_10200191 3300006195 Bacteria 1215
285 Ga0097621_100087331 3300006237 Bacteria 2604
286 Ga0097621_100216659 3300006237 Bacteria 1667
287 Ga0097621_100330010 3300006237 Bacteria 1353
288 Ga0097621_101619135 3300006237 Bacteria 616
289 Ga0068871_100389102 3300006358 Bacteria 1240
290 Ga0068871_100847370 3300006358 Bacteria 845
291 Ga0075428_100025828 3300006844 Bacteria 6504
292 Ga0075428_100044339 3300006844 Bacteria 4887
293 Ga0075428_100116926 3300006844 Bacteria 2904
294 Ga0075428_100184052 3300006844 Bacteria 2260
295 Ga0075428_100211533 3300006844 Bacteria 2095
296 Ga0075428_100301142 3300006844 Bacteria 1724
297 Ga0075428_100963850 3300006844 Bacteria 904
298 Ga0075430_100029402 3300006846 Bacteria 4664
299 Ga0075430_100161869 3300006846 Bacteria 1863
300 Ga0075430_100305244 3300006846 Bacteria 1316
301 Ga0075430_100449279 3300006846 Bacteria 1064
302 Ga0075430_101247234 3300006846 Bacteria 612
303 Ga0075431_100002019 3300006847 Bacteria 19380
304 Ga0075431_100014350 3300006847 Bacteria 8013
305 Ga0075431_100048216 3300006847 Bacteria 4393
306 Ga0075431_100085221 3300006847 Bacteria 3261
307 Ga0075433_10002400 3300006852 Bacteria 14254
308 Ga0075433_10006677 3300006852 Bacteria 9138
309 Ga0075433_10126528 3300006852 Bacteria 2269
310 Ga0075433_10180830 3300006852 Bacteria 1876
311 Ga0075433_10303775 3300006852 Bacteria 1413
312 Ga0075434_100033297 3300006871 Bacteria 5085
313 Ga0075434_100055563 3300006871 Bacteria 3934
314 Ga0075434_100061871 3300006871 Bacteria 3725
315 Ga0075434_100454741 3300006871 Bacteria 1302
316 Ga0075434_100541745 3300006871 Bacteria 1184
317 Ga0075434_100961198 3300006871 Bacteria 868
318 Ga0075429_100018835 3300006880 Bacteria 5980
319 Ga0075429_100796467 3300006880 Bacteria 828
320 Ga0068865_100004683 3300006881 Bacteria 8261
321 Ga0068865_100271014 3300006881 Bacteria 1348
322 Ga0075436_100001383 3300006914 Bacteria 16514
323 Ga0097620_100006726 3300006931 Bacteria 11681
324 Ga0097620_100019656 3300006931 Bacteria 6783
325 Ga0097620_100073751 3300006931 Bacteria 3451
326 Ga0097620_100224447 3300006931 Bacteria 1967
327 Ga0097620_100591697 3300006931 Bacteria 1203
328 Ga0097620_101558773 3300006931 Bacteria 729
329 Ga0097620_101828964 3300006931 Bacteria 671
330 Ga0075435_100043632 3300007076 Bacteria 3590
331 Ga0075435_100723045 3300007076 Bacteria 866
332 Ga0105251_10264466 3300009011 Bacteria 776
333 Ga0105244_10397305 3300009036 Bacteria 634
334 Ga0105250_10018370 3300009092 Bacteria 2832
335 Ga0105240_10670007 3300009093 Bacteria 1135
336 Ga0111539_10006608 3300009094 Bacteria 14940
337 Ga0111539_10023934 3300009094 Bacteria 7503
338 Ga0111539_10028568 3300009094 Bacteria 6802
339 Ga0111539_10080826 3300009094 Bacteria 3823
340 Ga0111539_10135824 3300009094 Bacteria 2880
341 Ga0111539_10188116 3300009094 Bacteria 2410
342 Ga0111539_11143466 3300009094 Bacteria 905
343 Ga0111539_11268994 3300009094 Bacteria 855
344 Ga0105245_10000718 3300009098 Bacteria 29853
345 Ga0105245_10766781 3300009098 Bacteria 1001
346 Ga0105245_11641566 3300009098 Bacteria 695
347 Ga0105247_10028576 3300009101 Bacteria 3375
348 Ga0105247_10542179 3300009101 Bacteria 854
349 Ga0105247_10598600 3300009101 Bacteria 817
350 Ga0105247_10968515 3300009101 Bacteria 662
351 Ga0114129_10067547 3300009147 Bacteria 4986
352 Ga0114129_10114822 3300009147 Bacteria 3713
353 Ga0114129_10159816 3300009147 Bacteria 3079
354 Ga0114129_10334793 3300009147 Bacteria 2009
355 Ga0114129_10467716 3300009147 Bacteria 1652
356 Ga0114129_10800767 3300009147 Bacteria 1202
357 Ga0114129_10980056 3300009147 Bacteria 1066
358 Ga0114129_11692413 3300009147 Bacteria 772
359 Ga0114129_13325443 3300009147 Bacteria 519
360 Ga0105243_10007855 3300009148 Bacteria 8198
361 Ga0105243_10016692 3300009148 Bacteria 5551
362 Ga0105243_10096050 3300009148 Bacteria 2451
363 Ga0105243_10164045 3300009148 Bacteria 1918
364 Ga0105243_10346945 3300009148 Bacteria 1362
365 Ga0105243_11690859 3300009148 Bacteria 662
366 Ga0105241_10001150 3300009174 Bacteria 20135
367 Ga0105241_10016819 3300009174 Bacteria 5369
368 Ga0105241_10750543 3300009174 Bacteria 895
369 Ga0105242_10003790 3300009176 Bacteria 11752
370 Ga0105242_10612942 3300009176 Bacteria 1053
371 Ga0105242_10844179 3300009176 Bacteria 911
372 Ga0105248_10017659 3300009177 Bacteria 7869
373 Ga0105248_10090078 3300009177 Bacteria 3454
374 Ga0105248_10249035 3300009177 Bacteria 2000
375 Ga0105237_10001618 3300009545 Bacteria 29243
376 Ga0105237_10025489 3300009545 Bacteria 6047
377 Ga0105237_10164275 3300009545 Bacteria 2219
378 Ga0105237_10906856 3300009545 Bacteria 888
379 Ga0105238_10038405 3300009551 Bacteria 4863
380 Ga0105238_10278955 3300009551 Bacteria 1652
381 Ga0105238_11897910 3300009551 Bacteria 629
382 Ga0105249_10000814 3300009553 Bacteria 28107
383 Ga0105249_10060094 3300009553 Bacteria 3487
384 Ga0105249_10726781 3300009553 Bacteria 1054
385 Ga0105249_10749652 3300009553 Bacteria 1038
386 Ga0105249_11004495 3300009553 Bacteria 903
387 Ga0105249_11539348 3300009553 Bacteria 737
388 Ga0105239_10022201 3300010375 Bacteria 6995
389 Ga0105239_10135147 3300010375 Bacteria 2745
390 Ga0105239_10248297 3300010375 Bacteria 1999
391 Ga0105239_10367586 3300010375 Bacteria 1625
392 Ga0105239_12863633 3300010375 Bacteria 563
393 Ga0105239_13198934 3300010375 Bacteria 533
394 Ga0105246_10008999 3300011119 Bacteria 6148
395 Ga0105246_10050163 3300011119 Bacteria 2861
396 Ga0105246_10058936 3300011119 Bacteria 2662
397 Ga0105246_10195815 3300011119 Bacteria 1567
398 Ga0105246_10628531 3300011119 Bacteria 932
399 Ga0157321_1002735 3300012487 Bacteria 1005
400 Ga0157335_1010858 3300012492 Bacteria 738
401 Ga0157342_1016568 3300012507 Bacteria 817
402 Ga0157373_10013558 3300013100 Bacteria 5980
403 Ga0157373_10057191 3300013100 Bacteria 2767
404 Ga0157371_10010822 3300013102 Bacteria 7081
405 Ga0157371_10178968 3300013102 Bacteria 1516
406 Ga0157370_10018923 3300013104 Bacteria 6925
407 Ga0157370_10022083 3300013104 Bacteria 6337
408 Ga0157370_10109337 3300013104 Bacteria 2584
409 Ga0157369_10012851 3300013105 Bacteria 9490
410 Ga0157369_10237379 3300013105 Bacteria 1905
411 Ga0157369_10382635 3300013105 Bacteria 1460
412 Ga0157374_10012339 3300013296 Bacteria 7433
413 Ga0157374_10287176 3300013296 Unclassified 1625
414 Ga0157378_10006735 3300013297 Bacteria 10037
415 Ga0157378_10073149 3300013297 Bacteria 3081
416 Ga0157378_10220717 3300013297 Bacteria 1802
417 Ga0157378_10447402 3300013297 Bacteria 1281
418 Ga0157378_10870715 3300013297 Bacteria 930
419 Ga0163162_10004532 3300013306 Bacteria 13382
420 Ga0163162_10213855 3300013306 Bacteria 2058
421 Ga0163162_10594627 3300013306 Bacteria 1233
422 Ga0163162_11855357 3300013306 Bacteria 690
423 Ga0163162_12134791 3300013306 Bacteria 643
424 Ga0157372_10019801 3300013307 Bacteria 7251
425 Ga0157372_10064568 3300013307 Bacteria 4107
426 Ga0157372_10367294 3300013307 Bacteria 1677
427 Ga0157372_10888664 3300013307 Bacteria 1034
428 Ga0157375_10043922 3300013308 Bacteria 4337
429 Ga0157375_10196112 3300013308 Bacteria 2174
430 Ga0157375_10396202 3300013308 Bacteria 1547
431 Ga0157375_11372090 3300013308 Bacteria 832
432 Ga0163163_10026373 3300014325 Bacteria 5553
433 Ga0163163_10143990 3300014325 Bacteria 2426
434 Ga0157380_10003574 3300014326 Bacteria 10693
435 Ga0157380_10118277 3300014326 Bacteria 2240
436 Ga0157380_10659844 3300014326 Bacteria 1045
437 Ga0157380_11283587 3300014326 Bacteria 779
438 Ga0157380_11873382 3300014326 Bacteria 660
439 Ga0157377_10254445 3300014745 Bacteria 1140
440 Ga0157377_10488350 3300014745 Bacteria 858
441 Ga0157377_10667616 3300014745 Bacteria 750
442 Ga0157377_11316939 3300014745 Bacteria 565
443 Ga0157377_11477652 3300014745 Bacteria 539
444 Ga0157379_10015080 3300014968 Bacteria 6778
445 Ga0157379_10016719 3300014968 Bacteria 6455
446 Ga0157379_10152930 3300014968 Bacteria 2081
447 Ga0157379_10472628 3300014968 Bacteria 1159
448 Ga0157379_10694896 3300014968 Bacteria 954
449 Ga0157379_10892907 3300014968 Bacteria 843
450 Ga0157376_10000606 3300014969 Bacteria 23175
451 Ga0157376_10470382 3300014969 Bacteria 1230
452 Ga0157376_10783890 3300014969 Bacteria 965
453 Ga0163161_10002394 3300017792 Bacteria 13438
454 Ga0163161_10009458 3300017792 Bacteria 6747
455 Ga0163161_10116346 3300017792 Bacteria 2004
456 Ga0163161_10759798 3300017792 Bacteria 812
457 Ga0197907_11483265 3300020069 Bacteria 542
458 Ga0213872_10132952 3300021361 Bacteria 1095
459 Ga0213876_10022060 3300021384 Bacteria 3368
460 Ga0213876_10423739 3300021384 Bacteria 708
461 Ga0213871_10030922 3300021441 Bacteria 1395
462 Ga0224572_1093388 3300024225 Bacteria 555
463 Ga0209676_1008643 3300025292 Bacteria 4509
464 Ga0209758_1016521 3300025297 Bacteria 3743
465 Ga0209758_1054523 3300025297 Bacteria 1365
466 Ga0209050_1014417 3300025298 Bacteria 3406
467 Ga0209256_1029617 3300025299 Bacteria 1523
468 Ga0209051_1011025 3300025303 Bacteria 4506
469 Ga0209257_1007191 3300025304 Bacteria 6832
470 Ga0207656_10227735 3300025321 Bacteria 908
471 Ga0207653_10001732 3300025885 Bacteria 6967
472 Ga0207653_10008442 3300025885 Bacteria 3208
473 Ga0207692_10002601 3300025898 Bacteria 6941
474 Ga0207642_10179543 3300025899 Bacteria 1152
475 Ga0207642_10188324 3300025899 Bacteria 1130
476 Ga0207642_10280697 3300025899 Bacteria 958
477 Ga0207710_10033641 3300025900 Bacteria 2249
478 Ga0207710_10247588 3300025900 Bacteria 890
479 Ga0207688_10000685 3300025901 Bacteria 16721
480 Ga0207680_10004197 3300025903 Bacteria 6819
481 Ga0207647_10001956 3300025904 Bacteria 15734
482 Ga0207647_10026538 3300025904 Bacteria 3789
483 Ga0207647_10126221 3300025904 Bacteria 1506
484 Ga0207685_10039371 3300025905 Bacteria 1754
485 Ga0207699_10000692 3300025906 Bacteria 16128
486 Ga0207699_10334343 3300025906 Bacteria 1066
487 Ga0207699_10645384 3300025906 Bacteria 773
488 Ga0207645_10012210 3300025907 Bacteria 5833
489 Ga0207645_10254541 3300025907 Bacteria 1162
490 Ga0207645_10296051 3300025907 Bacteria 1077
491 Ga0207645_10370527 3300025907 Bacteria 960
492 Ga0207643_10190093 3300025908 Bacteria 1246
493 Ga0207643_10612253 3300025908 Bacteria 701
494 Ga0207705_10102282 3300025909 Bacteria 2109
495 Ga0207684_10423995 3300025910 Bacteria 1143
496 Ga0207684_10668588 3300025910 Bacteria 884
497 Ga0207654_10008946 3300025911 Bacteria 5078
498 Ga0207654_10019158 3300025911 Bacteria 3606
499 Ga0207654_10545463 3300025911 Bacteria 823
500 Ga0207654_11098240 3300025911 Bacteria 579
501 Ga0207707_10004025 3300025912 Bacteria 13037
502 Ga0207707_10126099 3300025912 Bacteria 2239
503 Ga0207707_10148837 3300025912 Bacteria 2047
504 Ga0207707_10203186 3300025912 Bacteria 1727
505 Ga0207707_10303093 3300025912 Bacteria 1381
506 Ga0207695_10473876 3300025913 Bacteria 1134
507 Ga0207695_10525623 3300025913 Bacteria 1065
508 Ga0207671_10081612 3300025914 Bacteria 2425
509 Ga0207671_10083800 3300025914 Bacteria 2394
510 Ga0207671_10239751 3300025914 Bacteria 1424
511 Ga0207671_10459644 3300025914 Bacteria 1014
512 Ga0207693_10002667 3300025915 Bacteria 15496
513 Ga0207693_10050769 3300025915 Bacteria 3256
514 Ga0207693_10343264 3300025915 Bacteria 1169
515 Ga0207693_10438020 3300025915 Bacteria 1022
516 Ga0207663_10001067 3300025916 Bacteria 12565
517 Ga0207663_10547133 3300025916 Bacteria 904
518 Ga0207660_10018343 3300025917 Bacteria 4662
519 Ga0207660_10036326 3300025917 Bacteria 3425
520 Ga0207660_10063001 3300025917 Bacteria 2672
521 Ga0207660_10343883 3300025917 Bacteria 1195
522 Ga0207662_10002067 3300025918 Bacteria 9951
523 Ga0207662_10455378 3300025918 Bacteria 875
524 Ga0207662_10570154 3300025918 Bacteria 785
525 Ga0207657_10000282 3300025919 Bacteria 54101
526 Ga0207657_10032470 3300025919 Bacteria 4716
527 Ga0207657_10569233 3300025919 Bacteria 885
528 Ga0207657_10847256 3300025919 Bacteria 705
529 Ga0207649_10028091 3300025920 Bacteria 3309
530 Ga0207649_10216538 3300025920 Bacteria 1362
531 Ga0207649_10887824 3300025920 Bacteria 698
532 Ga0207652_10049921 3300025921 Bacteria 3583
533 Ga0207652_10066636 3300025921 Bacteria 3121
534 Ga0207652_10292555 3300025921 Bacteria 1469
535 Ga0207652_11164199 3300025921 Bacteria 672
536 Ga0207646_10246047 3300025922 Bacteria 1615
537 Ga0207646_10737384 3300025922 Bacteria 880
538 Ga0207681_10084571 3300025923 Bacteria 2249
539 Ga0207681_10453056 3300025923 Bacteria 1044
540 Ga0207694_10036374 3300025924 Bacteria 3779
541 Ga0207694_10605319 3300025924 Bacteria 922
542 Ga0207694_10866786 3300025924 Bacteria 763
543 Ga0207650_10012981 3300025925 Bacteria 5760
544 Ga0207659_10116815 3300025926 Bacteria 2038
545 Ga0207659_10746692 3300025926 Bacteria 839
546 Ga0207687_10003322 3300025927 Bacteria 10868
547 Ga0207687_10205948 3300025927 Bacteria 1540
548 Ga0207687_10695739 3300025927 Bacteria 862
549 Ga0207700_10001020 3300025928 Bacteria 16161
550 Ga0207700_10022703 3300025928 Bacteria 4309
551 Ga0207700_10775292 3300025928 Bacteria 857
552 Ga0207700_11051592 3300025928 Bacteria 728
553 Ga0207700_11198204 3300025928 Bacteria 678
554 Ga0207644_10171793 3300025931 Bacteria 1693
555 Ga0207644_10176747 3300025931 Bacteria 1670
556 Ga0207690_10073607 3300025932 Bacteria 2363
557 Ga0207690_10180182 3300025932 Bacteria 1590
558 Ga0207690_10271737 3300025932 Bacteria 1317
559 Ga0207690_10316459 3300025932 Bacteria 1226
560 Ga0207690_10628381 3300025932 Bacteria 878
561 Ga0207690_10874361 3300025932 Bacteria 745
562 Ga0207706_10000270 3300025933 Bacteria 56584
563 Ga0207706_10058445 3300025933 Bacteria 3396
564 Ga0207706_10107100 3300025933 Bacteria 2460
565 Ga0207706_10631627 3300025933 Bacteria 918
566 Ga0207706_10663538 3300025933 Bacteria 892
567 Ga0207706_10857337 3300025933 Bacteria 769
568 Ga0207686_10302879 3300025934 Bacteria 1188
569 Ga0207709_10006830 3300025935 Bacteria 6384
570 Ga0207709_10109558 3300025935 Bacteria 1844
571 Ga0207709_10131695 3300025935 Bacteria 1705
572 Ga0207709_10523121 3300025935 Bacteria 929
573 Ga0207709_11133556 3300025935 Bacteria 643
574 Ga0207670_10000642 3300025936 Bacteria 18604
575 Ga0207670_10029223 3300025936 Bacteria 3509
576 Ga0207670_10673025 3300025936 Bacteria 855
577 Ga0207670_10721099 3300025936 Bacteria 827
578 Ga0207670_10730585 3300025936 Bacteria 821
579 Ga0207670_11415890 3300025936 Bacteria 590
580 Ga0207669_10084859 3300025937 Bacteria 2042
581 Ga0207669_10153276 3300025937 Bacteria 1617
582 Ga0207669_10632456 3300025937 Bacteria 873
583 Ga0207704_10059428 3300025938 Bacteria 2360
584 Ga0207704_11243992 3300025938 Bacteria 635
585 Ga0207665_10000898 3300025939 Bacteria 20034
586 Ga0207665_10163210 3300025939 Bacteria 1604
587 Ga0207665_10242056 3300025939 Bacteria 1329
588 Ga0207691_10057833 3300025940 Bacteria 3528
589 Ga0207691_11023799 3300025940 Bacteria 689
590 Ga0207711_10003368 3300025941 Bacteria 13851
591 Ga0207711_11126324 3300025941 Bacteria 726
592 Ga0207689_10076718 3300025942 Bacteria 2747
593 Ga0207689_10212476 3300025942 Bacteria 1598
594 Ga0207689_10360679 3300025942 Bacteria 1208
595 Ga0207689_10490702 3300025942 Bacteria 1029
596 Ga0207661_10080767 3300025944 Bacteria 2684
597 Ga0207679_10001363 3300025945 Bacteria 15383
598 Ga0207679_10098094 3300025945 Bacteria 2284
599 Ga0207679_11191740 3300025945 Bacteria 699
600 Ga0207667_10035591 3300025949 Bacteria 5341
601 Ga0207667_10078715 3300025949 Bacteria 3416
602 Ga0207667_10221936 3300025949 Bacteria 1936
603 Ga0207667_10586223 3300025949 Bacteria 1125
604 Ga0207667_11412906 3300025949 Bacteria 669
605 Ga0207667_11436670 3300025949 Bacteria 662
606 Ga0207651_10223211 3300025960 Bacteria 1524
607 Ga0207651_10770582 3300025960 Bacteria 851
608 Ga0207712_10001373 3300025961 Bacteria 16667
609 Ga0207712_10013838 3300025961 Bacteria 5174
610 Ga0207712_11409388 3300025961 Bacteria 624
611 Ga0207668_10006213 3300025972 Bacteria 7052
612 Ga0207668_10095533 3300025972 Bacteria 2194
613 Ga0207668_10126956 3300025972 Bacteria 1941
614 Ga0207668_10718232 3300025972 Bacteria 879
615 Ga0207668_11212400 3300025972 Bacteria 678
616 Ga0207668_11431729 3300025972 Bacteria 623
617 Ga0207668_11545160 3300025972 Bacteria 599
618 Ga0207640_10078850 3300025981 Bacteria 2243
619 Ga0207640_10093395 3300025981 Bacteria 2090
620 Ga0207640_10324387 3300025981 Bacteria 1227
621 Ga0207640_10417543 3300025981 Bacteria 1097
622 Ga0207658_10029474 3300025986 Bacteria 3876
623 Ga0207658_10234178 3300025986 Bacteria 1552
624 Ga0207658_10268558 3300025986 Bacteria 1457
625 Ga0207658_10399861 3300025986 Bacteria 1207
626 Ga0207658_11214489 3300025986 Bacteria 689
627 Ga0207677_10013013 3300026023 Bacteria 4808
628 Ga0207677_10705069 3300026023 Bacteria 896
629 Ga0207703_10004600 3300026035 Bacteria 11288
630 Ga0207703_10073903 3300026035 Bacteria 2821
631 Ga0207703_10107868 3300026035 Bacteria 2371
632 Ga0207703_10185199 3300026035 Bacteria 1840
633 Ga0207703_10598623 3300026035 Bacteria 1043
634 Ga0207639_10037169 3300026041 Bacteria 3615
635 Ga0207639_10039336 3300026041 Bacteria 3523
636 Ga0207639_10866690 3300026041 Bacteria 843
637 Ga0207639_11005581 3300026041 Bacteria 781
638 Ga0207678_10000118 3300026067 Bacteria 65608
639 Ga0207678_10001987 3300026067 Bacteria 18624
640 Ga0207678_10061912 3300026067 Bacteria 3218
641 Ga0207678_10110263 3300026067 Bacteria 2348
642 Ga0207678_10165656 3300026067 Bacteria 1887
643 Ga0207678_10421822 3300026067 Bacteria 1157
644 Ga0207678_10900854 3300026067 Bacteria 782
645 Ga0207708_10013264 3300026075 Bacteria 6154
646 Ga0207708_10025042 3300026075 Bacteria 4514
647 Ga0207708_10158056 3300026075 Bacteria 1788
648 Ga0207708_10232694 3300026075 Bacteria 1480
649 Ga0207708_10241021 3300026075 Bacteria 1454
650 Ga0207708_10448455 3300026075 Bacteria 1074
651 Ga0207708_10559405 3300026075 Bacteria 965
652 Ga0207708_10662461 3300026075 Bacteria 889
653 Ga0207702_10041809 3300026078 Bacteria 3843
654 Ga0207702_10327512 3300026078 Bacteria 1460
655 Ga0207641_10396814 3300026088 Bacteria 1324
656 Ga0207641_10574227 3300026088 Bacteria 1102
657 Ga0207641_11146540 3300026088 Bacteria 776
658 Ga0207641_11671657 3300026088 Bacteria 639
659 Ga0207648_10012357 3300026089 Bacteria 7993
660 Ga0207648_10246208 3300026089 Bacteria 1593
661 Ga0207648_10465295 3300026089 Bacteria 1153
662 Ga0207648_10504985 3300026089 Bacteria 1107
663 Ga0207648_10870603 3300026089 Bacteria 841
664 Ga0207676_10028970 3300026095 Bacteria 4141
665 Ga0207676_10132645 3300026095 Bacteria 2120
666 Ga0207676_10415696 3300026095 Bacteria 1260
667 Ga0207674_10022215 3300026116 Bacteria 6819
668 Ga0207674_10047521 3300026116 Bacteria 4398
669 Ga0207674_10404751 3300026116 Bacteria 1319
670 Ga0207675_100001292 3300026118 Bacteria 25099
671 Ga0207675_100062290 3300026118 Bacteria 3483
672 Ga0207675_100203980 3300026118 Bacteria 1900
673 Ga0207675_100331062 3300026118 Bacteria 1489
674 Ga0207675_100572559 3300026118 Bacteria 1130
675 Ga0207683_10001738 3300026121 Bacteria 19398
676 Ga0207683_10062468 3300026121 Bacteria 3280
677 Ga0207698_10016384 3300026142 Bacteria 4992
678 Ga0207698_10105982 3300026142 Bacteria 2343
679 Ga0209983_1050263 3300027665 Bacteria 912
680 Ga0209998_10024125 3300027717 Bacteria 1318
681 Ga0209998_10090624 3300027717 Bacteria 749
682 Ga0209813_10007002 3300027866 Bacteria 2799
683 Ga0209813_10015540 3300027866 Bacteria 2065
684 Ga0209813_10015864 3300027866 Bacteria 2048
685 Ga0209974_10159032 3300027876 Bacteria 819
686 Ga0207428_10063093 3300027907 Bacteria 2928
687 Ga0207428_10091218 3300027907 Bacteria 2365
688 Ga0207428_10126762 3300027907 Bacteria 1955
689 Ga0207428_10142958 3300027907 Bacteria 1825
690 Ga0207428_10397050 3300027907 Bacteria 1010
691 Ga0207428_10455529 3300027907 Bacteria 932
692 Ga0268266_10030323 3300028379 Bacteria 4595
693 Ga0268266_10317764 3300028379 Bacteria 1457
694 Ga0268266_10466616 3300028379 Bacteria 1202
695 Ga0268266_10777071 3300028379 Bacteria 925
696 Ga0268266_11289615 3300028379 Bacteria 706
697 Ga0268265_10002634 3300028380 Bacteria 13325
698 Ga0268265_10259078 3300028380 Bacteria 1545
699 Ga0268265_10788200 3300028380 Bacteria 925
700 Ga0268264_10062737 3300028381 Bacteria 3122
701 Ga0268264_10546665 3300028381 Bacteria 1135
702 Ga0268264_10555818 3300028381 Bacteria 1126
703 Ga0265760_10094842 3300031090 Bacteria 938
704 Ga0265330_10049935 3300031235 Bacteria 1835
705 Ga0265330_10087553 3300031235 Bacteria 1338
706 Ga0265332_10089584 3300031238 Bacteria 1302
707 Ga0265332_10386488 3300031238 Bacteria 578
708 Ga0265328_10006537 3300031239 Bacteria 4918
709 Ga0265328_10098118 3300031239 Bacteria 1084
710 Ga0265325_10038876 3300031241 Bacteria 2508
711 Ga0265340_10256356 3300031247 Bacteria 779
712 Ga0265339_10004332 3300031249 Bacteria 9696
713 Ga0265331_10004690 3300031250 Bacteria 8465
714 Ga0265331_10033198 3300031250 Bacteria 2553
715 Ga0265331_10077686 3300031250 Bacteria 1546
716 Ga0265316_10028405 3300031344 Bacteria 4616
717 Ga0265316_10049860 3300031344 Bacteria 3296
718 Ga0307513_10051533 3300031456 Bacteria 4439
719 Ga0265313_10099214 3300031595 Bacteria 1295
720 Ga0316575_10041479 3300031665 Bacteria 1820
721 Ga0316579_10033148 3300031691 Bacteria 2370
722 Ga0265314_10011275 3300031711 Bacteria 7393
723 Ga0265314_10068619 3300031711 Bacteria 2383
724 Ga0265342_10560019 3300031712 Bacteria 579
725 Ga0316576_10024290 3300031727 Bacteria 4230
726 Ga0316576_10079460 3300031727 Bacteria 2431
727 Ga0316578_10109648 3300031728 Bacteria 1657
728 Ga0316578_10110133 3300031728 Bacteria 1653
729 Ga0307516_10044963 3300031730 Bacteria 4365
730 Ga0316577_10009470 3300031733 Bacteria 5240
731 Ga0307413_10754168 3300031824 Bacteria 814
732 Ga0307410_10621707 3300031852 Bacteria 903
733 Ga0307406_10036177 3300031901 Bacteria 3040
734 Ga0307407_10643051 3300031903 Bacteria 794
735 Ga0307412_10073835 3300031911 Bacteria 2335
736 Ga0307412_10188353 3300031911 Bacteria 1558
737 Ga0307412_11157684 3300031911 Bacteria 691
738 Ga0307415_100310957 3300032126 Bacteria 1309
739 Ga0307415_101727444 3300032126 Bacteria 604
740 Ga0316583_10006475 3300032133 Bacteria 4208
741 Ga0316585_10000354 3300032137 Bacteria 10487
742 Ga0316580_10004849 3300032139 Bacteria 3911
743 Ga0316593_10004600 3300032168 Bacteria 3557
744 Ga0316593_10137614 3300032168 Bacteria 884
745 Ga0316593_10334379 3300032168 Bacteria 578
746 Ga0316592_1000038 3300033524 Bacteria 10480
747 Ga0316586_1000750 3300033527 Bacteria 3328
748 Ga0316587_1026022 3300033529 Bacteria 1018
749 Ga0316596_1000071 3300033541 Bacteria 11803
750 Ga0316596_1000341 3300033541 Bacteria 7619
751 Ga0373958_0002782 3300034819 Bacteria 2482
752 Ga0373958_0007763 3300034819 Bacteria 1719
753 Ga0373958_0199378 3300034819 Bacteria 523
754 Ga0373959_0092431 3300034820 Bacteria 711
755 Ga0373959_0153067 3300034820 Bacteria 584
756 Ga0373928_0022650 3300035084 Bacteria 1334
757 Ga0373928_0121457 3300035084 Bacteria 700
758 Ga0373929_0039124 3300035085 Bacteria 1046
759 Ga0373934_0059436 3300035086 Bacteria 1522
760 Ga0373940_0094714 3300035088 Bacteria 899
761 Ga0373944_0016534 3300035089 Bacteria 2082
762 Ga0373944_0194227 3300035089 Bacteria 733
763 Ga0373949_0005456 3300035090 Bacteria 2835
764 Ga0373949_0007190 3300035090 Bacteria 2441
765 Ga0373951_0026168 3300035091 Bacteria 1358
766 Ga0373951_0026176 3300035091 Bacteria 1358
767 Ga0373951_0098987 3300035091 Bacteria 773
768 Ga0373951_0115755 3300035091 Bacteria 725
769 Ga0373923_0036411 3300035111 Bacteria 2009
770 Ga0373932_0021762 3300035112 Bacteria 1696
771 Ga0373932_0170764 3300035112 Bacteria 757
772 Ga0373932_0312795 3300035112 Bacteria 589
773 Ga0373939_0010771 3300035114 Bacteria 2295
774 Ga0373939_0140327 3300035114 Bacteria 871
775 Ga0373941_0016203 3300035115 Bacteria 2022
776 Ga0373953_0012782 3300035117 Bacteria 2981
777 Ga0373954_0047545 3300035118 Bacteria 2008
778 Ga0373954_0198084 3300035118 Bacteria 987
779 Ga0373956_0065806 3300035119 Bacteria 1647
780 Ga0373957_0056667 3300035120 Bacteria 1509
781 Ga0373957_0102117 3300035120 Bacteria 1149
782 Ga0373960_0043759 3300035121 Bacteria 1305
783 Ga0373960_0171541 3300035121 Bacteria 752
784 Ga0373960_0298427 3300035121 Bacteria 598
785 Ga0373943_0101641 3300035170 Bacteria 1504
786 Ga0373955_0085186 3300035172 Bacteria 1793
787 Ga0373942_0030108 3300035207 Bacteria 1428
788 Ga0373961_0056190 3300035241 Bacteria 1182
789 Ga0373961_0115072 3300035241 Bacteria 885
790 Ga0373962_0002684 3300035242 Bacteria 4233
791 Ga0373962_0153953 3300035242 Bacteria 754
792 Ga0316574_0199041 3300035398 Bacteria 1287
793 Ga0316574_0440126 3300035398 Bacteria 817
794 Ga0373924_0046598 3300035410 Bacteria 1787
795 Ga0373931_0000685 3300035691 Bacteria 14057
796 Ga0373931_0008300 3300035691 Bacteria 4920
797 Ga0373931_0011519 3300035691 Bacteria 4275
798 Ga0373931_0037963 3300035691 Bacteria 2517
799 Ga0373931_0109918 3300035691 Bacteria 1563
800 Ga0373935_0195031 3300035692 Bacteria 1397
801 Ga0373935_0244761 3300035692 Bacteria 1253
802 Ga0373935_0381976 3300035692 Bacteria 1009
803 Ga0373927_0002605 3300035695 Bacteria 13149
804 Ga0373927_0023112 3300035695 Bacteria 4072
805 Ga0373927_0028547 3300035695 Bacteria 3640
806 Ga0373933_0018678 3300035724 Bacteria 3902
807 Ga0373933_1098334 3300035724 Bacteria 524
808 Ga0373947_0008559 3300035725 Bacteria 5892
809 Ga0373947_0083872 3300035725 Bacteria 1977
810 Ga0373947_0376656 3300035725 Bacteria 955
811 Ga0373947_0826018 3300035725 Bacteria 633
812 Ga0373937_0137277 3300036401 Bacteria 2287
813 Ga0373937_0139978 3300036401 Bacteria 2263
814 Ga0373937_0692262 3300036401 Bacteria 966
815 Ga0373937_0876545 3300036401 Bacteria 846
816 Ga0310112_011278 3300036458 Bacteria 1276
817 Ga0316582_0193869 3300036647 Bacteria 1384
818 Ga0316584_0001985 3300036712 Bacteria 12764
819 Ga0316584_0030059 3300036712 Bacteria 4012
820 Ga0373925_0045923 3300037068 Bacteria 3246
821 Ga0373925_0052738 3300037068 Bacteria 3039
822 Ga0373925_0148264 3300037068 Bacteria 1840
823 Ga0373925_0836978 3300037068 Bacteria 758
824 Ga0373925_1363849 3300037068 Bacteria 581
825 Ga0395899_0457765 3300037312 Bacteria 834
826 Ga0395900_0065470 3300037418 Bacteria 3734
827 Ga0395898_0004337 3300037466 Bacteria 15530
828 Ga0395905_0002506 3300037471 Bacteria 20297
829 Ga0316581_0015698 3300037588 Bacteria 2167
830 Ga0395901_0002674 3300038443 Bacteria 17986
831 Ga0400483_133534 3300039062 Bacteria 1191
832 Ga0400483_267907 3300039062 Bacteria 2246
833 Ga0400489_21280 3300039093 Bacteria 3406
834 Ga0436365_0373305 3300039437 Bacteria 931
835 Ga0436365_1239138 3300039437 Bacteria 8147
836 Ga0436360_0571027 3300039438 Bacteria 789
837 Ga0436360_0645792 3300039438 Bacteria 862
838 Ga0436360_0817917 3300039438 Bacteria 3375
839 Ga0436360_1044379 3300039438 Bacteria 1527
840 Ga0436360_1063772 3300039438 Bacteria 1452
841 Ga0436361_0083999 3300039447 Bacteria 1653
842 Ga0436361_0430933 3300039447 Bacteria 1334
843 Ga0436361_0586937 3300039447 Bacteria 1952
844 Ga0436361_0611695 3300039447 Bacteria 1353
845 Ga0436362_0086357 3300039453 Bacteria 960
846 Ga0436362_0587836 3300039453 Bacteria 969
847 Ga0439450_121751 3300042008 Bacteria 672
848 Ga0439435_0081480 3300042436 Bacteria 972
849 Ga0439444_0072780 3300042437 Bacteria 739
850 Ga0451577_0000008 3300042876 Bacteria 692992
851 Ga0451577_0083132 3300042876 Bacteria 2856
852 Ga0451577_0414523 3300042876 Bacteria 1223
853 Ga0453683_0197226 3300044673 Bacteria 1278
854 Ga0453683_1113283 3300044673 Bacteria 527
855 Ga0466966_0477214 3300044684 Bacteria 750
856 Ga0453684_0000032 3300044712 Bacteria 745626
857 Ga0453684_0000652 3300044712 Bacteria 125090
858 Ga0453684_0003639 3300044712 Bacteria 34251
859 Ga0453684_0005247 3300044712 Bacteria 25923
860 Ga0453684_0008205 3300044712 Bacteria 18833
861 Ga0453684_0010967 3300044712 Bacteria 15319
862 Ga0453684_0597072 3300044712 Unclassified 1210
863 Ga0466968_0125467 3300044735 Bacteria 1164
864 Ga0466970_0306312 3300044765 Bacteria 897
865 Ga0451576_0060264 3300045051 Unclassified 3960
866 Ga0451576_0123410 3300045051 Bacteria 2697
867 Ga0451576_0170881 3300045051 Bacteria 2269
868 Ga0495592_0487702 3300046454 Bacteria 767
869 Ga0495603_0000644 3300046455 Bacteria 19646
870 Ga0495590_0179042 3300046457 Bacteria 775
871 Ga0495629_0000177 3300046459 Bacteria 56906
872 Ga0495638_0201963 3300046460 Bacteria 1122
873 Ga0495638_0230829 3300046460 Bacteria 1030
874 Ga0495638_0341699 3300046460 Bacteria 793
875 Ga0495651_0385215 3300046462 Bacteria 919
876 Ga0495580_0000498 3300046472 Bacteria 32908
877 Ga0495580_0054202 3300046472 Bacteria 2829
878 Ga0495580_0148738 3300046472 Bacteria 1623
879 Ga0495580_0218192 3300046472 Bacteria 1311
880 Ga0495582_0000185 3300046473 Bacteria 34065
881 Ga0495639_0002889 3300046475 Bacteria 7477
882 Ga0495664_0155753 3300046477 Bacteria 1386
883 Ga0495584_0019937 3300046491 Bacteria 3407
884 Ga0495584_0456114 3300046491 Bacteria 650
885 Ga0495594_0000023 3300046499 Bacteria 70363
886 Ga0495607_0138995 3300046501 Bacteria 1255
887 Ga0495583_0350624 3300046506 Bacteria 582
888 Ga0495608_0258169 3300046511 Bacteria 1085
889 Ga0495628_0603188 3300046516 Bacteria 784
890 Ga0495631_0323793 3300046518 Bacteria 656
891 Ga0495643_0178632 3300046522 Bacteria 1033
892 Ga0495644_0097060 3300046523 Bacteria 1114
893 Ga0495644_0185129 3300046523 Bacteria 801
894 Ga0495666_0089895 3300046526 Bacteria 1449
895 Ga0495666_0302972 3300046526 Bacteria 723
896 Ga0495652_0108553 3300046529 Bacteria 2236
897 Ga0495654_0005576 3300046530 Bacteria 7288
898 Ga0495665_0158714 3300046531 Bacteria 1179
899 Ga0495640_0536766 3300046533 Bacteria 710
900 Ga0495640_0667962 3300046533 Bacteria 625
901 Ga0495587_0060127 3300046536 Bacteria 2229
902 Ga0495609_0264142 3300046538 Bacteria 707
903 Ga0495622_0012059 3300046557 Bacteria 3996
904 Ga0495633_0160999 3300046558 Bacteria 1035
905 Ga0495667_0047741 3300046559 Bacteria 2828
906 Ga0495668_0053374 3300046616 Bacteria 2235
907 Ga0495634_0033371 3300046642 Bacteria 3538
908 Ga0495625_0151632 3300046660 Bacteria 1558
909 Ga0495635_0294666 3300046663 Bacteria 1088
910 Ga0495659_0029200 3300046664 Bacteria 1913
911 Ga0495661_0179077 3300046665 Bacteria 1125
912 Ga0495588_0112637 3300046674 Bacteria 1433
913 Ga0495657_0079161 3300046675 Bacteria 2129
914 Ga0495657_0900145 3300046675 Bacteria 503
915 Ga0495647_0021652 3300046681 Bacteria 2316
916 Ga0495658_0002288 3300046683 Bacteria 9659
917 Ga0495613_0000209 3300046689 Bacteria 57674
918 Ga0495624_0244080 3300046690 Bacteria 1087
919 Ga0495670_0233670 3300046691 Bacteria 978
920 Ga0495670_0407470 3300046691 Bacteria 735
921 Ga0495671_0452285 3300046692 Bacteria 614
922 Ga0495589_0216761 3300046794 Bacteria 900
923 Ga0495660_0165098 3300046810 Bacteria 1083
924 Ga0495581_0001042 3300047315 Bacteria 15004
925 Ga0495604_0087435 3300047317 Bacteria 2321
926 Ga0495672_0127853 3300047320 Bacteria 1341
927 Ga0495672_0243898 3300047320 Bacteria 876
928 Ga0495676_0013652 3300047321 Bacteria 7289
929 Ga0495676_0595926 3300047321 Bacteria 720
930 Ga0495680_0823796 3300047322 Bacteria 605
931 Ga0495683_0157375 3300047323 Bacteria 1053
932 Ga0495675_0066595 3300047444 Bacteria 2277
933 Ga0495677_0056224 3300047445 Bacteria 1453
934 Ga0495684_0479018 3300047471 Bacteria 860
935 Ga0495593_0000822 3300047673 Bacteria 18013
936 Ga0495614_0000618 3300048089 Bacteria 14895
937 Ga0495626_0180140 3300048091 Bacteria 876
938 Ga0496100_0011664 3300048903 Bacteria 5008
939 Ga0496100_0063587 3300048903 Bacteria 2439
940 Ga0496100_0072381 3300048903 Bacteria 2304
941 Ga0496100_0074061 3300048903 Bacteria 2280
942 Ga0496100_0131383 3300048903 Bacteria 1764
943 Ga0496100_0540612 3300048903 Bacteria 901
944 Ga0496100_0562191 3300048903 Bacteria 883
945 Ga0496101_0009865 3300048904 Bacteria 6290
946 Ga0496101_0014103 3300048904 Bacteria 5366
947 Ga0496101_0158638 3300048904 Bacteria 1734
948 Ga0496101_0180244 3300048904 Bacteria 1626
949 Ga0496101_0222451 3300048904 Bacteria 1465
950 Ga0496101_0400471 3300048904 Bacteria 1081
951 Ga0496101_0529491 3300048904 Bacteria 931
952 Ga0496101_0746767 3300048904 Bacteria 772
953 Ga0496101_0781035 3300048904 Bacteria 753
954 Ga0496101_0861968 3300048904 Bacteria 713
955 Ga0496101_1278358 3300048904 Bacteria 574
956 Ga0496102_0003666 3300048905 Bacteria 12983
957 Ga0496102_0021232 3300048905 Bacteria 5742
958 Ga0496102_0037637 3300048905 Bacteria 4365
959 Ga0496102_0054619 3300048905 Bacteria 3643
960 Ga0496102_0086307 3300048905 Bacteria 2898
961 Ga0496102_0142179 3300048905 Bacteria 2250
962 Ga0496102_0167272 3300048905 Bacteria 2069
963 Ga0496102_0258273 3300048905 Bacteria 1642
964 Ga0496102_0883914 3300048905 Bacteria 815
965 Ga0496103_0004549 3300048906 Bacteria 8395
966 Ga0496103_0053968 3300048906 Bacteria 2491
967 Ga0496103_0054499 3300048906 Bacteria 2478
968 Ga0496103_0085750 3300048906 Bacteria 1984
969 Ga0496103_0137323 3300048906 Bacteria 1563
970 Ga0496103_0143434 3300048906 Bacteria 1528
971 Ga0496103_0176728 3300048906 Bacteria 1372
972 Ga0496103_0886414 3300048906 Bacteria 560
973 Ga0496104_0000216 3300048907 Bacteria 50674
974 Ga0496104_0002392 3300048907 Bacteria 16158
975 Ga0496104_0011428 3300048907 Bacteria 7952
976 Ga0496104_0047709 3300048907 Bacteria 4037
977 Ga0496104_0137839 3300048907 Bacteria 2344
978 Ga0496104_0164226 3300048907 Bacteria 2129
979 Ga0496104_0356915 3300048907 Bacteria 1374
980 Ga0496104_0533539 3300048907 Bacteria 1084
981 Ga0496104_0784088 3300048907 Bacteria 859
982 Ga0496104_1212750 3300048907 Bacteria 658
983 Ga0496105_0006833 3300048908 Bacteria 8775
984 Ga0496105_0007408 3300048908 Bacteria 8492
985 Ga0496105_0181573 3300048908 Bacteria 1723
986 Ga0496105_0195984 3300048908 Bacteria 1650
987 Ga0496105_0248773 3300048908 Bacteria 1441
988 Ga0496105_0355062 3300048908 Bacteria 1170
989 Ga0496105_0790024 3300048908 Bacteria 722
990 Ga0496105_1339131 3300048908 Bacteria 521
991 Ga0496106_0014032 3300048909 Bacteria 5923
992 Ga0496106_0020151 3300048909 Bacteria 4947
993 Ga0496106_0034165 3300048909 Bacteria 3797
994 Ga0496106_0153542 3300048909 Bacteria 1817
995 Ga0496106_0203109 3300048909 Bacteria 1577
996 Ga0496106_0213960 3300048909 Bacteria 1536
997 Ga0496106_0503269 3300048909 Bacteria 973
998 Ga0496106_1330790 3300048909 Bacteria 557
999 Ga0496107_0002978 3300048910 Bacteria 11215
1000 Ga0496107_0051098 3300048910 Bacteria 2981
1001 Ga0496107_0087501 3300048910 Bacteria 2274
1002 Ga0496107_0128296 3300048910 Bacteria 1871
1003 Ga0496107_0161717 3300048910 Bacteria 1659
1004 Ga0496107_0673999 3300048910 Bacteria 761
1005 Ga0496108_0029327 3300048911 Bacteria 4555
1006 Ga0496108_0041617 3300048911 Bacteria 3836
1007 Ga0496108_0152896 3300048911 Bacteria 1992
1008 Ga0496108_0217641 3300048911 Bacteria 1659
1009 Ga0496108_0286212 3300048911 Bacteria 1435
1010 Ga0496108_0314137 3300048911 Bacteria 1365
1011 Ga0496108_0752042 3300048911 Bacteria 843
1012 Ga0496108_0895023 3300048911 Bacteria 762
1013 Ga0496108_1160598 3300048911 Bacteria 654
1014 Ga0496109_0005439 3300048912 Bacteria 10654
1015 Ga0496109_0019124 3300048912 Bacteria 6033
1016 Ga0496109_0030933 3300048912 Bacteria 4799
1017 Ga0496109_0046146 3300048912 Bacteria 3957
1018 Ga0496109_0060268 3300048912 Bacteria 3468
1019 Ga0496109_0185742 3300048912 Bacteria 1953
1020 Ga0496109_0226901 3300048912 Bacteria 1757
1021 Ga0496109_0381404 3300048912 Bacteria 1332
1022 Ga0496110_0007047 3300048913 Bacteria 8943
1023 Ga0496110_0024815 3300048913 Bacteria 5115
1024 Ga0496110_0033078 3300048913 Bacteria 4471
1025 Ga0496110_0035233 3300048913 Bacteria 4341
1026 Ga0496110_0080612 3300048913 Bacteria 2901
1027 Ga0496110_0092172 3300048913 Bacteria 2711
1028 Ga0496110_0197312 3300048913 Bacteria 1828
1029 Ga0496110_0397583 3300048913 Bacteria 1256
1030 Ga0496110_0474394 3300048913 Bacteria 1140
1031 Ga0496111_0000831 3300048914 Bacteria 16630
1032 Ga0496111_0021719 3300048914 Bacteria 4484
1033 Ga0496111_0036697 3300048914 Bacteria 3505
1034 Ga0496111_0091964 3300048914 Bacteria 2223
1035 Ga0496111_0210073 3300048914 Bacteria 1446
1036 Ga0496111_0335788 3300048914 Bacteria 1119
1037 Ga0496112_0013078 3300048915 Bacteria 7656
1038 Ga0496112_0046858 3300048915 Bacteria 4241
1039 Ga0496112_0054785 3300048915 Bacteria 3919
1040 Ga0496112_0064649 3300048915 Bacteria 3610
1041 Ga0496112_0068039 3300048915 Bacteria 3516
1042 Ga0496112_0290465 3300048915 Bacteria 1581
1043 Ga0496112_0675044 3300048915 Bacteria 962
1044 Ga0496113_0034328 3300048916 Bacteria 3701
1045 Ga0496113_0067510 3300048916 Bacteria 2712
1046 Ga0496113_0210369 3300048916 Bacteria 1548
1047 Ga0496114_0006659 3300048917 Bacteria 9106
1048 Ga0496114_0049973 3300048917 Bacteria 3480
1049 Ga0496114_0109813 3300048917 Bacteria 2362
1050 Ga0496114_0544702 3300048917 Bacteria 1025
1051 Ga0496114_0854744 3300048917 Bacteria 790
1052 Ga0496114_1061057 3300048917 Bacteria 694
1053 Ga0496115_0027506 3300048918 Bacteria 4449
1054 Ga0496115_0028276 3300048918 Bacteria 4394
1055 Ga0496115_0035138 3300048918 Bacteria 3964
1056 Ga0496115_0089669 3300048918 Bacteria 2511
1057 Ga0496115_0108912 3300048918 Bacteria 2274
1058 Ga0496115_0213094 3300048918 Bacteria 1595
1059 Ga0496115_0300579 3300048918 Bacteria 1315
1060 Ga0496115_0572119 3300048918 Bacteria 901
1061 Ga0496115_0921778 3300048918 Bacteria 672
1062 Ga0496122_0002761 3300048925 Bacteria 24237
1063 Ga0496123_0002923 3300048926 Bacteria 19986
1064 Ga0496124_0104578 3300048927 Bacteria 2289
1065 Ga0496124_0155757 3300048927 Bacteria 1787
1066 Ga0496124_0174143 3300048927 Bacteria 1663
1067 Ga0496126_0229728 3300048929 Bacteria 1555
1068 Ga0496126_0723637 3300048929 Bacteria 771
1069 Ga0496126_0739606 3300048929 Bacteria 760
1070 Ga0501308_036951 3300049128 Bacteria 676
1071 Ga0501031_0015742 3300049568 Bacteria 4909
1072 Ga0501031_0124425 3300049568 Bacteria 1684
1073 Ga0501031_0817588 3300049568 Bacteria 597
1074 Ga0501032_0026968 3300049569 Bacteria 3950
1075 Ga0501032_0180814 3300049569 Bacteria 1381
1076 Ga0501032_0403613 3300049569 Bacteria 878
1077 Ga0501032_0413034 3300049569 Bacteria 866
1078 Ga0501032_0494865 3300049569 Bacteria 782
1079 Ga0501033_0637546 3300049570 Bacteria 729
1080 Ga0501033_0688421 3300049570 Bacteria 696
1081 Ga0501033_0912419 3300049570 Bacteria 590
1082 Ga0501033_0940705 3300049570 Bacteria 579
1083 Ga0501034_0084509 3300049571 Bacteria 3175
1084 Ga0501034_0423062 3300049571 Bacteria 1253
1085 Ga0501036_0011493 3300049572 Bacteria 7331
1086 Ga0501036_0509958 3300049572 Bacteria 1000
1087 Ga0501036_0943255 3300049572 Bacteria 707
1088 Ga0501036_0957382 3300049572 Bacteria 701
1089 Ga0501036_0962178 3300049572 Bacteria 699
1090 Ga0501037_0368428 3300049573 Bacteria 989
1091 Ga0501037_0454662 3300049573 Bacteria 873
1092 Ga0501037_0508563 3300049573 Bacteria 816
1093 Ga0501037_0632712 3300049573 Bacteria 716
1094 Ga0501037_0722531 3300049573 Bacteria 661
1095 Ga0501038_0040318 3300049574 Bacteria 4080
1096 Ga0501038_0043951 3300049574 Bacteria 3883
1097 Ga0501038_0103763 3300049574 Bacteria 2364
1098 Ga0501038_0215612 3300049574 Bacteria 1534
1099 Ga0501038_0244434 3300049574 Bacteria 1424
1100 Ga0501038_0377332 3300049574 Bacteria 1100
1101 Ga0501039_0047469 3300049575 Bacteria 3319
1102 Ga0501039_0102579 3300049575 Bacteria 2233
1103 Ga0501039_0111547 3300049575 Bacteria 2138
1104 Ga0501039_0298062 3300049575 Bacteria 1267
1105 Ga0501039_0458142 3300049575 Bacteria 1001
1106 Ga0501039_0488920 3300049575 Bacteria 966
1107 Ga0501039_0791487 3300049575 Bacteria 740
1108 Ga0501040_0028204 3300049576 Bacteria 3783
1109 Ga0501040_0131387 3300049576 Bacteria 1761
1110 Ga0501040_0154989 3300049576 Bacteria 1617
1111 Ga0501040_0365950 3300049576 Bacteria 1034
1112 Ga0501040_0477028 3300049576 Bacteria 899
1113 Ga0501040_0716713 3300049576 Bacteria 723
1114 Ga0501041_0021811 3300049577 Bacteria 3836
1115 Ga0501041_0092487 3300049577 Bacteria 1867
1116 Ga0501041_0105027 3300049577 Bacteria 1750
1117 Ga0501041_0117214 3300049577 Bacteria 1654
1118 Ga0501041_0126602 3300049577 Bacteria 1590
1119 Ga0501041_0180825 3300049577 Bacteria 1320
1120 Ga0501041_0228652 3300049577 Bacteria 1168
1121 Ga0501041_0498414 3300049577 Bacteria 775
1122 Ga0501042_0017762 3300049578 Bacteria 4911
1123 Ga0501042_0099190 3300049578 Bacteria 2094
1124 Ga0501042_0112951 3300049578 Bacteria 1956
1125 Ga0501042_0200366 3300049578 Bacteria 1439
1126 Ga0501042_0404909 3300049578 Bacteria 988
1127 Ga0501042_0682073 3300049578 Bacteria 747
1128 Ga0501043_0258134 3300049579 Bacteria 1341
1129 Ga0501043_0515946 3300049579 Bacteria 891
1130 Ga0501043_0753919 3300049579 Bacteria 707
1131 Ga0501046_0002625 3300049580 Bacteria 16787
1132 Ga0501046_0324190 3300049580 Bacteria 1122
1133 Ga0501046_0546387 3300049580 Bacteria 826
1134 Ga0501046_0626781 3300049580 Bacteria 761
1135 Ga0501046_0638158 3300049580 Bacteria 753
1136 Ga0501047_0040402 3300049581 Bacteria 4511
1137 Ga0501048_0193045 3300049582 Bacteria 1443
1138 Ga0501048_0258396 3300049582 Bacteria 1237
1139 Ga0501048_0337337 3300049582 Bacteria 1074
1140 Ga0501048_0396254 3300049582 Bacteria 986
1141 Ga0501048_0456270 3300049582 Bacteria 915
1142 Ga0501048_0469464 3300049582 Bacteria 902
1143 Ga0501067_0056296 3300049583 Bacteria 2179
1144 Ga0501067_0288344 3300049583 Bacteria 914
1145 Ga0501068_0109422 3300049584 Bacteria 1717
1146 Ga0501068_0130935 3300049584 Bacteria 1568
1147 Ga0501068_0154445 3300049584 Bacteria 1444
1148 Ga0501068_0418936 3300049584 Bacteria 865
1149 Ga0501068_0959895 3300049584 Bacteria 563
1150 Ga0501069_0096618 3300049585 Bacteria 1674
1151 Ga0501069_0356825 3300049585 Bacteria 862
1152 Ga0501069_0537782 3300049585 Bacteria 699
1153 Ga0501070_0067955 3300049586 Bacteria 2951
1154 Ga0501070_0518013 3300049586 Bacteria 957
1155 Ga0501070_0918108 3300049586 Bacteria 682
1156 Ga0501071_0024493 3300049587 Bacteria 4223
1157 Ga0501071_0032410 3300049587 Bacteria 3710
1158 Ga0501071_0063978 3300049587 Bacteria 2668
1159 Ga0501071_0092876 3300049587 Bacteria 2218
1160 Ga0501071_0100192 3300049587 Bacteria 2135
1161 Ga0501071_0237972 3300049587 Bacteria 1372
1162 Ga0501071_0411846 3300049587 Bacteria 1033
1163 Ga0501071_0845326 3300049587 Bacteria 706
1164 Ga0501071_0946092 3300049587 Bacteria 665
1165 Ga0501071_1471194 3300049587 Bacteria 526
1166 Ga0501072_0007998 3300049588 Bacteria 8024
1167 Ga0501072_0051029 3300049588 Bacteria 3257
1168 Ga0501072_0177462 3300049588 Bacteria 1699
1169 Ga0501072_0220656 3300049588 Bacteria 1511
1170 Ga0501072_0303812 3300049588 Bacteria 1268
1171 Ga0501072_0350941 3300049588 Bacteria 1171
1172 Ga0501072_0628981 3300049588 Bacteria 845
1173 Ga0501072_0793966 3300049588 Bacteria 742
1174 Ga0501073_0003226 3300049589 Bacteria 12241
1175 Ga0501073_0034381 3300049589 Bacteria 3608
1176 Ga0501073_0185954 3300049589 Bacteria 1438
1177 Ga0501073_0224250 3300049589 Bacteria 1298
1178 Ga0501073_0226708 3300049589 Bacteria 1291
1179 Ga0501073_0273992 3300049589 Bacteria 1164
1180 Ga0501073_0333103 3300049589 Bacteria 1048
1181 Ga0501073_0485092 3300049589 Bacteria 855
1182 Ga0501073_0911896 3300049589 Bacteria 605
1183 Ga0501074_0049751 3300049590 Bacteria 3025
1184 Ga0501074_0071636 3300049590 Bacteria 2491
1185 Ga0501074_0088706 3300049590 Bacteria 2215
1186 Ga0501074_0152505 3300049590 Bacteria 1651
1187 Ga0501074_0161149 3300049590 Bacteria 1602
1188 Ga0501074_0697669 3300049590 Bacteria 716
1189 Ga0501074_0862709 3300049590 Bacteria 637
1190 Ga0501075_0069225 3300049591 Bacteria 2666
1191 Ga0501075_0118370 3300049591 Bacteria 2014
1192 Ga0501075_0136404 3300049591 Bacteria 1869
1193 Ga0501075_0139726 3300049591 Bacteria 1845
1194 Ga0501075_0193490 3300049591 Bacteria 1551
1195 Ga0501075_0265147 3300049591 Bacteria 1309
1196 Ga0501075_0303252 3300049591 Bacteria 1217
1197 Ga0501075_0484004 3300049591 Bacteria 944
1198 Ga0501075_0529279 3300049591 Bacteria 899
1199 Ga0501075_0596746 3300049591 Bacteria 842
1200 Ga0501076_0000421 3300049592 Bacteria 26662
1201 Ga0501076_0030475 3300049592 Bacteria 4201
1202 Ga0501076_0050061 3300049592 Bacteria 3304
1203 Ga0501076_0057669 3300049592 Bacteria 3084
1204 Ga0501076_0382244 3300049592 Bacteria 1157
1205 Ga0501076_0984771 3300049592 Bacteria 695
1206 Ga0501077_0011663 3300049593 Bacteria 5493
1207 Ga0501077_0019816 3300049593 Bacteria 4255
1208 Ga0501077_0052806 3300049593 Bacteria 2580
1209 Ga0501077_0065778 3300049593 Bacteria 2299
1210 Ga0501077_0081898 3300049593 Bacteria 2045
1211 Ga0501077_0117015 3300049593 Bacteria 1689
1212 Ga0501077_0173814 3300049593 Bacteria 1368
1213 Ga0501077_0178839 3300049593 Bacteria 1348
1214 Ga0501077_0255735 3300049593 Bacteria 1114
1215 Ga0501077_0723721 3300049593 Bacteria 640
1216 Ga0501238_002767 3300049671 Bacteria 2120
1217 Ga0501079_0011059 3300049741 Bacteria 6882
1218 Ga0501079_0015440 3300049741 Bacteria 5827
1219 Ga0501079_0025437 3300049741 Bacteria 4540
1220 Ga0501079_0029982 3300049741 Bacteria 4179
1221 Ga0501079_0064992 3300049741 Bacteria 2814
1222 Ga0501079_0085340 3300049741 Bacteria 2443
1223 Ga0501079_0392322 3300049741 Bacteria 1089
1224 Ga0501079_0533735 3300049741 Bacteria 922
1225 Ga0501079_0810015 3300049741 Bacteria 737
1226 Ga0501080_0027369 3300049742 Bacteria 5300
1227 Ga0501080_0095552 3300049742 Bacteria 2760
1228 Ga0501080_0141837 3300049742 Bacteria 2221
1229 Ga0501080_0204600 3300049742 Bacteria 1811
1230 Ga0501080_0251891 3300049742 Bacteria 1610
1231 Ga0501080_0347057 3300049742 Bacteria 1341
1232 Ga0501080_0488439 3300049742 Bacteria 1101
1233 Ga0501080_0658635 3300049742 Bacteria 926
1234 Ga0501081_0003198 3300049743 Bacteria 10403
1235 Ga0501081_0040953 3300049743 Bacteria 3171
1236 Ga0501081_0047963 3300049743 Bacteria 2939
1237 Ga0501081_0056768 3300049743 Bacteria 2706
1238 Ga0501081_0077134 3300049743 Bacteria 2328
1239 Ga0501081_0095052 3300049743 Bacteria 2100
1240 Ga0501081_0172437 3300049743 Bacteria 1562
1241 Ga0501081_0296293 3300049743 Bacteria 1186
1242 Ga0501081_0644853 3300049743 Bacteria 794
1243 Ga0501081_1009083 3300049743 Bacteria 629
1244 Ga0501081_1094349 3300049743 Bacteria 603
1245 Ga0501083_0031587 3300049744 Bacteria 3634
1246 Ga0501083_0102047 3300049744 Bacteria 1891
1247 Ga0501083_0154544 3300049744 Bacteria 1502
1248 Ga0501083_0205601 3300049744 Bacteria 1284
1249 Ga0501269_020609 3300049766 Bacteria 822
1250 Ga0501035_0189930 3300049822 Bacteria 1766
1251 Ga0501035_0459005 3300049822 Bacteria 1053
1252 Ga0501035_0543506 3300049822 Bacteria 952
1253 Ga0501035_0898209 3300049822 Bacteria 702
1254 Ga0501044_0012400 3300049823 Bacteria 9228
1255 Ga0501045_0013725 3300049824 Bacteria 5727
1256 Ga0501045_0057300 3300049824 Bacteria 2851
1257 Ga0501045_0060738 3300049824 Bacteria 2771
1258 Ga0501045_0076359 3300049824 Bacteria 2468
1259 Ga0501045_0243269 3300049824 Bacteria 1339
1260 Ga0501045_0528192 3300049824 Bacteria 876
1261 Ga0501045_0811197 3300049824 Bacteria 689
1262 Ga0501045_0964782 3300049824 Bacteria 625
1263 Ga0501045_1337924 3300049824 Bacteria 521
1264 nmdc:mga03n38_26789_c1 3300050490 Bacteria 2384
1265 nmdc:mga03n38_94395_c1 3300050490 Bacteria 1431
1266 nmdc:mga00v17_114995_c1 3300050491 Bacteria 1709
1267 nmdc:mga00v17_166581_c1 3300050491 Bacteria 1420
1268 nmdc:mga0yw44_4728_c1 3300050492 Bacteria 5791
1269 nmdc:mga0yw44_608088_c1 3300050492 Bacteria 743
1270 nmdc:mga0k408_197363_c1 3300050493 Bacteria 1201
1271 nmdc:mga06z11_23902_c1 3300050494 Bacteria 2877
1272 nmdc:mga06z11_284143_c1 3300050494 Bacteria 981
1273 nmdc:mga06z11_33224_c1 3300050494 Bacteria 2523
1274 nmdc:mga04h51_18257_c1 3300050495 Bacteria 2064
1275 nmdc:mga04h51_1973_c1 3300050495 Bacteria 4790
1276 nmdc:mga04h51_23062_c1 3300050495 Bacteria 1891
1277 nmdc:mga07m45_360574_c1 3300050496 Bacteria 844
1278 nmdc:mga05p37_1470845_c1 3300050507 Bacteria 681
1279 nmdc:mga05p37_159475_c1 3300050507 Bacteria 2756
1280 nmdc:mga05p37_27138_c1 3300050507 Bacteria 6970
1281 nmdc:mga05p37_301565_c1 3300050507 Bacteria 1903
1282 nmdc:mga05p37_454063_c1 3300050507 Bacteria 1482
1283 nmdc:mga05p37_49398_c1 3300050507 Bacteria 5174
1284 nmdc:mga05p37_878206_c1 3300050507 Bacteria 970
1285 nmdc:mga09592_219384_c1 3300050508 Bacteria 1648
1286 nmdc:mga09592_694129_c1 3300050508 Bacteria 867
1287 nmdc:mga0qj67_170797_c1 3300050509 Bacteria 1765
1288 nmdc:mga0qj67_224050_c1 3300050509 Bacteria 1526
1289 nmdc:mga0qj67_400386_c1 3300050509 Bacteria 1108
1290 nmdc:mga0qj67_43677_c1 3300050509 Bacteria 3530
1291 nmdc:mga06r32_207621_c1 3300050510 Bacteria 1947
1292 nmdc:mga06r32_209769_c1 3300050510 Bacteria 1936
1293 nmdc:mga06r32_2831_c1 3300050510 Bacteria 15564
1294 nmdc:mga06r32_381632_c1 3300050510 Bacteria 1392
1295 nmdc:mga06r32_45743_c1 3300050510 Bacteria 4173
1296 nmdc:mga08y16_1006887_c1 3300050511 Bacteria 813
1297 nmdc:mga08y16_354098_c1 3300050511 Bacteria 1508
1298 nmdc:mga08y16_479248_c1 3300050511 Bacteria 1266
1299 nmdc:mga08y16_51471_c1 3300050511 Bacteria 4309
1300 nmdc:mga08y16_560714_c1 3300050511 Bacteria 1155
1301 nmdc:mga08y16_79584_c1 3300050511 Bacteria 3416
1302 nmdc:mga0n895_1137071_c1 3300050512 Bacteria 757
1303 nmdc:mga0n895_1205724_c1 3300050512 Bacteria 731
1304 nmdc:mga0n895_200439_c1 3300050512 Bacteria 2027
1305 nmdc:mga0n895_28374_c1 3300050512 Bacteria 5323
1306 nmdc:mga0n895_30261_c1 3300050512 Bacteria 5172
1307 nmdc:mga0rr50_13958_c1 3300050513 Bacteria 5249
1308 nmdc:mga0rr50_173912_c1 3300050513 Bacteria 1756
1309 nmdc:mga0rr50_6581_c1 3300050513 Bacteria 7097
1310 nmdc:mga08x19_58182_c1 3300050514 Bacteria 2500
1311 nmdc:mga0a205_17244_c1 3300050515 Bacteria 6765
1312 nmdc:mga0a205_22301_c1 3300050515 Bacteria 5996
1313 nmdc:mga0a205_377889_c1 3300050515 Bacteria 1282
1314 nmdc:mga0a205_38046_c1 3300050515 Bacteria 4627
1315 nmdc:mga0a205_56983_c1 3300050515 Bacteria 3773
1316 nmdc:mga0a205_74311_c1 3300050515 Bacteria 3285
1317 Ga0495601_0015804 3300053077 Bacteria 4568
1318 Ga0495601_0033953 3300053077 Bacteria 3179
1319 Ga0495601_0702920 3300053077 Bacteria 645
1320 Ga0495612_0039940 3300053078 Bacteria 1910
1321 Ga0495655_0000679 3300053083 Bacteria 5465
1322 Ga0495655_0028926 3300053083 Bacteria 1328
1323 Ga0495595_0123678 3300053084 Bacteria 1261
1324 Ga0495595_0430932 3300053084 Bacteria 669
1325 Ga0495619_0003085 3300053085 Bacteria 10813
1326 Ga0495619_0040299 3300053085 Bacteria 3053
1327 Ga0495619_0047711 3300053085 Bacteria 2821
1328 Ga0495619_0412724 3300053085 Bacteria 932
1329 Ga0495619_0561373 3300053085 Bacteria 783
1330 Ga0500644_0230434 3300053088 Bacteria 775
1331 Ga0500646_0271481 3300053090 Bacteria 602
1332 Ga0500583_0267577 3300053092 Bacteria 841
1333 Ga0500651_0633458 3300053093 Bacteria 577
1334 Ga0500641_0136250 3300053096 Bacteria 1060
1335 Ga0500641_0230867 3300053096 Bacteria 782
1336 Ga0500650_0065747 3300053098 Bacteria 1694
1337 Ga0500650_0271518 3300053098 Bacteria 756
1338 Ga0500555_005793 3300053103 Bacteria 3506
1339 Ga0500556_0001703 3300053104 Bacteria 8393
1340 Ga0500556_0176632 3300053104 Bacteria 844
1341 Ga0500562_015287 3300053108 Bacteria 1968
1342 Ga0500594_0164320 3300053118 Bacteria 719
1343 Ga0500618_005553 3300053125 Bacteria 3815
1344 Ga0500618_016257 3300053125 Bacteria 1864
1345 Ga0500652_159728 3300053131 Bacteria 932
1346 Ga0500616_0006596 3300053153 Bacteria 7567
1347 Ga0500616_0009861 3300053153 Bacteria 5756
1348 Ga0500616_0023836 3300053153 Bacteria 3406
1349 Ga0500616_0155080 3300053153 Bacteria 1056
1350 Ga0500645_037607 3300053730 Bacteria 1437
1351 Ga0501084_0004756 3300054114 Bacteria 11097
1352 Ga0501084_0060676 3300054114 Bacteria 3165
1353 Ga0501084_0069792 3300054114 Bacteria 2942
1354 Ga0501084_0083487 3300054114 Bacteria 2681
1355 Ga0501084_0164633 3300054114 Bacteria 1871
1356 Ga0501084_0288349 3300054114 Bacteria 1386
1357 Ga0501084_0390430 3300054114 Bacteria 1176
1358 Ga0501084_0834579 3300054114 Bacteria 776
1359 Ga0587068_011988 3300059641 Bacteria 1317
1360 Ga0587111_0006178 3300060346 Bacteria 1887
1361 Ga0501082_0024683 3300060353 Bacteria 5182
1362 Ga0501082_0026929 3300060353 Bacteria 4953
1363 Ga0501082_0027843 3300060353 Bacteria 4867
1364 Ga0501082_0061171 3300060353 Bacteria 3242
1365 Ga0501082_0089971 3300060353 Bacteria 2650
1366 Ga0501082_0181067 3300060353 Bacteria 1833
1367 Ga0501082_0271970 3300060353 Bacteria 1474
1368 Ga0501082_0302697 3300060353 Bacteria 1392
1369 Ga0501082_0350329 3300060353 Bacteria 1287
1370 Ga0501082_0424543 3300060353 Bacteria 1161
1371 Ga0501082_0573731 3300060353 Bacteria 987
1372 Ga0501082_0896486 3300060353 Bacteria 776
1373 Ga0501082_0978755 3300060353 Bacteria 740
1374 Ga0501082_1034502 3300060353 Bacteria 718
1375 Ga0501082_1193922 3300060353 Bacteria 665
1376 Ga0501082_1509349 3300060353 Bacteria 587
1377 Ga0530510_0015060 3300061734 Bacteria 5462
1378 Ga0530510_0020058 3300061734 Bacteria 4753
1379 Ga0530510_0033570 3300061734 Bacteria 3694
1380 Ga0530510_0039532 3300061734 Bacteria 3405
1381 Ga0530510_0041216 3300061734 Bacteria 3333
1382 Ga0530510_0332355 3300061734 Bacteria 1140
1383 Ga0530510_0349592 3300061734 Bacteria 1110
1384 Ga0530510_0484071 3300061734 Bacteria 937

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006358 Ga0068871_100389102 Ga0068871_1003891021 134
2 3300044673 Ga0453683_1113283 Ga0453683_1113283_76_489 134
3 3300049568 Ga0501031_0817588 Ga0501031_0817588_14_421 135
4 3300049587 Ga0501071_1471194 Ga0501071_1471194_11_418 135
5 3300053118 Ga0500594_0164320 Ga0500594_0164320_80_487 135
6 3300014326 Ga0157380_11873382 Ga0157380_118733821 136
7 3300035112 Ga0373932_0170764 Ga0373932_0170764_57_467 136
8 3300046675 Ga0495657_0900145 Ga0495657_0900145_78_488 136
9 3300046681 Ga0495647_0021652 Ga0495647_0021652_244_654 136
10 3300049584 Ga0501068_0959895 Ga0501068_0959895_138_548 136
11 3300042008 Ga0439450_121751 Ga0439450_121751_61_498 145
12 3300042436 Ga0439435_0081480 Ga0439435_0081480_354_791 145
13 3300042437 Ga0439444_0072780 Ga0439444_0072780_151_588 145
14 3300049568 Ga0501031_0124425 Ga0501031_0124425_404_841 145
15 3300049569 Ga0501032_0403613 Ga0501032_0403613_348_785 145
16 3300049569 Ga0501032_0413034 Ga0501032_0413034_160_597 145
17 3300049570 Ga0501033_0688421 Ga0501033_0688421_118_555 145
18 3300049570 Ga0501033_0940705 Ga0501033_0940705_26_463 145
19 3300049572 Ga0501036_0943255 Ga0501036_0943255_235_672 145
20 3300049572 Ga0501036_0957382 Ga0501036_0957382_119_556 145
21 3300049573 Ga0501037_0632712 Ga0501037_0632712_161_598 145
22 3300049574 Ga0501038_0103763 Ga0501038_0103763_1842_2279 145
23 3300049574 Ga0501038_0215612 Ga0501038_0215612_26_463 145
24 3300049575 Ga0501039_0047469 Ga0501039_0047469_603_1040 145
25 3300049575 Ga0501039_0111547 Ga0501039_0111547_779_1216 145
26 3300049576 Ga0501040_0716713 Ga0501040_0716713_188_625 145
27 3300049577 Ga0501041_0021811 Ga0501041_0021811_2374_2811 145
28 3300049578 Ga0501042_0099190 Ga0501042_0099190_1557_1994 145
29 3300049578 Ga0501042_0404909 Ga0501042_0404909_431_868 145
30 3300049579 Ga0501043_0258134 Ga0501043_0258134_786_1223 145
31 3300049579 Ga0501043_0515946 Ga0501043_0515946_101_538 145
32 3300049580 Ga0501046_0546387 Ga0501046_0546387_205_642 145
33 3300049582 Ga0501048_0258396 Ga0501048_0258396_436_873 145
34 3300049582 Ga0501048_0337337 Ga0501048_0337337_180_617 145
35 3300049584 Ga0501068_0109422 Ga0501068_0109422_900_1337 145
36 3300049586 Ga0501070_0918108 Ga0501070_0918108_233_670 145
37 3300049587 Ga0501071_0063978 Ga0501071_0063978_79_516 145
38 3300049587 Ga0501071_0237972 Ga0501071_0237972_821_1258 145
39 3300049587 Ga0501071_0411846 Ga0501071_0411846_437_874 145
40 3300049588 Ga0501072_0350941 Ga0501072_0350941_594_1031 145
41 3300049588 Ga0501072_0628981 Ga0501072_0628981_336_773 145
42 3300049589 Ga0501073_0185954 Ga0501073_0185954_842_1279 145
43 3300049590 Ga0501074_0088706 Ga0501074_0088706_457_894 145
44 3300049590 Ga0501074_0161149 Ga0501074_0161149_483_920 145
45 3300049590 Ga0501074_0862709 Ga0501074_0862709_170_607 145
46 3300049591 Ga0501075_0136404 Ga0501075_0136404_944_1381 145
47 3300049591 Ga0501075_0529279 Ga0501075_0529279_342_779 145
48 3300049591 Ga0501075_0596746 Ga0501075_0596746_73_510 145
49 3300049593 Ga0501077_0019816 Ga0501077_0019816_3393_3830 145
50 3300049593 Ga0501077_0081898 Ga0501077_0081898_899_1336 145
51 3300049741 Ga0501079_0011059 Ga0501079_0011059_6315_6752 145
52 3300049741 Ga0501079_0025437 Ga0501079_0025437_3950_4387 145
53 3300049741 Ga0501079_0533735 Ga0501079_0533735_421_858 145
54 3300049742 Ga0501080_0095552 Ga0501080_0095552_509_946 145
55 3300049742 Ga0501080_0141837 Ga0501080_0141837_1650_2087 145
56 3300049742 Ga0501080_0251891 Ga0501080_0251891_76_513 145
57 3300049822 Ga0501035_0459005 Ga0501035_0459005_186_623 145
58 3300049824 Ga0501045_0057300 Ga0501045_0057300_1275_1712 145
59 3300049824 Ga0501045_0060738 Ga0501045_0060738_1112_1549 145
60 3300049824 Ga0501045_0811197 Ga0501045_0811197_236_673 145
61 3300050507 nmdc:mga05p37_454063_c1 nmdc:mga05p37_454063_c1_23_460 145
62 3300050509 nmdc:mga0qj67_400386_c1 nmdc:mga0qj67_400386_c1_109_546 145
63 3300050510 nmdc:mga06r32_381632_c1 nmdc:mga06r32_381632_c1_794_1231 145
64 3300054114 Ga0501084_0069792 Ga0501084_0069792_1821_2258 145
65 3300054114 Ga0501084_0083487 Ga0501084_0083487_1117_1554 145
66 3300060353 Ga0501082_0089971 Ga0501082_0089971_83_520 145
67 3300060353 Ga0501082_0271970 Ga0501082_0271970_81_518 145
68 3300061734 Ga0530510_0020058 Ga0530510_0020058_3146_3583 145
69 3300061734 Ga0530510_0039532 Ga0530510_0039532_297_734 145
70 3300026088 Ga0207641_11671657 Ga0207641_116716572 146
71 3300025919 Ga0207657_10569233 Ga0207657_105692331 152
72 iso_pu_bacteria 2510917026 2511169850 152
73 iso_pu_bacteria 2585427633 2585995368 152
74 iso_pu_bacteria 2585427634 2585999923 152
75 iso_pu_bacteria 2818991461 2819683833 152
76 iso_pu_bacteria 2854896431 2854901777 152
77 iso_pu_bacteria 2854916844 2854919396 152
78 iso_pu_bacteria 2919171160 2919177506 152
79 3300005330 Ga0070690_100031602 Ga0070690_1000316023 154
80 3300005340 Ga0070689_100001563 Ga0070689_1000015634 154
81 3300005367 Ga0070667_101605522 Ga0070667_1016055221 154
82 3300005466 Ga0070685_10679033 Ga0070685_106790331 154
83 3300005544 Ga0070686_100000940 Ga0070686_1000009403 154
84 3300013296 Ga0157374_10287176 Ga0157374_102871763 154
85 3300014745 Ga0157377_10667616 Ga0157377_106676162 154
86 3300014968 Ga0157379_10892907 Ga0157379_108929072 154
87 3300025936 Ga0207670_10000642 Ga0207670_100006425 154
88 3300005617 Ga0068859_101558607 Ga0068859_1015586071 155
89 3300006931 Ga0097620_101558773 Ga0097620_1015587731 155
90 3300031250 Ga0265331_10033198 Ga0265331_100331982 155
91 3300031344 Ga0265316_10028405 Ga0265316_100284053 155
92 3300044712 Ga0453684_0010967 Ga0453684_0010967_1513_1989 155
93 3300001989 JGI24739J22299_10003680 JGI24739J22299_100036802 156
94 3300002077 JGI24744J21845_10009957 JGI24744J21845_100099572 156
95 3300002239 JGI24034J26672_10026341 JGI24034J26672_100263412 156
96 3300002459 JGI24751J29686_10002788 JGI24751J29686_100027882 156
97 3300003215 JGI25153J46596_10019740 JGI25153J46596_100197402 156
98 3300003781 Ga0055536_1002518 Ga0055536_10025182 156
99 3300003791 Ga0055530_10015497 Ga0055530_100154972 156
100 3300003792 Ga0055540_1016845 Ga0055540_10168452 156
101 3300003794 Ga0055531_10016122 Ga0055531_100161224 156
102 3300005262 Ga0065165_1052002 Ga0065165_10520022 156
103 3300005290 Ga0065712_10221854 Ga0065712_102218542 156
104 3300005293 Ga0065715_10120074 Ga0065715_101200741 156
105 3300005327 Ga0070658_10117184 Ga0070658_101171842 156
106 3300005328 Ga0070676_10003697 Ga0070676_100036974 156
107 3300005329 Ga0070683_100066664 Ga0070683_1000666642 156
108 3300005330 Ga0070690_100000669 Ga0070690_1000006692 156
109 3300005330 Ga0070690_100437829 Ga0070690_1004378292 156
110 3300005331 Ga0070670_100000376 Ga0070670_10000037618 156
111 3300005333 Ga0070677_10061351 Ga0070677_100613513 156
112 3300005333 Ga0070677_10217266 Ga0070677_102172661 156
113 3300005334 Ga0068869_100017443 Ga0068869_1000174433 156
114 3300005334 Ga0068869_100350225 Ga0068869_1003502252 156
115 3300005334 Ga0068869_100792907 Ga0068869_1007929071 156
116 3300005335 Ga0070666_10010589 Ga0070666_100105893 156
117 3300005335 Ga0070666_10238426 Ga0070666_102384261 156
118 3300005336 Ga0070680_100002865 Ga0070680_1000028654 156
119 3300005336 Ga0070680_100022142 Ga0070680_1000221422 156
120 3300005336 Ga0070680_100045100 Ga0070680_1000451002 156
121 3300005336 Ga0070680_100063280 Ga0070680_1000632803 156
122 3300005337 Ga0070682_100000906 Ga0070682_1000009063 156
123 3300005337 Ga0070682_100002069 Ga0070682_10000206911 156
124 3300005337 Ga0070682_100080167 Ga0070682_1000801673 156
125 3300005337 Ga0070682_100457835 Ga0070682_1004578352 156
126 3300005338 Ga0068868_100002279 Ga0068868_1000022796 156
127 3300005338 Ga0068868_101195933 Ga0068868_1011959331 156
128 3300005339 Ga0070660_100000686 Ga0070660_1000006863 156
129 3300005339 Ga0070660_100025853 Ga0070660_1000258533 156
130 3300005339 Ga0070660_100980122 Ga0070660_1009801222 156
131 3300005340 Ga0070689_100000122 Ga0070689_10000012240 156
132 3300005340 Ga0070689_100561436 Ga0070689_1005614362 156
133 3300005340 Ga0070689_100636419 Ga0070689_1006364192 156
134 3300005340 Ga0070689_100806752 Ga0070689_1008067521 156
135 3300005340 Ga0070689_101300264 Ga0070689_1013002641 156
136 3300005341 Ga0070691_10000490 Ga0070691_100004904 156
137 3300005341 Ga0070691_10071705 Ga0070691_100717052 156
138 3300005341 Ga0070691_10112071 Ga0070691_101120712 156
139 3300005341 Ga0070691_10122218 Ga0070691_101222182 156
140 3300005341 Ga0070691_10491655 Ga0070691_104916551 156
141 3300005343 Ga0070687_100021008 Ga0070687_1000210082 156
142 3300005343 Ga0070687_100633737 Ga0070687_1006337371 156
143 3300005344 Ga0070661_100000385 Ga0070661_10000038525 156
144 3300005344 Ga0070661_100113169 Ga0070661_1001131692 156
145 3300005345 Ga0070692_10001302 Ga0070692_1000130211 156
146 3300005345 Ga0070692_10087562 Ga0070692_100875622 156
147 3300005345 Ga0070692_10135442 Ga0070692_101354422 156
148 3300005345 Ga0070692_10188993 Ga0070692_101889931 156
149 3300005345 Ga0070692_10350890 Ga0070692_103508901 156
150 3300005345 Ga0070692_10404232 Ga0070692_104042322 156
151 3300005347 Ga0070668_100005991 Ga0070668_1000059913 156
152 3300005347 Ga0070668_100097873 Ga0070668_1000978733 156
153 3300005347 Ga0070668_100630128 Ga0070668_1006301282 156
154 3300005347 Ga0070668_100717684 Ga0070668_1007176842 156
155 3300005347 Ga0070668_100901193 Ga0070668_1009011932 156
156 3300005347 Ga0070668_101757251 Ga0070668_1017572511 156
157 3300005353 Ga0070669_100002082 Ga0070669_10000208224 156
158 3300005353 Ga0070669_100832448 Ga0070669_1008324481 156
159 3300005353 Ga0070669_101013596 Ga0070669_1010135961 156
160 3300005354 Ga0070675_100005878 Ga0070675_1000058783 156
161 3300005354 Ga0070675_101154866 Ga0070675_1011548661 156
162 3300005355 Ga0070671_100001283 Ga0070671_1000012832 156
163 3300005355 Ga0070671_100302239 Ga0070671_1003022392 156
164 3300005356 Ga0070674_100000649 Ga0070674_1000006493 156
165 3300005356 Ga0070674_100097379 Ga0070674_1000973793 156
166 3300005356 Ga0070674_100530538 Ga0070674_1005305382 156
167 3300005364 Ga0070673_100121391 Ga0070673_1001213912 156
168 3300005365 Ga0070688_100000217 Ga0070688_10000021715 156
169 3300005365 Ga0070688_100028311 Ga0070688_1000283112 156
170 3300005365 Ga0070688_100202736 Ga0070688_1002027362 156
171 3300005365 Ga0070688_100965974 Ga0070688_1009659741 156
172 3300005366 Ga0070659_100002236 Ga0070659_10000223610 156
173 3300005366 Ga0070659_100023489 Ga0070659_1000234893 156
174 3300005366 Ga0070659_100045573 Ga0070659_1000455733 156
175 3300005366 Ga0070659_100227582 Ga0070659_1002275822 156
176 3300005366 Ga0070659_100270890 Ga0070659_1002708902 156
177 3300005366 Ga0070659_100859937 Ga0070659_1008599372 156
178 3300005367 Ga0070667_100002610 Ga0070667_1000026109 156
179 3300005367 Ga0070667_100092102 Ga0070667_1000921022 156
180 3300005367 Ga0070667_100128893 Ga0070667_1001288933 156
181 3300005367 Ga0070667_100226989 Ga0070667_1002269892 156
182 3300005406 Ga0070703_10004053 Ga0070703_100040532 156
183 3300005434 Ga0070709_10001232 Ga0070709_100012328 156
184 3300005434 Ga0070709_10288704 Ga0070709_102887041 156
185 3300005434 Ga0070709_10735828 Ga0070709_107358281 156
186 3300005435 Ga0070714_100018042 Ga0070714_1000180423 156
187 3300005436 Ga0070713_100001927 Ga0070713_10000192711 156
188 3300005436 Ga0070713_100078299 Ga0070713_1000782992 156
189 3300005437 Ga0070710_10166478 Ga0070710_101664782 156
190 3300005438 Ga0070701_10004381 Ga0070701_100043812 156
191 3300005439 Ga0070711_100000834 Ga0070711_1000008343 156
192 3300005439 Ga0070711_100512272 Ga0070711_1005122721 156
193 3300005439 Ga0070711_100752604 Ga0070711_1007526042 156
194 3300005440 Ga0070705_100001704 Ga0070705_1000017046 156
195 3300005440 Ga0070705_100004368 Ga0070705_1000043683 156
196 3300005440 Ga0070705_100461106 Ga0070705_1004611061 156
197 3300005441 Ga0070700_100002377 Ga0070700_1000023778 156
198 3300005441 Ga0070700_100065396 Ga0070700_1000653963 156
199 3300005441 Ga0070700_100091434 Ga0070700_1000914343 156
200 3300005441 Ga0070700_100091728 Ga0070700_1000917281 156
201 3300005441 Ga0070700_100098903 Ga0070700_1000989033 156
202 3300005441 Ga0070700_100353274 Ga0070700_1003532742 156
203 3300005441 Ga0070700_100711397 Ga0070700_1007113972 156
204 3300005444 Ga0070694_100000195 Ga0070694_10000019528 156
205 3300005444 Ga0070694_100036040 Ga0070694_1000360401 156
206 3300005444 Ga0070694_100133401 Ga0070694_1001334012 156
207 3300005444 Ga0070694_100202098 Ga0070694_1002020983 156
208 3300005444 Ga0070694_100389255 Ga0070694_1003892552 156
209 3300005444 Ga0070694_100637231 Ga0070694_1006372311 156
210 3300005445 Ga0070708_100056503 Ga0070708_1000565033 156
211 3300005445 Ga0070708_100093871 Ga0070708_1000938712 156
212 3300005455 Ga0070663_100000352 Ga0070663_10000035231 156
213 3300005455 Ga0070663_100001782 Ga0070663_1000017825 156
214 3300005455 Ga0070663_100071693 Ga0070663_1000716932 156
215 3300005455 Ga0070663_100192549 Ga0070663_1001925492 156
216 3300005455 Ga0070663_100350786 Ga0070663_1003507862 156
217 3300005456 Ga0070678_100001137 Ga0070678_1000011375 156
218 3300005457 Ga0070662_100000412 Ga0070662_10000041215 156
219 3300005457 Ga0070662_100550682 Ga0070662_1005506822 156
220 3300005457 Ga0070662_100836164 Ga0070662_1008361641 156
221 3300005457 Ga0070662_101037584 Ga0070662_1010375842 156
222 3300005458 Ga0070681_10005865 Ga0070681_100058654 156
223 3300005458 Ga0070681_10023484 Ga0070681_100234843 156
224 3300005458 Ga0070681_10042377 Ga0070681_100423773 156
225 3300005458 Ga0070681_10164070 Ga0070681_101640703 156
226 3300005458 Ga0070681_10185822 Ga0070681_101858223 156
227 3300005458 Ga0070681_10250538 Ga0070681_102505382 156
228 3300005459 Ga0068867_100070990 Ga0068867_1000709902 156
229 3300005466 Ga0070685_10005479 Ga0070685_100054793 156
230 3300005467 Ga0070706_100334391 Ga0070706_1003343912 156
231 3300005467 Ga0070706_100991629 Ga0070706_1009916292 156
232 3300005467 Ga0070706_102146987 Ga0070706_1021469871 156
233 3300005468 Ga0070707_100045980 Ga0070707_1000459803 156
234 3300005468 Ga0070707_100689963 Ga0070707_1006899632 156
235 3300005468 Ga0070707_100858955 Ga0070707_1008589552 156
236 3300005471 Ga0070698_100105371 Ga0070698_1001053712 156
237 3300005471 Ga0070698_100271798 Ga0070698_1002717982 156
238 3300005471 Ga0070698_101452714 Ga0070698_1014527141 156
239 3300005518 Ga0070699_100002571 Ga0070699_10000257113 156
240 3300005518 Ga0070699_100613012 Ga0070699_1006130122 156
241 3300005530 Ga0070679_100014791 Ga0070679_1000147913 156
242 3300005530 Ga0070679_100068971 Ga0070679_1000689713 156
243 3300005530 Ga0070679_100728392 Ga0070679_1007283922 156
244 3300005535 Ga0070684_100225818 Ga0070684_1002258181 156
245 3300005536 Ga0070697_100000391 Ga0070697_10000039118 156
246 3300005536 Ga0070697_100066290 Ga0070697_1000662903 156
247 3300005536 Ga0070697_100330332 Ga0070697_1003303321 156
248 3300005539 Ga0068853_100001595 Ga0068853_10000159512 156
249 3300005539 Ga0068853_100095708 Ga0068853_1000957082 156
250 3300005539 Ga0068853_101329379 Ga0068853_1013293791 156
251 3300005543 Ga0070672_100008680 Ga0070672_1000086803 156
252 3300005544 Ga0070686_100000853 Ga0070686_1000008532 156
253 3300005545 Ga0070695_100000238 Ga0070695_10000023835 156
254 3300005545 Ga0070695_100013344 Ga0070695_1000133442 156
255 3300005545 Ga0070695_100028804 Ga0070695_1000288042 156
256 3300005545 Ga0070695_100069546 Ga0070695_1000695461 156
257 3300005545 Ga0070695_100180109 Ga0070695_1001801091 156
258 3300005545 Ga0070695_100226022 Ga0070695_1002260221 156
259 3300005545 Ga0070695_100328434 Ga0070695_1003284342 156
260 3300005545 Ga0070695_100559307 Ga0070695_1005593072 156
261 3300005546 Ga0070696_100000815 Ga0070696_10000081524 156
262 3300005546 Ga0070696_100006241 Ga0070696_1000062414 156
263 3300005546 Ga0070696_100200406 Ga0070696_1002004062 156
264 3300005546 Ga0070696_100290248 Ga0070696_1002902482 156
265 3300005547 Ga0070693_100089116 Ga0070693_1000891162 156
266 3300005547 Ga0070693_100231277 Ga0070693_1002312772 156
267 3300005548 Ga0070665_100052313 Ga0070665_1000523133 156
268 3300005548 Ga0070665_101071652 Ga0070665_1010716522 156
269 3300005549 Ga0070704_100000124 Ga0070704_10000012430 156
270 3300005549 Ga0070704_100006261 Ga0070704_1000062611 156
271 3300005549 Ga0070704_100280374 Ga0070704_1002803741 156
272 3300005563 Ga0068855_100002691 Ga0068855_1000026913 156
273 3300005563 Ga0068855_100069700 Ga0068855_1000697003 156
274 3300005564 Ga0070664_100186343 Ga0070664_1001863432 156
275 3300005577 Ga0068857_100034156 Ga0068857_1000341563 156
276 3300005577 Ga0068857_100310077 Ga0068857_1003100772 156
277 3300005577 Ga0068857_100332947 Ga0068857_1003329472 156
278 3300005578 Ga0068854_100022328 Ga0068854_1000223283 156
279 3300005578 Ga0068854_100095464 Ga0068854_1000954642 156
280 3300005578 Ga0068854_100325520 Ga0068854_1003255202 156
281 3300005578 Ga0068854_100453359 Ga0068854_1004533592 156
282 3300005578 Ga0068854_100458028 Ga0068854_1004580281 156
283 3300005614 Ga0068856_100002821 Ga0068856_10000282119 156
284 3300005614 Ga0068856_100743676 Ga0068856_1007436762 156
285 3300005615 Ga0070702_100000018 Ga0070702_1000000186 156
286 3300005615 Ga0070702_100020165 Ga0070702_1000201653 156
287 3300005615 Ga0070702_100095027 Ga0070702_1000950273 156
288 3300005615 Ga0070702_100450512 Ga0070702_1004505122 156
289 3300005616 Ga0068852_100067019 Ga0068852_1000670193 156
290 3300005616 Ga0068852_100544065 Ga0068852_1005440652 156
291 3300005616 Ga0068852_101766950 Ga0068852_1017669501 156
292 3300005617 Ga0068859_100006726 Ga0068859_1000067264 156
293 3300005617 Ga0068859_100019657 Ga0068859_1000196572 156
294 3300005617 Ga0068859_100073753 Ga0068859_1000737532 156
295 3300005617 Ga0068859_100224454 Ga0068859_1002244543 156
296 3300005617 Ga0068859_100591668 Ga0068859_1005916682 156
297 3300005617 Ga0068859_101828721 Ga0068859_1018287211 156
298 3300005618 Ga0068864_100002243 Ga0068864_10000224324 156
299 3300005618 Ga0068864_100144705 Ga0068864_1001447053 156
300 3300005618 Ga0068864_100347956 Ga0068864_1003479562 156
301 3300005618 Ga0068864_101084319 Ga0068864_1010843192 156
302 3300005718 Ga0068866_10016535 Ga0068866_100165353 156
303 3300005718 Ga0068866_10162137 Ga0068866_101621372 156
304 3300005718 Ga0068866_10371120 Ga0068866_103711201 156
305 3300005718 Ga0068866_10547415 Ga0068866_105474151 156
306 3300005719 Ga0068861_100021853 Ga0068861_1000218533 156
307 3300005719 Ga0068861_100052445 Ga0068861_1000524453 156
308 3300005719 Ga0068861_100059827 Ga0068861_1000598272 156
309 3300005719 Ga0068861_100121537 Ga0068861_1001215372 156
310 3300005719 Ga0068861_100128342 Ga0068861_1001283422 156
311 3300005719 Ga0068861_100199791 Ga0068861_1001997912 156
312 3300005834 Ga0068851_10290140 Ga0068851_102901401 156
313 3300005840 Ga0068870_10142969 Ga0068870_101429692 156
314 3300005840 Ga0068870_10379296 Ga0068870_103792961 156
315 3300005841 Ga0068863_100035631 Ga0068863_1000356311 156
316 3300005841 Ga0068863_101263919 Ga0068863_1012639191 156
317 3300005841 Ga0068863_101553316 Ga0068863_1015533162 156
318 3300005842 Ga0068858_100014450 Ga0068858_1000144504 156
319 3300005842 Ga0068858_100059439 Ga0068858_1000594393 156
320 3300005842 Ga0068858_100102790 Ga0068858_1001027903 156
321 3300005842 Ga0068858_100231289 Ga0068858_1002312892 156
322 3300005842 Ga0068858_100818811 Ga0068858_1008188112 156
323 3300005842 Ga0068858_101058738 Ga0068858_1010587381 156
324 3300005843 Ga0068860_100000598 Ga0068860_10000059837 156
325 3300005843 Ga0068860_100730924 Ga0068860_1007309242 156
326 3300005843 Ga0068860_100735572 Ga0068860_1007355722 156
327 3300005843 Ga0068860_100747308 Ga0068860_1007473082 156
328 3300005843 Ga0068860_100768968 Ga0068860_1007689682 156
329 3300005843 Ga0068860_101148659 Ga0068860_1011486592 156
330 3300005844 Ga0068862_100002462 Ga0068862_1000024623 156
331 3300005844 Ga0068862_100008039 Ga0068862_1000080392 156
332 3300005844 Ga0068862_100021045 Ga0068862_1000210452 156
333 3300005844 Ga0068862_100355084 Ga0068862_1003550842 156
334 3300005844 Ga0068862_100516980 Ga0068862_1005169802 156
335 3300005844 Ga0068862_101384035 Ga0068862_1013840352 156
336 3300005937 Ga0081455_10004292 Ga0081455_100042923 156
337 3300005937 Ga0081455_10007585 Ga0081455_100075856 156
338 3300005937 Ga0081455_10308714 Ga0081455_103087142 156
339 3300005983 Ga0081540_1001954 Ga0081540_100195412 156
340 3300005983 Ga0081540_1039855 Ga0081540_10398553 156
341 3300005985 Ga0081539_10046146 Ga0081539_100461462 156
342 3300005985 Ga0081539_10050726 Ga0081539_100507262 156
343 3300006028 Ga0070717_10330910 Ga0070717_103309102 156
344 3300006038 Ga0075365_10003505 Ga0075365_100035053 156
345 3300006038 Ga0075365_10078853 Ga0075365_100788532 156
346 3300006042 Ga0075368_10007190 Ga0075368_100071902 156
347 3300006042 Ga0075368_10088331 Ga0075368_100883312 156
348 3300006042 Ga0075368_10164231 Ga0075368_101642312 156
349 3300006048 Ga0075363_100004707 Ga0075363_1000047072 156
350 3300006048 Ga0075363_100133533 Ga0075363_1001335331 156
351 3300006048 Ga0075363_100254370 Ga0075363_1002543702 156
352 3300006048 Ga0075363_100279414 Ga0075363_1002794142 156
353 3300006051 Ga0075364_10589678 Ga0075364_105896782 156
354 3300006058 Ga0075432_10009193 Ga0075432_100091933 156
355 3300006058 Ga0075432_10024708 Ga0075432_100247082 156
356 3300006163 Ga0070715_10009598 Ga0070715_100095982 156
357 3300006173 Ga0070716_100004896 Ga0070716_1000048963 156
358 3300006173 Ga0070716_100205373 Ga0070716_1002053733 156
359 3300006173 Ga0070716_100274689 Ga0070716_1002746892 156
360 3300006173 Ga0070716_100510710 Ga0070716_1005107101 156
361 3300006173 Ga0070716_100739079 Ga0070716_1007390791 156
362 3300006175 Ga0070712_100002909 Ga0070712_1000029092 156
363 3300006175 Ga0070712_100034164 Ga0070712_1000341643 156
364 3300006175 Ga0070712_100236495 Ga0070712_1002364953 156
365 3300006175 Ga0070712_100800337 Ga0070712_1008003371 156
366 3300006177 Ga0075362_10184200 Ga0075362_101842002 156
367 3300006178 Ga0075367_10113166 Ga0075367_101131662 156
368 3300006178 Ga0075367_10254589 Ga0075367_102545892 156
369 3300006195 Ga0075366_10107355 Ga0075366_101073552 156
370 3300006195 Ga0075366_10200191 Ga0075366_102001912 156
371 3300006237 Ga0097621_100087331 Ga0097621_1000873312 156
372 3300006237 Ga0097621_100216659 Ga0097621_1002166591 156
373 3300006237 Ga0097621_100330010 Ga0097621_1003300102 156
374 3300006237 Ga0097621_101619135 Ga0097621_1016191352 156
375 3300006358 Ga0068871_100847370 Ga0068871_1008473702 156
376 3300006844 Ga0075428_100025828 Ga0075428_1000258282 156
377 3300006844 Ga0075428_100044339 Ga0075428_1000443392 156
378 3300006844 Ga0075428_100116926 Ga0075428_1001169261 156
379 3300006844 Ga0075428_100184052 Ga0075428_1001840522 156
380 3300006844 Ga0075428_100211533 Ga0075428_1002115332 156
381 3300006844 Ga0075428_100301142 Ga0075428_1003011423 156
382 3300006844 Ga0075428_100963850 Ga0075428_1009638502 156
383 3300006846 Ga0075430_100029402 Ga0075430_1000294022 156
384 3300006846 Ga0075430_100161869 Ga0075430_1001618691 156
385 3300006846 Ga0075430_100305244 Ga0075430_1003052441 156
386 3300006846 Ga0075430_100449279 Ga0075430_1004492792 156
387 3300006846 Ga0075430_101247234 Ga0075430_1012472341 156
388 3300006847 Ga0075431_100002019 Ga0075431_1000020192 156
389 3300006847 Ga0075431_100014350 Ga0075431_1000143503 156
390 3300006847 Ga0075431_100048216 Ga0075431_1000482163 156
391 3300006847 Ga0075431_100085221 Ga0075431_1000852212 156
392 3300006852 Ga0075433_10002400 Ga0075433_100024002 156
393 3300006852 Ga0075433_10006677 Ga0075433_100066773 156
394 3300006852 Ga0075433_10126528 Ga0075433_101265282 156
395 3300006852 Ga0075433_10180830 Ga0075433_101808303 156
396 3300006852 Ga0075433_10303775 Ga0075433_103037752 156
397 3300006871 Ga0075434_100033297 Ga0075434_1000332973 156
398 3300006871 Ga0075434_100055563 Ga0075434_1000555634 156
399 3300006871 Ga0075434_100061871 Ga0075434_1000618713 156
400 3300006871 Ga0075434_100454741 Ga0075434_1004547412 156
401 3300006871 Ga0075434_100541745 Ga0075434_1005417452 156
402 3300006871 Ga0075434_100961198 Ga0075434_1009611982 156
403 3300006880 Ga0075429_100018835 Ga0075429_1000188353 156
404 3300006880 Ga0075429_100796467 Ga0075429_1007964672 156
405 3300006881 Ga0068865_100004683 Ga0068865_1000046832 156
406 3300006881 Ga0068865_100271014 Ga0068865_1002710141 156
407 3300006914 Ga0075436_100001383 Ga0075436_1000013832 156
408 3300006931 Ga0097620_100006726 Ga0097620_1000067263 156
409 3300006931 Ga0097620_100019656 Ga0097620_1000196562 156
410 3300006931 Ga0097620_100073751 Ga0097620_1000737512 156
411 3300006931 Ga0097620_100224447 Ga0097620_1002244472 156
412 3300006931 Ga0097620_100591697 Ga0097620_1005916972 156
413 3300006931 Ga0097620_101828964 Ga0097620_1018289641 156
414 3300007076 Ga0075435_100043632 Ga0075435_1000436322 156
415 3300007076 Ga0075435_100723045 Ga0075435_1007230452 156
416 3300009011 Ga0105251_10264466 Ga0105251_102644662 156
417 3300009036 Ga0105244_10397305 Ga0105244_103973051 156
418 3300009092 Ga0105250_10018370 Ga0105250_100183703 156
419 3300009093 Ga0105240_10670007 Ga0105240_106700072 156
420 3300009094 Ga0111539_10006608 Ga0111539_1000660810 156
421 3300009094 Ga0111539_10023934 Ga0111539_100239342 156
422 3300009094 Ga0111539_10028568 Ga0111539_100285682 156
423 3300009094 Ga0111539_10080826 Ga0111539_100808262 156
424 3300009094 Ga0111539_10135824 Ga0111539_101358242 156
425 3300009094 Ga0111539_10188116 Ga0111539_101881163 156
426 3300009094 Ga0111539_11143466 Ga0111539_111434661 156
427 3300009094 Ga0111539_11268994 Ga0111539_112689942 156
428 3300009098 Ga0105245_10000718 Ga0105245_1000071823 156
429 3300009098 Ga0105245_10766781 Ga0105245_107667812 156
430 3300009098 Ga0105245_11641566 Ga0105245_116415661 156
431 3300009101 Ga0105247_10028576 Ga0105247_100285763 156
432 3300009101 Ga0105247_10542179 Ga0105247_105421791 156
433 3300009101 Ga0105247_10598600 Ga0105247_105986001 156
434 3300009101 Ga0105247_10968515 Ga0105247_109685151 156
435 3300009147 Ga0114129_10067547 Ga0114129_100675473 156
436 3300009147 Ga0114129_10114822 Ga0114129_101148224 156
437 3300009147 Ga0114129_10159816 Ga0114129_101598162 156
438 3300009147 Ga0114129_10334793 Ga0114129_103347932 156
439 3300009147 Ga0114129_10467716 Ga0114129_104677163 156
440 3300009147 Ga0114129_10800767 Ga0114129_108007672 156
441 3300009147 Ga0114129_10980056 Ga0114129_109800562 156
442 3300009147 Ga0114129_11692413 Ga0114129_116924131 156
443 3300009147 Ga0114129_13325443 Ga0114129_133254431 156
444 3300009148 Ga0105243_10007855 Ga0105243_100078555 156
445 3300009148 Ga0105243_10016692 Ga0105243_100166923 156
446 3300009148 Ga0105243_10096050 Ga0105243_100960502 156
447 3300009148 Ga0105243_10164045 Ga0105243_101640452 156
448 3300009148 Ga0105243_10346945 Ga0105243_103469451 156
449 3300009148 Ga0105243_11690859 Ga0105243_116908591 156
450 3300009174 Ga0105241_10001150 Ga0105241_100011505 156
451 3300009174 Ga0105241_10016819 Ga0105241_100168193 156
452 3300009174 Ga0105241_10750543 Ga0105241_107505432 156
453 3300009176 Ga0105242_10003790 Ga0105242_100037903 156
454 3300009176 Ga0105242_10612942 Ga0105242_106129422 156
455 3300009176 Ga0105242_10844179 Ga0105242_108441792 156
456 3300009177 Ga0105248_10017659 Ga0105248_100176593 156
457 3300009177 Ga0105248_10090078 Ga0105248_100900783 156
458 3300009177 Ga0105248_10249035 Ga0105248_102490353 156
459 3300009545 Ga0105237_10001618 Ga0105237_1000161825 156
460 3300009545 Ga0105237_10025489 Ga0105237_100254893 156
461 3300009545 Ga0105237_10164275 Ga0105237_101642752 156
462 3300009545 Ga0105237_10906856 Ga0105237_109068562 156
463 3300009551 Ga0105238_10038405 Ga0105238_100384052 156
464 3300009551 Ga0105238_10278955 Ga0105238_102789552 156
465 3300009551 Ga0105238_11897910 Ga0105238_118979101 156
466 3300009553 Ga0105249_10000814 Ga0105249_1000081423 156
467 3300009553 Ga0105249_10060094 Ga0105249_100600942 156
468 3300009553 Ga0105249_10726781 Ga0105249_107267811 156
469 3300009553 Ga0105249_10749652 Ga0105249_107496522 156
470 3300009553 Ga0105249_11004495 Ga0105249_110044951 156
471 3300009553 Ga0105249_11539348 Ga0105249_115393481 156
472 3300010375 Ga0105239_10022201 Ga0105239_100222012 156
473 3300010375 Ga0105239_10135147 Ga0105239_101351472 156
474 3300010375 Ga0105239_10248297 Ga0105239_102482973 156
475 3300010375 Ga0105239_10367586 Ga0105239_103675862 156
476 3300010375 Ga0105239_12863633 Ga0105239_128636331 156
477 3300010375 Ga0105239_13198934 Ga0105239_131989341 156
478 3300011119 Ga0105246_10008999 Ga0105246_100089993 156
479 3300011119 Ga0105246_10050163 Ga0105246_100501633 156
480 3300011119 Ga0105246_10058936 Ga0105246_100589363 156
481 3300011119 Ga0105246_10195815 Ga0105246_101958153 156
482 3300011119 Ga0105246_10628531 Ga0105246_106285312 156
483 3300012487 Ga0157321_1002735 Ga0157321_10027351 156
484 3300012492 Ga0157335_1010858 Ga0157335_10108582 156
485 3300012507 Ga0157342_1016568 Ga0157342_10165682 156
486 3300013100 Ga0157373_10013558 Ga0157373_100135582 156
487 3300013100 Ga0157373_10057191 Ga0157373_100571911 156
488 3300013102 Ga0157371_10010822 Ga0157371_100108222 156
489 3300013102 Ga0157371_10178968 Ga0157371_101789682 156
490 3300013104 Ga0157370_10018923 Ga0157370_100189232 156
491 3300013104 Ga0157370_10022083 Ga0157370_100220833 156
492 3300013104 Ga0157370_10109337 Ga0157370_101093373 156
493 3300013105 Ga0157369_10012851 Ga0157369_100128514 156
494 3300013105 Ga0157369_10237379 Ga0157369_102373793 156
495 3300013105 Ga0157369_10382635 Ga0157369_103826352 156
496 3300013296 Ga0157374_10012339 Ga0157374_100123392 156
497 3300013297 Ga0157378_10006735 Ga0157378_100067355 156
498 3300013297 Ga0157378_10073149 Ga0157378_100731492 156
499 3300013297 Ga0157378_10220717 Ga0157378_102207173 156
500 3300013297 Ga0157378_10447402 Ga0157378_104474022 156
501 3300013297 Ga0157378_10870715 Ga0157378_108707152 156
502 3300013306 Ga0163162_10004532 Ga0163162_100045323 156
503 3300013306 Ga0163162_10213855 Ga0163162_102138553 156
504 3300013306 Ga0163162_10594627 Ga0163162_105946272 156
505 3300013306 Ga0163162_11855357 Ga0163162_118553572 156
506 3300013306 Ga0163162_12134791 Ga0163162_121347911 156
507 3300013307 Ga0157372_10019801 Ga0157372_100198013 156
508 3300013307 Ga0157372_10064568 Ga0157372_100645683 156
509 3300013307 Ga0157372_10367294 Ga0157372_103672942 156
510 3300013307 Ga0157372_10888664 Ga0157372_108886642 156
511 3300013308 Ga0157375_10043922 Ga0157375_100439223 156
512 3300013308 Ga0157375_10196112 Ga0157375_101961122 156
513 3300013308 Ga0157375_10396202 Ga0157375_103962023 156
514 3300013308 Ga0157375_11372090 Ga0157375_113720902 156
515 3300014325 Ga0163163_10026373 Ga0163163_100263738 156
516 3300014325 Ga0163163_10143990 Ga0163163_101439902 156
517 3300014326 Ga0157380_10003574 Ga0157380_100035744 156
518 3300014326 Ga0157380_10118277 Ga0157380_101182773 156
519 3300014326 Ga0157380_10659844 Ga0157380_106598442 156
520 3300014326 Ga0157380_11283587 Ga0157380_112835872 156
521 3300014745 Ga0157377_10254445 Ga0157377_102544452 156
522 3300014745 Ga0157377_10488350 Ga0157377_104883502 156
523 3300014745 Ga0157377_11316939 Ga0157377_113169391 156
524 3300014745 Ga0157377_11477652 Ga0157377_114776521 156
525 3300014968 Ga0157379_10015080 Ga0157379_100150804 156
526 3300014968 Ga0157379_10016719 Ga0157379_100167192 156
527 3300014968 Ga0157379_10152930 Ga0157379_101529303 156
528 3300014968 Ga0157379_10472628 Ga0157379_104726282 156
529 3300014968 Ga0157379_10694896 Ga0157379_106948962 156
530 3300014969 Ga0157376_10000606 Ga0157376_100006069 156
531 3300014969 Ga0157376_10470382 Ga0157376_104703822 156
532 3300014969 Ga0157376_10783890 Ga0157376_107838901 156
533 3300017792 Ga0163161_10002394 Ga0163161_100023943 156
534 3300017792 Ga0163161_10009458 Ga0163161_100094582 156
535 3300017792 Ga0163161_10116346 Ga0163161_101163462 156
536 3300017792 Ga0163161_10759798 Ga0163161_107597982 156
537 3300020069 Ga0197907_11483265 Ga0197907_114832651 156
538 3300021361 Ga0213872_10132952 Ga0213872_101329522 156
539 3300021384 Ga0213876_10022060 Ga0213876_100220604 156
540 3300021384 Ga0213876_10423739 Ga0213876_104237392 156
541 3300021441 Ga0213871_10030922 Ga0213871_100309222 156
542 3300024225 Ga0224572_1093388 Ga0224572_10933881 156
543 3300025292 Ga0209676_1008643 Ga0209676_10086433 156
544 3300025297 Ga0209758_1016521 Ga0209758_10165214 156
545 3300025297 Ga0209758_1054523 Ga0209758_10545232 156
546 3300025298 Ga0209050_1014417 Ga0209050_10144173 156
547 3300025299 Ga0209256_1029617 Ga0209256_10296171 156
548 3300025303 Ga0209051_1011025 Ga0209051_10110253 156
549 3300025304 Ga0209257_1007191 Ga0209257_10071913 156
550 3300025321 Ga0207656_10227735 Ga0207656_102277351 156
551 3300025885 Ga0207653_10001732 Ga0207653_100017323 156
552 3300025885 Ga0207653_10008442 Ga0207653_100084421 156
553 3300025898 Ga0207692_10002601 Ga0207692_100026018 156
554 3300025899 Ga0207642_10179543 Ga0207642_101795432 156
555 3300025899 Ga0207642_10188324 Ga0207642_101883242 156
556 3300025899 Ga0207642_10280697 Ga0207642_102806972 156
557 3300025900 Ga0207710_10033641 Ga0207710_100336413 156
558 3300025900 Ga0207710_10247588 Ga0207710_102475882 156
559 3300025901 Ga0207688_10000685 Ga0207688_1000068511 156
560 3300025903 Ga0207680_10004197 Ga0207680_100041973 156
561 3300025904 Ga0207647_10001956 Ga0207647_100019564 156
562 3300025904 Ga0207647_10026538 Ga0207647_100265382 156
563 3300025904 Ga0207647_10126221 Ga0207647_101262212 156
564 3300025905 Ga0207685_10039371 Ga0207685_100393713 156
565 3300025906 Ga0207699_10000692 Ga0207699_100006925 156
566 3300025906 Ga0207699_10334343 Ga0207699_103343432 156
567 3300025906 Ga0207699_10645384 Ga0207699_106453841 156
568 3300025907 Ga0207645_10012210 Ga0207645_100122103 156
569 3300025907 Ga0207645_10254541 Ga0207645_102545412 156
570 3300025907 Ga0207645_10296051 Ga0207645_102960511 156
571 3300025907 Ga0207645_10370527 Ga0207645_103705272 156
572 3300025908 Ga0207643_10190093 Ga0207643_101900932 156
573 3300025908 Ga0207643_10612253 Ga0207643_106122531 156
574 3300025909 Ga0207705_10102282 Ga0207705_101022823 156
575 3300025910 Ga0207684_10423995 Ga0207684_104239951 156
576 3300025910 Ga0207684_10668588 Ga0207684_106685881 156
577 3300025911 Ga0207654_10008946 Ga0207654_100089463 156
578 3300025911 Ga0207654_10019158 Ga0207654_100191583 156
579 3300025911 Ga0207654_10545463 Ga0207654_105454632 156
580 3300025911 Ga0207654_11098240 Ga0207654_110982401 156
581 3300025912 Ga0207707_10004025 Ga0207707_100040256 156
582 3300025912 Ga0207707_10126099 Ga0207707_101260992 156
583 3300025912 Ga0207707_10148837 Ga0207707_101488372 156
584 3300025912 Ga0207707_10203186 Ga0207707_102031863 156
585 3300025912 Ga0207707_10303093 Ga0207707_103030932 156
586 3300025913 Ga0207695_10473876 Ga0207695_104738761 156
587 3300025913 Ga0207695_10525623 Ga0207695_105256232 156
588 3300025914 Ga0207671_10081612 Ga0207671_100816122 156
589 3300025914 Ga0207671_10083800 Ga0207671_100838002 156
590 3300025914 Ga0207671_10239751 Ga0207671_102397512 156
591 3300025914 Ga0207671_10459644 Ga0207671_104596441 156
592 3300025915 Ga0207693_10002667 Ga0207693_100026672 156
593 3300025915 Ga0207693_10050769 Ga0207693_100507692 156
594 3300025915 Ga0207693_10343264 Ga0207693_103432641 156
595 3300025915 Ga0207693_10438020 Ga0207693_104380202 156
596 3300025916 Ga0207663_10001067 Ga0207663_1000106720 156
597 3300025916 Ga0207663_10547133 Ga0207663_105471332 156
598 3300025917 Ga0207660_10018343 Ga0207660_100183432 156
599 3300025917 Ga0207660_10036326 Ga0207660_100363262 156
600 3300025917 Ga0207660_10063001 Ga0207660_100630012 156
601 3300025917 Ga0207660_10343883 Ga0207660_103438832 156
602 3300025918 Ga0207662_10002067 Ga0207662_100020672 156
603 3300025918 Ga0207662_10455378 Ga0207662_104553781 156
604 3300025918 Ga0207662_10570154 Ga0207662_105701541 156
605 3300025919 Ga0207657_10000282 Ga0207657_1000028219 156
606 3300025919 Ga0207657_10032470 Ga0207657_100324703 156
607 3300025919 Ga0207657_10847256 Ga0207657_108472562 156
608 3300025920 Ga0207649_10028091 Ga0207649_100280912 156
609 3300025920 Ga0207649_10216538 Ga0207649_102165382 156
610 3300025920 Ga0207649_10887824 Ga0207649_108878241 156
611 3300025921 Ga0207652_10049921 Ga0207652_100499213 156
612 3300025921 Ga0207652_10066636 Ga0207652_100666363 156
613 3300025921 Ga0207652_10292555 Ga0207652_102925552 156
614 3300025921 Ga0207652_11164199 Ga0207652_111641992 156
615 3300025922 Ga0207646_10246047 Ga0207646_102460472 156
616 3300025922 Ga0207646_10737384 Ga0207646_107373842 156
617 3300025923 Ga0207681_10084571 Ga0207681_100845712 156
618 3300025923 Ga0207681_10453056 Ga0207681_104530562 156
619 3300025924 Ga0207694_10036374 Ga0207694_100363743 156
620 3300025924 Ga0207694_10605319 Ga0207694_106053192 156
621 3300025924 Ga0207694_10866786 Ga0207694_108667862 156
622 3300025925 Ga0207650_10012981 Ga0207650_100129813 156
623 3300025926 Ga0207659_10116815 Ga0207659_101168152 156
624 3300025926 Ga0207659_10746692 Ga0207659_107466922 156
625 3300025927 Ga0207687_10003322 Ga0207687_100033225 156
626 3300025927 Ga0207687_10205948 Ga0207687_102059482 156
627 3300025927 Ga0207687_10695739 Ga0207687_106957392 156
628 3300025928 Ga0207700_10001020 Ga0207700_100010203 156
629 3300025928 Ga0207700_10022703 Ga0207700_100227033 156
630 3300025928 Ga0207700_10775292 Ga0207700_107752922 156
631 3300025928 Ga0207700_11051592 Ga0207700_110515921 156
632 3300025928 Ga0207700_11198204 Ga0207700_111982041 156
633 3300025931 Ga0207644_10171793 Ga0207644_101717932 156
634 3300025931 Ga0207644_10176747 Ga0207644_101767472 156
635 3300025932 Ga0207690_10073607 Ga0207690_100736072 156
636 3300025932 Ga0207690_10180182 Ga0207690_101801823 156
637 3300025932 Ga0207690_10271737 Ga0207690_102717372 156
638 3300025932 Ga0207690_10316459 Ga0207690_103164592 156
639 3300025932 Ga0207690_10628381 Ga0207690_106283812 156
640 3300025932 Ga0207690_10874361 Ga0207690_108743612 156
641 3300025933 Ga0207706_10000270 Ga0207706_1000027020 156
642 3300025933 Ga0207706_10058445 Ga0207706_100584452 156
643 3300025933 Ga0207706_10107100 Ga0207706_101071003 156
644 3300025933 Ga0207706_10631627 Ga0207706_106316272 156
645 3300025933 Ga0207706_10663538 Ga0207706_106635382 156
646 3300025933 Ga0207706_10857337 Ga0207706_108573372 156
647 3300025934 Ga0207686_10302879 Ga0207686_103028792 156
648 3300025935 Ga0207709_10006830 Ga0207709_100068303 156
649 3300025935 Ga0207709_10109558 Ga0207709_101095582 156
650 3300025935 Ga0207709_10131695 Ga0207709_101316952 156
651 3300025935 Ga0207709_10523121 Ga0207709_105231211 156
652 3300025935 Ga0207709_11133556 Ga0207709_111335561 156
653 3300025936 Ga0207670_10029223 Ga0207670_100292232 156
654 3300025936 Ga0207670_10673025 Ga0207670_106730251 156
655 3300025936 Ga0207670_10721099 Ga0207670_107210992 156
656 3300025936 Ga0207670_10730585 Ga0207670_107305852 156
657 3300025936 Ga0207670_11415890 Ga0207670_114158901 156
658 3300025937 Ga0207669_10084859 Ga0207669_100848593 156
659 3300025937 Ga0207669_10153276 Ga0207669_101532762 156
660 3300025937 Ga0207669_10632456 Ga0207669_106324562 156
661 3300025938 Ga0207704_10059428 Ga0207704_100594283 156
662 3300025938 Ga0207704_11243992 Ga0207704_112439921 156
663 3300025939 Ga0207665_10000898 Ga0207665_1000089818 156
664 3300025939 Ga0207665_10163210 Ga0207665_101632103 156
665 3300025939 Ga0207665_10242056 Ga0207665_102420562 156
666 3300025940 Ga0207691_10057833 Ga0207691_100578333 156
667 3300025940 Ga0207691_11023799 Ga0207691_110237992 156
668 3300025941 Ga0207711_10003368 Ga0207711_100033682 156
669 3300025941 Ga0207711_11126324 Ga0207711_111263242 156
670 3300025942 Ga0207689_10076718 Ga0207689_100767182 156
671 3300025942 Ga0207689_10212476 Ga0207689_102124762 156
672 3300025942 Ga0207689_10360679 Ga0207689_103606792 156
673 3300025942 Ga0207689_10490702 Ga0207689_104907021 156
674 3300025944 Ga0207661_10080767 Ga0207661_100807673 156
675 3300025945 Ga0207679_10001363 Ga0207679_1000136315 156
676 3300025945 Ga0207679_10098094 Ga0207679_100980942 156
677 3300025945 Ga0207679_11191740 Ga0207679_111917402 156
678 3300025949 Ga0207667_10035591 Ga0207667_100355913 156
679 3300025949 Ga0207667_10078715 Ga0207667_100787152 156
680 3300025949 Ga0207667_10221936 Ga0207667_102219362 156
681 3300025949 Ga0207667_10586223 Ga0207667_105862232 156
682 3300025949 Ga0207667_11412906 Ga0207667_114129061 156
683 3300025949 Ga0207667_11436670 Ga0207667_114366701 156
684 3300025960 Ga0207651_10223211 Ga0207651_102232112 156
685 3300025960 Ga0207651_10770582 Ga0207651_107705822 156
686 3300025961 Ga0207712_10001373 Ga0207712_100013732 156
687 3300025961 Ga0207712_10013838 Ga0207712_100138382 156
688 3300025961 Ga0207712_11409388 Ga0207712_114093882 156
689 3300025972 Ga0207668_10006213 Ga0207668_100062138 156
690 3300025972 Ga0207668_10095533 Ga0207668_100955331 156
691 3300025972 Ga0207668_10126956 Ga0207668_101269562 156
692 3300025972 Ga0207668_10718232 Ga0207668_107182322 156
693 3300025972 Ga0207668_11212400 Ga0207668_112124001 156
694 3300025972 Ga0207668_11431729 Ga0207668_114317292 156
695 3300025972 Ga0207668_11545160 Ga0207668_115451601 156
696 3300025981 Ga0207640_10078850 Ga0207640_100788502 156
697 3300025981 Ga0207640_10093395 Ga0207640_100933953 156
698 3300025981 Ga0207640_10324387 Ga0207640_103243872 156
699 3300025981 Ga0207640_10417543 Ga0207640_104175431 156
700 3300025986 Ga0207658_10029474 Ga0207658_100294743 156
701 3300025986 Ga0207658_10234178 Ga0207658_102341783 156
702 3300025986 Ga0207658_10268558 Ga0207658_102685582 156
703 3300025986 Ga0207658_10399861 Ga0207658_103998612 156
704 3300025986 Ga0207658_11214489 Ga0207658_112144891 156
705 3300026023 Ga0207677_10013013 Ga0207677_100130132 156
706 3300026023 Ga0207677_10705069 Ga0207677_107050692 156
707 3300026035 Ga0207703_10004600 Ga0207703_100046005 156
708 3300026035 Ga0207703_10073903 Ga0207703_100739033 156
709 3300026035 Ga0207703_10107868 Ga0207703_101078683 156
710 3300026035 Ga0207703_10185199 Ga0207703_101851992 156
711 3300026035 Ga0207703_10598623 Ga0207703_105986232 156
712 3300026041 Ga0207639_10037169 Ga0207639_100371692 156
713 3300026041 Ga0207639_10039336 Ga0207639_100393362 156
714 3300026041 Ga0207639_10866690 Ga0207639_108666901 156
715 3300026041 Ga0207639_11005581 Ga0207639_110055811 156
716 3300026067 Ga0207678_10000118 Ga0207678_1000011861 156
717 3300026067 Ga0207678_10001987 Ga0207678_100019873 156
718 3300026067 Ga0207678_10061912 Ga0207678_100619123 156
719 3300026067 Ga0207678_10110263 Ga0207678_101102632 156
720 3300026067 Ga0207678_10165656 Ga0207678_101656562 156
721 3300026067 Ga0207678_10421822 Ga0207678_104218222 156
722 3300026067 Ga0207678_10900854 Ga0207678_109008541 156
723 3300026075 Ga0207708_10013264 Ga0207708_100132643 156
724 3300026075 Ga0207708_10025042 Ga0207708_100250423 156
725 3300026075 Ga0207708_10158056 Ga0207708_101580562 156
726 3300026075 Ga0207708_10232694 Ga0207708_102326943 156
727 3300026075 Ga0207708_10241021 Ga0207708_102410212 156
728 3300026075 Ga0207708_10448455 Ga0207708_104484552 156
729 3300026075 Ga0207708_10559405 Ga0207708_105594052 156
730 3300026075 Ga0207708_10662461 Ga0207708_106624612 156
731 3300026078 Ga0207702_10041809 Ga0207702_100418093 156
732 3300026078 Ga0207702_10327512 Ga0207702_103275122 156
733 3300026088 Ga0207641_10396814 Ga0207641_103968142 156
734 3300026088 Ga0207641_10574227 Ga0207641_105742272 156
735 3300026088 Ga0207641_11146540 Ga0207641_111465401 156
736 3300026089 Ga0207648_10012357 Ga0207648_100123574 156
737 3300026089 Ga0207648_10246208 Ga0207648_102462082 156
738 3300026089 Ga0207648_10465295 Ga0207648_104652952 156
739 3300026089 Ga0207648_10504985 Ga0207648_105049852 156
740 3300026089 Ga0207648_10870603 Ga0207648_108706032 156
741 3300026095 Ga0207676_10028970 Ga0207676_100289702 156
742 3300026095 Ga0207676_10132645 Ga0207676_101326453 156
743 3300026095 Ga0207676_10415696 Ga0207676_104156962 156
744 3300026116 Ga0207674_10022215 Ga0207674_100222154 156
745 3300026116 Ga0207674_10047521 Ga0207674_100475212 156
746 3300026116 Ga0207674_10404751 Ga0207674_104047512 156
747 3300026118 Ga0207675_100001292 Ga0207675_10000129218 156
748 3300026118 Ga0207675_100062290 Ga0207675_1000622904 156
749 3300026118 Ga0207675_100203980 Ga0207675_1002039801 156
750 3300026118 Ga0207675_100331062 Ga0207675_1003310622 156
751 3300026118 Ga0207675_100572559 Ga0207675_1005725592 156
752 3300026121 Ga0207683_10001738 Ga0207683_1000173811 156
753 3300026121 Ga0207683_10062468 Ga0207683_100624682 156
754 3300026142 Ga0207698_10016384 Ga0207698_100163843 156
755 3300026142 Ga0207698_10105982 Ga0207698_101059822 156
756 3300027665 Ga0209983_1050263 Ga0209983_10502632 156
757 3300027717 Ga0209998_10024125 Ga0209998_100241252 156
758 3300027717 Ga0209998_10090624 Ga0209998_100906242 156
759 3300027866 Ga0209813_10007002 Ga0209813_100070022 156
760 3300027866 Ga0209813_10015540 Ga0209813_100155402 156
761 3300027866 Ga0209813_10015864 Ga0209813_100158642 156
762 3300027876 Ga0209974_10159032 Ga0209974_101590321 156
763 3300027907 Ga0207428_10063093 Ga0207428_100630933 156
764 3300027907 Ga0207428_10091218 Ga0207428_100912181 156
765 3300027907 Ga0207428_10126762 Ga0207428_101267623 156
766 3300027907 Ga0207428_10142958 Ga0207428_101429582 156
767 3300027907 Ga0207428_10397050 Ga0207428_103970502 156
768 3300027907 Ga0207428_10455529 Ga0207428_104555292 156
769 3300028379 Ga0268266_10030323 Ga0268266_100303232 156
770 3300028379 Ga0268266_10317764 Ga0268266_103177642 156
771 3300028379 Ga0268266_10466616 Ga0268266_104666162 156
772 3300028379 Ga0268266_10777071 Ga0268266_107770712 156
773 3300028379 Ga0268266_11289615 Ga0268266_112896151 156
774 3300028380 Ga0268265_10002634 Ga0268265_100026343 156
775 3300028380 Ga0268265_10259078 Ga0268265_102590782 156
776 3300028380 Ga0268265_10788200 Ga0268265_107882002 156
777 3300028381 Ga0268264_10062737 Ga0268264_100627372 156
778 3300028381 Ga0268264_10546665 Ga0268264_105466652 156
779 3300028381 Ga0268264_10555818 Ga0268264_105558182 156
780 3300031090 Ga0265760_10094842 Ga0265760_100948422 156
781 3300031235 Ga0265330_10049935 Ga0265330_100499352 156
782 3300031235 Ga0265330_10087553 Ga0265330_100875532 156
783 3300031238 Ga0265332_10089584 Ga0265332_100895842 156
784 3300031238 Ga0265332_10386488 Ga0265332_103864881 156
785 3300031239 Ga0265328_10006537 Ga0265328_100065375 156
786 3300031239 Ga0265328_10098118 Ga0265328_100981182 156
787 3300031241 Ga0265325_10038876 Ga0265325_100388762 156
788 3300031247 Ga0265340_10256356 Ga0265340_102563561 156
789 3300031249 Ga0265339_10004332 Ga0265339_100043325 156
790 3300031250 Ga0265331_10004690 Ga0265331_100046903 156
791 3300031250 Ga0265331_10077686 Ga0265331_100776862 156
792 3300031344 Ga0265316_10049860 Ga0265316_100498602 156
793 3300031456 Ga0307513_10051533 Ga0307513_100515333 156
794 3300031595 Ga0265313_10099214 Ga0265313_100992142 156
795 3300031665 Ga0316575_10041479 Ga0316575_100414792 156
796 3300031691 Ga0316579_10033148 Ga0316579_100331482 156
797 3300031711 Ga0265314_10011275 Ga0265314_100112752 156
798 3300031711 Ga0265314_10068619 Ga0265314_100686191 156
799 3300031712 Ga0265342_10560019 Ga0265342_105600191 156
800 3300031727 Ga0316576_10024290 Ga0316576_100242902 156
801 3300031727 Ga0316576_10079460 Ga0316576_100794602 156
802 3300031728 Ga0316578_10109648 Ga0316578_101096481 156
803 3300031728 Ga0316578_10110133 Ga0316578_101101332 156
804 3300031730 Ga0307516_10044963 Ga0307516_100449635 156
805 3300031733 Ga0316577_10009470 Ga0316577_100094702 156
806 3300031824 Ga0307413_10754168 Ga0307413_107541682 156
807 3300031852 Ga0307410_10621707 Ga0307410_106217072 156
808 3300031901 Ga0307406_10036177 Ga0307406_100361773 156
809 3300031903 Ga0307407_10643051 Ga0307407_106430511 156
810 3300031911 Ga0307412_10073835 Ga0307412_100738352 156
811 3300031911 Ga0307412_10188353 Ga0307412_101883532 156
812 3300031911 Ga0307412_11157684 Ga0307412_111576842 156
813 3300032126 Ga0307415_100310957 Ga0307415_1003109572 156
814 3300032126 Ga0307415_101727444 Ga0307415_1017274441 156
815 3300032133 Ga0316583_10006475 Ga0316583_100064752 156
816 3300032137 Ga0316585_10000354 Ga0316585_100003543 156
817 3300032139 Ga0316580_10004849 Ga0316580_100048492 156
818 3300032168 Ga0316593_10004600 Ga0316593_100046003 156
819 3300032168 Ga0316593_10137614 Ga0316593_101376142 156
820 3300032168 Ga0316593_10334379 Ga0316593_103343791 156
821 3300033524 Ga0316592_1000038 Ga0316592_10000382 156
822 3300033527 Ga0316586_1000750 Ga0316586_10007502 156
823 3300033529 Ga0316587_1026022 Ga0316587_10260222 156
824 3300033541 Ga0316596_1000071 Ga0316596_100007117 156
825 3300033541 Ga0316596_1000341 Ga0316596_10003419 156
826 3300034819 Ga0373958_0002782 Ga0373958_0002782_1819_2289 156
827 3300034819 Ga0373958_0007763 Ga0373958_0007763_383_853 156
828 3300034819 Ga0373958_0199378 Ga0373958_0199378_26_496 156
829 3300034820 Ga0373959_0092431 Ga0373959_0092431_97_567 156
830 3300034820 Ga0373959_0153067 Ga0373959_0153067_21_491 156
831 3300035084 Ga0373928_0022650 Ga0373928_0022650_783_1253 156
832 3300035084 Ga0373928_0121457 Ga0373928_0121457_217_687 156
833 3300035085 Ga0373929_0039124 Ga0373929_0039124_157_627 156
834 3300035086 Ga0373934_0059436 Ga0373934_0059436_554_1024 156
835 3300035088 Ga0373940_0094714 Ga0373940_0094714_136_606 156
836 3300035089 Ga0373944_0016534 Ga0373944_0016534_247_717 156
837 3300035089 Ga0373944_0194227 Ga0373944_0194227_95_565 156
838 3300035090 Ga0373949_0005456 Ga0373949_0005456_2240_2710 156
839 3300035090 Ga0373949_0007190 Ga0373949_0007190_1961_2431 156
840 3300035091 Ga0373951_0026168 Ga0373951_0026168_519_989 156
841 3300035091 Ga0373951_0026176 Ga0373951_0026176_875_1345 156
842 3300035091 Ga0373951_0098987 Ga0373951_0098987_32_502 156
843 3300035091 Ga0373951_0115755 Ga0373951_0115755_185_655 156
844 3300035111 Ga0373923_0036411 Ga0373923_0036411_1107_1577 156
845 3300035112 Ga0373932_0021762 Ga0373932_0021762_234_704 156
846 3300035112 Ga0373932_0312795 Ga0373932_0312795_59_529 156
847 3300035114 Ga0373939_0010771 Ga0373939_0010771_1416_1886 156
848 3300035114 Ga0373939_0140327 Ga0373939_0140327_46_516 156
849 3300035115 Ga0373941_0016203 Ga0373941_0016203_705_1175 156
850 3300035117 Ga0373953_0012782 Ga0373953_0012782_1254_1724 156
851 3300035118 Ga0373954_0047545 Ga0373954_0047545_169_639 156
852 3300035118 Ga0373954_0198084 Ga0373954_0198084_37_507 156
853 3300035119 Ga0373956_0065806 Ga0373956_0065806_702_1172 156
854 3300035120 Ga0373957_0056667 Ga0373957_0056667_208_678 156
855 3300035120 Ga0373957_0102117 Ga0373957_0102117_152_622 156
856 3300035121 Ga0373960_0043759 Ga0373960_0043759_575_1045 156
857 3300035121 Ga0373960_0171541 Ga0373960_0171541_255_725 156
858 3300035121 Ga0373960_0298427 Ga0373960_0298427_14_484 156
859 3300035170 Ga0373943_0101641 Ga0373943_0101641_1020_1490 156
860 3300035172 Ga0373955_0085186 Ga0373955_0085186_1084_1554 156
861 3300035207 Ga0373942_0030108 Ga0373942_0030108_118_588 156
862 3300035241 Ga0373961_0056190 Ga0373961_0056190_400_870 156
863 3300035241 Ga0373961_0115072 Ga0373961_0115072_194_664 156
864 3300035242 Ga0373962_0002684 Ga0373962_0002684_373_843 156
865 3300035242 Ga0373962_0153953 Ga0373962_0153953_116_586 156
866 3300035398 Ga0316574_0199041 Ga0316574_0199041_397_867 156
867 3300035398 Ga0316574_0440126 Ga0316574_0440126_243_713 156
868 3300035410 Ga0373924_0046598 Ga0373924_0046598_525_995 156
869 3300035691 Ga0373931_0000685 Ga0373931_0000685_12914_13384 156
870 3300035691 Ga0373931_0008300 Ga0373931_0008300_4284_4754 156
871 3300035691 Ga0373931_0011519 Ga0373931_0011519_1235_1705 156
872 3300035691 Ga0373931_0037963 Ga0373931_0037963_114_584 156
873 3300035691 Ga0373931_0109918 Ga0373931_0109918_201_671 156
874 3300035692 Ga0373935_0195031 Ga0373935_0195031_175_645 156
875 3300035692 Ga0373935_0244761 Ga0373935_0244761_714_1184 156
876 3300035692 Ga0373935_0381976 Ga0373935_0381976_529_999 156
877 3300035695 Ga0373927_0002605 Ga0373927_0002605_1599_2069 156
878 3300035695 Ga0373927_0023112 Ga0373927_0023112_2892_3362 156
879 3300035695 Ga0373927_0028547 Ga0373927_0028547_892_1362 156
880 3300035724 Ga0373933_0018678 Ga0373933_0018678_842_1312 156
881 3300035724 Ga0373933_1098334 Ga0373933_1098334_16_486 156
882 3300035725 Ga0373947_0008559 Ga0373947_0008559_1869_2339 156
883 3300035725 Ga0373947_0083872 Ga0373947_0083872_803_1273 156
884 3300035725 Ga0373947_0376656 Ga0373947_0376656_350_820 156
885 3300035725 Ga0373947_0826018 Ga0373947_0826018_112_582 156
886 3300036401 Ga0373937_0137277 Ga0373937_0137277_1777_2247 156
887 3300036401 Ga0373937_0139978 Ga0373937_0139978_796_1266 156
888 3300036401 Ga0373937_0692262 Ga0373937_0692262_184_654 156
889 3300036401 Ga0373937_0876545 Ga0373937_0876545_281_751 156
890 3300036458 Ga0310112_011278 Ga0310112_011278_749_1219 156
891 3300036647 Ga0316582_0193869 Ga0316582_0193869_810_1280 156
892 3300036712 Ga0316584_0001985 Ga0316584_0001985_11231_11701 156
893 3300036712 Ga0316584_0030059 Ga0316584_0030059_525_995 156
894 3300037068 Ga0373925_0045923 Ga0373925_0045923_2225_2695 156
895 3300037068 Ga0373925_0052738 Ga0373925_0052738_2243_2713 156
896 3300037068 Ga0373925_0148264 Ga0373925_0148264_817_1287 156
897 3300037068 Ga0373925_0836978 Ga0373925_0836978_30_500 156
898 3300037068 Ga0373925_1363849 Ga0373925_1363849_37_507 156
899 3300037312 Ga0395899_0457765 Ga0395899_0457765_226_696 156
900 3300037418 Ga0395900_0065470 Ga0395900_0065470_1857_2327 156
901 3300037466 Ga0395898_0004337 Ga0395898_0004337_104_574 156
902 3300037471 Ga0395905_0002506 Ga0395905_0002506_5109_5579 156
903 3300037588 Ga0316581_0015698 Ga0316581_0015698_570_1040 156
904 3300038443 Ga0395901_0002674 Ga0395901_0002674_8720_9190 156
905 3300039062 Ga0400483_133534 Ga0400483_133534_614_1084 156
906 3300039062 Ga0400483_267907 Ga0400483_267907_1259_1729 156
907 3300039093 Ga0400489_21280 Ga0400489_21280_1044_1514 156
908 3300039437 Ga0436365_0373305 Ga0436365_0373305_414_884 156
909 3300039437 Ga0436365_1239138 Ga0436365_1239138_3337_3807 156
910 3300039438 Ga0436360_0571027 Ga0436360_0571027_285_755 156
911 3300039438 Ga0436360_0645792 Ga0436360_0645792_270_740 156
912 3300039438 Ga0436360_0817917 Ga0436360_0817917_260_730 156
913 3300039438 Ga0436360_1044379 Ga0436360_1044379_475_945 156
914 3300039438 Ga0436360_1063772 Ga0436360_1063772_860_1330 156
915 3300039447 Ga0436361_0083999 Ga0436361_0083999_906_1376 156
916 3300039447 Ga0436361_0430933 Ga0436361_0430933_706_1176 156
917 3300039447 Ga0436361_0586937 Ga0436361_0586937_1014_1484 156
918 3300039447 Ga0436361_0611695 Ga0436361_0611695_553_1023 156
919 3300039453 Ga0436362_0086357 Ga0436362_0086357_418_888 156
920 3300039453 Ga0436362_0587836 Ga0436362_0587836_233_703 156
921 3300042876 Ga0451577_0000008 Ga0451577_0000008_437355_437834 156
922 3300042876 Ga0451577_0083132 Ga0451577_0083132_1386_1865 156
923 3300042876 Ga0451577_0414523 Ga0451577_0414523_240_719 156
924 3300044673 Ga0453683_0197226 Ga0453683_0197226_482_961 156
925 3300044684 Ga0466966_0477214 Ga0466966_0477214_88_558 156
926 3300044712 Ga0453684_0000032 Ga0453684_0000032_486509_486988 156
927 3300044712 Ga0453684_0000652 Ga0453684_0000652_46958_47437 156
928 3300044712 Ga0453684_0003639 Ga0453684_0003639_7401_7880 156
929 3300044712 Ga0453684_0005247 Ga0453684_0005247_1525_2004 156
930 3300044712 Ga0453684_0008205 Ga0453684_0008205_893_1372 156
931 3300044712 Ga0453684_0597072 Ga0453684_0597072_601_1080 156
932 3300044735 Ga0466968_0125467 Ga0466968_0125467_488_958 156
933 3300044765 Ga0466970_0306312 Ga0466970_0306312_262_732 156
934 3300045051 Ga0451576_0060264 Ga0451576_0060264_1232_1711 156
935 3300045051 Ga0451576_0123410 Ga0451576_0123410_416_895 156
936 3300045051 Ga0451576_0170881 Ga0451576_0170881_625_1104 156
937 3300046454 Ga0495592_0487702 Ga0495592_0487702_204_674 156
938 3300046455 Ga0495603_0000644 Ga0495603_0000644_4748_5218 156
939 3300046457 Ga0495590_0179042 Ga0495590_0179042_26_496 156
940 3300046459 Ga0495629_0000177 Ga0495629_0000177_40983_41453 156
941 3300046460 Ga0495638_0201963 Ga0495638_0201963_471_941 156
942 3300046460 Ga0495638_0230829 Ga0495638_0230829_433_903 156
943 3300046460 Ga0495638_0341699 Ga0495638_0341699_201_671 156
944 3300046462 Ga0495651_0385215 Ga0495651_0385215_165_635 156
945 3300046472 Ga0495580_0000498 Ga0495580_0000498_9795_10265 156
946 3300046472 Ga0495580_0054202 Ga0495580_0054202_875_1345 156
947 3300046472 Ga0495580_0148738 Ga0495580_0148738_696_1166 156
948 3300046472 Ga0495580_0218192 Ga0495580_0218192_500_970 156
949 3300046473 Ga0495582_0000185 Ga0495582_0000185_5417_5887 156
950 3300046475 Ga0495639_0002889 Ga0495639_0002889_2334_2804 156
951 3300046477 Ga0495664_0155753 Ga0495664_0155753_669_1139 156
952 3300046491 Ga0495584_0019937 Ga0495584_0019937_1244_1714 156
953 3300046491 Ga0495584_0456114 Ga0495584_0456114_17_487 156
954 3300046499 Ga0495594_0000023 Ga0495594_0000023_5771_6241 156
955 3300046501 Ga0495607_0138995 Ga0495607_0138995_88_558 156
956 3300046506 Ga0495583_0350624 Ga0495583_0350624_46_516 156
957 3300046511 Ga0495608_0258169 Ga0495608_0258169_413_883 156
958 3300046516 Ga0495628_0603188 Ga0495628_0603188_29_499 156
959 3300046518 Ga0495631_0323793 Ga0495631_0323793_143_613 156
960 3300046522 Ga0495643_0178632 Ga0495643_0178632_437_907 156
961 3300046523 Ga0495644_0097060 Ga0495644_0097060_370_840 156
962 3300046523 Ga0495644_0185129 Ga0495644_0185129_316_786 156
963 3300046526 Ga0495666_0089895 Ga0495666_0089895_364_834 156
964 3300046526 Ga0495666_0302972 Ga0495666_0302972_146_616 156
965 3300046529 Ga0495652_0108553 Ga0495652_0108553_1414_1884 156
966 3300046530 Ga0495654_0005576 Ga0495654_0005576_5086_5556 156
967 3300046531 Ga0495665_0158714 Ga0495665_0158714_679_1149 156
968 3300046533 Ga0495640_0536766 Ga0495640_0536766_47_517 156
969 3300046533 Ga0495640_0667962 Ga0495640_0667962_66_536 156
970 3300046536 Ga0495587_0060127 Ga0495587_0060127_396_866 156
971 3300046538 Ga0495609_0264142 Ga0495609_0264142_198_668 156
972 3300046557 Ga0495622_0012059 Ga0495622_0012059_3384_3854 156
973 3300046558 Ga0495633_0160999 Ga0495633_0160999_504_974 156
974 3300046559 Ga0495667_0047741 Ga0495667_0047741_1577_2047 156
975 3300046616 Ga0495668_0053374 Ga0495668_0053374_1142_1612 156
976 3300046642 Ga0495634_0033371 Ga0495634_0033371_56_526 156
977 3300046660 Ga0495625_0151632 Ga0495625_0151632_688_1158 156
978 3300046663 Ga0495635_0294666 Ga0495635_0294666_150_620 156
979 3300046664 Ga0495659_0029200 Ga0495659_0029200_834_1304 156
980 3300046665 Ga0495661_0179077 Ga0495661_0179077_214_684 156
981 3300046674 Ga0495588_0112637 Ga0495588_0112637_247_717 156
982 3300046675 Ga0495657_0079161 Ga0495657_0079161_819_1289 156
983 3300046683 Ga0495658_0002288 Ga0495658_0002288_8817_9287 156
984 3300046689 Ga0495613_0000209 Ga0495613_0000209_54237_54707 156
985 3300046690 Ga0495624_0244080 Ga0495624_0244080_44_514 156
986 3300046691 Ga0495670_0233670 Ga0495670_0233670_213_683 156
987 3300046691 Ga0495670_0407470 Ga0495670_0407470_236_706 156
988 3300046692 Ga0495671_0452285 Ga0495671_0452285_102_572 156
989 3300046794 Ga0495589_0216761 Ga0495589_0216761_154_624 156
990 3300046810 Ga0495660_0165098 Ga0495660_0165098_425_895 156
991 3300047315 Ga0495581_0001042 Ga0495581_0001042_9237_9707 156
992 3300047317 Ga0495604_0087435 Ga0495604_0087435_832_1302 156
993 3300047320 Ga0495672_0127853 Ga0495672_0127853_735_1205 156
994 3300047320 Ga0495672_0243898 Ga0495672_0243898_286_756 156
995 3300047321 Ga0495676_0013652 Ga0495676_0013652_435_905 156
996 3300047321 Ga0495676_0595926 Ga0495676_0595926_110_580 156
997 3300047322 Ga0495680_0823796 Ga0495680_0823796_88_558 156
998 3300047323 Ga0495683_0157375 Ga0495683_0157375_79_549 156
999 3300047444 Ga0495675_0066595 Ga0495675_0066595_1334_1804 156
1000 3300047445 Ga0495677_0056224 Ga0495677_0056224_404_874 156
1001 3300047471 Ga0495684_0479018 Ga0495684_0479018_360_830 156
1002 3300047673 Ga0495593_0000822 Ga0495593_0000822_2931_3401 156
1003 3300048089 Ga0495614_0000618 Ga0495614_0000618_555_1025 156
1004 3300048091 Ga0495626_0180140 Ga0495626_0180140_260_730 156
1005 3300048903 Ga0496100_0011664 Ga0496100_0011664_2344_2814 156
1006 3300048903 Ga0496100_0063587 Ga0496100_0063587_944_1414 156
1007 3300048903 Ga0496100_0072381 Ga0496100_0072381_998_1468 156
1008 3300048903 Ga0496100_0074061 Ga0496100_0074061_885_1355 156
1009 3300048903 Ga0496100_0131383 Ga0496100_0131383_10_480 156
1010 3300048903 Ga0496100_0540612 Ga0496100_0540612_236_706 156
1011 3300048903 Ga0496100_0562191 Ga0496100_0562191_293_763 156
1012 3300048904 Ga0496101_0009865 Ga0496101_0009865_4921_5391 156
1013 3300048904 Ga0496101_0014103 Ga0496101_0014103_4150_4620 156
1014 3300048904 Ga0496101_0158638 Ga0496101_0158638_1020_1490 156
1015 3300048904 Ga0496101_0180244 Ga0496101_0180244_144_614 156
1016 3300048904 Ga0496101_0222451 Ga0496101_0222451_876_1346 156
1017 3300048904 Ga0496101_0400471 Ga0496101_0400471_171_641 156
1018 3300048904 Ga0496101_0529491 Ga0496101_0529491_58_528 156
1019 3300048904 Ga0496101_0746767 Ga0496101_0746767_141_611 156
1020 3300048904 Ga0496101_0781035 Ga0496101_0781035_210_680 156
1021 3300048904 Ga0496101_0861968 Ga0496101_0861968_170_640 156
1022 3300048904 Ga0496101_1278358 Ga0496101_1278358_29_499 156
1023 3300048905 Ga0496102_0003666 Ga0496102_0003666_4081_4551 156
1024 3300048905 Ga0496102_0021232 Ga0496102_0021232_89_559 156
1025 3300048905 Ga0496102_0037637 Ga0496102_0037637_2517_2987 156
1026 3300048905 Ga0496102_0054619 Ga0496102_0054619_2852_3355 156
1027 3300048905 Ga0496102_0086307 Ga0496102_0086307_21_491 156
1028 3300048905 Ga0496102_0142179 Ga0496102_0142179_926_1396 156
1029 3300048905 Ga0496102_0167272 Ga0496102_0167272_1133_1603 156
1030 3300048905 Ga0496102_0258273 Ga0496102_0258273_476_946 156
1031 3300048905 Ga0496102_0883914 Ga0496102_0883914_120_590 156
1032 3300048906 Ga0496103_0004549 Ga0496103_0004549_3589_4059 156
1033 3300048906 Ga0496103_0053968 Ga0496103_0053968_1887_2357 156
1034 3300048906 Ga0496103_0054499 Ga0496103_0054499_1154_1624 156
1035 3300048906 Ga0496103_0085750 Ga0496103_0085750_616_1086 156
1036 3300048906 Ga0496103_0137323 Ga0496103_0137323_937_1407 156
1037 3300048906 Ga0496103_0143434 Ga0496103_0143434_739_1209 156
1038 3300048906 Ga0496103_0176728 Ga0496103_0176728_462_932 156
1039 3300048906 Ga0496103_0886414 Ga0496103_0886414_32_502 156
1040 3300048907 Ga0496104_0000216 Ga0496104_0000216_36831_37301 156
1041 3300048907 Ga0496104_0002392 Ga0496104_0002392_11424_11894 156
1042 3300048907 Ga0496104_0011428 Ga0496104_0011428_1549_2019 156
1043 3300048907 Ga0496104_0047709 Ga0496104_0047709_1492_1962 156
1044 3300048907 Ga0496104_0137839 Ga0496104_0137839_1004_1474 156
1045 3300048907 Ga0496104_0164226 Ga0496104_0164226_118_588 156
1046 3300048907 Ga0496104_0356915 Ga0496104_0356915_96_599 156
1047 3300048907 Ga0496104_0533539 Ga0496104_0533539_452_922 156
1048 3300048907 Ga0496104_0784088 Ga0496104_0784088_31_501 156
1049 3300048907 Ga0496104_1212750 Ga0496104_1212750_160_630 156
1050 3300048908 Ga0496105_0006833 Ga0496105_0006833_4220_4690 156
1051 3300048908 Ga0496105_0007408 Ga0496105_0007408_7814_8284 156
1052 3300048908 Ga0496105_0181573 Ga0496105_0181573_781_1251 156
1053 3300048908 Ga0496105_0195984 Ga0496105_0195984_754_1224 156
1054 3300048908 Ga0496105_0248773 Ga0496105_0248773_345_815 156
1055 3300048908 Ga0496105_0355062 Ga0496105_0355062_349_819 156
1056 3300048908 Ga0496105_0790024 Ga0496105_0790024_171_641 156
1057 3300048908 Ga0496105_1339131 Ga0496105_1339131_34_504 156
1058 3300048909 Ga0496106_0014032 Ga0496106_0014032_2869_3339 156
1059 3300048909 Ga0496106_0020151 Ga0496106_0020151_26_496 156
1060 3300048909 Ga0496106_0034165 Ga0496106_0034165_921_1391 156
1061 3300048909 Ga0496106_0153542 Ga0496106_0153542_1028_1498 156
1062 3300048909 Ga0496106_0203109 Ga0496106_0203109_241_711 156
1063 3300048909 Ga0496106_0213960 Ga0496106_0213960_360_830 156
1064 3300048909 Ga0496106_0503269 Ga0496106_0503269_123_593 156
1065 3300048909 Ga0496106_1330790 Ga0496106_1330790_59_529 156
1066 3300048910 Ga0496107_0002978 Ga0496107_0002978_2442_2912 156
1067 3300048910 Ga0496107_0051098 Ga0496107_0051098_896_1366 156
1068 3300048910 Ga0496107_0087501 Ga0496107_0087501_1419_1889 156
1069 3300048910 Ga0496107_0128296 Ga0496107_0128296_519_989 156
1070 3300048910 Ga0496107_0161717 Ga0496107_0161717_527_997 156
1071 3300048910 Ga0496107_0673999 Ga0496107_0673999_64_534 156
1072 3300048911 Ga0496108_0029327 Ga0496108_0029327_3746_4216 156
1073 3300048911 Ga0496108_0041617 Ga0496108_0041617_284_754 156
1074 3300048911 Ga0496108_0152896 Ga0496108_0152896_939_1409 156
1075 3300048911 Ga0496108_0217641 Ga0496108_0217641_308_778 156
1076 3300048911 Ga0496108_0286212 Ga0496108_0286212_666_1136 156
1077 3300048911 Ga0496108_0314137 Ga0496108_0314137_857_1327 156
1078 3300048911 Ga0496108_0752042 Ga0496108_0752042_56_526 156
1079 3300048911 Ga0496108_0895023 Ga0496108_0895023_248_718 156
1080 3300048911 Ga0496108_1160598 Ga0496108_1160598_115_585 156
1081 3300048912 Ga0496109_0005439 Ga0496109_0005439_5848_6318 156
1082 3300048912 Ga0496109_0019124 Ga0496109_0019124_119_589 156
1083 3300048912 Ga0496109_0030933 Ga0496109_0030933_1858_2328 156
1084 3300048912 Ga0496109_0046146 Ga0496109_0046146_991_1461 156
1085 3300048912 Ga0496109_0060268 Ga0496109_0060268_2855_3325 156
1086 3300048912 Ga0496109_0185742 Ga0496109_0185742_552_1022 156
1087 3300048912 Ga0496109_0226901 Ga0496109_0226901_353_823 156
1088 3300048912 Ga0496109_0381404 Ga0496109_0381404_320_790 156
1089 3300048913 Ga0496110_0007047 Ga0496110_0007047_4265_4735 156
1090 3300048913 Ga0496110_0024815 Ga0496110_0024815_2388_2858 156
1091 3300048913 Ga0496110_0033078 Ga0496110_0033078_2703_3173 156
1092 3300048913 Ga0496110_0035233 Ga0496110_0035233_1251_1721 156
1093 3300048913 Ga0496110_0080612 Ga0496110_0080612_120_590 156
1094 3300048913 Ga0496110_0092172 Ga0496110_0092172_994_1464 156
1095 3300048913 Ga0496110_0197312 Ga0496110_0197312_602_1072 156
1096 3300048913 Ga0496110_0397583 Ga0496110_0397583_88_558 156
1097 3300048913 Ga0496110_0474394 Ga0496110_0474394_163_666 156
1098 3300048914 Ga0496111_0000831 Ga0496111_0000831_5107_5577 156
1099 3300048914 Ga0496111_0021719 Ga0496111_0021719_2380_2850 156
1100 3300048914 Ga0496111_0036697 Ga0496111_0036697_761_1231 156
1101 3300048914 Ga0496111_0091964 Ga0496111_0091964_143_613 156
1102 3300048914 Ga0496111_0210073 Ga0496111_0210073_804_1274 156
1103 3300048914 Ga0496111_0335788 Ga0496111_0335788_249_719 156
1104 3300048915 Ga0496112_0013078 Ga0496112_0013078_6130_6600 156
1105 3300048915 Ga0496112_0046858 Ga0496112_0046858_2342_2812 156
1106 3300048915 Ga0496112_0054785 Ga0496112_0054785_3417_3887 156
1107 3300048915 Ga0496112_0064649 Ga0496112_0064649_2243_2713 156
1108 3300048915 Ga0496112_0068039 Ga0496112_0068039_658_1128 156
1109 3300048915 Ga0496112_0290465 Ga0496112_0290465_1100_1570 156
1110 3300048915 Ga0496112_0675044 Ga0496112_0675044_40_510 156
1111 3300048916 Ga0496113_0034328 Ga0496113_0034328_981_1451 156
1112 3300048916 Ga0496113_0067510 Ga0496113_0067510_983_1453 156
1113 3300048916 Ga0496113_0210369 Ga0496113_0210369_436_906 156
1114 3300048917 Ga0496114_0006659 Ga0496114_0006659_7518_7988 156
1115 3300048917 Ga0496114_0049973 Ga0496114_0049973_345_815 156
1116 3300048917 Ga0496114_0109813 Ga0496114_0109813_1843_2313 156
1117 3300048917 Ga0496114_0544702 Ga0496114_0544702_170_640 156
1118 3300048917 Ga0496114_0854744 Ga0496114_0854744_306_776 156
1119 3300048917 Ga0496114_1061057 Ga0496114_1061057_157_627 156
1120 3300048918 Ga0496115_0027506 Ga0496115_0027506_2496_2966 156
1121 3300048918 Ga0496115_0028276 Ga0496115_0028276_1282_1752 156
1122 3300048918 Ga0496115_0035138 Ga0496115_0035138_1082_1552 156
1123 3300048918 Ga0496115_0089669 Ga0496115_0089669_954_1424 156
1124 3300048918 Ga0496115_0108912 Ga0496115_0108912_1419_1889 156
1125 3300048918 Ga0496115_0213094 Ga0496115_0213094_235_705 156
1126 3300048918 Ga0496115_0300579 Ga0496115_0300579_161_631 156
1127 3300048918 Ga0496115_0572119 Ga0496115_0572119_10_480 156
1128 3300048918 Ga0496115_0921778 Ga0496115_0921778_79_549 156
1129 3300048925 Ga0496122_0002761 Ga0496122_0002761_21282_21752 156
1130 3300048926 Ga0496123_0002923 Ga0496123_0002923_2486_2956 156
1131 3300048927 Ga0496124_0104578 Ga0496124_0104578_520_990 156
1132 3300048927 Ga0496124_0155757 Ga0496124_0155757_1198_1668 156
1133 3300048927 Ga0496124_0174143 Ga0496124_0174143_881_1351 156
1134 3300048929 Ga0496126_0229728 Ga0496126_0229728_378_848 156
1135 3300048929 Ga0496126_0723637 Ga0496126_0723637_285_755 156
1136 3300048929 Ga0496126_0739606 Ga0496126_0739606_167_637 156
1137 3300049128 Ga0501308_036951 Ga0501308_036951_178_663 156
1138 3300049568 Ga0501031_0015742 Ga0501031_0015742_2641_3111 156
1139 3300049569 Ga0501032_0026968 Ga0501032_0026968_2141_2611 156
1140 3300049569 Ga0501032_0180814 Ga0501032_0180814_189_659 156
1141 3300049569 Ga0501032_0494865 Ga0501032_0494865_272_742 156
1142 3300049570 Ga0501033_0637546 Ga0501033_0637546_166_636 156
1143 3300049570 Ga0501033_0912419 Ga0501033_0912419_21_491 156
1144 3300049571 Ga0501034_0084509 Ga0501034_0084509_1028_1498 156
1145 3300049571 Ga0501034_0423062 Ga0501034_0423062_668_1138 156
1146 3300049572 Ga0501036_0011493 Ga0501036_0011493_6572_7042 156
1147 3300049572 Ga0501036_0509958 Ga0501036_0509958_104_574 156
1148 3300049572 Ga0501036_0962178 Ga0501036_0962178_55_525 156
1149 3300049573 Ga0501037_0368428 Ga0501037_0368428_388_858 156
1150 3300049573 Ga0501037_0454662 Ga0501037_0454662_383_853 156
1151 3300049573 Ga0501037_0508563 Ga0501037_0508563_129_599 156
1152 3300049573 Ga0501037_0722531 Ga0501037_0722531_131_601 156
1153 3300049574 Ga0501038_0040318 Ga0501038_0040318_2306_2776 156
1154 3300049574 Ga0501038_0043951 Ga0501038_0043951_1363_1833 156
1155 3300049574 Ga0501038_0244434 Ga0501038_0244434_149_619 156
1156 3300049574 Ga0501038_0377332 Ga0501038_0377332_264_734 156
1157 3300049575 Ga0501039_0102579 Ga0501039_0102579_347_817 156
1158 3300049575 Ga0501039_0298062 Ga0501039_0298062_415_885 156
1159 3300049575 Ga0501039_0458142 Ga0501039_0458142_407_877 156
1160 3300049575 Ga0501039_0488920 Ga0501039_0488920_475_945 156
1161 3300049575 Ga0501039_0791487 Ga0501039_0791487_161_631 156
1162 3300049576 Ga0501040_0028204 Ga0501040_0028204_1244_1714 156
1163 3300049576 Ga0501040_0131387 Ga0501040_0131387_734_1204 156
1164 3300049576 Ga0501040_0154989 Ga0501040_0154989_386_856 156
1165 3300049576 Ga0501040_0365950 Ga0501040_0365950_339_809 156
1166 3300049576 Ga0501040_0477028 Ga0501040_0477028_286_756 156
1167 3300049577 Ga0501041_0092487 Ga0501041_0092487_1355_1825 156
1168 3300049577 Ga0501041_0105027 Ga0501041_0105027_543_1013 156
1169 3300049577 Ga0501041_0117214 Ga0501041_0117214_325_795 156
1170 3300049577 Ga0501041_0126602 Ga0501041_0126602_475_945 156
1171 3300049577 Ga0501041_0180825 Ga0501041_0180825_800_1270 156
1172 3300049577 Ga0501041_0228652 Ga0501041_0228652_277_747 156
1173 3300049577 Ga0501041_0498414 Ga0501041_0498414_55_525 156
1174 3300049578 Ga0501042_0017762 Ga0501042_0017762_2631_3101 156
1175 3300049578 Ga0501042_0112951 Ga0501042_0112951_157_627 156
1176 3300049578 Ga0501042_0200366 Ga0501042_0200366_512_982 156
1177 3300049578 Ga0501042_0682073 Ga0501042_0682073_133_603 156
1178 3300049579 Ga0501043_0753919 Ga0501043_0753919_119_589 156
1179 3300049580 Ga0501046_0002625 Ga0501046_0002625_13980_14450 156
1180 3300049580 Ga0501046_0324190 Ga0501046_0324190_300_770 156
1181 3300049580 Ga0501046_0626781 Ga0501046_0626781_68_538 156
1182 3300049580 Ga0501046_0638158 Ga0501046_0638158_60_530 156
1183 3300049581 Ga0501047_0040402 Ga0501047_0040402_3794_4264 156
1184 3300049582 Ga0501048_0193045 Ga0501048_0193045_857_1327 156
1185 3300049582 Ga0501048_0396254 Ga0501048_0396254_365_835 156
1186 3300049582 Ga0501048_0456270 Ga0501048_0456270_316_786 156
1187 3300049582 Ga0501048_0469464 Ga0501048_0469464_11_481 156
1188 3300049583 Ga0501067_0056296 Ga0501067_0056296_639_1109 156
1189 3300049583 Ga0501067_0288344 Ga0501067_0288344_89_559 156
1190 3300049584 Ga0501068_0130935 Ga0501068_0130935_174_644 156
1191 3300049584 Ga0501068_0154445 Ga0501068_0154445_321_791 156
1192 3300049584 Ga0501068_0418936 Ga0501068_0418936_149_619 156
1193 3300049585 Ga0501069_0096618 Ga0501069_0096618_574_1044 156
1194 3300049585 Ga0501069_0356825 Ga0501069_0356825_22_492 156
1195 3300049585 Ga0501069_0537782 Ga0501069_0537782_30_500 156
1196 3300049586 Ga0501070_0067955 Ga0501070_0067955_1057_1527 156
1197 3300049586 Ga0501070_0518013 Ga0501070_0518013_141_611 156
1198 3300049587 Ga0501071_0024493 Ga0501071_0024493_2532_3002 156
1199 3300049587 Ga0501071_0032410 Ga0501071_0032410_1442_1912 156
1200 3300049587 Ga0501071_0092876 Ga0501071_0092876_715_1185 156
1201 3300049587 Ga0501071_0100192 Ga0501071_0100192_567_1037 156
1202 3300049587 Ga0501071_0845326 Ga0501071_0845326_38_508 156
1203 3300049587 Ga0501071_0946092 Ga0501071_0946092_109_579 156
1204 3300049588 Ga0501072_0007998 Ga0501072_0007998_4716_5186 156
1205 3300049588 Ga0501072_0051029 Ga0501072_0051029_273_743 156
1206 3300049588 Ga0501072_0177462 Ga0501072_0177462_1042_1512 156
1207 3300049588 Ga0501072_0220656 Ga0501072_0220656_67_537 156
1208 3300049588 Ga0501072_0303812 Ga0501072_0303812_180_650 156
1209 3300049588 Ga0501072_0793966 Ga0501072_0793966_13_483 156
1210 3300049589 Ga0501073_0003226 Ga0501073_0003226_9514_9984 156
1211 3300049589 Ga0501073_0034381 Ga0501073_0034381_1601_2071 156
1212 3300049589 Ga0501073_0224250 Ga0501073_0224250_288_758 156
1213 3300049589 Ga0501073_0226708 Ga0501073_0226708_613_1083 156
1214 3300049589 Ga0501073_0273992 Ga0501073_0273992_406_876 156
1215 3300049589 Ga0501073_0333103 Ga0501073_0333103_204_674 156
1216 3300049589 Ga0501073_0485092 Ga0501073_0485092_121_591 156
1217 3300049589 Ga0501073_0911896 Ga0501073_0911896_113_583 156
1218 3300049590 Ga0501074_0049751 Ga0501074_0049751_152_622 156
1219 3300049590 Ga0501074_0071636 Ga0501074_0071636_970_1440 156
1220 3300049590 Ga0501074_0152505 Ga0501074_0152505_419_889 156
1221 3300049590 Ga0501074_0697669 Ga0501074_0697669_189_659 156
1222 3300049591 Ga0501075_0069225 Ga0501075_0069225_1467_1937 156
1223 3300049591 Ga0501075_0118370 Ga0501075_0118370_1232_1702 156
1224 3300049591 Ga0501075_0139726 Ga0501075_0139726_82_552 156
1225 3300049591 Ga0501075_0193490 Ga0501075_0193490_589_1059 156
1226 3300049591 Ga0501075_0265147 Ga0501075_0265147_10_480 156
1227 3300049591 Ga0501075_0303252 Ga0501075_0303252_212_682 156
1228 3300049591 Ga0501075_0484004 Ga0501075_0484004_189_659 156
1229 3300049592 Ga0501076_0000421 Ga0501076_0000421_11543_12013 156
1230 3300049592 Ga0501076_0030475 Ga0501076_0030475_3201_3671 156
1231 3300049592 Ga0501076_0050061 Ga0501076_0050061_1037_1507 156
1232 3300049592 Ga0501076_0057669 Ga0501076_0057669_1859_2329 156
1233 3300049592 Ga0501076_0382244 Ga0501076_0382244_470_940 156
1234 3300049592 Ga0501076_0984771 Ga0501076_0984771_118_588 156
1235 3300049593 Ga0501077_0011663 Ga0501077_0011663_4728_5198 156
1236 3300049593 Ga0501077_0052806 Ga0501077_0052806_884_1354 156
1237 3300049593 Ga0501077_0065778 Ga0501077_0065778_1055_1525 156
1238 3300049593 Ga0501077_0117015 Ga0501077_0117015_783_1253 156
1239 3300049593 Ga0501077_0173814 Ga0501077_0173814_386_856 156
1240 3300049593 Ga0501077_0178839 Ga0501077_0178839_190_660 156
1241 3300049593 Ga0501077_0255735 Ga0501077_0255735_279_749 156
1242 3300049593 Ga0501077_0723721 Ga0501077_0723721_94_564 156
1243 3300049671 Ga0501238_002767 Ga0501238_002767_628_1098 156
1244 3300049741 Ga0501079_0015440 Ga0501079_0015440_533_1003 156
1245 3300049741 Ga0501079_0029982 Ga0501079_0029982_2170_2640 156
1246 3300049741 Ga0501079_0064992 Ga0501079_0064992_1270_1740 156
1247 3300049741 Ga0501079_0085340 Ga0501079_0085340_1937_2407 156
1248 3300049741 Ga0501079_0392322 Ga0501079_0392322_456_926 156
1249 3300049741 Ga0501079_0810015 Ga0501079_0810015_219_689 156
1250 3300049742 Ga0501080_0027369 Ga0501080_0027369_2916_3386 156
1251 3300049742 Ga0501080_0204600 Ga0501080_0204600_988_1458 156
1252 3300049742 Ga0501080_0347057 Ga0501080_0347057_182_652 156
1253 3300049742 Ga0501080_0488439 Ga0501080_0488439_75_545 156
1254 3300049742 Ga0501080_0658635 Ga0501080_0658635_337_807 156
1255 3300049743 Ga0501081_0003198 Ga0501081_0003198_3035_3505 156
1256 3300049743 Ga0501081_0040953 Ga0501081_0040953_919_1389 156
1257 3300049743 Ga0501081_0047963 Ga0501081_0047963_511_981 156
1258 3300049743 Ga0501081_0056768 Ga0501081_0056768_494_964 156
1259 3300049743 Ga0501081_0077134 Ga0501081_0077134_1790_2260 156
1260 3300049743 Ga0501081_0095052 Ga0501081_0095052_172_642 156
1261 3300049743 Ga0501081_0172437 Ga0501081_0172437_39_509 156
1262 3300049743 Ga0501081_0296293 Ga0501081_0296293_508_978 156
1263 3300049743 Ga0501081_0644853 Ga0501081_0644853_31_501 156
1264 3300049743 Ga0501081_1009083 Ga0501081_1009083_120_590 156
1265 3300049743 Ga0501081_1094349 Ga0501081_1094349_39_509 156
1266 3300049744 Ga0501083_0031587 Ga0501083_0031587_1084_1554 156
1267 3300049744 Ga0501083_0102047 Ga0501083_0102047_162_632 156
1268 3300049744 Ga0501083_0154544 Ga0501083_0154544_479_949 156
1269 3300049744 Ga0501083_0205601 Ga0501083_0205601_722_1192 156
1270 3300049766 Ga0501269_020609 Ga0501269_020609_203_673 156
1271 3300049822 Ga0501035_0189930 Ga0501035_0189930_272_742 156
1272 3300049822 Ga0501035_0543506 Ga0501035_0543506_308_778 156
1273 3300049822 Ga0501035_0898209 Ga0501035_0898209_109_579 156
1274 3300049823 Ga0501044_0012400 Ga0501044_0012400_7193_7663 156
1275 3300049824 Ga0501045_0013725 Ga0501045_0013725_5137_5607 156
1276 3300049824 Ga0501045_0076359 Ga0501045_0076359_514_984 156
1277 3300049824 Ga0501045_0243269 Ga0501045_0243269_171_641 156
1278 3300049824 Ga0501045_0528192 Ga0501045_0528192_267_737 156
1279 3300049824 Ga0501045_0964782 Ga0501045_0964782_53_523 156
1280 3300049824 Ga0501045_1337924 Ga0501045_1337924_40_510 156
1281 3300050490 nmdc:mga03n38_26789_c1 nmdc:mga03n38_26789_c1_77_547 156
1282 3300050490 nmdc:mga03n38_94395_c1 nmdc:mga03n38_94395_c1_223_693 156
1283 3300050491 nmdc:mga00v17_114995_c1 nmdc:mga00v17_114995_c1_1110_1580 156
1284 3300050491 nmdc:mga00v17_166581_c1 nmdc:mga00v17_166581_c1_331_801 156
1285 3300050492 nmdc:mga0yw44_4728_c1 nmdc:mga0yw44_4728_c1_3619_4089 156
1286 3300050492 nmdc:mga0yw44_608088_c1 nmdc:mga0yw44_608088_c1_254_724 156
1287 3300050493 nmdc:mga0k408_197363_c1 nmdc:mga0k408_197363_c1_463_933 156
1288 3300050494 nmdc:mga06z11_23902_c1 nmdc:mga06z11_23902_c1_2286_2756 156
1289 3300050494 nmdc:mga06z11_284143_c1 nmdc:mga06z11_284143_c1_23_493 156
1290 3300050494 nmdc:mga06z11_33224_c1 nmdc:mga06z11_33224_c1_350_820 156
1291 3300050495 nmdc:mga04h51_18257_c1 nmdc:mga04h51_18257_c1_1511_1981 156
1292 3300050495 nmdc:mga04h51_1973_c1 nmdc:mga04h51_1973_c1_908_1378 156
1293 3300050495 nmdc:mga04h51_23062_c1 nmdc:mga04h51_23062_c1_1259_1729 156
1294 3300050496 nmdc:mga07m45_360574_c1 nmdc:mga07m45_360574_c1_58_528 156
1295 3300050507 nmdc:mga05p37_1470845_c1 nmdc:mga05p37_1470845_c1_169_639 156
1296 3300050507 nmdc:mga05p37_159475_c1 nmdc:mga05p37_159475_c1_1115_1585 156
1297 3300050507 nmdc:mga05p37_27138_c1 nmdc:mga05p37_27138_c1_808_1278 156
1298 3300050507 nmdc:mga05p37_301565_c1 nmdc:mga05p37_301565_c1_1204_1674 156
1299 3300050507 nmdc:mga05p37_49398_c1 nmdc:mga05p37_49398_c1_1042_1512 156
1300 3300050507 nmdc:mga05p37_878206_c1 nmdc:mga05p37_878206_c1_295_765 156
1301 3300050508 nmdc:mga09592_219384_c1 nmdc:mga09592_219384_c1_96_566 156
1302 3300050508 nmdc:mga09592_694129_c1 nmdc:mga09592_694129_c1_155_625 156
1303 3300050509 nmdc:mga0qj67_170797_c1 nmdc:mga0qj67_170797_c1_557_1027 156
1304 3300050509 nmdc:mga0qj67_224050_c1 nmdc:mga0qj67_224050_c1_190_660 156
1305 3300050509 nmdc:mga0qj67_43677_c1 nmdc:mga0qj67_43677_c1_2311_2781 156
1306 3300050510 nmdc:mga06r32_207621_c1 nmdc:mga06r32_207621_c1_1414_1884 156
1307 3300050510 nmdc:mga06r32_209769_c1 nmdc:mga06r32_209769_c1_516_986 156
1308 3300050510 nmdc:mga06r32_2831_c1 nmdc:mga06r32_2831_c1_918_1388 156
1309 3300050510 nmdc:mga06r32_45743_c1 nmdc:mga06r32_45743_c1_1479_1949 156
1310 3300050511 nmdc:mga08y16_1006887_c1 nmdc:mga08y16_1006887_c1_287_757 156
1311 3300050511 nmdc:mga08y16_354098_c1 nmdc:mga08y16_354098_c1_514_984 156
1312 3300050511 nmdc:mga08y16_479248_c1 nmdc:mga08y16_479248_c1_79_549 156
1313 3300050511 nmdc:mga08y16_51471_c1 nmdc:mga08y16_51471_c1_1998_2468 156
1314 3300050511 nmdc:mga08y16_560714_c1 nmdc:mga08y16_560714_c1_295_765 156
1315 3300050511 nmdc:mga08y16_79584_c1 nmdc:mga08y16_79584_c1_1445_1915 156
1316 3300050512 nmdc:mga0n895_1137071_c1 nmdc:mga0n895_1137071_c1_129_599 156
1317 3300050512 nmdc:mga0n895_1205724_c1 nmdc:mga0n895_1205724_c1_159_629 156
1318 3300050512 nmdc:mga0n895_200439_c1 nmdc:mga0n895_200439_c1_1042_1512 156
1319 3300050512 nmdc:mga0n895_28374_c1 nmdc:mga0n895_28374_c1_527_997 156
1320 3300050512 nmdc:mga0n895_30261_c1 nmdc:mga0n895_30261_c1_2279_2749 156
1321 3300050513 nmdc:mga0rr50_13958_c1 nmdc:mga0rr50_13958_c1_2273_2743 156
1322 3300050513 nmdc:mga0rr50_173912_c1 nmdc:mga0rr50_173912_c1_385_855 156
1323 3300050513 nmdc:mga0rr50_6581_c1 nmdc:mga0rr50_6581_c1_6117_6587 156
1324 3300050514 nmdc:mga08x19_58182_c1 nmdc:mga08x19_58182_c1_1035_1505 156
1325 3300050515 nmdc:mga0a205_17244_c1 nmdc:mga0a205_17244_c1_4413_4883 156
1326 3300050515 nmdc:mga0a205_22301_c1 nmdc:mga0a205_22301_c1_2672_3142 156
1327 3300050515 nmdc:mga0a205_377889_c1 nmdc:mga0a205_377889_c1_550_1020 156
1328 3300050515 nmdc:mga0a205_38046_c1 nmdc:mga0a205_38046_c1_347_817 156
1329 3300050515 nmdc:mga0a205_56983_c1 nmdc:mga0a205_56983_c1_2278_2748 156
1330 3300050515 nmdc:mga0a205_74311_c1 nmdc:mga0a205_74311_c1_1687_2157 156
1331 3300053077 Ga0495601_0015804 Ga0495601_0015804_1307_1777 156
1332 3300053077 Ga0495601_0033953 Ga0495601_0033953_750_1220 156
1333 3300053077 Ga0495601_0702920 Ga0495601_0702920_59_529 156
1334 3300053078 Ga0495612_0039940 Ga0495612_0039940_552_1022 156
1335 3300053083 Ga0495655_0000679 Ga0495655_0000679_4614_5084 156
1336 3300053083 Ga0495655_0028926 Ga0495655_0028926_701_1171 156
1337 3300053084 Ga0495595_0123678 Ga0495595_0123678_759_1229 156
1338 3300053084 Ga0495595_0430932 Ga0495595_0430932_32_502 156
1339 3300053085 Ga0495619_0003085 Ga0495619_0003085_7958_8428 156
1340 3300053085 Ga0495619_0040299 Ga0495619_0040299_1422_1892 156
1341 3300053085 Ga0495619_0047711 Ga0495619_0047711_1566_2036 156
1342 3300053085 Ga0495619_0412724 Ga0495619_0412724_73_543 156
1343 3300053085 Ga0495619_0561373 Ga0495619_0561373_10_480 156
1344 3300053088 Ga0500644_0230434 Ga0500644_0230434_88_558 156
1345 3300053090 Ga0500646_0271481 Ga0500646_0271481_67_537 156
1346 3300053092 Ga0500583_0267577 Ga0500583_0267577_291_761 156
1347 3300053093 Ga0500651_0633458 Ga0500651_0633458_74_544 156
1348 3300053096 Ga0500641_0136250 Ga0500641_0136250_67_537 156
1349 3300053096 Ga0500641_0230867 Ga0500641_0230867_284_754 156
1350 3300053098 Ga0500650_0065747 Ga0500650_0065747_197_667 156
1351 3300053098 Ga0500650_0271518 Ga0500650_0271518_111_581 156
1352 3300053103 Ga0500555_005793 Ga0500555_005793_2935_3405 156
1353 3300053104 Ga0500556_0001703 Ga0500556_0001703_1744_2214 156
1354 3300053104 Ga0500556_0176632 Ga0500556_0176632_11_481 156
1355 3300053108 Ga0500562_015287 Ga0500562_015287_173_643 156
1356 3300053125 Ga0500618_005553 Ga0500618_005553_1267_1737 156
1357 3300053125 Ga0500618_016257 Ga0500618_016257_197_667 156
1358 3300053131 Ga0500652_159728 Ga0500652_159728_99_569 156
1359 3300053153 Ga0500616_0006596 Ga0500616_0006596_6084_6554 156
1360 3300053153 Ga0500616_0009861 Ga0500616_0009861_2410_2880 156
1361 3300053153 Ga0500616_0023836 Ga0500616_0023836_472_942 156
1362 3300053153 Ga0500616_0155080 Ga0500616_0155080_276_746 156
1363 3300053730 Ga0500645_037607 Ga0500645_037607_165_635 156
1364 3300054114 Ga0501084_0004756 Ga0501084_0004756_3228_3698 156
1365 3300054114 Ga0501084_0060676 Ga0501084_0060676_1678_2148 156
1366 3300054114 Ga0501084_0164633 Ga0501084_0164633_272_742 156
1367 3300054114 Ga0501084_0288349 Ga0501084_0288349_771_1241 156
1368 3300054114 Ga0501084_0390430 Ga0501084_0390430_58_528 156
1369 3300054114 Ga0501084_0834579 Ga0501084_0834579_160_630 156
1370 3300059641 Ga0587068_011988 Ga0587068_011988_263_733 156
1371 3300060346 Ga0587111_0006178 Ga0587111_0006178_656_1126 156
1372 3300060353 Ga0501082_0024683 Ga0501082_0024683_2430_2900 156
1373 3300060353 Ga0501082_0026929 Ga0501082_0026929_2594_3064 156
1374 3300060353 Ga0501082_0027843 Ga0501082_0027843_1021_1491 156
1375 3300060353 Ga0501082_0061171 Ga0501082_0061171_1322_1792 156
1376 3300060353 Ga0501082_0181067 Ga0501082_0181067_135_605 156
1377 3300060353 Ga0501082_0302697 Ga0501082_0302697_226_696 156
1378 3300060353 Ga0501082_0350329 Ga0501082_0350329_666_1136 156
1379 3300060353 Ga0501082_0424543 Ga0501082_0424543_416_886 156
1380 3300060353 Ga0501082_0573731 Ga0501082_0573731_327_797 156
1381 3300060353 Ga0501082_0896486 Ga0501082_0896486_244_714 156
1382 3300060353 Ga0501082_0978755 Ga0501082_0978755_140_610 156
1383 3300060353 Ga0501082_1034502 Ga0501082_1034502_80_550 156
1384 3300060353 Ga0501082_1193922 Ga0501082_1193922_171_641 156
1385 3300060353 Ga0501082_1509349 Ga0501082_1509349_100_570 156
1386 3300061734 Ga0530510_0015060 Ga0530510_0015060_421_891 156
1387 3300061734 Ga0530510_0033570 Ga0530510_0033570_3198_3668 156
1388 3300061734 Ga0530510_0041216 Ga0530510_0041216_1204_1674 156
1389 3300061734 Ga0530510_0332355 Ga0530510_0332355_416_886 156
1390 3300061734 Ga0530510_0349592 Ga0530510_0349592_53_523 156
1391 3300061734 Ga0530510_0484071 Ga0530510_0484071_306_776 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

1

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (state ii) 0.9939 22 127
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9819 12 152
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9808 12 152
7p7u-assembly1.cif.gz_h e. faecalis 70s ribosome with p-trna, state iv 0.9765 6 154
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.975 12 152
ID Description Score Start End Superfamily
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9726 6 152 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9638 10 148 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9632 3 156 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9601 2 155 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9568 10 148 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.9976 12 149 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.9904 12 149 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2N6U8M5-F1-model_v4 deleted 0.9872 12 126
AF-A0A3S1UAE0-F1-model_v4 30S ribosomal protein S7 0.9861 34 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2J0MZE0-F1-model_v4 Small ribosomal subunit protein uS7 0.9839 11 153 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
92.56 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map