F493592

General Info

Members Datasets Scaffolds Average Seq Length
1391 391 1391 222

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10483620|Ga0207646_104836202
Length 252
Sequence VVAAAARRGLHALRAVSAIISAVDSTGRRHLPLPASAAVAAVLLTAALALIAFYVPTDADQGLSQKIFYFHVPIALTAYACFGWGAWKALRVLWKRDQRADLESYVSIHLGVIFGALTLVTGSIWARASWGVWWAWQSRQLVLFLVLFLFYCAYFMLRFSVEPGPRRANLSAVYAIFGVVLIPISFLAIRLAEDFIHPTVFTEHGPQMAGSMFFTFCVSWAAMLATAHALYRIELTGKRIDARLRELRELLA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
115 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
364 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
365 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 8.27
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003188 3300000041 Unclassified 1467
2 ARcpr5yngRDRAFT_c003832 3300000043 Unclassified 1449
3 ARSoilOldRDRAFT_c004433 3300000044 Unclassified 1191
4 ARCol0yngRDRAFT_1002248 3300000652 Unclassified 1476
5 JGI24743J22301_10005676 3300001991 Bacteria 2093
6 JGI24738J21930_10001833 3300002075 Bacteria 5759
7 JGI24751J29686_10013783 3300002459 Bacteria 1669
8 JGI25406J46586_10013135 3300003203 Bacteria 3570
9 JGI25406J46586_10082648 3300003203 Bacteria 982
10 JGI25407J50210_10034210 3300003373 Bacteria 1310
11 JGI25407J50210_10058135 3300003373 Bacteria 974
12 Ga0070658_10002943 3300005327 Bacteria 14120
13 Ga0070658_10009777 3300005327 Bacteria 7702
14 Ga0070658_10032354 3300005327 Bacteria 4205
15 Ga0070658_10073794 3300005327 Bacteria 2798
16 Ga0070658_10210622 3300005327 Bacteria 1642
17 Ga0070676_10282728 3300005328 Bacteria 1118
18 Ga0070676_10338060 3300005328 Unclassified 1032
19 Ga0070683_100006766 3300005329 Bacteria 9633
20 Ga0070683_100012195 3300005329 Bacteria 7461
21 Ga0070683_100027412 3300005329 Archaea 5138
22 Ga0070683_100033341 3300005329 Bacteria 4696
23 Ga0070683_100043826 3300005329 Unclassified 4124
24 Ga0070683_100152146 3300005329 Bacteria 2193
25 Ga0070683_100283720 3300005329 Bacteria 1575
26 Ga0070690_100163101 3300005330 Bacteria 1529
27 Ga0070670_100005794 3300005331 Bacteria 10439
28 Ga0070670_100054160 3300005331 Bacteria 3443
29 Ga0068869_100182580 3300005334 Bacteria 1645
30 Ga0068869_100191614 3300005334 Unclassified 1608
31 Ga0068869_100315373 3300005334 Bacteria 1267
32 Ga0070680_100001631 3300005336 Bacteria 16396
33 Ga0070680_100040799 3300005336 Bacteria 3761
34 Ga0070682_100001656 3300005337 Bacteria 12392
35 Ga0070682_100056257 3300005337 Bacteria 2473
36 Ga0070682_100240416 3300005337 Bacteria 1299
37 Ga0068868_100217082 3300005338 Bacteria 1600
38 Ga0070660_100001098 3300005339 Bacteria 18183
39 Ga0070660_100005732 3300005339 Bacteria 8600
40 Ga0070660_100035321 3300005339 Bacteria 3783
41 Ga0070660_100082411 3300005339 Unclassified 2526
42 Ga0070660_100092427 3300005339 Bacteria 2388
43 Ga0070660_100203938 3300005339 Bacteria 1604
44 Ga0070660_100206536 3300005339 Bacteria 1594
45 Ga0070689_100172286 3300005340 Unclassified 1754
46 Ga0070689_100217114 3300005340 Bacteria 1567
47 Ga0070691_10031993 3300005341 Bacteria 2470
48 Ga0070691_10077050 3300005341 Unclassified 1627
49 Ga0070691_10092069 3300005341 Bacteria 1496
50 Ga0070687_100029265 3300005343 Bacteria 2680
51 Ga0070687_100084705 3300005343 Bacteria 1738
52 Ga0070661_100045182 3300005344 Bacteria 3219
53 Ga0070661_100105277 3300005344 Bacteria 2102
54 Ga0070661_100229993 3300005344 Bacteria 1425
55 Ga0070661_100303446 3300005344 Unclassified 1243
56 Ga0070661_100442981 3300005344 Bacteria 1032
57 Ga0070668_100057446 3300005347 Bacteria 3007
58 Ga0070668_100084083 3300005347 Bacteria 2499
59 Ga0070668_100107489 3300005347 Bacteria 2218
60 Ga0070668_100333639 3300005347 Bacteria 1280
61 Ga0070669_100099402 3300005353 Unclassified 2193
62 Ga0070669_100176320 3300005353 Bacteria 1669
63 Ga0070675_100023222 3300005354 Bacteria 4956
64 Ga0070675_100084877 3300005354 Bacteria 2644
65 Ga0070675_100090968 3300005354 Unclassified 2556
66 Ga0070675_100153587 3300005354 Bacteria 1975
67 Ga0070671_100173488 3300005355 Unclassified 1824
68 Ga0070671_100262769 3300005355 Bacteria 1467
69 Ga0070671_100295114 3300005355 Bacteria 1380
70 Ga0070671_100439701 3300005355 Bacteria 1118
71 Ga0070674_100002724 3300005356 Bacteria 9771
72 Ga0070674_100007148 3300005356 Bacteria 6567
73 Ga0070674_100009851 3300005356 Bacteria 5746
74 Ga0070674_100055508 3300005356 Bacteria 2743
75 Ga0070674_100184491 3300005356 Bacteria 1600
76 Ga0070674_100197434 3300005356 Bacteria 1551
77 Ga0070674_100415540 3300005356 Unclassified 1102
78 Ga0070673_100022803 3300005364 Bacteria 4564
79 Ga0070673_100230662 3300005364 Bacteria 1606
80 Ga0070673_100265460 3300005364 Bacteria 1501
81 Ga0070688_100003445 3300005365 Bacteria 8137
82 Ga0070688_100053471 3300005365 Bacteria 2526
83 Ga0070659_100020596 3300005366 Bacteria 5013
84 Ga0070659_100033384 3300005366 Bacteria 3996
85 Ga0070659_100041480 3300005366 Bacteria 3597
86 Ga0070659_100089294 3300005366 Unclassified 2469
87 Ga0070659_100179025 3300005366 Bacteria 1739
88 Ga0070667_100002001 3300005367 Bacteria 18056
89 Ga0070703_10062258 3300005406 Bacteria 1224
90 Ga0070709_10486271 3300005434 Bacteria 935
91 Ga0070714_100070139 3300005435 Bacteria 3029
92 Ga0070714_100130942 3300005435 Bacteria 2242
93 Ga0070714_100395853 3300005435 Bacteria 1305
94 Ga0070713_100100872 3300005436 Bacteria 2500
95 Ga0070713_100125863 3300005436 Bacteria 2254
96 Ga0070713_100455766 3300005436 Bacteria 1202
97 Ga0070710_10074017 3300005437 Unclassified 1971
98 Ga0070710_10145208 3300005437 Bacteria 1458
99 Ga0070701_10008930 3300005438 Bacteria 4363
100 Ga0070701_10015349 3300005438 Bacteria 3536
101 Ga0070701_10036567 3300005438 Bacteria 2474
102 Ga0070711_100167216 3300005439 Bacteria 1673
103 Ga0070711_100287595 3300005439 Unclassified 1303
104 Ga0070705_100079149 3300005440 Bacteria 2012
105 Ga0070705_100143310 3300005440 Bacteria 1575
106 Ga0070700_100163839 3300005441 Bacteria 1533
107 Ga0070700_100196000 3300005441 Bacteria 1416
108 Ga0070694_100047908 3300005444 Bacteria 2873
109 Ga0070694_100378279 3300005444 Bacteria 1104
110 Ga0070708_100012455 3300005445 Bacteria 6942
111 Ga0070708_100056558 3300005445 Bacteria 3490
112 Ga0070708_100493461 3300005445 Unclassified 1155
113 Ga0070708_100548146 3300005445 Bacteria 1091
114 Ga0070678_100012016 3300005456 Bacteria 5365
115 Ga0070678_100024842 3300005456 Bacteria 4019
116 Ga0070678_100047190 3300005456 Bacteria 3094
117 Ga0070678_100141003 3300005456 Bacteria 1929
118 Ga0070662_100032975 3300005457 Bacteria 3644
119 Ga0070662_100390905 3300005457 Unclassified 1146
120 Ga0070681_10012775 3300005458 Bacteria 8333
121 Ga0070681_10016479 3300005458 Bacteria 7379
122 Ga0070681_10029608 3300005458 Bacteria 5498
123 Ga0070681_10036127 3300005458 Bacteria 4963
124 Ga0070681_10046981 3300005458 Bacteria 4316
125 Ga0070681_10462193 3300005458 Bacteria 1181
126 Ga0068867_100042330 3300005459 Bacteria 3331
127 Ga0068867_100107143 3300005459 Bacteria 2142
128 Ga0068867_100284653 3300005459 Unclassified 1357
129 Ga0068867_100480869 3300005459 Bacteria 1064
130 Ga0070685_10006816 3300005466 Bacteria 5832
131 Ga0070685_10067464 3300005466 Bacteria 2110
132 Ga0070685_10154284 3300005466 Bacteria 1458
133 Ga0070685_10217349 3300005466 Bacteria 1250
134 Ga0070706_100292541 3300005467 Unclassified 1520
135 Ga0070707_100375841 3300005468 Bacteria 1381
136 Ga0070698_100029853 3300005471 Bacteria 5656
137 Ga0070699_100386592 3300005518 Bacteria 1264
138 Ga0070679_100012420 3300005530 Bacteria 8138
139 Ga0070679_100013349 3300005530 Bacteria 7866
140 Ga0070679_100029390 3300005530 Bacteria 5422
141 Ga0070679_100177374 3300005530 Bacteria 2103
142 Ga0070684_100002408 3300005535 Bacteria 13784
143 Ga0070684_100019041 3300005535 Bacteria 5672
144 Ga0070684_100020894 3300005535 Bacteria 5434
145 Ga0070684_100030545 3300005535 Bacteria 4578
146 Ga0070684_100034834 3300005535 Bacteria 4306
147 Ga0070684_100161688 3300005535 Bacteria 2031
148 Ga0070684_100287010 3300005535 Unclassified 1508
149 Ga0068853_100169008 3300005539 Bacteria 1977
150 Ga0068853_100338089 3300005539 Bacteria 1398
151 Ga0070672_100095075 3300005543 Bacteria 2410
152 Ga0070672_100150410 3300005543 Bacteria 1925
153 Ga0070672_100384079 3300005543 Bacteria 1201
154 Ga0070686_100037595 3300005544 Bacteria 3003
155 Ga0070686_100104149 3300005544 Unclassified 1922
156 Ga0070695_100018857 3300005545 Bacteria 4193
157 Ga0070695_100165042 3300005545 Bacteria 1558
158 Ga0070696_100037333 3300005546 Bacteria 3352
159 Ga0070696_100376786 3300005546 Bacteria 1105
160 Ga0070693_100011997 3300005547 Bacteria 4376
161 Ga0070693_100100732 3300005547 Bacteria 1759
162 Ga0070693_100155346 3300005547 Bacteria 1452
163 Ga0070693_100162402 3300005547 Bacteria 1424
164 Ga0070693_100206466 3300005547 Bacteria 1279
165 Ga0070665_100013479 3300005548 Bacteria 8223
166 Ga0070665_100588118 3300005548 Bacteria 1126
167 Ga0070665_100860466 3300005548 Unclassified 920
168 Ga0070704_100015256 3300005549 Bacteria 4822
169 Ga0070704_100015833 3300005549 Bacteria 4748
170 Ga0070704_100295450 3300005549 Bacteria 1348
171 Ga0070704_100439873 3300005549 Bacteria 1120
172 Ga0070704_100533841 3300005549 Bacteria 1023
173 Ga0068855_100023527 3300005563 Bacteria 7376
174 Ga0068855_100028552 3300005563 Bacteria 6674
175 Ga0068855_100067743 3300005563 Bacteria 4157
176 Ga0068855_100115589 3300005563 Bacteria 3076
177 Ga0068855_100206313 3300005563 Unclassified 2211
178 Ga0068855_100208157 3300005563 Bacteria 2199
179 Ga0068855_100358543 3300005563 Bacteria 1605
180 Ga0068855_100422644 3300005563 Bacteria 1457
181 Ga0070664_100004408 3300005564 Bacteria 11304
182 Ga0070664_100135794 3300005564 Unclassified 2162
183 Ga0070664_100446061 3300005564 Bacteria 1187
184 Ga0070664_100614628 3300005564 Bacteria 1008
185 Ga0068857_100007742 3300005577 Bacteria 9254
186 Ga0068857_100025515 3300005577 Bacteria 5203
187 Ga0068857_100170212 3300005577 Bacteria 1980
188 Ga0068857_100338388 3300005577 Bacteria 1392
189 Ga0068857_100362960 3300005577 Bacteria 1343
190 Ga0068854_100013324 3300005578 Bacteria 5393
191 Ga0068854_100030195 3300005578 Bacteria 3758
192 Ga0068854_100399798 3300005578 Bacteria 1137
193 Ga0068854_100869055 3300005578 Bacteria 790
194 Ga0068856_100025756 3300005614 Bacteria 5736
195 Ga0068856_100227960 3300005614 Unclassified 1879
196 Ga0068856_100483205 3300005614 Unclassified 1260
197 Ga0070702_100018988 3300005615 Bacteria 3576
198 Ga0070702_100082975 3300005615 Bacteria 1924
199 Ga0070702_100105817 3300005615 Bacteria 1734
200 Ga0070702_100127111 3300005615 Bacteria 1605
201 Ga0068852_100027238 3300005616 Bacteria 4657
202 Ga0068852_100047747 3300005616 Bacteria 3655
203 Ga0068852_100366177 3300005616 Unclassified 1411
204 Ga0068852_100492650 3300005616 Bacteria 1219
205 Ga0068852_100555689 3300005616 Unclassified 1149
206 Ga0068852_100684370 3300005616 Unclassified 1035
207 Ga0068859_100082634 3300005617 Bacteria 3255
208 Ga0068859_100148629 3300005617 Bacteria 2418
209 Ga0068864_100014941 3300005618 Bacteria 6452
210 Ga0068864_100187173 3300005618 Bacteria 1896
211 Ga0068864_100211114 3300005618 Bacteria 1787
212 Ga0068861_100046962 3300005719 Bacteria 3257
213 Ga0068861_100285535 3300005719 Unclassified 1423
214 Ga0068861_101122433 3300005719 Unclassified 757
215 Ga0068851_10122852 3300005834 Bacteria 1397
216 Ga0068870_10036786 3300005840 Bacteria 2519
217 Ga0068870_10071379 3300005840 Unclassified 1895
218 Ga0068870_10098302 3300005840 Bacteria 1649
219 Ga0068863_100193147 3300005841 Bacteria 1957
220 Ga0068860_100069232 3300005843 Bacteria 3354
221 Ga0068860_100107820 3300005843 Bacteria 2662
222 Ga0068862_100204699 3300005844 Unclassified 1781
223 Ga0068862_100509024 3300005844 Unclassified 1144
224 Ga0081455_10004421 3300005937 Bacteria 15777
225 Ga0081455_10021846 3300005937 Bacteria 5994
226 Ga0081455_10025482 3300005937 Bacteria 5457
227 Ga0081455_10046334 3300005937 Bacteria 3773
228 Ga0081455_10115009 3300005937 Bacteria 2130
229 Ga0081455_10115983 3300005937 Bacteria 2119
230 Ga0081455_10163130 3300005937 Bacteria 1706
231 Ga0081455_10166101 3300005937 Bacteria 1686
232 Ga0081455_10189361 3300005937 Unclassified 1551
233 Ga0081538_10000053 3300005981 Bacteria 109213
234 Ga0081538_10000218 3300005981 Bacteria 64601
235 Ga0081538_10000755 3300005981 Bacteria 35288
236 Ga0081538_10005147 3300005981 Bacteria 11853
237 Ga0081538_10018080 3300005981 Bacteria 5318
238 Ga0081538_10018620 3300005981 Bacteria 5203
239 Ga0081540_1005622 3300005983 Bacteria 9335
240 Ga0081540_1017275 3300005983 Bacteria 4473
241 Ga0081539_10001005 3300005985 Bacteria 52334
242 Ga0081539_10003144 3300005985 Bacteria 20994
243 Ga0081539_10004886 3300005985 Bacteria 14304
244 Ga0081539_10081320 3300005985 Bacteria 1702
245 Ga0070717_10263363 3300006028 Bacteria 1526
246 Ga0075365_10055904 3300006038 Bacteria 2622
247 Ga0075432_10009183 3300006058 Bacteria 3368
248 Ga0070715_10005089 3300006163 Bacteria 4362
249 Ga0070715_10017065 3300006163 Bacteria 2741
250 Ga0070716_100039814 3300006173 Bacteria 2611
251 Ga0070716_100228956 3300006173 Bacteria 1253
252 Ga0070712_100021567 3300006175 Bacteria 4232
253 Ga0070712_100042000 3300006175 Bacteria 3143
254 Ga0070712_100155349 3300006175 Unclassified 1761
255 Ga0070712_100178092 3300006175 Unclassified 1655
256 Ga0070712_100294839 3300006175 Unclassified 1311
257 Ga0097621_100114346 3300006237 Unclassified 2283
258 Ga0097621_100133310 3300006237 Bacteria 2116
259 Ga0068871_100009498 3300006358 Bacteria 7052
260 Ga0068871_100174376 3300006358 Bacteria 1845
261 Ga0068871_100659454 3300006358 Bacteria 956
262 Ga0075428_100002460 3300006844 Bacteria 20102
263 Ga0075428_100005053 3300006844 Bacteria 14668
264 Ga0075428_100080483 3300006844 Bacteria 3555
265 Ga0075428_100114666 3300006844 Bacteria 2935
266 Ga0075428_100234143 3300006844 Bacteria 1982
267 Ga0075430_100071037 3300006846 Bacteria 2920
268 Ga0075430_100132968 3300006846 Bacteria 2073
269 Ga0075431_100736708 3300006847 Unclassified 962
270 Ga0075433_10009414 3300006852 Bacteria 7807
271 Ga0075433_10052274 3300006852 Archaea 3559
272 Ga0075433_10346277 3300006852 Bacteria 1313
273 Ga0075434_100288348 3300006871 Bacteria 1661
274 Ga0075429_100008378 3300006880 Bacteria 9000
275 Ga0075429_100036160 3300006880 Bacteria 4294
276 Ga0075429_100169259 3300006880 Bacteria 1914
277 Ga0068865_100013958 3300006881 Bacteria 5095
278 Ga0068865_100024625 3300006881 Bacteria 3951
279 Ga0068865_100051004 3300006881 Bacteria 2862
280 Ga0075436_100268032 3300006914 Bacteria 1219
281 Ga0075436_100298661 3300006914 Bacteria 1154
282 Ga0097620_100082635 3300006931 Bacteria 3255
283 Ga0097620_100148637 3300006931 Bacteria 2418
284 Ga0075435_100128718 3300007076 Archaea 2117
285 Ga0075435_100480733 3300007076 Bacteria 1073
286 Ga0105240_10150029 3300009093 Unclassified 2778
287 Ga0105240_10151735 3300009093 Bacteria 2759
288 Ga0105240_10355163 3300009093 Bacteria 1662
289 Ga0105240_10406298 3300009093 Bacteria 1533
290 Ga0111539_10003095 3300009094 Bacteria 22053
291 Ga0111539_10003648 3300009094 Bacteria 20271
292 Ga0111539_10030994 3300009094 Bacteria 6497
293 Ga0111539_10033642 3300009094 Bacteria 6223
294 Ga0111539_10041021 3300009094 Bacteria 5568
295 Ga0111539_10126644 3300009094 Bacteria 2992
296 Ga0111539_10286871 3300009094 Bacteria 1915
297 Ga0111539_10535509 3300009094 Bacteria 1364
298 Ga0105245_10052550 3300009098 Bacteria 3654
299 Ga0105245_10086893 3300009098 Bacteria 2869
300 Ga0105245_10128026 3300009098 Unclassified 2379
301 Ga0105245_10200719 3300009098 Bacteria 1915
302 Ga0105245_10363411 3300009098 Bacteria 1437
303 Ga0105245_10490642 3300009098 Bacteria 1243
304 Ga0105247_10145025 3300009101 Bacteria 1559
305 Ga0105247_10404747 3300009101 Bacteria 973
306 Ga0114129_10003789 3300009147 Bacteria 21316
307 Ga0114129_10003813 3300009147 Bacteria 21253
308 Ga0114129_10088100 3300009147 Bacteria 4304
309 Ga0114129_10098466 3300009147 Bacteria 4047
310 Ga0114129_10148778 3300009147 Bacteria 3205
311 Ga0114129_10420980 3300009147 Bacteria 1757
312 Ga0114129_10624218 3300009147 Bacteria 1394
313 Ga0114129_10959911 3300009147 Unclassified 1079
314 Ga0114129_11414663 3300009147 Bacteria 858
315 Ga0105243_10003343 3300009148 Bacteria 13014
316 Ga0105243_10056476 3300009148 Bacteria 3122
317 Ga0105243_10102453 3300009148 Bacteria 2379
318 Ga0105243_10110898 3300009148 Bacteria 2295
319 Ga0105243_10329942 3300009148 Bacteria 1393
320 Ga0105243_10468365 3300009148 Bacteria 1186
321 Ga0105241_10354024 3300009174 Bacteria 1276
322 Ga0105242_10028215 3300009176 Bacteria 4466
323 Ga0105242_10047409 3300009176 Bacteria 3488
324 Ga0105242_10070870 3300009176 Bacteria 2891
325 Ga0105242_10084615 3300009176 Bacteria 2658
326 Ga0105242_10335384 3300009176 Bacteria 1392
327 Ga0105242_10365697 3300009176 Unclassified 1336
328 Ga0105248_10081493 3300009177 Bacteria 3637
329 Ga0105248_10265992 3300009177 Bacteria 1930
330 Ga0105248_10697499 3300009177 Bacteria 1145
331 Ga0105237_10206395 3300009545 Bacteria 1965
332 Ga0105237_10279610 3300009545 Bacteria 1672
333 Ga0105237_10731463 3300009545 Unclassified 996
334 Ga0105238_10344176 3300009551 Bacteria 1479
335 Ga0105249_10077142 3300009553 Bacteria 3090
336 Ga0105249_10432403 3300009553 Bacteria 1352
337 Ga0105249_10666508 3300009553 Bacteria 1099
338 Ga0105249_10839255 3300009553 Unclassified 984
339 Ga0105239_10012359 3300010375 Bacteria 9508
340 Ga0105239_10060646 3300010375 Bacteria 4152
341 Ga0105239_10156767 3300010375 Bacteria 2543
342 Ga0105239_10218440 3300010375 Bacteria 2137
343 Ga0105239_10352233 3300010375 Bacteria 1662
344 Ga0105246_10012229 3300011119 Bacteria 5350
345 Ga0105246_10055089 3300011119 Bacteria 2743
346 Ga0105246_10129907 3300011119 Bacteria 1880
347 Ga0105246_10141948 3300011119 Unclassified 1807
348 Ga0105246_10207489 3300011119 Bacteria 1527
349 Ga0105246_10225978 3300011119 Bacteria 1470
350 Ga0105246_10453979 3300011119 Bacteria 1078
351 Ga0105246_10608486 3300011119 Bacteria 945
352 Ga0105246_10696606 3300011119 Unclassified 890
353 Ga0157343_1001301 3300012488 Unclassified 1196
354 Ga0157341_1005889 3300012494 Unclassified 933
355 Ga0157373_10059735 3300013100 Bacteria 2702
356 Ga0157373_10135538 3300013100 Bacteria 1731
357 Ga0157371_10008600 3300013102 Bacteria 8109
358 Ga0157371_10090251 3300013102 Bacteria 2171
359 Ga0157371_10108986 3300013102 Bacteria 1965
360 Ga0157371_10185800 3300013102 Bacteria 1487
361 Ga0157370_10015040 3300013104 Bacteria 7888
362 Ga0157370_10022920 3300013104 Bacteria 6207
363 Ga0157370_10052000 3300013104 Bacteria 3912
364 Ga0157370_10058868 3300013104 Bacteria 3651
365 Ga0157369_10002470 3300013105 Bacteria 22156
366 Ga0157369_10035760 3300013105 Bacteria 5445
367 Ga0157369_10047041 3300013105 Bacteria 4686
368 Ga0157369_10067560 3300013105 Bacteria 3842
369 Ga0157369_10351166 3300013105 Bacteria 1532
370 Ga0157369_10384972 3300013105 Bacteria 1456
371 Ga0157374_10008652 3300013296 Bacteria 8712
372 Ga0157378_10151034 3300013297 Bacteria 2164
373 Ga0157378_10292743 3300013297 Bacteria 1573
374 Ga0157378_10774555 3300013297 Bacteria 984
375 Ga0163162_10195742 3300013306 Bacteria 2150
376 Ga0157372_10100141 3300013307 Bacteria 3306
377 Ga0157372_10175964 3300013307 Bacteria 2477
378 Ga0157372_10480001 3300013307 Bacteria 1449
379 Ga0157375_10010798 3300013308 Bacteria 8046
380 Ga0157375_10055724 3300013308 Bacteria 3899
381 Ga0157375_10335992 3300013308 Bacteria 1676
382 Ga0157375_10423461 3300013308 Bacteria 1497
383 Ga0157375_10500167 3300013308 Bacteria 1380
384 Ga0157375_10960274 3300013308 Bacteria 996
385 Ga0157375_11376790 3300013308 Unclassified 831
386 Ga0163163_10146985 3300014325 Unclassified 2401
387 Ga0163163_10174889 3300014325 Bacteria 2193
388 Ga0163163_11089740 3300014325 Unclassified 862
389 Ga0157380_10005200 3300014326 Bacteria 9095
390 Ga0157380_10025787 3300014326 Unclassified 4460
391 Ga0157380_10133071 3300014326 Bacteria 2124
392 Ga0157380_10845755 3300014326 Bacteria 936
393 Ga0182008_10031835 3300014497 Bacteria 2652
394 Ga0157377_10008074 3300014745 Bacteria 5120
395 Ga0157379_10382783 3300014968 Bacteria 1291
396 Ga0157379_10643943 3300014968 Bacteria 992
397 Ga0157376_10100708 3300014969 Bacteria 2523
398 Ga0157376_10116142 3300014969 Bacteria 2364
399 Ga0157376_10287110 3300014969 Bacteria 1552
400 Ga0157376_10336839 3300014969 Unclassified 1439
401 Ga0157376_10365130 3300014969 Bacteria 1386
402 Ga0157376_10401962 3300014969 Bacteria 1325
403 Ga0157376_11102058 3300014969 Unclassified 820
404 Ga0163161_10327530 3300017792 Bacteria 1212
405 Ga0206356_10502231 3300020070 Unclassified 1052
406 Ga0206356_11887349 3300020070 Bacteria 1764
407 Ga0206354_11615480 3300020081 Bacteria 1091
408 Ga0206354_11680607 3300020081 Bacteria 2030
409 Ga0206353_10400033 3300020082 Bacteria 9806
410 Ga0206353_10869854 3300020082 Bacteria 5355
411 Ga0206353_11689011 3300020082 Bacteria 14322
412 Ga0213871_10009035 3300021441 Bacteria 2218
413 Ga0224712_10242124 3300022467 Unclassified 831
414 Ga0207682_10124742 3300025893 Bacteria 1145
415 Ga0207692_10325133 3300025898 Bacteria 942
416 Ga0207642_10339197 3300025899 Unclassified 883
417 Ga0207710_10076752 3300025900 Bacteria 1542
418 Ga0207688_10000535 3300025901 Bacteria 18433
419 Ga0207688_10057005 3300025901 Bacteria 2196
420 Ga0207680_10109330 3300025903 Bacteria 1790
421 Ga0207647_10087541 3300025904 Bacteria 1860
422 Ga0207685_10082302 3300025905 Bacteria 1335
423 Ga0207699_10046539 3300025906 Bacteria 2538
424 Ga0207699_10559615 3300025906 Bacteria 830
425 Ga0207645_10097001 3300025907 Bacteria 1900
426 Ga0207645_10117434 3300025907 Bacteria 1725
427 Ga0207645_10196677 3300025907 Bacteria 1326
428 Ga0207645_10274626 3300025907 Bacteria 1118
429 Ga0207643_10008455 3300025908 Bacteria 5522
430 Ga0207643_10051830 3300025908 Bacteria 2330
431 Ga0207643_10060656 3300025908 Bacteria 2160
432 Ga0207705_10092043 3300025909 Bacteria 2221
433 Ga0207705_10113133 3300025909 Bacteria 2007
434 Ga0207654_10095181 3300025911 Bacteria 1824
435 Ga0207707_10002976 3300025912 Bacteria 15080
436 Ga0207707_10050464 3300025912 Bacteria 3624
437 Ga0207707_10050817 3300025912 Bacteria 3610
438 Ga0207707_10078522 3300025912 Bacteria 2883
439 Ga0207707_10152044 3300025912 Bacteria 2023
440 Ga0207707_10162795 3300025912 Bacteria 1950
441 Ga0207707_10285806 3300025912 Unclassified 1427
442 Ga0207695_10092181 3300025913 Bacteria 3041
443 Ga0207695_10213806 3300025913 Unclassified 1838
444 Ga0207695_10450019 3300025913 Bacteria 1171
445 Ga0207695_10799001 3300025913 Unclassified 823
446 Ga0207695_10805197 3300025913 Unclassified 820
447 Ga0207671_10263437 3300025914 Bacteria 1357
448 Ga0207671_10720560 3300025914 Bacteria 793
449 Ga0207693_10007638 3300025915 Bacteria 8877
450 Ga0207693_10058762 3300025915 Bacteria 3013
451 Ga0207693_10068604 3300025915 Bacteria 2775
452 Ga0207663_10019782 3300025916 Bacteria 3801
453 Ga0207663_10029168 3300025916 Bacteria 3237
454 Ga0207663_10109766 3300025916 Bacteria 1870
455 Ga0207663_10211952 3300025916 Bacteria 1404
456 Ga0207660_10013907 3300025917 Bacteria 5281
457 Ga0207660_10119521 3300025917 Bacteria 1994
458 Ga0207660_10133667 3300025917 Bacteria 1891
459 Ga0207660_10530605 3300025917 Bacteria 956
460 Ga0207660_10577824 3300025917 Unclassified 915
461 Ga0207662_10011183 3300025918 Bacteria 4968
462 Ga0207662_10038456 3300025918 Unclassified 2804
463 Ga0207657_10000166 3300025919 Bacteria 67098
464 Ga0207657_10001365 3300025919 Bacteria 26019
465 Ga0207657_10002032 3300025919 Bacteria 21869
466 Ga0207657_10009308 3300025919 Bacteria 9893
467 Ga0207657_10055492 3300025919 Bacteria 3421
468 Ga0207657_10078925 3300025919 Unclassified 2770
469 Ga0207657_10080178 3300025919 Bacteria 2744
470 Ga0207657_10130814 3300025919 Bacteria 2057
471 Ga0207649_10088914 3300025920 Bacteria 2018
472 Ga0207649_10140630 3300025920 Unclassified 1651
473 Ga0207649_10466834 3300025920 Bacteria 955
474 Ga0207652_10007377 3300025921 Bacteria 8865
475 Ga0207652_10017983 3300025921 Bacteria 5791
476 Ga0207652_10021270 3300025921 Bacteria 5353
477 Ga0207652_10052695 3300025921 Bacteria 3493
478 Ga0207652_10188592 3300025921 Bacteria 1854
479 Ga0207646_10483620 3300025922 Bacteria 1116
480 Ga0207681_10701772 3300025923 Unclassified 841
481 Ga0207681_10730191 3300025923 Bacteria 825
482 Ga0207694_10037957 3300025924 Bacteria 3703
483 Ga0207694_10153565 3300025924 Bacteria 1856
484 Ga0207650_10046675 3300025925 Unclassified 3190
485 Ga0207659_10020288 3300025926 Bacteria 4391
486 Ga0207659_10029530 3300025926 Unclassified 3738
487 Ga0207659_10092263 3300025926 Bacteria 2264
488 Ga0207659_10096084 3300025926 Bacteria 2223
489 Ga0207659_10334060 3300025926 Unclassified 1254
490 Ga0207687_10075625 3300025927 Bacteria 2417
491 Ga0207687_10075958 3300025927 Bacteria 2412
492 Ga0207687_10118659 3300025927 Bacteria 1975
493 Ga0207687_10340008 3300025927 Bacteria 1220
494 Ga0207687_10357902 3300025927 Bacteria 1190
495 Ga0207687_10442715 3300025927 Bacteria 1076
496 Ga0207700_10157183 3300025928 Bacteria 1885
497 Ga0207700_10713187 3300025928 Bacteria 896
498 Ga0207664_10190833 3300025929 Bacteria 1764
499 Ga0207664_10416198 3300025929 Bacteria 1197
500 Ga0207644_10065695 3300025931 Bacteria 2639
501 Ga0207644_10154916 3300025931 Bacteria 1776
502 Ga0207690_10012423 3300025932 Bacteria 5093
503 Ga0207690_10071196 3300025932 Bacteria 2397
504 Ga0207690_10105094 3300025932 Unclassified 2024
505 Ga0207690_10320382 3300025932 Bacteria 1218
506 Ga0207706_10008670 3300025933 Bacteria 9367
507 Ga0207706_10011753 3300025933 Bacteria 7974
508 Ga0207706_10037457 3300025933 Bacteria 4306
509 Ga0207706_10284450 3300025933 Bacteria 1442
510 Ga0207686_10011543 3300025934 Bacteria 4840
511 Ga0207686_10063371 3300025934 Bacteria 2350
512 Ga0207686_10166343 3300025934 Bacteria 1551
513 Ga0207686_10345409 3300025934 Bacteria 1119
514 Ga0207686_10609492 3300025934 Bacteria 860
515 Ga0207709_10083475 3300025935 Bacteria 2066
516 Ga0207709_10120710 3300025935 Unclassified 1769
517 Ga0207709_10156025 3300025935 Bacteria 1587
518 Ga0207709_10223987 3300025935 Bacteria 1358
519 Ga0207709_10425720 3300025935 Bacteria 1021
520 Ga0207669_10008482 3300025937 Bacteria 4828
521 Ga0207669_10044853 3300025937 Bacteria 2601
522 Ga0207669_10201814 3300025937 Unclassified 1444
523 Ga0207669_10206108 3300025937 Unclassified 1431
524 Ga0207669_10374982 3300025937 Bacteria 1107
525 Ga0207669_10567606 3300025937 Unclassified 918
526 Ga0207704_10041773 3300025938 Bacteria 2693
527 Ga0207704_10070439 3300025938 Bacteria 2214
528 Ga0207704_10231309 3300025938 Bacteria 1375
529 Ga0207665_10021412 3300025939 Bacteria 4251
530 Ga0207691_10002465 3300025940 Bacteria 18090
531 Ga0207691_10029283 3300025940 Bacteria 5151
532 Ga0207691_10167526 3300025940 Bacteria 1925
533 Ga0207691_10564722 3300025940 Bacteria 964
534 Ga0207711_10143958 3300025941 Bacteria 2146
535 Ga0207711_10185534 3300025941 Bacteria 1893
536 Ga0207689_10091630 3300025942 Unclassified 2497
537 Ga0207689_10413808 3300025942 Bacteria 1124
538 Ga0207661_10004552 3300025944 Bacteria 9720
539 Ga0207661_10016160 3300025944 Bacteria 5500
540 Ga0207661_10064721 3300025944 Unclassified 2965
541 Ga0207661_10090489 3300025944 Bacteria 2548
542 Ga0207661_10097117 3300025944 Bacteria 2466
543 Ga0207661_10245655 3300025944 Bacteria 1589
544 Ga0207661_10293074 3300025944 Bacteria 1457
545 Ga0207679_10010073 3300025945 Bacteria 6075
546 Ga0207679_10032437 3300025945 Bacteria 3667
547 Ga0207679_10074519 3300025945 Bacteria 2572
548 Ga0207667_10025437 3300025949 Bacteria 6478
549 Ga0207667_10053702 3300025949 Bacteria 4239
550 Ga0207667_10112288 3300025949 Unclassified 2810
551 Ga0207667_10129750 3300025949 Bacteria 2596
552 Ga0207667_10223825 3300025949 Bacteria 1927
553 Ga0207667_10300712 3300025949 Unclassified 1639
554 Ga0207667_10455580 3300025949 Bacteria 1299
555 Ga0207667_10664228 3300025949 Unclassified 1047
556 Ga0207651_10016608 3300025960 Bacteria 4319
557 Ga0207651_10279557 3300025960 Unclassified 1379
558 Ga0207712_10057414 3300025961 Bacteria 2746
559 Ga0207712_10176030 3300025961 Bacteria 1676
560 Ga0207668_10054370 3300025972 Bacteria 2779
561 Ga0207668_10107660 3300025972 Unclassified 2085
562 Ga0207640_10015709 3300025981 Bacteria 4387
563 Ga0207640_10049574 3300025981 Bacteria 2720
564 Ga0207640_10590120 3300025981 Bacteria 939
565 Ga0207658_10002326 3300025986 Bacteria 13958
566 Ga0207677_10035672 3300026023 Bacteria 3233
567 Ga0207677_10088709 3300026023 Bacteria 2243
568 Ga0207677_10787351 3300026023 Bacteria 850
569 Ga0207639_10008867 3300026041 Bacteria 6918
570 Ga0207678_10008133 3300026067 Bacteria 9246
571 Ga0207678_10175329 3300026067 Bacteria 1831
572 Ga0207678_10529956 3300026067 Bacteria 1028
573 Ga0207708_10000684 3300026075 Bacteria 25753
574 Ga0207708_10175979 3300026075 Bacteria 1697
575 Ga0207702_10059747 3300026078 Unclassified 3248
576 Ga0207702_10071311 3300026078 Bacteria 2991
577 Ga0207641_10823405 3300026088 Bacteria 919
578 Ga0207648_10004479 3300026089 Bacteria 14336
579 Ga0207648_10011247 3300026089 Bacteria 8438
580 Ga0207648_10076799 3300026089 Bacteria 2911
581 Ga0207648_10355679 3300026089 Bacteria 1321
582 Ga0207676_10175334 3300026095 Bacteria 1872
583 Ga0207676_10327114 3300026095 Bacteria 1409
584 Ga0207674_10006727 3300026116 Bacteria 13498
585 Ga0207674_10132097 3300026116 Bacteria 2459
586 Ga0207674_10163430 3300026116 Bacteria 2181
587 Ga0207674_10172272 3300026116 Bacteria 2117
588 Ga0207674_10487926 3300026116 Bacteria 1191
589 Ga0207675_100015139 3300026118 Bacteria 7193
590 Ga0207675_100033826 3300026118 Bacteria 4763
591 Ga0207675_100037084 3300026118 Bacteria 4548
592 Ga0207675_100086196 3300026118 Unclassified 2949
593 Ga0207675_100147891 3300026118 Bacteria 2235
594 Ga0207675_100148997 3300026118 Bacteria 2226
595 Ga0207675_100716033 3300026118 Unclassified 1010
596 Ga0207683_10002760 3300026121 Bacteria 15343
597 Ga0207683_10006872 3300026121 Bacteria 9745
598 Ga0207683_10020047 3300026121 Bacteria 5714
599 Ga0207683_10037498 3300026121 Bacteria 4221
600 Ga0207683_10063512 3300026121 Bacteria 3253
601 Ga0207683_10891791 3300026121 Unclassified 826
602 Ga0207698_10025008 3300026142 Bacteria 4199
603 Ga0207698_10057052 3300026142 Bacteria 3018
604 Ga0207698_10252068 3300026142 Unclassified 1616
605 Ga0207698_10257935 3300026142 Bacteria 1600
606 Ga0207698_10342577 3300026142 Unclassified 1409
607 Ga0207428_10000108 3300027907 Bacteria 115378
608 Ga0207428_10009737 3300027907 Bacteria 8612
609 Ga0207428_10025233 3300027907 Bacteria 4976
610 Ga0207428_10105882 3300027907 Bacteria 2169
611 Ga0268266_10230307 3300028379 Bacteria 1706
612 Ga0268266_10410049 3300028379 Bacteria 1282
613 Ga0268266_10531024 3300028379 Bacteria 1126
614 Ga0268266_10562841 3300028379 Unclassified 1093
615 Ga0268266_10773543 3300028379 Bacteria 927
616 Ga0268266_10996326 3300028379 Unclassified 811
617 Ga0268265_10112257 3300028380 Bacteria 2228
618 Ga0268265_10180973 3300028380 Unclassified 1811
619 Ga0268264_10112654 3300028381 Bacteria 2385
620 Ga0268264_10515331 3300028381 Bacteria 1168
621 Ga0265319_1025330 3300028563 Bacteria 2124
622 Ga0265334_10067398 3300028573 Unclassified 1337
623 Ga0265318_10003761 3300028577 Bacteria 7549
624 Ga0265318_10027261 3300028577 Bacteria 2247
625 Ga0265322_10017061 3300028654 Bacteria 2093
626 Ga0265338_10006214 3300028800 Bacteria 15298
627 Ga0265338_10107122 3300028800 Bacteria 2261
628 Ga0265330_10020397 3300031235 Bacteria 3029
629 Ga0265325_10033082 3300031241 Bacteria 2757
630 Ga0265340_10216111 3300031247 Bacteria 860
631 Ga0265316_10044789 3300031344 Bacteria 3516
632 Ga0265313_10122558 3300031595 Archaea 1133
633 Ga0265313_10183566 3300031595 Unclassified 878
634 Ga0265314_10009508 3300031711 Bacteria 8196
635 Ga0307405_10187425 3300031731 Bacteria 1491
636 Ga0307410_10001992 3300031852 Bacteria 9620
637 Ga0307406_10065194 3300031901 Bacteria 2366
638 Ga0307407_10000349 3300031903 Bacteria 13923
639 Ga0307412_10580951 3300031911 Bacteria 946
640 Ga0307409_100051110 3300031995 Bacteria 3161
641 Ga0307409_100087434 3300031995 Bacteria 2540
642 Ga0307414_10052282 3300032004 Bacteria 2842
643 Ga0307411_10114964 3300032005 Bacteria 1934
644 Ga0307415_100001163 3300032126 Bacteria 12295
645 Ga0307415_100081322 3300032126 Bacteria 2314
646 Ga0373948_0007592 3300034817 Bacteria 1828
647 Ga0373950_0026585 3300034818 Bacteria 1051
648 Ga0373958_0015793 3300034819 Bacteria 1339
649 Ga0373959_0008251 3300034820 Bacteria 1769
650 Ga0373928_0019562 3300035084 Bacteria 1414
651 Ga0373944_0008676 3300035089 Bacteria 2747
652 Ga0373944_0032038 3300035089 Bacteria 1585
653 Ga0373952_0027172 3300035092 Bacteria 1248
654 Ga0373932_0012406 3300035112 Bacteria 2099
655 Ga0373939_0018485 3300035114 Bacteria 1868
656 Ga0373941_0056776 3300035115 Bacteria 1262
657 Ga0373945_0022087 3300035116 Bacteria 2189
658 Ga0373960_0003986 3300035121 Bacteria 3368
659 Ga0373960_0008369 3300035121 Bacteria 2478
660 Ga0373943_0000198 3300035170 Bacteria 24537
661 Ga0373943_0000348 3300035170 Bacteria 19472
662 Ga0373943_0011820 3300035170 Bacteria 3927
663 Ga0373943_0386432 3300035170 Bacteria 806
664 Ga0373946_0095826 3300035171 Bacteria 1322
665 Ga0373942_0026801 3300035207 Bacteria 1494
666 Ga0373961_0014760 3300035241 Bacteria 1988
667 Ga0373961_0071548 3300035241 Bacteria 1073
668 Ga0373962_0042591 3300035242 Bacteria 1284
669 Ga0373935_0017226 3300035692 Bacteria 4380
670 Ga0373927_0063317 3300035695 Bacteria 2392
671 Ga0373927_0199779 3300035695 Unclassified 1312
672 Ga0373927_0372301 3300035695 Bacteria 942
673 Ga0373933_0016502 3300035724 Bacteria 4131
674 Ga0373947_0000463 3300035725 Bacteria 23167
675 Ga0373947_0002019 3300035725 Bacteria 12393
676 Ga0373947_0002635 3300035725 Bacteria 10776
677 Ga0373937_0041990 3300036401 Bacteria 4173
678 Ga0373937_0166180 3300036401 Bacteria 2069
679 Ga0373925_0016553 3300037068 Bacteria 5341
680 Ga0373925_0024512 3300037068 Bacteria 4405
681 Ga0373925_0041085 3300037068 Bacteria 3426
682 Ga0373925_0094572 3300037068 Bacteria 2288
683 Ga0395899_0005918 3300037312 Bacteria 9496
684 Ga0395899_0105744 3300037312 Bacteria 2027
685 Ga0395899_0112011 3300037312 Bacteria 1961
686 Ga0395899_0210777 3300037312 Bacteria 1350
687 Ga0395899_0240780 3300037312 Bacteria 1245
688 Ga0395900_0001485 3300037418 Bacteria 27947
689 Ga0395900_0009112 3300037418 Bacteria 10167
690 Ga0395900_0054373 3300037418 Bacteria 4122
691 Ga0395900_0058494 3300037418 Bacteria 3968
692 Ga0395900_0082860 3300037418 Bacteria 3295
693 Ga0395900_0097378 3300037418 Bacteria 3022
694 Ga0395900_0160270 3300037418 Bacteria 2295
695 Ga0395900_0201186 3300037418 Bacteria 2015
696 Ga0395900_0382126 3300037418 Unclassified 1376
697 Ga0395898_0012014 3300037466 Bacteria 8965
698 Ga0395898_0020108 3300037466 Bacteria 6783
699 Ga0395898_0022431 3300037466 Bacteria 6394
700 Ga0395898_0089314 3300037466 Bacteria 2965
701 Ga0395898_0102809 3300037466 Bacteria 2742
702 Ga0395898_0188774 3300037466 Bacteria 1969
703 Ga0395898_0281829 3300037466 Bacteria 1585
704 Ga0395898_0316496 3300037466 Bacteria 1489
705 Ga0395898_0395135 3300037466 Bacteria 1318
706 Ga0395898_0526328 3300037466 Bacteria 1124
707 Ga0395898_0811270 3300037466 Unclassified 876
708 Ga0395905_0008167 3300037471 Bacteria 10336
709 Ga0395905_0008242 3300037471 Bacteria 10291
710 Ga0395905_0068636 3300037471 Bacteria 3320
711 Ga0395905_0093548 3300037471 Bacteria 2819
712 Ga0395905_0103074 3300037471 Bacteria 2679
713 Ga0395905_0133466 3300037471 Bacteria 2335
714 Ga0395905_0143166 3300037471 Bacteria 2249
715 Ga0395901_0001883 3300038443 Bacteria 21647
716 Ga0395901_0009984 3300038443 Bacteria 9620
717 Ga0395901_0011802 3300038443 Bacteria 8859
718 Ga0395901_0020566 3300038443 Bacteria 6754
719 Ga0395901_0030500 3300038443 Bacteria 5555
720 Ga0395901_0080423 3300038443 Bacteria 3402
721 Ga0395901_0095272 3300038443 Bacteria 3119
722 Ga0395901_0107997 3300038443 Bacteria 2921
723 Ga0395901_0124343 3300038443 Bacteria 2710
724 Ga0395901_0159378 3300038443 Bacteria 2370
725 Ga0395901_0233828 3300038443 Bacteria 1918
726 Ga0395901_0287720 3300038443 Bacteria 1706
727 Ga0395901_0296248 3300038443 Bacteria 1678
728 Ga0395901_0552588 3300038443 Bacteria 1167
729 Ga0395901_0784826 3300038443 Bacteria 943
730 Ga0395901_0835251 3300038443 Bacteria 908
731 Ga0436365_1649965 3300039437 Unclassified 857
732 Ga0436362_0209500 3300039453 Bacteria 1022
733 Ga0451795_1456911 3300041456 Unclassified 943
734 Ga0451806_051954 3300041462 Unclassified 855
735 Ga0451807_1968779 3300041486 Unclassified 1218
736 Ga0451845_0543180 3300041501 Bacteria 823
737 Ga0451853_0888380 3300041512 Bacteria 3046
738 Ga0439448_0032735 3300042005 Bacteria 1655
739 Ga0450906_006151 3300042145 Bacteria 2432
740 Ga0439435_0096555 3300042436 Bacteria 904
741 Ga0439460_0068507 3300042461 Bacteria 1095
742 Ga0450916_015947 3300042530 Bacteria 992
743 Ga0466961_0012851 3300044693 Bacteria 5357
744 Ga0466963_0003161 3300044694 Bacteria 9351
745 Ga0466963_0014018 3300044694 Bacteria 4937
746 Ga0466963_0015404 3300044694 Bacteria 4733
747 Ga0466963_0025256 3300044694 Bacteria 3787
748 Ga0466963_0052406 3300044694 Bacteria 2707
749 Ga0466963_0057169 3300044694 Bacteria 2597
750 Ga0466963_0079595 3300044694 Bacteria 2217
751 Ga0466963_0154620 3300044694 Bacteria 1594
752 Ga0466963_0280344 3300044694 Bacteria 1171
753 Ga0466963_0361083 3300044694 Bacteria 1023
754 Ga0466964_0003963 3300044706 Bacteria 5443
755 Ga0466964_0021478 3300044706 Bacteria 2497
756 Ga0466964_0031098 3300044706 Archaea 2115
757 Ga0466964_0050315 3300044706 Unclassified 1708
758 Ga0466971_0022578 3300044719 Bacteria 2804
759 Ga0466971_0051216 3300044719 Bacteria 1858
760 Ga0466968_0048085 3300044735 Bacteria 1815
761 Ga0466957_0011251 3300044842 Bacteria 5154
762 Ga0466957_0190032 3300044842 Bacteria 1345
763 Ga0466960_0025806 3300044901 Bacteria 2663
764 Ga0466959_0024314 3300045049 Bacteria 4487
765 Ga0466958_0019375 3300045836 Bacteria 3960
766 Ga0466958_0035887 3300045836 Bacteria 2964
767 Ga0466958_0051351 3300045836 Bacteria 2496
768 Ga0466967_0000676 3300045976 Bacteria 17274
769 Ga0466967_0003018 3300045976 Bacteria 10796
770 Ga0466967_0003281 3300045976 Bacteria 10494
771 Ga0466967_0025078 3300045976 Bacteria 4911
772 Ga0466967_0027088 3300045976 Bacteria 4762
773 Ga0466967_0028485 3300045976 Bacteria 4662
774 Ga0466967_0062313 3300045976 Bacteria 3310
775 Ga0466967_0065517 3300045976 Bacteria 3234
776 Ga0466967_0083491 3300045976 Bacteria 2889
777 Ga0466967_0084549 3300045976 Bacteria 2871
778 Ga0466967_0085892 3300045976 Bacteria 2850
779 Ga0466967_0118795 3300045976 Bacteria 2439
780 Ga0466967_0156303 3300045976 Bacteria 2136
781 Ga0466967_0185694 3300045976 Bacteria 1963
782 Ga0466967_0225491 3300045976 Bacteria 1782
783 Ga0466967_0288063 3300045976 Bacteria 1577
784 Ga0466967_0375012 3300045976 Bacteria 1380
785 Ga0466967_0386719 3300045976 Unclassified 1359
786 Ga0495592_0012008 3300046454 Bacteria 6564
787 Ga0495592_0093141 3300046454 Bacteria 2158
788 Ga0495592_0110842 3300046454 Unclassified 1942
789 Ga0495592_0149436 3300046454 Unclassified 1617
790 Ga0495592_0281292 3300046454 Bacteria 1088
791 Ga0495592_0333276 3300046454 Unclassified 977
792 Ga0495592_0420337 3300046454 Unclassified 843
793 Ga0495603_0000081 3300046455 Bacteria 42501
794 Ga0495603_0011869 3300046455 Bacteria 5273
795 Ga0495603_0039078 3300046455 Bacteria 2845
796 Ga0495603_0171718 3300046455 Unclassified 1255
797 Ga0495629_0000685 3300046459 Bacteria 27423
798 Ga0495629_0227825 3300046459 Bacteria 1285
799 Ga0495629_0286383 3300046459 Unclassified 1130
800 Ga0495641_0002133 3300046461 Bacteria 15953
801 Ga0495641_0004788 3300046461 Bacteria 9421
802 Ga0495641_0019598 3300046461 Bacteria 3454
803 Ga0495641_0028580 3300046461 Bacteria 2697
804 Ga0495641_0039327 3300046461 Bacteria 2206
805 Ga0495651_0025023 3300046462 Bacteria 4644
806 Ga0495651_0050868 3300046462 Bacteria 3196
807 Ga0495651_0196263 3300046462 Bacteria 1416
808 Ga0495651_0206051 3300046462 Unclassified 1372
809 Ga0495653_0009654 3300046463 Bacteria 7893
810 Ga0495653_0018383 3300046463 Bacteria 5679
811 Ga0495653_0076386 3300046463 Bacteria 2490
812 Ga0495653_0076547 3300046463 Bacteria 2487
813 Ga0495580_0338407 3300046472 Bacteria 1021
814 Ga0495582_0003506 3300046473 Bacteria 8842
815 Ga0495582_0027562 3300046473 Bacteria 3115
816 Ga0495582_0039470 3300046473 Bacteria 2599
817 Ga0495582_0101616 3300046473 Bacteria 1610
818 Ga0495639_0001909 3300046475 Bacteria 9243
819 Ga0495639_0092686 3300046475 Bacteria 1419
820 Ga0495662_0005936 3300046476 Bacteria 6101
821 Ga0495664_0035970 3300046477 Bacteria 2918
822 Ga0495664_0040904 3300046477 Bacteria 2742
823 Ga0495584_0268011 3300046491 Unclassified 868
824 Ga0495594_0000536 3300046499 Bacteria 19443
825 Ga0495596_0031645 3300046500 Bacteria 2112
826 Ga0495608_0006652 3300046511 Bacteria 8203
827 Ga0495608_0048020 3300046511 Bacteria 2837
828 Ga0495608_0240156 3300046511 Archaea 1132
829 Ga0495608_0421052 3300046511 Bacteria 815
830 Ga0495618_0138691 3300046514 Bacteria 1555
831 Ga0495618_0145799 3300046514 Unclassified 1513
832 Ga0495628_0022530 3300046516 Bacteria 5175
833 Ga0495628_0042397 3300046516 Bacteria 3630
834 Ga0495628_0045502 3300046516 Bacteria 3489
835 Ga0495630_0012976 3300046517 Bacteria 6053
836 Ga0495630_0026151 3300046517 Bacteria 4320
837 Ga0495630_0045557 3300046517 Bacteria 3278
838 Ga0495630_0073335 3300046517 Bacteria 2578
839 Ga0495630_0107265 3300046517 Bacteria 2115
840 Ga0495666_0019555 3300046526 Bacteria 3359
841 Ga0495666_0026651 3300046526 Bacteria 2847
842 Ga0495652_0032336 3300046529 Bacteria 4576
843 Ga0495652_0062254 3300046529 Bacteria 3146
844 Ga0495652_0151372 3300046529 Bacteria 1812
845 Ga0495652_0163183 3300046529 Unclassified 1727
846 Ga0495665_0002182 3300046531 Bacteria 10588
847 Ga0495665_0090260 3300046531 Bacteria 1610
848 Ga0495665_0107038 3300046531 Bacteria 1467
849 Ga0495640_0017130 3300046533 Bacteria 5407
850 Ga0495640_0093241 3300046533 Bacteria 1985
851 Ga0495640_0105752 3300046533 Bacteria 1843
852 Ga0495640_0239368 3300046533 Unclassified 1139
853 Ga0495587_0024356 3300046536 Bacteria 3710
854 Ga0495587_0027933 3300046536 Bacteria 3435
855 Ga0495587_0185408 3300046536 Bacteria 1179
856 Ga0495587_0338492 3300046536 Bacteria 839
857 Ga0495645_0039466 3300046543 Bacteria 3443
858 Ga0495645_0103876 3300046543 Bacteria 2018
859 Ga0495645_0170790 3300046543 Unclassified 1497
860 Ga0495645_0250155 3300046543 Bacteria 1178
861 Ga0495645_0279810 3300046543 Bacteria 1097
862 Ga0495622_0183680 3300046557 Bacteria 937
863 Ga0495667_0006276 3300046559 Bacteria 8062
864 Ga0495667_0008058 3300046559 Bacteria 7149
865 Ga0495667_0013743 3300046559 Bacteria 5469
866 Ga0495667_0043084 3300046559 Bacteria 2991
867 Ga0495667_0238344 3300046559 Bacteria 1159
868 Ga0495656_0254226 3300046615 Unclassified 888
869 Ga0495656_0309904 3300046615 Unclassified 811
870 Ga0495634_0014543 3300046642 Bacteria 5672
871 Ga0495634_0040698 3300046642 Bacteria 3158
872 Ga0495634_0063428 3300046642 Bacteria 2452
873 Ga0495634_0349857 3300046642 Unclassified 885
874 Ga0495635_0008303 3300046663 Bacteria 7248
875 Ga0495635_0055094 3300046663 Bacteria 2739
876 Ga0495635_0062423 3300046663 Bacteria 2559
877 Ga0495635_0104629 3300046663 Unclassified 1934
878 Ga0495588_0002678 3300046674 Bacteria 7625
879 Ga0495588_0136375 3300046674 Bacteria 1295
880 Ga0495657_0022472 3300046675 Bacteria 4516
881 Ga0495657_0050396 3300046675 Bacteria 2799
882 Ga0495657_0099309 3300046675 Bacteria 1857
883 Ga0495657_0212939 3300046675 Archaea 1174
884 Ga0495599_0008974 3300046678 Bacteria 6091
885 Ga0495599_0143711 3300046678 Unclassified 1479
886 Ga0495599_0154266 3300046678 Bacteria 1421
887 Ga0495623_0009860 3300046679 Bacteria 6188
888 Ga0495646_0045886 3300046680 Bacteria 2667
889 Ga0495646_0048217 3300046680 Bacteria 2589
890 Ga0495646_0053276 3300046680 Bacteria 2440
891 Ga0495647_0014020 3300046681 Bacteria 2787
892 Ga0495647_0064178 3300046681 Bacteria 1456
893 Ga0495658_0004562 3300046683 Bacteria 6811
894 Ga0495658_0142270 3300046683 Bacteria 1468
895 Ga0495658_0158524 3300046683 Bacteria 1394
896 Ga0495613_0037388 3300046689 Bacteria 3599
897 Ga0495613_0045661 3300046689 Bacteria 3239
898 Ga0495624_0021440 3300046690 Bacteria 4284
899 Ga0495624_0382408 3300046690 Unclassified 846
900 Ga0495600_0021977 3300046809 Bacteria 4093
901 Ga0495600_0127553 3300046809 Bacteria 1654
902 Ga0495600_0410002 3300046809 Unclassified 842
903 Ga0495581_0000096 3300047315 Bacteria 36595
904 Ga0495581_0151180 3300047315 Bacteria 1356
905 Ga0495604_0006659 3300047317 Bacteria 9154
906 Ga0495604_0259579 3300047317 Unclassified 1181
907 Ga0495674_0002194 3300047319 Bacteria 19201
908 Ga0495674_0012523 3300047319 Bacteria 7990
909 Ga0495674_0015466 3300047319 Bacteria 7130
910 Ga0495674_0046499 3300047319 Bacteria 3851
911 Ga0495674_0101589 3300047319 Bacteria 2446
912 Ga0495674_0103229 3300047319 Bacteria 2424
913 Ga0495674_0105099 3300047319 Bacteria 2400
914 Ga0495674_0620027 3300047319 Bacteria 855
915 Ga0495676_0002817 3300047321 Bacteria 15665
916 Ga0495676_0003591 3300047321 Bacteria 14079
917 Ga0495676_0416967 3300047321 Bacteria 889
918 Ga0495680_0005411 3300047322 Bacteria 12025
919 Ga0495680_0012790 3300047322 Bacteria 7359
920 Ga0495680_0014352 3300047322 Bacteria 6865
921 Ga0495680_0040429 3300047322 Bacteria 3716
922 Ga0495680_0067791 3300047322 Bacteria 2727
923 Ga0495680_0084623 3300047322 Bacteria 2390
924 Ga0495675_0002014 3300047444 Bacteria 12134
925 Ga0495677_0117163 3300047445 Bacteria 1015
926 Ga0495679_081528 3300047446 Bacteria 918
927 Ga0495684_0009628 3300047471 Bacteria 7453
928 Ga0495684_0011499 3300047471 Bacteria 6839
929 Ga0495684_0018011 3300047471 Bacteria 5442
930 Ga0495684_0029449 3300047471 Bacteria 4214
931 Ga0495684_0285148 3300047471 Bacteria 1190
932 Ga0495593_0006479 3300047673 Bacteria 6858
933 Ga0495602_0023064 3300048088 Bacteria 6074
934 Ga0495602_0053966 3300048088 Bacteria 3553
935 Ga0495602_0101513 3300048088 Bacteria 2360
936 Ga0495602_0336955 3300048088 Bacteria 1092
937 Ga0495614_0032651 3300048089 Bacteria 2240
938 Ga0496100_0010608 3300048903 Bacteria 5220
939 Ga0496100_0017082 3300048903 Bacteria 4276
940 Ga0496100_0020623 3300048903 Bacteria 3955
941 Ga0496100_0129406 3300048903 Bacteria 1776
942 Ga0496100_0143663 3300048903 Bacteria 1694
943 Ga0496100_0226444 3300048903 Bacteria 1374
944 Ga0496100_0553649 3300048903 Unclassified 890
945 Ga0496101_0001024 3300048904 Bacteria 16471
946 Ga0496101_0026476 3300048904 Bacteria 4033
947 Ga0496101_0029311 3300048904 Bacteria 3849
948 Ga0496101_0081036 3300048904 Bacteria 2399
949 Ga0496101_0145864 3300048904 Bacteria 1807
950 Ga0496101_0178812 3300048904 Bacteria 1633
951 Ga0496101_0276894 3300048904 Bacteria 1311
952 Ga0496102_0012193 3300048905 Bacteria 7431
953 Ga0496102_0017600 3300048905 Bacteria 6262
954 Ga0496102_0049578 3300048905 Bacteria 3820
955 Ga0496102_0063252 3300048905 Bacteria 3388
956 Ga0496102_0112078 3300048905 Bacteria 2544
957 Ga0496102_0190594 3300048905 Bacteria 1932
958 Ga0496102_0198763 3300048905 Bacteria 1889
959 Ga0496102_0220089 3300048905 Bacteria 1789
960 Ga0496102_0317465 3300048905 Bacteria 1468
961 Ga0496103_0096349 3300048906 Bacteria 1870
962 Ga0496103_0201162 3300048906 Bacteria 1281
963 Ga0496103_0216909 3300048906 Bacteria 1230
964 Ga0496103_0268851 3300048906 Bacteria 1097
965 Ga0496104_0000865 3300048907 Bacteria 26083
966 Ga0496104_0004406 3300048907 Bacteria 12261
967 Ga0496104_0008693 3300048907 Bacteria 9031
968 Ga0496104_0068058 3300048907 Bacteria 3383
969 Ga0496104_0084458 3300048907 Bacteria 3030
970 Ga0496104_0178994 3300048907 Bacteria 2031
971 Ga0496104_0275841 3300048907 Unclassified 1594
972 Ga0496104_0414241 3300048907 Bacteria 1260
973 Ga0496105_0000775 3300048908 Bacteria 21608
974 Ga0496105_0004904 3300048908 Bacteria 10116
975 Ga0496105_0010597 3300048908 Bacteria 7253
976 Ga0496105_0036907 3300048908 Bacteria 4026
977 Ga0496105_0038173 3300048908 Bacteria 3956
978 Ga0496106_0021917 3300048909 Bacteria 4746
979 Ga0496106_0031774 3300048909 Bacteria 3934
980 Ga0496106_0095212 3300048909 Bacteria 2303
981 Ga0496106_0188080 3300048909 Bacteria 1641
982 Ga0496106_0245184 3300048909 Bacteria 1432
983 Ga0496106_0250987 3300048909 Bacteria 1414
984 Ga0496106_0367167 3300048909 Bacteria 1156
985 Ga0496106_0547083 3300048909 Unclassified 929
986 Ga0496107_0006234 3300048910 Bacteria 8198
987 Ga0496107_0016203 3300048910 Bacteria 5231
988 Ga0496107_0212393 3300048910 Unclassified 1439
989 Ga0496107_0260884 3300048910 Bacteria 1289
990 Ga0496107_0269984 3300048910 Unclassified 1266
991 Ga0496107_0437578 3300048910 Unclassified 972
992 Ga0496107_0522224 3300048910 Bacteria 880
993 Ga0496108_0005018 3300048911 Bacteria 10693
994 Ga0496108_0007413 3300048911 Bacteria 8893
995 Ga0496108_0010715 3300048911 Bacteria 7439
996 Ga0496108_0056838 3300048911 Bacteria 3288
997 Ga0496108_0061474 3300048911 Bacteria 3161
998 Ga0496108_0104312 3300048911 Bacteria 2419
999 Ga0496108_0114151 3300048911 Bacteria 2312
1000 Ga0496108_0137205 3300048911 Bacteria 2106
1001 Ga0496108_0433856 3300048911 Unclassified 1147
1002 Ga0496109_0001239 3300048912 Bacteria 21163
1003 Ga0496109_0008523 3300048912 Bacteria 8717
1004 Ga0496109_0018833 3300048912 Bacteria 6073
1005 Ga0496109_0032165 3300048912 Bacteria 4713
1006 Ga0496109_0033330 3300048912 Bacteria 4633
1007 Ga0496109_0061766 3300048912 Bacteria 3426
1008 Ga0496109_0063007 3300048912 Bacteria 3391
1009 Ga0496109_0071649 3300048912 Bacteria 3182
1010 Ga0496109_0702906 3300048912 Bacteria 948
1011 Ga0496109_0819826 3300048912 Bacteria 868
1012 Ga0496110_0011919 3300048913 Bacteria 7142
1013 Ga0496110_0046602 3300048913 Bacteria 3793
1014 Ga0496110_0048083 3300048913 Bacteria 3738
1015 Ga0496110_0048867 3300048913 Bacteria 3709
1016 Ga0496110_0088644 3300048913 Bacteria 2764
1017 Ga0496110_0182517 3300048913 Bacteria 1905
1018 Ga0496110_0182717 3300048913 Unclassified 1904
1019 Ga0496111_0003372 3300048914 Bacteria 9877
1020 Ga0496111_0059871 3300048914 Bacteria 2759
1021 Ga0496111_0061619 3300048914 Bacteria 2719
1022 Ga0496111_0175990 3300048914 Bacteria 1590
1023 Ga0496111_0361810 3300048914 Bacteria 1074
1024 Ga0496112_0001889 3300048915 Bacteria 16523
1025 Ga0496112_0003082 3300048915 Bacteria 13654
1026 Ga0496112_0003845 3300048915 Bacteria 12539
1027 Ga0496112_0019694 3300048915 Bacteria 6376
1028 Ga0496112_0077424 3300048915 Bacteria 3289
1029 Ga0496112_0151505 3300048915 Bacteria 2286
1030 Ga0496112_0200576 3300048915 Bacteria 1954
1031 Ga0496113_0001530 3300048916 Bacteria 12949
1032 Ga0496113_0041139 3300048916 Bacteria 3408
1033 Ga0496114_0009938 3300048917 Bacteria 7562
1034 Ga0496114_0012025 3300048917 Bacteria 6923
1035 Ga0496114_0026950 3300048917 Bacteria 4708
1036 Ga0496114_0074362 3300048917 Bacteria 2860
1037 Ga0496114_0098509 3300048917 Bacteria 2493
1038 Ga0496114_0101630 3300048917 Bacteria 2455
1039 Ga0496114_0103167 3300048917 Bacteria 2437
1040 Ga0496114_0203985 3300048917 Bacteria 1733
1041 Ga0496114_0205513 3300048917 Bacteria 1726
1042 Ga0496114_0252204 3300048917 Bacteria 1553
1043 Ga0496114_0338672 3300048917 Unclassified 1330
1044 Ga0496115_0000701 3300048918 Bacteria 24832
1045 Ga0496115_0002745 3300048918 Bacteria 12643
1046 Ga0496115_0005818 3300048918 Bacteria 8984
1047 Ga0496115_0127647 3300048918 Bacteria 2095
1048 Ga0496115_0136347 3300048918 Unclassified 2024
1049 Ga0496115_0344628 3300048918 Bacteria 1216
1050 Ga0501031_0000033 3300049568 Bacteria 76506
1051 Ga0501031_0039958 3300049568 Bacteria 3062
1052 Ga0501031_0432174 3300049568 Bacteria 851
1053 Ga0501032_0000534 3300049569 Bacteria 30915
1054 Ga0501032_0068094 3300049569 Bacteria 2377
1055 Ga0501032_0094572 3300049569 Bacteria 1981
1056 Ga0501032_0268422 3300049569 Bacteria 1106
1057 Ga0501033_0001697 3300049570 Bacteria 19273
1058 Ga0501033_0019452 3300049570 Bacteria 5136
1059 Ga0501033_0023427 3300049570 Bacteria 4656
1060 Ga0501033_0038330 3300049570 Bacteria 3585
1061 Ga0501034_0040001 3300049571 Bacteria 4748
1062 Ga0501036_0000100 3300049572 Bacteria 54095
1063 Ga0501036_0042492 3300049572 Bacteria 3848
1064 Ga0501036_0055141 3300049572 Bacteria 3367
1065 Ga0501036_0090347 3300049572 Bacteria 2587
1066 Ga0501036_0140509 3300049572 Bacteria 2038
1067 Ga0501036_0416668 3300049572 Bacteria 1120
1068 Ga0501036_0423010 3300049572 Bacteria 1110
1069 Ga0501036_0461501 3300049572 Bacteria 1058
1070 Ga0501037_0000149 3300049573 Bacteria 65174
1071 Ga0501037_0053601 3300049573 Bacteria 2950
1072 Ga0501037_0133435 3300049573 Bacteria 1779
1073 Ga0501037_0194278 3300049573 Bacteria 1436
1074 Ga0501037_0312856 3300049573 Bacteria 1088
1075 Ga0501038_0000227 3300049574 Bacteria 47719
1076 Ga0501038_0007286 3300049574 Bacteria 10210
1077 Ga0501038_0026061 3300049574 Bacteria 5207
1078 Ga0501038_0051266 3300049574 Bacteria 3563
1079 Ga0501038_0080270 3300049574 Bacteria 2750
1080 Ga0501038_0200753 3300049574 Bacteria 1600
1081 Ga0501038_0239755 3300049574 Bacteria 1440
1082 Ga0501039_0000423 3300049575 Bacteria 30441
1083 Ga0501039_0015416 3300049575 Bacteria 5850
1084 Ga0501039_0017235 3300049575 Bacteria 5541
1085 Ga0501039_0020134 3300049575 Bacteria 5115
1086 Ga0501039_0029270 3300049575 Bacteria 4241
1087 Ga0501039_0086991 3300049575 Bacteria 2434
1088 Ga0501039_0129306 3300049575 Bacteria 1982
1089 Ga0501039_0335691 3300049575 Bacteria 1188
1090 Ga0501039_0467379 3300049575 Bacteria 990
1091 Ga0501039_0485891 3300049575 Bacteria 970
1092 Ga0501040_0000502 3300049576 Bacteria 23345
1093 Ga0501040_0001387 3300049576 Bacteria 15298
1094 Ga0501040_0005343 3300049576 Bacteria 8305
1095 Ga0501040_0005466 3300049576 Bacteria 8221
1096 Ga0501040_0034592 3300049576 Bacteria 3422
1097 Ga0501040_0047493 3300049576 Bacteria 2931
1098 Ga0501040_0055433 3300049576 Bacteria 2718
1099 Ga0501040_0078527 3300049576 Bacteria 2284
1100 Ga0501040_0573698 3300049576 Unclassified 815
1101 Ga0501041_0000012 3300049577 Bacteria 58514
1102 Ga0501041_0000895 3300049577 Bacteria 16124
1103 Ga0501041_0011567 3300049577 Bacteria 5220
1104 Ga0501041_0017309 3300049577 Bacteria 4288
1105 Ga0501041_0019626 3300049577 Bacteria 4038
1106 Ga0501041_0029930 3300049577 Bacteria 3285
1107 Ga0501041_0041093 3300049577 Bacteria 2807
1108 Ga0501041_0041256 3300049577 Bacteria 2803
1109 Ga0501041_0079805 3300049577 Bacteria 2014
1110 Ga0501041_0152656 3300049577 Bacteria 1442
1111 Ga0501041_0348180 3300049577 Bacteria 936
1112 Ga0501042_0000006 3300049578 Bacteria 64564
1113 Ga0501042_0000695 3300049578 Bacteria 18274
1114 Ga0501042_0005804 3300049578 Bacteria 7973
1115 Ga0501042_0009685 3300049578 Bacteria 6433
1116 Ga0501042_0033769 3300049578 Bacteria 3628
1117 Ga0501042_0091590 3300049578 Bacteria 2182
1118 Ga0501042_0149677 3300049578 Unclassified 1683
1119 Ga0501042_0160223 3300049578 Bacteria 1623
1120 Ga0501042_0414794 3300049578 Bacteria 976
1121 Ga0501042_0443758 3300049578 Bacteria 941
1122 Ga0501043_0000804 3300049579 Bacteria 27870
1123 Ga0501043_0051588 3300049579 Bacteria 3232
1124 Ga0501043_0084261 3300049579 Bacteria 2498
1125 Ga0501043_0130953 3300049579 Bacteria 1966
1126 Ga0501043_0175239 3300049579 Bacteria 1672
1127 Ga0501043_0218772 3300049579 Bacteria 1474
1128 Ga0501043_0272575 3300049579 Unclassified 1299
1129 Ga0501046_0000342 3300049580 Bacteria 47047
1130 Ga0501046_0011144 3300049580 Bacteria 7701
1131 Ga0501046_0037860 3300049580 Bacteria 3874
1132 Ga0501046_0041445 3300049580 Bacteria 3674
1133 Ga0501046_0186294 3300049580 Bacteria 1550
1134 Ga0501046_0263734 3300049580 Bacteria 1265
1135 Ga0501046_0275856 3300049580 Bacteria 1232
1136 Ga0501047_0000421 3300049581 Bacteria 47507
1137 Ga0501047_0009775 3300049581 Bacteria 9065
1138 Ga0501047_0046548 3300049581 Bacteria 4192
1139 Ga0501047_0101879 3300049581 Bacteria 2751
1140 Ga0501048_0000027 3300049582 Bacteria 66478
1141 Ga0501048_0001796 3300049582 Bacteria 16311
1142 Ga0501048_0045848 3300049582 Bacteria 3121
1143 Ga0501048_0052712 3300049582 Bacteria 2895
1144 Ga0501048_0063434 3300049582 Bacteria 2613
1145 Ga0501048_0068055 3300049582 Bacteria 2516
1146 Ga0501048_0276743 3300049582 Unclassified 1193
1147 Ga0501067_0001625 3300049583 Bacteria 12334
1148 Ga0501067_0001827 3300049583 Bacteria 11688
1149 Ga0501067_0010668 3300049583 Bacteria 5083
1150 Ga0501067_0029415 3300049583 Bacteria 3044
1151 Ga0501067_0059493 3300049583 Bacteria 2115
1152 Ga0501067_0074315 3300049583 Bacteria 1883
1153 Ga0501067_0106523 3300049583 Bacteria 1558
1154 Ga0501067_0210247 3300049583 Bacteria 1084
1155 Ga0501068_0000037 3300049584 Bacteria 49431
1156 Ga0501068_0002603 3300049584 Bacteria 9550
1157 Ga0501068_0003100 3300049584 Bacteria 8878
1158 Ga0501068_0007456 3300049584 Bacteria 6060
1159 Ga0501068_0030111 3300049584 Bacteria 3217
1160 Ga0501068_0100397 3300049584 Bacteria 1793
1161 Ga0501068_0202652 3300049584 Unclassified 1258
1162 Ga0501069_0002851 3300049585 Bacteria 8857
1163 Ga0501069_0007623 3300049585 Bacteria 5681
1164 Ga0501069_0010781 3300049585 Bacteria 4845
1165 Ga0501069_0013593 3300049585 Bacteria 4341
1166 Ga0501069_0020010 3300049585 Bacteria 3623
1167 Ga0501069_0031375 3300049585 Bacteria 2922
1168 Ga0501069_0044575 3300049585 Bacteria 2455
1169 Ga0501069_0059946 3300049585 Bacteria 2124
1170 Ga0501069_0081324 3300049585 Bacteria 1825
1171 Ga0501069_0104452 3300049585 Bacteria 1610
1172 Ga0501069_0145356 3300049585 Unclassified 1361
1173 Ga0501070_0000805 3300049586 Bacteria 28505
1174 Ga0501070_0050977 3300049586 Bacteria 3435
1175 Ga0501070_0120704 3300049586 Bacteria 2166
1176 Ga0501070_0221164 3300049586 Bacteria 1553
1177 Ga0501070_0246722 3300049586 Unclassified 1461
1178 Ga0501070_0378440 3300049586 Bacteria 1147
1179 Ga0501070_0399721 3300049586 Bacteria 1111
1180 Ga0501071_0000012 3300049587 Bacteria 62725
1181 Ga0501071_0000330 3300049587 Bacteria 22815
1182 Ga0501071_0001183 3300049587 Bacteria 14683
1183 Ga0501071_0004051 3300049587 Bacteria 9258
1184 Ga0501071_0049864 3300049587 Bacteria 3014
1185 Ga0501071_0063841 3300049587 Unclassified 2671
1186 Ga0501071_0071580 3300049587 Bacteria 2528
1187 Ga0501071_0154584 3300049587 Unclassified 1712
1188 Ga0501071_0275865 3300049587 Unclassified 1272
1189 Ga0501072_0000295 3300049588 Bacteria 35307
1190 Ga0501072_0000448 3300049588 Bacteria 29632
1191 Ga0501072_0001627 3300049588 Bacteria 16809
1192 Ga0501072_0007864 3300049588 Bacteria 8100
1193 Ga0501072_0016896 3300049588 Bacteria 5606
1194 Ga0501072_0040889 3300049588 Bacteria 3641
1195 Ga0501072_0041310 3300049588 Bacteria 3622
1196 Ga0501072_0059461 3300049588 Bacteria 3013
1197 Ga0501072_0082255 3300049588 Unclassified 2552
1198 Ga0501072_0084943 3300049588 Bacteria 2510
1199 Ga0501072_0127601 3300049588 Bacteria 2027
1200 Ga0501072_0330556 3300049588 Bacteria 1211
1201 Ga0501072_0342390 3300049588 Bacteria 1187
1202 Ga0501073_0002424 3300049589 Bacteria 13951
1203 Ga0501073_0006657 3300049589 Bacteria 8607
1204 Ga0501073_0028017 3300049589 Bacteria 4024
1205 Ga0501073_0214897 3300049589 Bacteria 1329
1206 Ga0501074_0000008 3300049590 Bacteria 105048
1207 Ga0501074_0000859 3300049590 Bacteria 19335
1208 Ga0501074_0012136 3300049590 Bacteria 6264
1209 Ga0501074_0020171 3300049590 Bacteria 4844
1210 Ga0501074_0030420 3300049590 Bacteria 3913
1211 Ga0501074_0053199 3300049590 Bacteria 2921
1212 Ga0501074_0083055 3300049590 Bacteria 2297
1213 Ga0501074_0224469 3300049590 Bacteria 1337
1214 Ga0501074_0234980 3300049590 Unclassified 1304
1215 Ga0501074_0241633 3300049590 Unclassified 1284
1216 Ga0501074_0462258 3300049590 Bacteria 899
1217 Ga0501075_0000571 3300049591 Bacteria 22450
1218 Ga0501075_0000839 3300049591 Bacteria 19363
1219 Ga0501075_0004350 3300049591 Bacteria 9580
1220 Ga0501075_0007131 3300049591 Bacteria 7732
1221 Ga0501075_0017103 3300049591 Bacteria 5234
1222 Ga0501075_0111672 3300049591 Bacteria 2078
1223 Ga0501075_0199289 3300049591 Bacteria 1527
1224 Ga0501075_0302818 3300049591 Bacteria 1218
1225 Ga0501075_0504317 3300049591 Bacteria 923
1226 Ga0501075_0759204 3300049591 Bacteria 738
1227 Ga0501076_0000020 3300049592 Bacteria 86221
1228 Ga0501076_0001551 3300049592 Bacteria 15383
1229 Ga0501076_0005537 3300049592 Bacteria 9099
1230 Ga0501076_0011459 3300049592 Bacteria 6606
1231 Ga0501076_0015332 3300049592 Bacteria 5790
1232 Ga0501076_0045969 3300049592 Bacteria 3448
1233 Ga0501076_0065372 3300049592 Bacteria 2900
1234 Ga0501076_0088873 3300049592 Unclassified 2483
1235 Ga0501076_0089262 3300049592 Bacteria 2477
1236 Ga0501076_0093020 3300049592 Bacteria 2426
1237 Ga0501076_0191130 3300049592 Unclassified 1671
1238 Ga0501076_0198358 3300049592 Bacteria 1638
1239 Ga0501076_0531525 3300049592 Unclassified 969
1240 Ga0501077_0000040 3300049593 Bacteria 65332
1241 Ga0501077_0000576 3300049593 Bacteria 22271
1242 Ga0501077_0010553 3300049593 Bacteria 5752
1243 Ga0501077_0044698 3300049593 Bacteria 2813
1244 Ga0501077_0058784 3300049593 Bacteria 2440
1245 Ga0501077_0060687 3300049593 Bacteria 2399
1246 Ga0501077_0061776 3300049593 Bacteria 2377
1247 Ga0501077_0069117 3300049593 Bacteria 2239
1248 Ga0501077_0072820 3300049593 Bacteria 2177
1249 Ga0501077_0114769 3300049593 Bacteria 1707
1250 Ga0501077_0123252 3300049593 Bacteria 1643
1251 Ga0501077_0462726 3300049593 Unclassified 812
1252 Ga0501079_0000001 3300049741 Bacteria 121247
1253 Ga0501079_0001513 3300049741 Bacteria 16457
1254 Ga0501079_0017893 3300049741 Bacteria 5412
1255 Ga0501079_0022542 3300049741 Bacteria 4829
1256 Ga0501079_0047478 3300049741 Bacteria 3312
1257 Ga0501079_0053746 3300049741 Bacteria 3107
1258 Ga0501079_0169640 3300049741 Bacteria 1701
1259 Ga0501079_0179939 3300049741 Bacteria 1650
1260 Ga0501079_0288348 3300049741 Unclassified 1283
1261 Ga0501079_0294796 3300049741 Bacteria 1268
1262 Ga0501080_0000042 3300049742 Bacteria 81541
1263 Ga0501080_0004620 3300049742 Bacteria 12268
1264 Ga0501080_0008532 3300049742 Bacteria 9291
1265 Ga0501080_0070394 3300049742 Bacteria 3253
1266 Ga0501080_0159033 3300049742 Unclassified 2087
1267 Ga0501080_0177276 3300049742 Bacteria 1963
1268 Ga0501080_0231114 3300049742 Bacteria 1690
1269 Ga0501080_0471837 3300049742 Bacteria 1123
1270 Ga0501081_0000001 3300049743 Bacteria 115059
1271 Ga0501081_0000753 3300049743 Bacteria 18947
1272 Ga0501081_0005108 3300049743 Bacteria 8450
1273 Ga0501081_0015036 3300049743 Bacteria 5106
1274 Ga0501081_0025513 3300049743 Bacteria 3976
1275 Ga0501081_0068445 3300049743 Bacteria 2471
1276 Ga0501081_0072126 3300049743 Bacteria 2408
1277 Ga0501081_0090356 3300049743 Bacteria 2153
1278 Ga0501081_0158960 3300049743 Bacteria 1627
1279 Ga0501083_0000294 3300049744 Bacteria 31378
1280 Ga0501083_0015159 3300049744 Bacteria 5396
1281 Ga0501083_0229740 3300049744 Unclassified 1208
1282 Ga0501083_0246283 3300049744 Bacteria 1164
1283 Ga0501035_0000303 3300049822 Bacteria 58024
1284 Ga0501035_0003674 3300049822 Bacteria 14625
1285 Ga0501035_0280356 3300049822 Bacteria 1409
1286 Ga0501035_0302893 3300049822 Unclassified 1346
1287 Ga0501044_0001480 3300049823 Bacteria 27532
1288 Ga0501044_0084921 3300049823 Bacteria 3199
1289 Ga0501045_0000017 3300049824 Bacteria 71857
1290 Ga0501045_0001276 3300049824 Bacteria 16726
1291 Ga0501045_0001594 3300049824 Bacteria 15148
1292 Ga0501045_0018668 3300049824 Bacteria 4937
1293 Ga0501045_0024950 3300049824 Bacteria 4295
1294 Ga0501045_0041915 3300049824 Bacteria 3331
1295 Ga0501045_0113602 3300049824 Bacteria 2008
1296 Ga0501045_0162019 3300049824 Unclassified 1665
1297 Ga0501045_0180790 3300049824 Unclassified 1571
1298 Ga0501045_0232210 3300049824 Unclassified 1373
1299 nmdc:mga05p37_171969_c1 3300050507 Bacteria 2642
1300 nmdc:mga05p37_19624_c1 3300050507 Bacteria 8175
1301 nmdc:mga05p37_29269_c1 3300050507 Bacteria 6723
1302 nmdc:mga05p37_436128_c1 3300050507 Bacteria 1521
1303 nmdc:mga05p37_6300_c1 3300050507 Bacteria 13965
1304 nmdc:mga05p37_659808_c1 3300050507 Unclassified 1170
1305 nmdc:mga05p37_77436_c1 3300050507 Bacteria 4094
1306 nmdc:mga09592_137531_c1 3300050508 Bacteria 2104
1307 nmdc:mga09592_182167_c1 3300050508 Bacteria 1817
1308 nmdc:mga09592_28270_c2 3300050508 Bacteria 3160
1309 nmdc:mga09592_374555_c1 3300050508 Bacteria 1231
1310 nmdc:mga09592_5828_c1 3300050508 Bacteria 10047
1311 nmdc:mga09592_62805_c1 3300050508 Bacteria 3142
1312 nmdc:mga0qj67_27683_c1 3300050509 Bacteria 4395
1313 nmdc:mga0qj67_4025_c1 3300050509 Unclassified 1042
1314 nmdc:mga0qj67_500599_c1 3300050509 Bacteria 977
1315 nmdc:mga06r32_195806_c1 3300050510 Bacteria 2008
1316 nmdc:mga06r32_49576_c1 3300050510 Bacteria 4015
1317 nmdc:mga08y16_266127_c1 3300050511 Bacteria 1770
1318 nmdc:mga08y16_41387_c1 3300050511 Bacteria 4827
1319 nmdc:mga08y16_43999_c1 3300050511 Bacteria 4679
1320 nmdc:mga08y16_50495_c1 3300050511 Bacteria 4353
1321 nmdc:mga08y16_59520_c1 3300050511 Bacteria 3989
1322 nmdc:mga0n895_226365_c1 3300050512 Bacteria 1898
1323 nmdc:mga0n895_714033_c1 3300050512 Bacteria 998
1324 nmdc:mga0rr50_172883_c1 3300050513 Bacteria 1762
1325 nmdc:mga0rr50_283648_c1 3300050513 Bacteria 1382
1326 nmdc:mga08x19_378608_c1 3300050514 Bacteria 991
1327 nmdc:mga08x19_591480_c1 3300050514 Unclassified 786
1328 nmdc:mga0a205_101074_c1 3300050515 Archaea 2782
1329 nmdc:mga0a205_10353_c1 3300050515 Bacteria 8572
1330 nmdc:mga0a205_137886_c1 3300050515 Bacteria 2340
1331 Ga0495601_0016630 3300053077 Bacteria 4459
1332 Ga0495601_0060497 3300053077 Bacteria 2403
1333 Ga0495601_0066465 3300053077 Bacteria 2295
1334 Ga0495601_0218882 3300053077 Bacteria 1243
1335 Ga0495612_0057276 3300053078 Unclassified 1609
1336 Ga0495612_0197777 3300053078 Unclassified 886
1337 Ga0495655_0000400 3300053083 Bacteria 7351
1338 Ga0495595_0004698 3300053084 Bacteria 5494
1339 Ga0495595_0033090 3300053084 Bacteria 2331
1340 Ga0495595_0047626 3300053084 Bacteria 1978
1341 Ga0495595_0219952 3300053084 Bacteria 948
1342 Ga0495619_0000441 3300053085 Bacteria 28038
1343 Ga0495619_0004147 3300053085 Bacteria 9261
1344 Ga0495619_0007322 3300053085 Bacteria 6991
1345 Ga0495619_0015016 3300053085 Bacteria 4894
1346 Ga0495619_0025840 3300053085 Bacteria 3774
1347 Ga0495619_0120410 3300053085 Bacteria 1799
1348 Ga0501084_0000120 3300054114 Bacteria 59271
1349 Ga0501084_0000985 3300054114 Bacteria 22070
1350 Ga0501084_0002144 3300054114 Bacteria 15775
1351 Ga0501084_0002421 3300054114 Bacteria 15015
1352 Ga0501084_0032475 3300054114 Bacteria 4366
1353 Ga0501084_0041752 3300054114 Bacteria 3837
1354 Ga0501084_0048275 3300054114 Bacteria 3563
1355 Ga0501084_0050875 3300054114 Bacteria 3467
1356 Ga0501084_0089815 3300054114 Bacteria 2579
1357 Ga0501084_0107896 3300054114 Bacteria 2339
1358 Ga0501084_0153354 3300054114 Bacteria 1943
1359 Ga0501084_0201607 3300054114 Bacteria 1679
1360 Ga0501084_0222672 3300054114 Unclassified 1592
1361 Ga0501084_0268057 3300054114 Bacteria 1442
1362 Ga0501084_0320820 3300054114 Bacteria 1308
1363 Ga0501084_0347229 3300054114 Bacteria 1253
1364 Ga0501084_0489942 3300054114 Bacteria 1039
1365 Ga0590074_008080 3300059423 Bacteria 1753
1366 Ga0501082_0000393 3300060353 Bacteria 38800
1367 Ga0501082_0011837 3300060353 Bacteria 7499
1368 Ga0501082_0016180 3300060353 Bacteria 6419
1369 Ga0501082_0021375 3300060353 Bacteria 5582
1370 Ga0501082_0051109 3300060353 Bacteria 3563
1371 Ga0501082_0096695 3300060353 Bacteria 2553
1372 Ga0501082_0098824 3300060353 Bacteria 2523
1373 Ga0501082_0104239 3300060353 Bacteria 2453
1374 Ga0501082_0134703 3300060353 Bacteria 2143
1375 Ga0501082_0307372 3300060353 Bacteria 1381
1376 Ga0501082_0396336 3300060353 Bacteria 1205
1377 Ga0501082_0487603 3300060353 Bacteria 1077
1378 Ga0466962_0006696 3300061719 Bacteria 5525
1379 Ga0530510_0001036 3300061734 Bacteria 18398
1380 Ga0530510_0005569 3300061734 Bacteria 8727
1381 Ga0530510_0008262 3300061734 Bacteria 7258
1382 Ga0530510_0008980 3300061734 Bacteria 7004
1383 Ga0530510_0049026 3300061734 Bacteria 3052
1384 Ga0530510_0052965 3300061734 Bacteria 2932
1385 Ga0530510_0069711 3300061734 Bacteria 2551
1386 Ga0530510_0143282 3300061734 Bacteria 1761
1387 Ga0530510_0156701 3300061734 Unclassified 1683
1388 Ga0530510_0186781 3300061734 Bacteria 1538
1389 Ga0530510_0245085 3300061734 Bacteria 1335
1390 Ga0530510_0348408 3300061734 Bacteria 1112
1391 Ga0530510_0459684 3300061734 Bacteria 963

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_10664228 Ga0207667_106642282 184
2 3300048904 Ga0496101_0029311 Ga0496101_0029311_2528_3196 200
3 3300041486 Ga0451807_1968779 Ga0451807_1968779_254_916 202
4 3300021441 Ga0213871_10009035 Ga0213871_100090353 203
5 3300046454 Ga0495592_0093141 Ga0495592_0093141_426_1037 203
6 3300046516 Ga0495628_0045502 Ga0495628_0045502_1528_2139 203
7 3300046529 Ga0495652_0163183 Ga0495652_0163183_293_904 203
8 3300048088 Ga0495602_0101513 Ga0495602_0101513_1623_2234 203
9 3300005331 Ga0070670_100005794 Ga0070670_1000057947 204
10 3300005356 Ga0070674_100002724 Ga0070674_1000027244 204
11 3300005577 Ga0068857_100007742 Ga0068857_1000077428 204
12 3300009147 Ga0114129_10098466 Ga0114129_100984661 204
13 3300009148 Ga0105243_10056476 Ga0105243_100564764 204
14 3300009176 Ga0105242_10028215 Ga0105242_100282155 204
15 3300011119 Ga0105246_10453979 Ga0105246_104539792 204
16 3300017792 Ga0163161_10327530 Ga0163161_103275302 204
17 3300025929 Ga0207664_10190833 Ga0207664_101908332 204
18 3300025934 Ga0207686_10011543 Ga0207686_100115432 204
19 3300025937 Ga0207669_10206108 Ga0207669_102061081 204
20 3300026116 Ga0207674_10006727 Ga0207674_100067279 204
21 3300027907 Ga0207428_10025233 Ga0207428_100252337 204
22 3300034819 Ga0373958_0015793 Ga0373958_0015793_20_634 204
23 3300041501 Ga0451845_0543180 Ga0451845_0543180_199_813 204
24 3300044694 Ga0466963_0361083 Ga0466963_0361083_311_994 204
25 3300045976 Ga0466967_0062313 Ga0466967_0062313_24_707 204
26 3300048907 Ga0496104_0414241 Ga0496104_0414241_129_818 204
27 3300048912 Ga0496109_0819826 Ga0496109_0819826_70_759 204
28 3300049572 Ga0501036_0423010 Ga0501036_0423010_69_686 204
29 3300049576 Ga0501040_0034592 Ga0501040_0034592_675_1292 204
30 3300049577 Ga0501041_0019626 Ga0501041_0019626_1277_1894 204
31 3300049579 Ga0501043_0051588 Ga0501043_0051588_1440_2057 204
32 3300049586 Ga0501070_0399721 Ga0501070_0399721_26_640 204
33 3300049587 Ga0501071_0049864 Ga0501071_0049864_2247_2861 204
34 3300049588 Ga0501072_0059461 Ga0501072_0059461_1436_2053 204
35 3300049590 Ga0501074_0462258 Ga0501074_0462258_10_624 204
36 3300049592 Ga0501076_0089262 Ga0501076_0089262_864_1481 204
37 3300049592 Ga0501076_0198358 Ga0501076_0198358_504_1118 204
38 3300049593 Ga0501077_0044698 Ga0501077_0044698_137_751 204
39 3300049593 Ga0501077_0058784 Ga0501077_0058784_147_764 204
40 3300049741 Ga0501079_0047478 Ga0501079_0047478_2206_2823 204
41 3300049743 Ga0501081_0072126 Ga0501081_0072126_1213_1827 204
42 3300049743 Ga0501081_0158960 Ga0501081_0158960_665_1282 204
43 3300049824 Ga0501045_0041915 Ga0501045_0041915_1724_2341 204
44 3300050507 nmdc:mga05p37_77436_c1 nmdc:mga05p37_77436_c1_2704_3333 204
45 3300054114 Ga0501084_0048275 Ga0501084_0048275_1377_1994 204
46 3300060353 Ga0501082_0104239 Ga0501082_0104239_1055_1672 204
47 3300026067 Ga0207678_10529956 Ga0207678_105299561 205
48 3300037466 Ga0395898_0811270 Ga0395898_0811270_50_709 205
49 3300050514 nmdc:mga08x19_378608_c1 nmdc:mga08x19_378608_c1_271_906 205
50 3300035170 Ga0373943_0000348 Ga0373943_0000348_1717_2355 206
51 3300035692 Ga0373935_0017226 Ga0373935_0017226_3106_3744 206
52 3300035695 Ga0373927_0199779 Ga0373927_0199779_623_1261 206
53 3300035725 Ga0373947_0002019 Ga0373947_0002019_8441_9079 206
54 3300037068 Ga0373925_0094572 Ga0373925_0094572_1589_2227 206
55 3300037418 Ga0395900_0382126 Ga0395900_0382126_523_1215 206
56 3300038443 Ga0395901_0159378 Ga0395901_0159378_1068_1760 206
57 3300046459 Ga0495629_0000685 Ga0495629_0000685_15376_16014 206
58 3300046461 Ga0495641_0004788 Ga0495641_0004788_875_1513 206
59 3300046463 Ga0495653_0018383 Ga0495653_0018383_395_1033 206
60 3300046473 Ga0495582_0003506 Ga0495582_0003506_3369_4007 206
61 3300046475 Ga0495639_0001909 Ga0495639_0001909_6302_6940 206
62 3300046476 Ga0495662_0005936 Ga0495662_0005936_2068_2706 206
63 3300046511 Ga0495608_0240156 Ga0495608_0240156_271_909 206
64 3300046514 Ga0495618_0145799 Ga0495618_0145799_529_1167 206
65 3300046517 Ga0495630_0107265 Ga0495630_0107265_248_886 206
66 3300046526 Ga0495666_0026651 Ga0495666_0026651_1556_2194 206
67 3300046531 Ga0495665_0002182 Ga0495665_0002182_3620_4258 206
68 3300046533 Ga0495640_0105752 Ga0495640_0105752_162_800 206
69 3300046559 Ga0495667_0013743 Ga0495667_0013743_1010_1648 206
70 3300046642 Ga0495634_0040698 Ga0495634_0040698_1552_2190 206
71 3300046663 Ga0495635_0055094 Ga0495635_0055094_30_668 206
72 3300046675 Ga0495657_0212939 Ga0495657_0212939_479_1117 206
73 3300046681 Ga0495647_0014020 Ga0495647_0014020_801_1439 206
74 3300046683 Ga0495658_0004562 Ga0495658_0004562_1734_2372 206
75 3300046689 Ga0495613_0045661 Ga0495613_0045661_2488_3126 206
76 3300047315 Ga0495581_0000096 Ga0495581_0000096_4498_5136 206
77 3300047319 Ga0495674_0012523 Ga0495674_0012523_2889_3527 206
78 3300047321 Ga0495676_0003591 Ga0495676_0003591_4775_5413 206
79 3300047322 Ga0495680_0012790 Ga0495680_0012790_3994_4632 206
80 3300047471 Ga0495684_0011499 Ga0495684_0011499_3841_4479 206
81 3300047673 Ga0495593_0006479 Ga0495593_0006479_4710_5348 206
82 3300048089 Ga0495614_0032651 Ga0495614_0032651_71_709 206
83 3300048911 Ga0496108_0137205 Ga0496108_0137205_964_1653 206
84 3300053085 Ga0495619_0007322 Ga0495619_0007322_4015_4653 206
85 3300049580 Ga0501046_0275856 Ga0501046_0275856_163_813 207
86 3300006175 Ga0070712_100294839 Ga0070712_1002948392 208
87 3300025915 Ga0207693_10068604 Ga0207693_100686042 208
88 3300002459 JGI24751J29686_10013783 JGI24751J29686_100137833 209
89 3300005328 Ga0070676_10282728 Ga0070676_102827281 209
90 3300005329 Ga0070683_100027412 Ga0070683_1000274123 209
91 3300005334 Ga0068869_100182580 Ga0068869_1001825802 209
92 3300005338 Ga0068868_100217082 Ga0068868_1002170822 209
93 3300005340 Ga0070689_100172286 Ga0070689_1001722863 209
94 3300005343 Ga0070687_100029265 Ga0070687_1000292653 209
95 3300005347 Ga0070668_100107489 Ga0070668_1001074894 209
96 3300005353 Ga0070669_100099402 Ga0070669_1000994021 209
97 3300005354 Ga0070675_100023222 Ga0070675_1000232224 209
98 3300005354 Ga0070675_100090968 Ga0070675_1000909684 209
99 3300005355 Ga0070671_100173488 Ga0070671_1001734883 209
100 3300005356 Ga0070674_100007148 Ga0070674_1000071484 209
101 3300005356 Ga0070674_100184491 Ga0070674_1001844911 209
102 3300005356 Ga0070674_100415540 Ga0070674_1004155402 209
103 3300005364 Ga0070673_100022803 Ga0070673_1000228034 209
104 3300005365 Ga0070688_100003445 Ga0070688_1000034457 209
105 3300005438 Ga0070701_10015349 Ga0070701_100153494 209
106 3300005445 Ga0070708_100056558 Ga0070708_1000565584 209
107 3300005456 Ga0070678_100012016 Ga0070678_1000120167 209
108 3300005459 Ga0068867_100107143 Ga0068867_1001071432 209
109 3300005466 Ga0070685_10006816 Ga0070685_100068167 209
110 3300005467 Ga0070706_100292541 Ga0070706_1002925413 209
111 3300005471 Ga0070698_100029853 Ga0070698_1000298534 209
112 3300005518 Ga0070699_100386592 Ga0070699_1003865922 209
113 3300005543 Ga0070672_100150410 Ga0070672_1001504103 209
114 3300005544 Ga0070686_100104149 Ga0070686_1001041493 209
115 3300005549 Ga0070704_100533841 Ga0070704_1005338412 209
116 3300005564 Ga0070664_100135794 Ga0070664_1001357941 209
117 3300005615 Ga0070702_100127111 Ga0070702_1001271112 209
118 3300005617 Ga0068859_100082634 Ga0068859_1000826344 209
119 3300005618 Ga0068864_100211114 Ga0068864_1002111143 209
120 3300005840 Ga0068870_10036786 Ga0068870_100367864 209
121 3300005840 Ga0068870_10071379 Ga0068870_100713793 209
122 3300005844 Ga0068862_100204699 Ga0068862_1002046993 209
123 3300005981 Ga0081538_10000053 Ga0081538_1000005394 209
124 3300006237 Ga0097621_100114346 Ga0097621_1001143462 209
125 3300006358 Ga0068871_100174376 Ga0068871_1001743763 209
126 3300006847 Ga0075431_100736708 Ga0075431_1007367082 209
127 3300006852 Ga0075433_10052274 Ga0075433_100522743 209
128 3300006880 Ga0075429_100169259 Ga0075429_1001692592 209
129 3300006881 Ga0068865_100013958 Ga0068865_1000139582 209
130 3300006881 Ga0068865_100024625 Ga0068865_1000246254 209
131 3300006931 Ga0097620_100082635 Ga0097620_1000826353 209
132 3300007076 Ga0075435_100128718 Ga0075435_1001287183 209
133 3300009094 Ga0111539_10033642 Ga0111539_100336423 209
134 3300009094 Ga0111539_10286871 Ga0111539_102868712 209
135 3300009098 Ga0105245_10128026 Ga0105245_101280261 209
136 3300009147 Ga0114129_10624218 Ga0114129_106242183 209
137 3300009147 Ga0114129_11414663 Ga0114129_114146632 209
138 3300009148 Ga0105243_10110898 Ga0105243_101108983 209
139 3300011119 Ga0105246_10012229 Ga0105246_100122296 209
140 3300011119 Ga0105246_10696606 Ga0105246_106966062 209
141 3300013308 Ga0157375_10010798 Ga0157375_100107988 209
142 3300014325 Ga0163163_10146985 Ga0163163_101469853 209
143 3300014326 Ga0157380_10025787 Ga0157380_100257873 209
144 3300014497 Ga0182008_10031835 Ga0182008_100318352 209
145 3300014745 Ga0157377_10008074 Ga0157377_100080744 209
146 3300014969 Ga0157376_10336839 Ga0157376_103368393 209
147 3300014969 Ga0157376_10401962 Ga0157376_104019622 209
148 3300025901 Ga0207688_10000535 Ga0207688_100005359 209
149 3300025907 Ga0207645_10274626 Ga0207645_102746262 209
150 3300025908 Ga0207643_10008455 Ga0207643_100084554 209
151 3300025918 Ga0207662_10038456 Ga0207662_100384563 209
152 3300025925 Ga0207650_10046675 Ga0207650_100466752 209
153 3300025926 Ga0207659_10029530 Ga0207659_100295304 209
154 3300025931 Ga0207644_10154916 Ga0207644_101549162 209
155 3300025937 Ga0207669_10008482 Ga0207669_100084827 209
156 3300025937 Ga0207669_10201814 Ga0207669_102018142 209
157 3300025937 Ga0207669_10567606 Ga0207669_105676061 209
158 3300025938 Ga0207704_10041773 Ga0207704_100417733 209
159 3300025938 Ga0207704_10231309 Ga0207704_102313092 209
160 3300025940 Ga0207691_10167526 Ga0207691_101675262 209
161 3300025942 Ga0207689_10091630 Ga0207689_100916302 209
162 3300025960 Ga0207651_10016608 Ga0207651_100166084 209
163 3300025960 Ga0207651_10279557 Ga0207651_102795572 209
164 3300025961 Ga0207712_10176030 Ga0207712_101760303 209
165 3300026023 Ga0207677_10787351 Ga0207677_107873511 209
166 3300026088 Ga0207641_10823405 Ga0207641_108234052 209
167 3300026118 Ga0207675_100148997 Ga0207675_1001489973 209
168 3300026121 Ga0207683_10006872 Ga0207683_1000687211 209
169 3300026121 Ga0207683_10020047 Ga0207683_100200473 209
170 3300028379 Ga0268266_10410049 Ga0268266_104100492 209
171 3300028380 Ga0268265_10180973 Ga0268265_101809733 209
172 3300038443 Ga0395901_0552588 Ga0395901_0552588_13_642 209
173 3300038443 Ga0395901_0784826 Ga0395901_0784826_28_657 209
174 3300042436 Ga0439435_0096555 Ga0439435_0096555_103_732 209
175 3300046455 Ga0495603_0171718 Ga0495603_0171718_145_774 209
176 3300046473 Ga0495582_0101616 Ga0495582_0101616_474_1103 209
177 3300046615 Ga0495656_0254226 Ga0495656_0254226_92_721 209
178 3300047315 Ga0495581_0151180 Ga0495581_0151180_588_1217 209
179 3300048906 Ga0496103_0268851 Ga0496103_0268851_20_667 209
180 3300048907 Ga0496104_0275841 Ga0496104_0275841_241_870 209
181 3300048908 Ga0496105_0036907 Ga0496105_0036907_1498_2145 209
182 3300048911 Ga0496108_0056838 Ga0496108_0056838_1001_1648 209
183 3300048912 Ga0496109_0063007 Ga0496109_0063007_2499_3128 209
184 3300048912 Ga0496109_0071649 Ga0496109_0071649_964_1611 209
185 3300048913 Ga0496110_0046602 Ga0496110_0046602_1214_1843 209
186 3300048913 Ga0496110_0088644 Ga0496110_0088644_2068_2715 209
187 3300048915 Ga0496112_0003082 Ga0496112_0003082_10048_10677 209
188 3300049568 Ga0501031_0039958 Ga0501031_0039958_622_1251 209
189 3300049568 Ga0501031_0432174 Ga0501031_0432174_27_656 209
190 3300049569 Ga0501032_0068094 Ga0501032_0068094_732_1361 209
191 3300049570 Ga0501033_0019452 Ga0501033_0019452_2661_3290 209
192 3300049572 Ga0501036_0042492 Ga0501036_0042492_1770_2399 209
193 3300049572 Ga0501036_0416668 Ga0501036_0416668_243_872 209
194 3300049574 Ga0501038_0007286 Ga0501038_0007286_1770_2399 209
195 3300049575 Ga0501039_0015416 Ga0501039_0015416_4405_5034 209
196 3300049576 Ga0501040_0047493 Ga0501040_0047493_1770_2399 209
197 3300049576 Ga0501040_0573698 Ga0501040_0573698_58_687 209
198 3300049577 Ga0501041_0017309 Ga0501041_0017309_1805_2434 209
199 3300049577 Ga0501041_0041256 Ga0501041_0041256_2090_2719 209
200 3300049578 Ga0501042_0009685 Ga0501042_0009685_1839_2468 209
201 3300049578 Ga0501042_0149677 Ga0501042_0149677_100_729 209
202 3300049580 Ga0501046_0011144 Ga0501046_0011144_4373_5002 209
203 3300049582 Ga0501048_0001796 Ga0501048_0001796_5103_5732 209
204 3300049584 Ga0501068_0002603 Ga0501068_0002603_1599_2228 209
205 3300049585 Ga0501069_0044575 Ga0501069_0044575_372_1001 209
206 3300049585 Ga0501069_0059946 Ga0501069_0059946_964_1593 209
207 3300049587 Ga0501071_0001183 Ga0501071_0001183_7323_7952 209
208 3300049587 Ga0501071_0275865 Ga0501071_0275865_155_784 209
209 3300049588 Ga0501072_0007864 Ga0501072_0007864_2521_3150 209
210 3300049590 Ga0501074_0000859 Ga0501074_0000859_11546_12175 209
211 3300049591 Ga0501075_0000839 Ga0501075_0000839_14880_15509 209
212 3300049592 Ga0501076_0045969 Ga0501076_0045969_1771_2400 209
213 3300049593 Ga0501077_0060687 Ga0501077_0060687_305_934 209
214 3300049593 Ga0501077_0114769 Ga0501077_0114769_42_671 209
215 3300049741 Ga0501079_0022542 Ga0501079_0022542_3261_3890 209
216 3300049742 Ga0501080_0008532 Ga0501080_0008532_498_1127 209
217 3300049742 Ga0501080_0159033 Ga0501080_0159033_917_1546 209
218 3300049822 Ga0501035_0003674 Ga0501035_0003674_848_1477 209
219 3300049822 Ga0501035_0280356 Ga0501035_0280356_515_1144 209
220 3300049824 Ga0501045_0113602 Ga0501045_0113602_728_1357 209
221 3300050508 nmdc:mga09592_137531_c1 nmdc:mga09592_137531_c1_495_1124 209
222 3300050508 nmdc:mga09592_182167_c1 nmdc:mga09592_182167_c1_467_1096 209
223 3300050510 nmdc:mga06r32_195806_c1 nmdc:mga06r32_195806_c1_823_1452 209
224 3300050511 nmdc:mga08y16_266127_c1 nmdc:mga08y16_266127_c1_29_658 209
225 3300050512 nmdc:mga0n895_714033_c1 nmdc:mga0n895_714033_c1_66_695 209
226 3300050515 nmdc:mga0a205_101074_c1 nmdc:mga0a205_101074_c1_162_791 209
227 3300054114 Ga0501084_0041752 Ga0501084_0041752_651_1280 209
228 3300054114 Ga0501084_0268057 Ga0501084_0268057_53_682 209
229 3300060353 Ga0501082_0011837 Ga0501082_0011837_2648_3277 209
230 3300061734 Ga0530510_0005569 Ga0530510_0005569_6280_6909 209
231 3300061734 Ga0530510_0049026 Ga0530510_0049026_1249_1878 209
232 3300005355 Ga0070671_100262769 Ga0070671_1002627691 210
233 3300005937 Ga0081455_10115983 Ga0081455_101159833 210
234 3300025931 Ga0207644_10065695 Ga0207644_100656953 210
235 3300025941 Ga0207711_10143958 Ga0207711_101439581 210
236 3300025944 Ga0207661_10090489 Ga0207661_100904894 210
237 3300044694 Ga0466963_0057169 Ga0466963_0057169_633_1292 210
238 3300044719 Ga0466971_0022578 Ga0466971_0022578_1617_2276 210
239 3300044842 Ga0466957_0011251 Ga0466957_0011251_1079_1738 210
240 3300048905 Ga0496102_0112078 Ga0496102_0112078_127_762 210
241 3300049577 Ga0501041_0348180 Ga0501041_0348180_86_718 210
242 3300049578 Ga0501042_0033769 Ga0501042_0033769_2869_3501 210
243 3300049585 Ga0501069_0031375 Ga0501069_0031375_1326_1961 210
244 3300049591 Ga0501075_0759204 Ga0501075_0759204_77_709 210
245 3300049592 Ga0501076_0065372 Ga0501076_0065372_731_1363 210
246 3300049593 Ga0501077_0069117 Ga0501077_0069117_779_1411 210
247 3300049741 Ga0501079_0179939 Ga0501079_0179939_491_1123 210
248 3300050514 nmdc:mga08x19_591480_c1 nmdc:mga08x19_591480_c1_119_754 210
249 3300060353 Ga0501082_0396336 Ga0501082_0396336_425_1057 210
250 3300060353 Ga0501082_0487603 Ga0501082_0487603_360_992 210
251 3300061719 Ga0466962_0006696 Ga0466962_0006696_3176_3835 210
252 3300061734 Ga0530510_0052965 Ga0530510_0052965_1306_1938 210
253 3300005334 Ga0068869_100315373 Ga0068869_1003153732 211
254 3300005347 Ga0070668_100084083 Ga0070668_1000840832 211
255 3300005347 Ga0070668_100333639 Ga0070668_1003336393 211
256 3300005356 Ga0070674_100197434 Ga0070674_1001974341 211
257 3300005406 Ga0070703_10062258 Ga0070703_100622582 211
258 3300005441 Ga0070700_100163839 Ga0070700_1001638392 211
259 3300005441 Ga0070700_100196000 Ga0070700_1001960001 211
260 3300005444 Ga0070694_100378279 Ga0070694_1003782792 211
261 3300005459 Ga0068867_100284653 Ga0068867_1002846533 211
262 3300005578 Ga0068854_100869055 Ga0068854_1008690551 211
263 3300005719 Ga0068861_101122433 Ga0068861_1011224331 211
264 3300005937 Ga0081455_10025482 Ga0081455_100254827 211
265 3300005981 Ga0081538_10000218 Ga0081538_1000021855 211
266 3300009094 Ga0111539_10003648 Ga0111539_1000364812 211
267 3300009148 Ga0105243_10102453 Ga0105243_101024533 211
268 3300009148 Ga0105243_10468365 Ga0105243_104683653 211
269 3300009176 Ga0105242_10070870 Ga0105242_100708703 211
270 3300010375 Ga0105239_10218440 Ga0105239_102184403 211
271 3300013105 Ga0157369_10035760 Ga0157369_100357607 211
272 3300013308 Ga0157375_10960274 Ga0157375_109602741 211
273 3300025899 Ga0207642_10339197 Ga0207642_103391972 211
274 3300025917 Ga0207660_10133667 Ga0207660_101336673 211
275 3300025927 Ga0207687_10075958 Ga0207687_100759582 211
276 3300025927 Ga0207687_10340008 Ga0207687_103400082 211
277 3300025934 Ga0207686_10166343 Ga0207686_101663433 211
278 3300025935 Ga0207709_10120710 Ga0207709_101207103 211
279 3300025935 Ga0207709_10223987 Ga0207709_102239873 211
280 3300025981 Ga0207640_10049574 Ga0207640_100495744 211
281 3300025981 Ga0207640_10590120 Ga0207640_105901202 211
282 3300026075 Ga0207708_10175979 Ga0207708_101759793 211
283 3300026089 Ga0207648_10076799 Ga0207648_100767993 211
284 3300026118 Ga0207675_100033826 Ga0207675_1000338262 211
285 3300028379 Ga0268266_10531024 Ga0268266_105310242 211
286 3300028563 Ga0265319_1025330 Ga0265319_10253303 211
287 3300028577 Ga0265318_10003761 Ga0265318_100037616 211
288 3300037466 Ga0395898_0395135 Ga0395898_0395135_228_863 211
289 3300037471 Ga0395905_0008167 Ga0395905_0008167_380_1015 211
290 3300047446 Ga0495679_081528 Ga0495679_081528_46_681 211
291 3300048905 Ga0496102_0063252 Ga0496102_0063252_432_1076 211
292 3300048905 Ga0496102_0317465 Ga0496102_0317465_199_879 211
293 3300048906 Ga0496103_0096349 Ga0496103_0096349_74_757 211
294 3300049591 Ga0501075_0199289 Ga0501075_0199289_834_1469 211
295 3300049593 Ga0501077_0462726 Ga0501077_0462726_60_695 211
296 3300061734 Ga0530510_0459684 Ga0530510_0459684_312_947 211
297 3300005327 Ga0070658_10073794 Ga0070658_100737943 212
298 3300005334 Ga0068869_100191614 Ga0068869_1001916142 212
299 3300005355 Ga0070671_100295114 Ga0070671_1002951141 212
300 3300005366 Ga0070659_100041480 Ga0070659_1000414802 212
301 3300005539 Ga0068853_100169008 Ga0068853_1001690082 212
302 3300005548 Ga0070665_100013479 Ga0070665_1000134796 212
303 3300005616 Ga0068852_100555689 Ga0068852_1005556893 212
304 3300005616 Ga0068852_100684370 Ga0068852_1006843702 212
305 3300005937 Ga0081455_10004421 Ga0081455_100044219 212
306 3300005981 Ga0081538_10018620 Ga0081538_100186206 212
307 3300005983 Ga0081540_1017275 Ga0081540_10172756 212
308 3300009093 Ga0105240_10355163 Ga0105240_103551632 212
309 3300009177 Ga0105248_10697499 Ga0105248_106974992 212
310 3300009545 Ga0105237_10206395 Ga0105237_102063954 212
311 3300010375 Ga0105239_10156767 Ga0105239_101567673 212
312 3300011119 Ga0105246_10608486 Ga0105246_106084863 212
313 3300013105 Ga0157369_10067560 Ga0157369_100675603 212
314 3300013307 Ga0157372_10480001 Ga0157372_104800013 212
315 3300025907 Ga0207645_10117434 Ga0207645_101174342 212
316 3300025913 Ga0207695_10450019 Ga0207695_104500192 212
317 3300025914 Ga0207671_10720560 Ga0207671_107205601 212
318 3300025920 Ga0207649_10088914 Ga0207649_100889143 212
319 3300025927 Ga0207687_10442715 Ga0207687_104427151 212
320 3300025932 Ga0207690_10071196 Ga0207690_100711963 212
321 3300025949 Ga0207667_10129750 Ga0207667_101297503 212
322 3300026067 Ga0207678_10175329 Ga0207678_101753292 212
323 3300028379 Ga0268266_10230307 Ga0268266_102303073 212
324 3300041456 Ga0451795_1456911 Ga0451795_1456911_256_915 212
325 3300044694 Ga0466963_0014018 Ga0466963_0014018_2341_3003 212
326 3300044694 Ga0466963_0052406 Ga0466963_0052406_1008_1667 212
327 3300045976 Ga0466967_0027088 Ga0466967_0027088_2359_3018 212
328 3300045976 Ga0466967_0386719 Ga0466967_0386719_24_677 212
329 3300046557 Ga0495622_0183680 Ga0495622_0183680_289_927 212
330 3300046674 Ga0495588_0136375 Ga0495588_0136375_334_993 212
331 3300048903 Ga0496100_0020623 Ga0496100_0020623_2395_3054 212
332 3300048904 Ga0496101_0081036 Ga0496101_0081036_336_995 212
333 3300048907 Ga0496104_0084458 Ga0496104_0084458_1195_1854 212
334 3300048909 Ga0496106_0547083 Ga0496106_0547083_237_896 212
335 3300048910 Ga0496107_0212393 Ga0496107_0212393_233_892 212
336 3300048912 Ga0496109_0061766 Ga0496109_0061766_693_1352 212
337 3300005436 Ga0070713_100455766 Ga0070713_1004557662 213
338 3300005439 Ga0070711_100287595 Ga0070711_1002875952 213
339 3300005530 Ga0070679_100013349 Ga0070679_1000133497 213
340 3300005614 Ga0068856_100483205 Ga0068856_1004832052 213
341 3300006175 Ga0070712_100042000 Ga0070712_1000420002 213
342 3300007076 Ga0075435_100480733 Ga0075435_1004807332 213
343 3300009551 Ga0105238_10344176 Ga0105238_103441762 213
344 3300010375 Ga0105239_10060646 Ga0105239_100606462 213
345 3300013102 Ga0157371_10185800 Ga0157371_101858003 213
346 3300013105 Ga0157369_10047041 Ga0157369_100470413 213
347 3300013297 Ga0157378_10774555 Ga0157378_107745552 213
348 3300025916 Ga0207663_10019782 Ga0207663_100197825 213
349 3300025927 Ga0207687_10118659 Ga0207687_101186594 213
350 3300025928 Ga0207700_10157183 Ga0207700_101571833 213
351 3300026121 Ga0207683_10891791 Ga0207683_108917912 213
352 3300048903 Ga0496100_0017082 Ga0496100_0017082_732_1391 213
353 3300048904 Ga0496101_0001024 Ga0496101_0001024_9882_10541 213
354 3300048905 Ga0496102_0012193 Ga0496102_0012193_6042_6701 213
355 3300048907 Ga0496104_0004406 Ga0496104_0004406_6177_6818 213
356 3300048907 Ga0496104_0008693 Ga0496104_0008693_386_1045 213
357 3300048908 Ga0496105_0010597 Ga0496105_0010597_5567_6208 213
358 3300048908 Ga0496105_0038173 Ga0496105_0038173_2611_3270 213
359 3300048909 Ga0496106_0031774 Ga0496106_0031774_2545_3204 213
360 3300048910 Ga0496107_0016203 Ga0496107_0016203_2258_2917 213
361 3300048911 Ga0496108_0433856 Ga0496108_0433856_385_1044 213
362 3300048912 Ga0496109_0032165 Ga0496109_0032165_1662_2342 213
363 3300048912 Ga0496109_0033330 Ga0496109_0033330_742_1401 213
364 3300048913 Ga0496110_0182717 Ga0496110_0182717_130_789 213
365 3300048915 Ga0496112_0077424 Ga0496112_0077424_812_1471 213
366 3300048917 Ga0496114_0009938 Ga0496114_0009938_523_1182 213
367 3300048917 Ga0496114_0252204 Ga0496114_0252204_524_1165 213
368 3300048918 Ga0496115_0000701 Ga0496115_0000701_17956_18615 213
369 3300048918 Ga0496115_0136347 Ga0496115_0136347_807_1448 213
370 3300049583 Ga0501067_0001827 Ga0501067_0001827_5410_6093 213
371 3300049584 Ga0501068_0007456 Ga0501068_0007456_1859_2542 213
372 3300049585 Ga0501069_0013593 Ga0501069_0013593_1798_2481 213
373 3300050513 nmdc:mga0rr50_283648_c1 nmdc:mga0rr50_283648_c1_528_1208 213
374 3300005439 Ga0070711_100167216 Ga0070711_1001672163 214
375 3300005937 Ga0081455_10189361 Ga0081455_101893612 214
376 3300044694 Ga0466963_0079595 Ga0466963_0079595_1450_2094 214
377 3300045976 Ga0466967_0288063 Ga0466967_0288063_256_900 214
378 3300049583 Ga0501067_0010668 Ga0501067_0010668_3115_3801 214
379 3300049583 Ga0501067_0029415 Ga0501067_0029415_1096_1743 214
380 3300049584 Ga0501068_0202652 Ga0501068_0202652_13_660 214
381 3300049585 Ga0501069_0081324 Ga0501069_0081324_94_780 214
382 3300049586 Ga0501070_0378440 Ga0501070_0378440_179_826 214
383 3300061734 Ga0530510_0143282 Ga0530510_0143282_394_1041 214
384 3300003203 JGI25406J46586_10082648 JGI25406J46586_100826482 215
385 3300005329 Ga0070683_100033341 Ga0070683_1000333415 215
386 3300005435 Ga0070714_100130942 Ga0070714_1001309422 215
387 3300005445 Ga0070708_100548146 Ga0070708_1005481461 215
388 3300005985 Ga0081539_10001005 Ga0081539_100010058 215
389 3300005985 Ga0081539_10004886 Ga0081539_100048862 215
390 3300006175 Ga0070712_100178092 Ga0070712_1001780922 215
391 3300006844 Ga0075428_100005053 Ga0075428_10000505315 215
392 3300006914 Ga0075436_100298661 Ga0075436_1002986611 215
393 3300009147 Ga0114129_10148778 Ga0114129_101487784 215
394 3300025917 Ga0207660_10119521 Ga0207660_101195211 215
395 3300025929 Ga0207664_10416198 Ga0207664_104161982 215
396 3300028573 Ga0265334_10067398 Ga0265334_100673981 215
397 3300028654 Ga0265322_10017061 Ga0265322_100170614 215
398 3300028800 Ga0265338_10006214 Ga0265338_100062148 215
399 3300028800 Ga0265338_10107122 Ga0265338_101071224 215
400 3300031241 Ga0265325_10033082 Ga0265325_100330823 215
401 3300031344 Ga0265316_10044789 Ga0265316_100447893 215
402 3300031711 Ga0265314_10009508 Ga0265314_100095083 215
403 3300037418 Ga0395900_0082860 Ga0395900_0082860_1062_1709 215
404 3300037466 Ga0395898_0012014 Ga0395898_0012014_373_1020 215
405 3300037471 Ga0395905_0068636 Ga0395905_0068636_1211_1858 215
406 3300038443 Ga0395901_0124343 Ga0395901_0124343_1610_2257 215
407 3300038443 Ga0395901_0835251 Ga0395901_0835251_27_674 215
408 3300046454 Ga0495592_0420337 Ga0495592_0420337_113_793 215
409 3300046543 Ga0495645_0250155 Ga0495645_0250155_48_728 215
410 3300046678 Ga0495599_0154266 Ga0495599_0154266_503_1183 215
411 3300048088 Ga0495602_0336955 Ga0495602_0336955_123_803 215
412 3300048907 Ga0496104_0178994 Ga0496104_0178994_421_1104 215
413 3300049575 Ga0501039_0335691 Ga0501039_0335691_388_1074 215
414 3300049591 Ga0501075_0302818 Ga0501075_0302818_463_1149 215
415 3300050507 nmdc:mga05p37_171969_c1 nmdc:mga05p37_171969_c1_1189_1836 215
416 3300050507 nmdc:mga05p37_29269_c1 nmdc:mga05p37_29269_c1_3836_4483 215
417 3300050508 nmdc:mga09592_374555_c1 nmdc:mga09592_374555_c1_554_1201 215
418 3300050510 nmdc:mga06r32_49576_c1 nmdc:mga06r32_49576_c1_3210_3857 215
419 3300054114 Ga0501084_0089815 Ga0501084_0089815_1301_1987 215
420 3300059423 Ga0590074_008080 Ga0590074_008080_222_914 215
421 3300060353 Ga0501082_0307372 Ga0501082_0307372_642_1328 215
422 3300061734 Ga0530510_0245085 Ga0530510_0245085_323_970 215
423 3300005364 Ga0070673_100265460 Ga0070673_1002654602 216
424 3300005834 Ga0068851_10122852 Ga0068851_101228523 216
425 3300013308 Ga0157375_10335992 Ga0157375_103359923 216
426 3300014969 Ga0157376_10287110 Ga0157376_102871102 216
427 3300026142 Ga0207698_10252068 Ga0207698_102520683 216
428 3300048906 Ga0496103_0201162 Ga0496103_0201162_352_1041 216
429 3300048917 Ga0496114_0098509 Ga0496114_0098509_1721_2380 216
430 3300049570 Ga0501033_0038330 Ga0501033_0038330_118_804 216
431 3300049572 Ga0501036_0055141 Ga0501036_0055141_1775_2461 216
432 3300049574 Ga0501038_0080270 Ga0501038_0080270_1016_1702 216
433 3300049575 Ga0501039_0467379 Ga0501039_0467379_98_784 216
434 3300049576 Ga0501040_0005343 Ga0501040_0005343_481_1167 216
435 3300049577 Ga0501041_0152656 Ga0501041_0152656_532_1218 216
436 3300049578 Ga0501042_0000695 Ga0501042_0000695_5169_5855 216
437 3300049579 Ga0501043_0130953 Ga0501043_0130953_74_760 216
438 3300049582 Ga0501048_0063434 Ga0501048_0063434_340_1026 216
439 3300049587 Ga0501071_0004051 Ga0501071_0004051_7149_7835 216
440 3300049588 Ga0501072_0040889 Ga0501072_0040889_2585_3271 216
441 3300049591 Ga0501075_0007131 Ga0501075_0007131_3026_3712 216
442 3300049592 Ga0501076_0005537 Ga0501076_0005537_5503_6189 216
443 3300049593 Ga0501077_0010553 Ga0501077_0010553_1975_2661 216
444 3300049741 Ga0501079_0017893 Ga0501079_0017893_3027_3713 216
445 3300049742 Ga0501080_0231114 Ga0501080_0231114_473_1159 216
446 3300049743 Ga0501081_0015036 Ga0501081_0015036_2904_3590 216
447 3300049822 Ga0501035_0302893 Ga0501035_0302893_456_1142 216
448 3300049824 Ga0501045_0024950 Ga0501045_0024950_2969_3655 216
449 3300054114 Ga0501084_0002144 Ga0501084_0002144_2826_3512 216
450 3300060353 Ga0501082_0134703 Ga0501082_0134703_971_1657 216
451 3300061734 Ga0530510_0348408 Ga0530510_0348408_78_764 216
452 3300003203 JGI25406J46586_10013135 JGI25406J46586_100131354 217
453 3300005435 Ga0070714_100395853 Ga0070714_1003958531 217
454 3300005437 Ga0070710_10074017 Ga0070710_100740172 217
455 3300005985 Ga0081539_10003144 Ga0081539_100031444 217
456 3300006038 Ga0075365_10055904 Ga0075365_100559043 217
457 3300006175 Ga0070712_100155349 Ga0070712_1001553493 217
458 3300009176 Ga0105242_10365697 Ga0105242_103656973 217
459 3300014325 Ga0163163_11089740 Ga0163163_110897401 217
460 3300014326 Ga0157380_10133071 Ga0157380_101330714 217
461 3300025915 Ga0207693_10058762 Ga0207693_100587624 217
462 3300028379 Ga0268266_10562841 Ga0268266_105628413 217
463 3300031852 Ga0307410_10001992 Ga0307410_100019926 217
464 3300031901 Ga0307406_10065194 Ga0307406_100651942 217
465 3300031903 Ga0307407_10000349 Ga0307407_100003497 217
466 3300032004 Ga0307414_10052282 Ga0307414_100522824 217
467 3300032005 Ga0307411_10114964 Ga0307411_101149642 217
468 3300032126 Ga0307415_100001163 Ga0307415_10000116312 217
469 3300046454 Ga0495592_0110842 Ga0495592_0110842_781_1473 217
470 3300046462 Ga0495651_0196263 Ga0495651_0196263_131_823 217
471 3300046517 Ga0495630_0045557 Ga0495630_0045557_1693_2385 217
472 3300046533 Ga0495640_0239368 Ga0495640_0239368_112_804 217
473 3300046536 Ga0495587_0338492 Ga0495587_0338492_17_709 217
474 3300046543 Ga0495645_0103876 Ga0495645_0103876_981_1673 217
475 3300046559 Ga0495667_0008058 Ga0495667_0008058_5214_5906 217
476 3300046642 Ga0495634_0063428 Ga0495634_0063428_642_1334 217
477 3300046663 Ga0495635_0008303 Ga0495635_0008303_2187_2879 217
478 3300046809 Ga0495600_0127553 Ga0495600_0127553_367_1059 217
479 3300047319 Ga0495674_0046499 Ga0495674_0046499_2644_3336 217
480 3300047322 Ga0495680_0014352 Ga0495680_0014352_3933_4625 217
481 3300047471 Ga0495684_0018011 Ga0495684_0018011_981_1673 217
482 3300048903 Ga0496100_0010608 Ga0496100_0010608_2092_2811 217
483 3300048905 Ga0496102_0198763 Ga0496102_0198763_898_1617 217
484 3300048910 Ga0496107_0269984 Ga0496107_0269984_544_1236 217
485 3300048917 Ga0496114_0012025 Ga0496114_0012025_1254_1946 217
486 3300048917 Ga0496114_0074362 Ga0496114_0074362_1648_2367 217
487 3300048918 Ga0496115_0002745 Ga0496115_0002745_3913_4632 217
488 3300049583 Ga0501067_0059493 Ga0501067_0059493_954_1673 217
489 3300053077 Ga0495601_0016630 Ga0495601_0016630_1304_1996 217
490 3300053084 Ga0495595_0004698 Ga0495595_0004698_137_829 217
491 3300053085 Ga0495619_0000441 Ga0495619_0000441_8279_8971 217
492 3300001991 JGI24743J22301_10005676 JGI24743J22301_100056763 218
493 3300002075 JGI24738J21930_10001833 JGI24738J21930_100018333 218
494 3300003373 JGI25407J50210_10034210 JGI25407J50210_100342103 218
495 3300005327 Ga0070658_10002943 Ga0070658_100029436 218
496 3300005329 Ga0070683_100006766 Ga0070683_1000067662 218
497 3300005337 Ga0070682_100001656 Ga0070682_10000165614 218
498 3300005337 Ga0070682_100240416 Ga0070682_1002404162 218
499 3300005339 Ga0070660_100092427 Ga0070660_1000924274 218
500 3300005344 Ga0070661_100105277 Ga0070661_1001052773 218
501 3300005344 Ga0070661_100303446 Ga0070661_1003034462 218
502 3300005356 Ga0070674_100009851 Ga0070674_1000098514 218
503 3300005438 Ga0070701_10036567 Ga0070701_100365673 218
504 3300005458 Ga0070681_10012775 Ga0070681_100127758 218
505 3300005535 Ga0070684_100019041 Ga0070684_1000190415 218
506 3300005535 Ga0070684_100287010 Ga0070684_1002870103 218
507 3300005539 Ga0068853_100338089 Ga0068853_1003380891 218
508 3300005545 Ga0070695_100018857 Ga0070695_1000188574 218
509 3300005563 Ga0068855_100358543 Ga0068855_1003585432 218
510 3300005563 Ga0068855_100422644 Ga0068855_1004226443 218
511 3300005577 Ga0068857_100025515 Ga0068857_1000255154 218
512 3300005578 Ga0068854_100399798 Ga0068854_1003997982 218
513 3300005616 Ga0068852_100027238 Ga0068852_1000272383 218
514 3300005937 Ga0081455_10166101 Ga0081455_101661013 218
515 3300005981 Ga0081538_10000755 Ga0081538_1000075527 218
516 3300005981 Ga0081538_10005147 Ga0081538_1000514712 218
517 3300009093 Ga0105240_10150029 Ga0105240_101500294 218
518 3300009148 Ga0105243_10003343 Ga0105243_100033435 218
519 3300009176 Ga0105242_10084615 Ga0105242_100846153 218
520 3300013100 Ga0157373_10135538 Ga0157373_101355384 218
521 3300013102 Ga0157371_10008600 Ga0157371_100086009 218
522 3300013105 Ga0157369_10351166 Ga0157369_103511663 218
523 3300013105 Ga0157369_10384972 Ga0157369_103849723 218
524 3300013296 Ga0157374_10008652 Ga0157374_100086524 218
525 3300013307 Ga0157372_10100141 Ga0157372_101001413 218
526 3300013307 Ga0157372_10175964 Ga0157372_101759644 218
527 3300020081 Ga0206354_11680607 Ga0206354_116806073 218
528 3300025904 Ga0207647_10087541 Ga0207647_100875412 218
529 3300025912 Ga0207707_10002976 Ga0207707_100029762 218
530 3300025912 Ga0207707_10152044 Ga0207707_101520444 218
531 3300025913 Ga0207695_10213806 Ga0207695_102138062 218
532 3300025919 Ga0207657_10001365 Ga0207657_1000136524 218
533 3300025919 Ga0207657_10002032 Ga0207657_100020325 218
534 3300025920 Ga0207649_10466834 Ga0207649_104668342 218
535 3300025921 Ga0207652_10007377 Ga0207652_100073778 218
536 3300025921 Ga0207652_10017983 Ga0207652_100179832 218
537 3300025924 Ga0207694_10037957 Ga0207694_100379575 218
538 3300025924 Ga0207694_10153565 Ga0207694_101535653 218
539 3300025926 Ga0207659_10020288 Ga0207659_100202881 218
540 3300025932 Ga0207690_10012423 Ga0207690_100124232 218
541 3300025933 Ga0207706_10008670 Ga0207706_100086706 218
542 3300025934 Ga0207686_10063371 Ga0207686_100633713 218
543 3300025940 Ga0207691_10029283 Ga0207691_100292835 218
544 3300025941 Ga0207711_10185534 Ga0207711_101855344 218
545 3300025945 Ga0207679_10032437 Ga0207679_100324373 218
546 3300025949 Ga0207667_10053702 Ga0207667_100537025 218
547 3300025949 Ga0207667_10223825 Ga0207667_102238252 218
548 3300026023 Ga0207677_10088709 Ga0207677_100887091 218
549 3300026041 Ga0207639_10008867 Ga0207639_100088676 218
550 3300026089 Ga0207648_10004479 Ga0207648_100044797 218
551 3300035089 Ga0373944_0032038 Ga0373944_0032038_455_1117 218
552 3300035170 Ga0373943_0011820 Ga0373943_0011820_1452_2114 218
553 3300035170 Ga0373943_0386432 Ga0373943_0386432_52_708 218
554 3300035695 Ga0373927_0063317 Ga0373927_0063317_130_786 218
555 3300035725 Ga0373947_0002635 Ga0373947_0002635_5636_6292 218
556 3300037068 Ga0373925_0016553 Ga0373925_0016553_1325_1981 218
557 3300037068 Ga0373925_0041085 Ga0373925_0041085_2712_3374 218
558 3300037312 Ga0395899_0105744 Ga0395899_0105744_12_671 218
559 3300037418 Ga0395900_0160270 Ga0395900_0160270_586_1245 218
560 3300037418 Ga0395900_0201186 Ga0395900_0201186_228_887 218
561 3300037466 Ga0395898_0102809 Ga0395898_0102809_792_1451 218
562 3300037466 Ga0395898_0316496 Ga0395898_0316496_528_1190 218
563 3300038443 Ga0395901_0001883 Ga0395901_0001883_17745_18404 218
564 3300038443 Ga0395901_0020566 Ga0395901_0020566_3079_3738 218
565 3300038443 Ga0395901_0030500 Ga0395901_0030500_1662_2321 218
566 3300044693 Ga0466961_0012851 Ga0466961_0012851_2185_2844 218
567 3300044694 Ga0466963_0015404 Ga0466963_0015404_2746_3408 218
568 3300044694 Ga0466963_0154620 Ga0466963_0154620_450_1112 218
569 3300044719 Ga0466971_0051216 Ga0466971_0051216_129_788 218
570 3300044842 Ga0466957_0190032 Ga0466957_0190032_439_1113 218
571 3300045049 Ga0466959_0024314 Ga0466959_0024314_337_996 218
572 3300045836 Ga0466958_0019375 Ga0466958_0019375_692_1351 218
573 3300045976 Ga0466967_0003018 Ga0466967_0003018_6341_7000 218
574 3300045976 Ga0466967_0065517 Ga0466967_0065517_471_1133 218
575 3300045976 Ga0466967_0084549 Ga0466967_0084549_727_1386 218
576 3300045976 Ga0466967_0156303 Ga0466967_0156303_887_1549 218
577 3300045976 Ga0466967_0185694 Ga0466967_0185694_787_1446 218
578 3300046461 Ga0495641_0028580 Ga0495641_0028580_238_900 218
579 3300046472 Ga0495580_0338407 Ga0495580_0338407_234_890 218
580 3300046473 Ga0495582_0039470 Ga0495582_0039470_859_1521 218
581 3300046683 Ga0495658_0158524 Ga0495658_0158524_11_673 218
582 3300048905 Ga0496102_0190594 Ga0496102_0190594_1121_1807 218
583 3300048909 Ga0496106_0367167 Ga0496106_0367167_100_786 218
584 3300049575 Ga0501039_0086991 Ga0501039_0086991_1057_1743 218
585 3300049578 Ga0501042_0443758 Ga0501042_0443758_184_870 218
586 3300049579 Ga0501043_0272575 Ga0501043_0272575_370_1029 218
587 3300049580 Ga0501046_0263734 Ga0501046_0263734_434_1120 218
588 3300049581 Ga0501047_0046548 Ga0501047_0046548_64_723 218
589 3300049583 Ga0501067_0001625 Ga0501067_0001625_2405_3067 218
590 3300049583 Ga0501067_0210247 Ga0501067_0210247_102_761 218
591 3300049585 Ga0501069_0007623 Ga0501069_0007623_897_1559 218
592 3300049585 Ga0501069_0145356 Ga0501069_0145356_409_1068 218
593 3300049586 Ga0501070_0120704 Ga0501070_0120704_168_827 218
594 3300049587 Ga0501071_0063841 Ga0501071_0063841_1201_1887 218
595 3300049588 Ga0501072_0016896 Ga0501072_0016896_3459_4145 218
596 3300049589 Ga0501073_0214897 Ga0501073_0214897_152_838 218
597 3300049590 Ga0501074_0083055 Ga0501074_0083055_302_961 218
598 3300049590 Ga0501074_0224469 Ga0501074_0224469_181_867 218
599 3300049590 Ga0501074_0234980 Ga0501074_0234980_361_1020 218
600 3300049592 Ga0501076_0011459 Ga0501076_0011459_4826_5512 218
601 3300049742 Ga0501080_0070394 Ga0501080_0070394_156_815 218
602 3300049742 Ga0501080_0177276 Ga0501080_0177276_461_1147 218
603 3300049742 Ga0501080_0471837 Ga0501080_0471837_295_954 218
604 3300049824 Ga0501045_0018668 Ga0501045_0018668_2368_3054 218
605 3300054114 Ga0501084_0347229 Ga0501084_0347229_177_863 218
606 3300005329 Ga0070683_100152146 Ga0070683_1001521461 219
607 3300005336 Ga0070680_100040799 Ga0070680_1000407992 219
608 3300005339 Ga0070660_100001098 Ga0070660_10000109816 219
609 3300005339 Ga0070660_100203938 Ga0070660_1002039382 219
610 3300005344 Ga0070661_100442981 Ga0070661_1004429811 219
611 3300005366 Ga0070659_100020596 Ga0070659_1000205962 219
612 3300005457 Ga0070662_100390905 Ga0070662_1003909052 219
613 3300005458 Ga0070681_10462193 Ga0070681_104621931 219
614 3300005530 Ga0070679_100029390 Ga0070679_1000293905 219
615 3300005616 Ga0068852_100492650 Ga0068852_1004926502 219
616 3300005719 Ga0068861_100285535 Ga0068861_1002855353 219
617 3300005844 Ga0068862_100509024 Ga0068862_1005090242 219
618 3300005985 Ga0081539_10081320 Ga0081539_100813203 219
619 3300006914 Ga0075436_100268032 Ga0075436_1002680322 219
620 3300009545 Ga0105237_10731463 Ga0105237_107314632 219
621 3300013102 Ga0157371_10108986 Ga0157371_101089863 219
622 3300025909 Ga0207705_10092043 Ga0207705_100920433 219
623 3300025912 Ga0207707_10078522 Ga0207707_100785221 219
624 3300025914 Ga0207671_10263437 Ga0207671_102634372 219
625 3300025919 Ga0207657_10055492 Ga0207657_100554924 219
626 3300025920 Ga0207649_10140630 Ga0207649_101406302 219
627 3300025933 Ga0207706_10284450 Ga0207706_102844503 219
628 3300025944 Ga0207661_10245655 Ga0207661_102456553 219
629 3300026118 Ga0207675_100086196 Ga0207675_1000861963 219
630 3300045976 Ga0466967_0225491 Ga0466967_0225491_403_1128 219
631 3300046615 Ga0495656_0309904 Ga0495656_0309904_118_777 219
632 3300003373 JGI25407J50210_10058135 JGI25407J50210_100581352 220
633 3300005445 Ga0070708_100012455 Ga0070708_1000124554 220
634 3300005981 Ga0081538_10018080 Ga0081538_100180806 220
635 3300009176 Ga0105242_10335384 Ga0105242_103353842 220
636 3300009553 Ga0105249_10432403 Ga0105249_104324031 220
637 3300013308 Ga0157375_10500167 Ga0157375_105001671 220
638 3300014969 Ga0157376_10365130 Ga0157376_103651301 220
639 3300037466 Ga0395898_0526328 Ga0395898_0526328_231_926 220
640 3300038443 Ga0395901_0296248 Ga0395901_0296248_838_1500 220
641 3300048905 Ga0496102_0220089 Ga0496102_0220089_1012_1674 220
642 3300048910 Ga0496107_0522224 Ga0496107_0522224_21_683 220
643 3300005327 Ga0070658_10009777 Ga0070658_100097777 221
644 3300005329 Ga0070683_100012195 Ga0070683_1000121953 221
645 3300005336 Ga0070680_100001631 Ga0070680_10000163117 221
646 3300005339 Ga0070660_100005732 Ga0070660_1000057326 221
647 3300005344 Ga0070661_100229993 Ga0070661_1002299932 221
648 3300005436 Ga0070713_100100872 Ga0070713_1001008724 221
649 3300005436 Ga0070713_100125863 Ga0070713_1001258633 221
650 3300005445 Ga0070708_100493461 Ga0070708_1004934611 221
651 3300005458 Ga0070681_10046981 Ga0070681_100469813 221
652 3300005530 Ga0070679_100012420 Ga0070679_1000124208 221
653 3300005535 Ga0070684_100002408 Ga0070684_10000240812 221
654 3300005548 Ga0070665_100588118 Ga0070665_1005881182 221
655 3300005563 Ga0068855_100028552 Ga0068855_1000285524 221
656 3300005563 Ga0068855_100206313 Ga0068855_1002063133 221
657 3300005577 Ga0068857_100338388 Ga0068857_1003383882 221
658 3300005616 Ga0068852_100047747 Ga0068852_1000477472 221
659 3300005937 Ga0081455_10163130 Ga0081455_101631303 221
660 3300006163 Ga0070715_10005089 Ga0070715_100050896 221
661 3300006173 Ga0070716_100039814 Ga0070716_1000398143 221
662 3300009094 Ga0111539_10535509 Ga0111539_105355093 221
663 3300013104 Ga0157370_10022920 Ga0157370_100229203 221
664 3300020070 Ga0206356_11887349 Ga0206356_118873493 221
665 3300020082 Ga0206353_10400033 Ga0206353_104000333 221
666 3300020082 Ga0206353_10869854 Ga0206353_108698545 221
667 3300025909 Ga0207705_10113133 Ga0207705_101131332 221
668 3300025912 Ga0207707_10050464 Ga0207707_100504645 221
669 3300025913 Ga0207695_10092181 Ga0207695_100921814 221
670 3300025917 Ga0207660_10013907 Ga0207660_100139076 221
671 3300025917 Ga0207660_10530605 Ga0207660_105306052 221
672 3300025919 Ga0207657_10000166 Ga0207657_1000016643 221
673 3300025921 Ga0207652_10021270 Ga0207652_100212703 221
674 3300025921 Ga0207652_10052695 Ga0207652_100526952 221
675 3300025934 Ga0207686_10345409 Ga0207686_103454092 221
676 3300025949 Ga0207667_10025437 Ga0207667_100254378 221
677 3300025949 Ga0207667_10300712 Ga0207667_103007122 221
678 3300026116 Ga0207674_10172272 Ga0207674_101722723 221
679 3300026118 Ga0207675_100147891 Ga0207675_1001478913 221
680 3300026118 Ga0207675_100716033 Ga0207675_1007160332 221
681 3300026142 Ga0207698_10057052 Ga0207698_100570524 221
682 3300031235 Ga0265330_10020397 Ga0265330_100203974 221
683 3300031247 Ga0265340_10216111 Ga0265340_102161112 221
684 3300035724 Ga0373933_0016502 Ga0373933_0016502_1582_2262 221
685 3300036401 Ga0373937_0041990 Ga0373937_0041990_567_1247 221
686 3300044706 Ga0466964_0003963 Ga0466964_0003963_306_989 221
687 3300044901 Ga0466960_0025806 Ga0466960_0025806_468_1151 221
688 3300045976 Ga0466967_0003281 Ga0466967_0003281_7377_8060 221
689 3300046454 Ga0495592_0149436 Ga0495592_0149436_175_855 221
690 3300046454 Ga0495592_0333276 Ga0495592_0333276_162_830 221
691 3300046459 Ga0495629_0286383 Ga0495629_0286383_191_871 221
692 3300046461 Ga0495641_0039327 Ga0495641_0039327_259_927 221
693 3300046462 Ga0495651_0025023 Ga0495651_0025023_602_1282 221
694 3300046462 Ga0495651_0050868 Ga0495651_0050868_1694_2362 221
695 3300046463 Ga0495653_0009654 Ga0495653_0009654_1266_1946 221
696 3300046463 Ga0495653_0076547 Ga0495653_0076547_769_1437 221
697 3300046477 Ga0495664_0040904 Ga0495664_0040904_652_1332 221
698 3300046511 Ga0495608_0006652 Ga0495608_0006652_3800_4480 221
699 3300046516 Ga0495628_0022530 Ga0495628_0022530_1278_1946 221
700 3300046516 Ga0495628_0042397 Ga0495628_0042397_208_888 221
701 3300046517 Ga0495630_0012976 Ga0495630_0012976_1272_1940 221
702 3300046517 Ga0495630_0026151 Ga0495630_0026151_2051_2731 221
703 3300046529 Ga0495652_0062254 Ga0495652_0062254_416_1096 221
704 3300046529 Ga0495652_0151372 Ga0495652_0151372_384_1052 221
705 3300046531 Ga0495665_0090260 Ga0495665_0090260_885_1553 221
706 3300046533 Ga0495640_0017130 Ga0495640_0017130_3446_4114 221
707 3300046536 Ga0495587_0024356 Ga0495587_0024356_1373_2053 221
708 3300046543 Ga0495645_0170790 Ga0495645_0170790_709_1389 221
709 3300046559 Ga0495667_0006276 Ga0495667_0006276_3995_4663 221
710 3300046559 Ga0495667_0043084 Ga0495667_0043084_628_1308 221
711 3300046642 Ga0495634_0014543 Ga0495634_0014543_1456_2124 221
712 3300046663 Ga0495635_0104629 Ga0495635_0104629_548_1228 221
713 3300046675 Ga0495657_0022472 Ga0495657_0022472_1254_1934 221
714 3300046675 Ga0495657_0050396 Ga0495657_0050396_947_1615 221
715 3300046678 Ga0495599_0143711 Ga0495599_0143711_283_963 221
716 3300046679 Ga0495623_0009860 Ga0495623_0009860_823_1503 221
717 3300046680 Ga0495646_0053276 Ga0495646_0053276_1592_2272 221
718 3300046683 Ga0495658_0142270 Ga0495658_0142270_64_732 221
719 3300046689 Ga0495613_0037388 Ga0495613_0037388_2025_2693 221
720 3300046690 Ga0495624_0021440 Ga0495624_0021440_1847_2527 221
721 3300046809 Ga0495600_0021977 Ga0495600_0021977_1659_2339 221
722 3300046809 Ga0495600_0410002 Ga0495600_0410002_57_725 221
723 3300047317 Ga0495604_0006659 Ga0495604_0006659_5843_6523 221
724 3300047319 Ga0495674_0002194 Ga0495674_0002194_14595_15263 221
725 3300047319 Ga0495674_0015466 Ga0495674_0015466_6172_6852 221
726 3300047322 Ga0495680_0005411 Ga0495680_0005411_5074_5742 221
727 3300047322 Ga0495680_0067791 Ga0495680_0067791_363_1043 221
728 3300047444 Ga0495675_0002014 Ga0495675_0002014_8749_9429 221
729 3300047471 Ga0495684_0009628 Ga0495684_0009628_5141_5821 221
730 3300047471 Ga0495684_0285148 Ga0495684_0285148_217_885 221
731 3300048088 Ga0495602_0023064 Ga0495602_0023064_3737_4417 221
732 3300048918 Ga0496115_0344628 Ga0496115_0344628_522_1190 221
733 3300049584 Ga0501068_0003100 Ga0501068_0003100_1278_1946 221
734 3300053077 Ga0495601_0060497 Ga0495601_0060497_1456_2136 221
735 3300053078 Ga0495612_0057276 Ga0495612_0057276_742_1422 221
736 3300053084 Ga0495595_0033090 Ga0495595_0033090_173_853 221
737 3300053085 Ga0495619_0004147 Ga0495619_0004147_5843_6523 221
738 3300053085 Ga0495619_0015016 Ga0495619_0015016_1567_2235 221
739 3300005339 Ga0070660_100082411 Ga0070660_1000824114 222
740 3300005367 Ga0070667_100002001 Ga0070667_1000020017 222
741 3300005535 Ga0070684_100020894 Ga0070684_1000208947 222
742 3300005546 Ga0070696_100376786 Ga0070696_1003767862 222
743 3300005563 Ga0068855_100067743 Ga0068855_1000677435 222
744 3300005614 Ga0068856_100227960 Ga0068856_1002279602 222
745 3300009093 Ga0105240_10151735 Ga0105240_101517353 222
746 3300013104 Ga0157370_10015040 Ga0157370_100150404 222
747 3300013105 Ga0157369_10002470 Ga0157369_100024703 222
748 3300020070 Ga0206356_10502231 Ga0206356_105022312 222
749 3300020081 Ga0206354_11615480 Ga0206354_116154802 222
750 3300020082 Ga0206353_11689011 Ga0206353_116890118 222
751 3300025913 Ga0207695_10805197 Ga0207695_108051971 222
752 3300025919 Ga0207657_10078925 Ga0207657_100789252 222
753 3300025986 Ga0207658_10002326 Ga0207658_100023267 222
754 3300026078 Ga0207702_10059747 Ga0207702_100597472 222
755 3300028577 Ga0265318_10027261 Ga0265318_100272613 222
756 3300031595 Ga0265313_10122558 Ga0265313_101225582 222
757 3300031595 Ga0265313_10183566 Ga0265313_101835661 222
758 3300036401 Ga0373937_0166180 Ga0373937_0166180_43_735 222
759 3300037466 Ga0395898_0089314 Ga0395898_0089314_871_1557 222
760 3300037471 Ga0395905_0103074 Ga0395905_0103074_914_1600 222
761 3300038443 Ga0395901_0009984 Ga0395901_0009984_98_784 222
762 3300041462 Ga0451806_051954 Ga0451806_051954_45_734 222
763 3300044694 Ga0466963_0280344 Ga0466963_0280344_90_788 222
764 3300044706 Ga0466964_0050315 Ga0466964_0050315_451_1137 222
765 3300044735 Ga0466968_0048085 Ga0466968_0048085_430_1128 222
766 3300045836 Ga0466958_0035887 Ga0466958_0035887_631_1329 222
767 3300045976 Ga0466967_0025078 Ga0466967_0025078_958_1659 222
768 3300045976 Ga0466967_0028485 Ga0466967_0028485_1357_2046 222
769 3300045976 Ga0466967_0085892 Ga0466967_0085892_1517_2203 222
770 3300046680 Ga0495646_0048217 Ga0495646_0048217_941_1618 222
771 3300049581 Ga0501047_0009775 Ga0501047_0009775_6869_7558 222
772 3300049581 Ga0501047_0101879 Ga0501047_0101879_848_1537 222
773 3300049583 Ga0501067_0074315 Ga0501067_0074315_336_1028 222
774 3300049585 Ga0501069_0104452 Ga0501069_0104452_135_827 222
775 3300049586 Ga0501070_0221164 Ga0501070_0221164_326_1015 222
776 3300049590 Ga0501074_0241633 Ga0501074_0241633_155_844 222
777 3300005329 Ga0070683_100043826 Ga0070683_1000438262 223
778 3300005563 Ga0068855_100023527 Ga0068855_1000235277 223
779 3300005616 Ga0068852_100366177 Ga0068852_1003661772 223
780 3300013104 Ga0157370_10052000 Ga0157370_100520004 223
781 3300025913 Ga0207695_10799001 Ga0207695_107990012 223
782 3300025917 Ga0207660_10577824 Ga0207660_105778242 223
783 3300025944 Ga0207661_10064721 Ga0207661_100647213 223
784 3300025949 Ga0207667_10112288 Ga0207667_101122884 223
785 3300026142 Ga0207698_10342577 Ga0207698_103425772 223
786 3300037312 Ga0395899_0240780 Ga0395899_0240780_151_828 223
787 3300037418 Ga0395900_0058494 Ga0395900_0058494_2439_3116 223
788 3300037466 Ga0395898_0188774 Ga0395898_0188774_1041_1718 223
789 3300037466 Ga0395898_0281829 Ga0395898_0281829_802_1479 223
790 3300037471 Ga0395905_0133466 Ga0395905_0133466_46_735 223
791 3300037471 Ga0395905_0143166 Ga0395905_0143166_130_807 223
792 3300038443 Ga0395901_0095272 Ga0395901_0095272_1112_1801 223
793 3300038443 Ga0395901_0107997 Ga0395901_0107997_436_1113 223
794 3300044694 Ga0466963_0003161 Ga0466963_0003161_1482_2159 223
795 3300044694 Ga0466963_0025256 Ga0466963_0025256_2837_3526 223
796 3300044706 Ga0466964_0031098 Ga0466964_0031098_276_953 223
797 3300045836 Ga0466958_0051351 Ga0466958_0051351_14_691 223
798 3300045976 Ga0466967_0083491 Ga0466967_0083491_2147_2836 223
799 3300045976 Ga0466967_0118795 Ga0466967_0118795_1645_2322 223
800 3300045976 Ga0466967_0375012 Ga0466967_0375012_69_758 223
801 3300046454 Ga0495592_0012008 Ga0495592_0012008_4000_4689 223
802 3300046529 Ga0495652_0032336 Ga0495652_0032336_802_1491 223
803 3300046536 Ga0495587_0027933 Ga0495587_0027933_604_1293 223
804 3300046543 Ga0495645_0279810 Ga0495645_0279810_143_832 223
805 3300046678 Ga0495599_0008974 Ga0495599_0008974_4129_4818 223
806 3300048088 Ga0495602_0053966 Ga0495602_0053966_2721_3410 223
807 3300048910 Ga0496107_0437578 Ga0496107_0437578_68_754 223
808 3300049585 Ga0501069_0020010 Ga0501069_0020010_2142_2900 223
809 3300049586 Ga0501070_0000805 Ga0501070_0000805_24021_24779 223
810 3300053077 Ga0495601_0218882 Ga0495601_0218882_289_978 223
811 3300053083 Ga0495655_0000400 Ga0495655_0000400_3510_4184 223
812 3300054114 Ga0501084_0050875 Ga0501084_0050875_179_859 223
813 3300006175 Ga0070712_100021567 Ga0070712_1000215672 224
814 3300009553 Ga0105249_10077142 Ga0105249_100771423 224
815 3300025915 Ga0207693_10007638 Ga0207693_100076384 224
816 3300025916 Ga0207663_10211952 Ga0207663_102119522 224
817 3300046462 Ga0495651_0206051 Ga0495651_0206051_501_1187 224
818 3300046463 Ga0495653_0076386 Ga0495653_0076386_1214_1900 224
819 3300046477 Ga0495664_0035970 Ga0495664_0035970_1858_2544 224
820 3300046511 Ga0495608_0048020 Ga0495608_0048020_1907_2593 224
821 3300046514 Ga0495618_0138691 Ga0495618_0138691_678_1364 224
822 3300046517 Ga0495630_0073335 Ga0495630_0073335_50_736 224
823 3300046533 Ga0495640_0093241 Ga0495640_0093241_1143_1829 224
824 3300046543 Ga0495645_0039466 Ga0495645_0039466_945_1631 224
825 3300046559 Ga0495667_0238344 Ga0495667_0238344_110_796 224
826 3300046642 Ga0495634_0349857 Ga0495634_0349857_156_842 224
827 3300046663 Ga0495635_0062423 Ga0495635_0062423_1621_2307 224
828 3300046680 Ga0495646_0045886 Ga0495646_0045886_1057_1743 224
829 3300047317 Ga0495604_0259579 Ga0495604_0259579_108_794 224
830 3300047319 Ga0495674_0103229 Ga0495674_0103229_1716_2402 224
831 3300047319 Ga0495674_0105099 Ga0495674_0105099_582_1268 224
832 3300047322 Ga0495680_0084623 Ga0495680_0084623_806_1492 224
833 3300047471 Ga0495684_0029449 Ga0495684_0029449_396_1082 224
834 3300048904 Ga0496101_0178812 Ga0496101_0178812_413_1099 224
835 3300048917 Ga0496114_0203985 Ga0496114_0203985_834_1520 224
836 3300049572 Ga0501036_0461501 Ga0501036_0461501_90_782 224
837 3300049583 Ga0501067_0106523 Ga0501067_0106523_550_1236 224
838 3300053077 Ga0495601_0066465 Ga0495601_0066465_1108_1794 224
839 3300053078 Ga0495612_0197777 Ga0495612_0197777_143_829 224
840 3300053085 Ga0495619_0025840 Ga0495619_0025840_1495_2181 224
841 3300053085 Ga0495619_0120410 Ga0495619_0120410_1011_1697 224
842 3300005327 Ga0070658_10032354 Ga0070658_100323546 225
843 3300005330 Ga0070690_100163101 Ga0070690_1001631012 225
844 3300005339 Ga0070660_100035321 Ga0070660_1000353215 225
845 3300005341 Ga0070691_10031993 Ga0070691_100319932 225
846 3300005343 Ga0070687_100084705 Ga0070687_1000847053 225
847 3300005355 Ga0070671_100439701 Ga0070671_1004397011 225
848 3300005356 Ga0070674_100055508 Ga0070674_1000555084 225
849 3300005364 Ga0070673_100230662 Ga0070673_1002306623 225
850 3300005435 Ga0070714_100070139 Ga0070714_1000701394 225
851 3300005437 Ga0070710_10145208 Ga0070710_101452082 225
852 3300005440 Ga0070705_100143310 Ga0070705_1001433102 225
853 3300005444 Ga0070694_100047908 Ga0070694_1000479084 225
854 3300005456 Ga0070678_100047190 Ga0070678_1000471904 225
855 3300005456 Ga0070678_100141003 Ga0070678_1001410032 225
856 3300005457 Ga0070662_100032975 Ga0070662_1000329755 225
857 3300005458 Ga0070681_10036127 Ga0070681_100361273 225
858 3300005468 Ga0070707_100375841 Ga0070707_1003758411 225
859 3300005530 Ga0070679_100177374 Ga0070679_1001773743 225
860 3300005535 Ga0070684_100034834 Ga0070684_1000348343 225
861 3300005547 Ga0070693_100100732 Ga0070693_1001007322 225
862 3300005547 Ga0070693_100155346 Ga0070693_1001553462 225
863 3300005548 Ga0070665_100860466 Ga0070665_1008604662 225
864 3300005549 Ga0070704_100015256 Ga0070704_1000152562 225
865 3300005563 Ga0068855_100208157 Ga0068855_1002081572 225
866 3300005578 Ga0068854_100030195 Ga0068854_1000301953 225
867 3300005615 Ga0070702_100082975 Ga0070702_1000829752 225
868 3300005843 Ga0068860_100107820 Ga0068860_1001078202 225
869 3300005983 Ga0081540_1005622 Ga0081540_10056223 225
870 3300006358 Ga0068871_100659454 Ga0068871_1006594542 225
871 3300006844 Ga0075428_100114666 Ga0075428_1001146664 225
872 3300006846 Ga0075430_100071037 Ga0075430_1000710374 225
873 3300006846 Ga0075430_100132968 Ga0075430_1001329684 225
874 3300006852 Ga0075433_10346277 Ga0075433_103462772 225
875 3300009093 Ga0105240_10406298 Ga0105240_104062982 225
876 3300009098 Ga0105245_10200719 Ga0105245_102007192 225
877 3300009098 Ga0105245_10490642 Ga0105245_104906422 225
878 3300009147 Ga0114129_10003789 Ga0114129_1000378918 225
879 3300009177 Ga0105248_10265992 Ga0105248_102659923 225
880 3300009545 Ga0105237_10279610 Ga0105237_102796102 225
881 3300011119 Ga0105246_10129907 Ga0105246_101299072 225
882 3300012488 Ga0157343_1001301 Ga0157343_10013012 225
883 3300013100 Ga0157373_10059735 Ga0157373_100597352 225
884 3300013297 Ga0157378_10151034 Ga0157378_101510342 225
885 3300013308 Ga0157375_10423461 Ga0157375_104234612 225
886 3300013308 Ga0157375_11376790 Ga0157375_113767902 225
887 3300014325 Ga0163163_10174889 Ga0163163_101748892 225
888 3300014326 Ga0157380_10845755 Ga0157380_108457552 225
889 3300014968 Ga0157379_10382783 Ga0157379_103827833 225
890 3300014968 Ga0157379_10643943 Ga0157379_106439431 225
891 3300014969 Ga0157376_11102058 Ga0157376_111020581 225
892 3300025898 Ga0207692_10325133 Ga0207692_103251333 225
893 3300025905 Ga0207685_10082302 Ga0207685_100823023 225
894 3300025906 Ga0207699_10559615 Ga0207699_105596151 225
895 3300025912 Ga0207707_10050817 Ga0207707_100508176 225
896 3300025912 Ga0207707_10162795 Ga0207707_101627953 225
897 3300025916 Ga0207663_10109766 Ga0207663_101097663 225
898 3300025919 Ga0207657_10009308 Ga0207657_1000930810 225
899 3300025919 Ga0207657_10080178 Ga0207657_100801782 225
900 3300025921 Ga0207652_10188592 Ga0207652_101885923 225
901 3300025922 Ga0207646_10483620 Ga0207646_104836202 225
902 3300025923 Ga0207681_10730191 Ga0207681_107301912 225
903 3300025926 Ga0207659_10092263 Ga0207659_100922634 225
904 3300025928 Ga0207700_10713187 Ga0207700_107131871 225
905 3300025934 Ga0207686_10609492 Ga0207686_106094922 225
906 3300025940 Ga0207691_10564722 Ga0207691_105647222 225
907 3300025942 Ga0207689_10413808 Ga0207689_104138082 225
908 3300025944 Ga0207661_10016160 Ga0207661_100161605 225
909 3300026075 Ga0207708_10000684 Ga0207708_1000068414 225
910 3300026089 Ga0207648_10011247 Ga0207648_100112472 225
911 3300026121 Ga0207683_10063512 Ga0207683_100635125 225
912 3300028379 Ga0268266_10996326 Ga0268266_109963261 225
913 3300028381 Ga0268264_10112654 Ga0268264_101126542 225
914 3300031731 Ga0307405_10187425 Ga0307405_101874252 225
915 3300031911 Ga0307412_10580951 Ga0307412_105809511 225
916 3300031995 Ga0307409_100051110 Ga0307409_1000511103 225
917 3300031995 Ga0307409_100087434 Ga0307409_1000874344 225
918 3300032126 Ga0307415_100081322 Ga0307415_1000813222 225
919 3300034818 Ga0373950_0026585 Ga0373950_0026585_219_923 225
920 3300035089 Ga0373944_0008676 Ga0373944_0008676_1170_1859 225
921 3300035116 Ga0373945_0022087 Ga0373945_0022087_698_1387 225
922 3300035170 Ga0373943_0000198 Ga0373943_0000198_5179_5868 225
923 3300035171 Ga0373946_0095826 Ga0373946_0095826_157_846 225
924 3300035695 Ga0373927_0372301 Ga0373927_0372301_129_818 225
925 3300035725 Ga0373947_0000463 Ga0373947_0000463_11513_12202 225
926 3300037068 Ga0373925_0024512 Ga0373925_0024512_2810_3499 225
927 3300037312 Ga0395899_0005918 Ga0395899_0005918_2829_3518 225
928 3300037312 Ga0395899_0210777 Ga0395899_0210777_175_858 225
929 3300037418 Ga0395900_0009112 Ga0395900_0009112_3390_4073 225
930 3300037418 Ga0395900_0054373 Ga0395900_0054373_497_1186 225
931 3300037466 Ga0395898_0022431 Ga0395898_0022431_2758_3447 225
932 3300037471 Ga0395905_0008242 Ga0395905_0008242_6846_7535 225
933 3300038443 Ga0395901_0080423 Ga0395901_0080423_392_1081 225
934 3300038443 Ga0395901_0287720 Ga0395901_0287720_95_778 225
935 3300039437 Ga0436365_1649965 Ga0436365_1649965_56_799 225
936 3300039453 Ga0436362_0209500 Ga0436362_0209500_53_769 225
937 3300041512 Ga0451853_0888380 Ga0451853_0888380_2075_2755 225
938 3300044706 Ga0466964_0021478 Ga0466964_0021478_577_1281 225
939 3300045976 Ga0466967_0000676 Ga0466967_0000676_6757_7449 225
940 3300046454 Ga0495592_0281292 Ga0495592_0281292_235_915 225
941 3300046455 Ga0495603_0000081 Ga0495603_0000081_17083_17772 225
942 3300046455 Ga0495603_0039078 Ga0495603_0039078_861_1541 225
943 3300046459 Ga0495629_0227825 Ga0495629_0227825_135_821 225
944 3300046461 Ga0495641_0002133 Ga0495641_0002133_11645_12334 225
945 3300046461 Ga0495641_0019598 Ga0495641_0019598_2038_2724 225
946 3300046473 Ga0495582_0027562 Ga0495582_0027562_360_1049 225
947 3300046475 Ga0495639_0092686 Ga0495639_0092686_133_822 225
948 3300046491 Ga0495584_0268011 Ga0495584_0268011_69_749 225
949 3300046499 Ga0495594_0000536 Ga0495594_0000536_5895_6584 225
950 3300046500 Ga0495596_0031645 Ga0495596_0031645_207_887 225
951 3300046511 Ga0495608_0421052 Ga0495608_0421052_93_773 225
952 3300046526 Ga0495666_0019555 Ga0495666_0019555_2541_3230 225
953 3300046531 Ga0495665_0107038 Ga0495665_0107038_391_1080 225
954 3300046536 Ga0495587_0185408 Ga0495587_0185408_206_886 225
955 3300046674 Ga0495588_0002678 Ga0495588_0002678_4472_5161 225
956 3300046675 Ga0495657_0099309 Ga0495657_0099309_128_808 225
957 3300046681 Ga0495647_0064178 Ga0495647_0064178_479_1168 225
958 3300046690 Ga0495624_0382408 Ga0495624_0382408_122_802 225
959 3300047319 Ga0495674_0101589 Ga0495674_0101589_1108_1788 225
960 3300047319 Ga0495674_0620027 Ga0495674_0620027_78_761 225
961 3300047321 Ga0495676_0002817 Ga0495676_0002817_3386_4075 225
962 3300047321 Ga0495676_0416967 Ga0495676_0416967_152_841 225
963 3300047322 Ga0495680_0040429 Ga0495680_0040429_2736_3416 225
964 3300047445 Ga0495677_0117163 Ga0495677_0117163_196_885 225
965 3300048903 Ga0496100_0129406 Ga0496100_0129406_666_1355 225
966 3300048903 Ga0496100_0143663 Ga0496100_0143663_966_1646 225
967 3300048903 Ga0496100_0553649 Ga0496100_0553649_66_746 225
968 3300048904 Ga0496101_0026476 Ga0496101_0026476_3285_3965 225
969 3300048904 Ga0496101_0145864 Ga0496101_0145864_960_1649 225
970 3300048905 Ga0496102_0017600 Ga0496102_0017600_4924_5613 225
971 3300048905 Ga0496102_0049578 Ga0496102_0049578_218_901 225
972 3300048907 Ga0496104_0000865 Ga0496104_0000865_1371_2060 225
973 3300048907 Ga0496104_0068058 Ga0496104_0068058_1094_1783 225
974 3300048908 Ga0496105_0000775 Ga0496105_0000775_15086_15775 225
975 3300048908 Ga0496105_0004904 Ga0496105_0004904_1116_1805 225
976 3300048909 Ga0496106_0095212 Ga0496106_0095212_445_1125 225
977 3300048909 Ga0496106_0188080 Ga0496106_0188080_443_1132 225
978 3300048910 Ga0496107_0006234 Ga0496107_0006234_4717_5406 225
979 3300048911 Ga0496108_0005018 Ga0496108_0005018_3664_4353 225
980 3300048911 Ga0496108_0010715 Ga0496108_0010715_5022_5711 225
981 3300048911 Ga0496108_0061474 Ga0496108_0061474_1351_2031 225
982 3300048912 Ga0496109_0001239 Ga0496109_0001239_6527_7216 225
983 3300048912 Ga0496109_0018833 Ga0496109_0018833_3959_4648 225
984 3300048912 Ga0496109_0702906 Ga0496109_0702906_35_715 225
985 3300048913 Ga0496110_0011919 Ga0496110_0011919_1601_2290 225
986 3300048913 Ga0496110_0048083 Ga0496110_0048083_2834_3523 225
987 3300048914 Ga0496111_0003372 Ga0496111_0003372_4868_5557 225
988 3300048914 Ga0496111_0059871 Ga0496111_0059871_1066_1755 225
989 3300048914 Ga0496111_0361810 Ga0496111_0361810_91_771 225
990 3300048915 Ga0496112_0001889 Ga0496112_0001889_9127_9810 225
991 3300048915 Ga0496112_0003845 Ga0496112_0003845_1546_2235 225
992 3300048915 Ga0496112_0019694 Ga0496112_0019694_3959_4648 225
993 3300048916 Ga0496113_0001530 Ga0496113_0001530_3347_4036 225
994 3300048916 Ga0496113_0041139 Ga0496113_0041139_2531_3220 225
995 3300048917 Ga0496114_0026950 Ga0496114_0026950_1629_2318 225
996 3300048917 Ga0496114_0101630 Ga0496114_0101630_1765_2445 225
997 3300048917 Ga0496114_0103167 Ga0496114_0103167_649_1338 225
998 3300048917 Ga0496114_0338672 Ga0496114_0338672_40_720 225
999 3300048918 Ga0496115_0005818 Ga0496115_0005818_2868_3557 225
1000 3300049568 Ga0501031_0000033 Ga0501031_0000033_58515_59207 225
1001 3300049569 Ga0501032_0000534 Ga0501032_0000534_12271_12963 225
1002 3300049569 Ga0501032_0268422 Ga0501032_0268422_43_735 225
1003 3300049570 Ga0501033_0001697 Ga0501033_0001697_387_1079 225
1004 3300049571 Ga0501034_0040001 Ga0501034_0040001_2272_2964 225
1005 3300049572 Ga0501036_0000100 Ga0501036_0000100_30359_31051 225
1006 3300049573 Ga0501037_0000149 Ga0501037_0000149_28766_29458 225
1007 3300049573 Ga0501037_0133435 Ga0501037_0133435_396_1088 225
1008 3300049573 Ga0501037_0312856 Ga0501037_0312856_44_736 225
1009 3300049574 Ga0501038_0000227 Ga0501038_0000227_5834_6526 225
1010 3300049574 Ga0501038_0051266 Ga0501038_0051266_2129_2821 225
1011 3300049574 Ga0501038_0200753 Ga0501038_0200753_515_1207 225
1012 3300049575 Ga0501039_0000423 Ga0501039_0000423_6705_7397 225
1013 3300049575 Ga0501039_0029270 Ga0501039_0029270_2908_3600 225
1014 3300049575 Ga0501039_0129306 Ga0501039_0129306_71_763 225
1015 3300049576 Ga0501040_0000502 Ga0501040_0000502_1204_1896 225
1016 3300049576 Ga0501040_0001387 Ga0501040_0001387_6570_7262 225
1017 3300049576 Ga0501040_0055433 Ga0501040_0055433_1800_2492 225
1018 3300049577 Ga0501041_0000012 Ga0501041_0000012_27869_28561 225
1019 3300049577 Ga0501041_0000895 Ga0501041_0000895_6589_7281 225
1020 3300049577 Ga0501041_0029930 Ga0501041_0029930_500_1192 225
1021 3300049577 Ga0501041_0079805 Ga0501041_0079805_757_1449 225
1022 3300049578 Ga0501042_0000006 Ga0501042_0000006_17300_17992 225
1023 3300049578 Ga0501042_0091590 Ga0501042_0091590_1442_2134 225
1024 3300049578 Ga0501042_0414794 Ga0501042_0414794_251_943 225
1025 3300049579 Ga0501043_0000804 Ga0501043_0000804_5360_6052 225
1026 3300049579 Ga0501043_0218772 Ga0501043_0218772_354_1046 225
1027 3300049580 Ga0501046_0000342 Ga0501046_0000342_23045_23737 225
1028 3300049580 Ga0501046_0041445 Ga0501046_0041445_108_800 225
1029 3300049580 Ga0501046_0186294 Ga0501046_0186294_193_885 225
1030 3300049581 Ga0501047_0000421 Ga0501047_0000421_34280_34972 225
1031 3300049582 Ga0501048_0000027 Ga0501048_0000027_35372_36064 225
1032 3300049582 Ga0501048_0045848 Ga0501048_0045848_1360_2052 225
1033 3300049582 Ga0501048_0052712 Ga0501048_0052712_235_927 225
1034 3300049582 Ga0501048_0276743 Ga0501048_0276743_196_888 225
1035 3300049584 Ga0501068_0000037 Ga0501068_0000037_19788_20480 225
1036 3300049584 Ga0501068_0100397 Ga0501068_0100397_87_779 225
1037 3300049585 Ga0501069_0002851 Ga0501069_0002851_2706_3398 225
1038 3300049586 Ga0501070_0246722 Ga0501070_0246722_758_1450 225
1039 3300049587 Ga0501071_0000012 Ga0501071_0000012_38784_39476 225
1040 3300049587 Ga0501071_0071580 Ga0501071_0071580_1396_2088 225
1041 3300049587 Ga0501071_0154584 Ga0501071_0154584_538_1230 225
1042 3300049588 Ga0501072_0000295 Ga0501072_0000295_17282_17974 225
1043 3300049588 Ga0501072_0000448 Ga0501072_0000448_28325_29017 225
1044 3300049588 Ga0501072_0041310 Ga0501072_0041310_865_1557 225
1045 3300049588 Ga0501072_0127601 Ga0501072_0127601_194_886 225
1046 3300049588 Ga0501072_0330556 Ga0501072_0330556_64_756 225
1047 3300049588 Ga0501072_0342390 Ga0501072_0342390_305_997 225
1048 3300049589 Ga0501073_0002424 Ga0501073_0002424_10431_11123 225
1049 3300049590 Ga0501074_0000008 Ga0501074_0000008_45553_46245 225
1050 3300049590 Ga0501074_0020171 Ga0501074_0020171_3739_4431 225
1051 3300049590 Ga0501074_0030420 Ga0501074_0030420_2095_2787 225
1052 3300049591 Ga0501075_0000571 Ga0501075_0000571_4477_5169 225
1053 3300049591 Ga0501075_0004350 Ga0501075_0004350_686_1378 225
1054 3300049591 Ga0501075_0504317 Ga0501075_0504317_77_769 225
1055 3300049592 Ga0501076_0000020 Ga0501076_0000020_58494_59186 225
1056 3300049592 Ga0501076_0001551 Ga0501076_0001551_3274_3966 225
1057 3300049592 Ga0501076_0015332 Ga0501076_0015332_4463_5155 225
1058 3300049592 Ga0501076_0093020 Ga0501076_0093020_152_844 225
1059 3300049592 Ga0501076_0531525 Ga0501076_0531525_164_856 225
1060 3300049593 Ga0501077_0000040 Ga0501077_0000040_41356_42048 225
1061 3300049741 Ga0501079_0000001 Ga0501079_0000001_58990_59682 225
1062 3300049741 Ga0501079_0053746 Ga0501079_0053746_166_858 225
1063 3300049741 Ga0501079_0169640 Ga0501079_0169640_291_983 225
1064 3300049742 Ga0501080_0000042 Ga0501080_0000042_45009_45701 225
1065 3300049743 Ga0501081_0000001 Ga0501081_0000001_59061_59753 225
1066 3300049743 Ga0501081_0000753 Ga0501081_0000753_6568_7260 225
1067 3300049743 Ga0501081_0090356 Ga0501081_0090356_530_1222 225
1068 3300049744 Ga0501083_0000294 Ga0501083_0000294_21007_21699 225
1069 3300049744 Ga0501083_0246283 Ga0501083_0246283_374_1066 225
1070 3300049822 Ga0501035_0000303 Ga0501035_0000303_28217_28909 225
1071 3300049823 Ga0501044_0001480 Ga0501044_0001480_76_768 225
1072 3300049824 Ga0501045_0000017 Ga0501045_0000017_32268_32960 225
1073 3300049824 Ga0501045_0001276 Ga0501045_0001276_11905_12597 225
1074 3300049824 Ga0501045_0001594 Ga0501045_0001594_9617_10309 225
1075 3300049824 Ga0501045_0162019 Ga0501045_0162019_82_774 225
1076 3300049824 Ga0501045_0232210 Ga0501045_0232210_626_1318 225
1077 3300050507 nmdc:mga05p37_6300_c1 nmdc:mga05p37_6300_c1_12336_13028 225
1078 3300050509 nmdc:mga0qj67_4025_c1 nmdc:mga0qj67_4025_c1_223_915 225
1079 3300050509 nmdc:mga0qj67_500599_c1 nmdc:mga0qj67_500599_c1_243_935 225
1080 3300053084 Ga0495595_0047626 Ga0495595_0047626_379_1059 225
1081 3300053084 Ga0495595_0219952 Ga0495595_0219952_70_753 225
1082 3300054114 Ga0501084_0000120 Ga0501084_0000120_38898_39590 225
1083 3300054114 Ga0501084_0002421 Ga0501084_0002421_1827_2519 225
1084 3300054114 Ga0501084_0032475 Ga0501084_0032475_3049_3741 225
1085 3300054114 Ga0501084_0107896 Ga0501084_0107896_357_1049 225
1086 3300054114 Ga0501084_0489942 Ga0501084_0489942_289_981 225
1087 3300060353 Ga0501082_0000393 Ga0501082_0000393_32264_32956 225
1088 3300060353 Ga0501082_0016180 Ga0501082_0016180_853_1545 225
1089 3300060353 Ga0501082_0096695 Ga0501082_0096695_1156_1848 225
1090 3300061734 Ga0530510_0001036 Ga0530510_0001036_15328_16020 225
1091 3300061734 Ga0530510_0008262 Ga0530510_0008262_735_1427 225
1092 3300061734 Ga0530510_0069711 Ga0530510_0069711_129_821 225
1093 3300061734 Ga0530510_0156701 Ga0530510_0156701_673_1365 225
1094 3300061734 Ga0530510_0186781 Ga0530510_0186781_375_1067 225
1095 3300000041 ARcpr5oldR_c003188 ARcpr5oldR_0031883 226
1096 3300000043 ARcpr5yngRDRAFT_c003832 ARcpr5yngRDRAFT_0038322 226
1097 3300000044 ARSoilOldRDRAFT_c004433 ARSoilOldRDRAFT_0044332 226
1098 3300000652 ARCol0yngRDRAFT_1002248 ARCol0yngRDRAFT_10022482 226
1099 3300005327 Ga0070658_10210622 Ga0070658_102106222 226
1100 3300005328 Ga0070676_10338060 Ga0070676_103380602 226
1101 3300005329 Ga0070683_100283720 Ga0070683_1002837203 226
1102 3300005331 Ga0070670_100054160 Ga0070670_1000541604 226
1103 3300005337 Ga0070682_100056257 Ga0070682_1000562572 226
1104 3300005339 Ga0070660_100206536 Ga0070660_1002065361 226
1105 3300005340 Ga0070689_100217114 Ga0070689_1002171143 226
1106 3300005341 Ga0070691_10077050 Ga0070691_100770502 226
1107 3300005341 Ga0070691_10092069 Ga0070691_100920692 226
1108 3300005344 Ga0070661_100045182 Ga0070661_1000451821 226
1109 3300005347 Ga0070668_100057446 Ga0070668_1000574461 226
1110 3300005353 Ga0070669_100176320 Ga0070669_1001763203 226
1111 3300005354 Ga0070675_100084877 Ga0070675_1000848773 226
1112 3300005354 Ga0070675_100153587 Ga0070675_1001535873 226
1113 3300005365 Ga0070688_100053471 Ga0070688_1000534714 226
1114 3300005366 Ga0070659_100033384 Ga0070659_1000333846 226
1115 3300005366 Ga0070659_100089294 Ga0070659_1000892942 226
1116 3300005366 Ga0070659_100179025 Ga0070659_1001790251 226
1117 3300005434 Ga0070709_10486271 Ga0070709_104862712 226
1118 3300005438 Ga0070701_10008930 Ga0070701_100089304 226
1119 3300005440 Ga0070705_100079149 Ga0070705_1000791493 226
1120 3300005456 Ga0070678_100024842 Ga0070678_1000248423 226
1121 3300005458 Ga0070681_10016479 Ga0070681_100164799 226
1122 3300005458 Ga0070681_10029608 Ga0070681_100296084 226
1123 3300005459 Ga0068867_100042330 Ga0068867_1000423305 226
1124 3300005459 Ga0068867_100480869 Ga0068867_1004808691 226
1125 3300005466 Ga0070685_10067464 Ga0070685_100674643 226
1126 3300005466 Ga0070685_10154284 Ga0070685_101542842 226
1127 3300005466 Ga0070685_10217349 Ga0070685_102173492 226
1128 3300005535 Ga0070684_100030545 Ga0070684_1000305456 226
1129 3300005535 Ga0070684_100161688 Ga0070684_1001616882 226
1130 3300005543 Ga0070672_100095075 Ga0070672_1000950753 226
1131 3300005543 Ga0070672_100384079 Ga0070672_1003840792 226
1132 3300005544 Ga0070686_100037595 Ga0070686_1000375952 226
1133 3300005545 Ga0070695_100165042 Ga0070695_1001650422 226
1134 3300005546 Ga0070696_100037333 Ga0070696_1000373333 226
1135 3300005547 Ga0070693_100011997 Ga0070693_1000119975 226
1136 3300005547 Ga0070693_100162402 Ga0070693_1001624023 226
1137 3300005547 Ga0070693_100206466 Ga0070693_1002064661 226
1138 3300005549 Ga0070704_100015833 Ga0070704_1000158334 226
1139 3300005549 Ga0070704_100295450 Ga0070704_1002954502 226
1140 3300005549 Ga0070704_100439873 Ga0070704_1004398732 226
1141 3300005563 Ga0068855_100115589 Ga0068855_1001155893 226
1142 3300005564 Ga0070664_100004408 Ga0070664_1000044087 226
1143 3300005564 Ga0070664_100446061 Ga0070664_1004460613 226
1144 3300005564 Ga0070664_100614628 Ga0070664_1006146282 226
1145 3300005577 Ga0068857_100170212 Ga0068857_1001702122 226
1146 3300005577 Ga0068857_100362960 Ga0068857_1003629603 226
1147 3300005578 Ga0068854_100013324 Ga0068854_1000133247 226
1148 3300005614 Ga0068856_100025756 Ga0068856_1000257567 226
1149 3300005615 Ga0070702_100018988 Ga0070702_1000189882 226
1150 3300005615 Ga0070702_100105817 Ga0070702_1001058172 226
1151 3300005617 Ga0068859_100148629 Ga0068859_1001486293 226
1152 3300005618 Ga0068864_100014941 Ga0068864_1000149417 226
1153 3300005618 Ga0068864_100187173 Ga0068864_1001871733 226
1154 3300005719 Ga0068861_100046962 Ga0068861_1000469624 226
1155 3300005840 Ga0068870_10098302 Ga0068870_100983023 226
1156 3300005841 Ga0068863_100193147 Ga0068863_1001931473 226
1157 3300005843 Ga0068860_100069232 Ga0068860_1000692325 226
1158 3300005937 Ga0081455_10021846 Ga0081455_100218466 226
1159 3300005937 Ga0081455_10046334 Ga0081455_100463342 226
1160 3300005937 Ga0081455_10115009 Ga0081455_101150093 226
1161 3300006028 Ga0070717_10263363 Ga0070717_102633633 226
1162 3300006058 Ga0075432_10009183 Ga0075432_100091832 226
1163 3300006163 Ga0070715_10017065 Ga0070715_100170652 226
1164 3300006173 Ga0070716_100228956 Ga0070716_1002289563 226
1165 3300006237 Ga0097621_100133310 Ga0097621_1001333102 226
1166 3300006358 Ga0068871_100009498 Ga0068871_1000094984 226
1167 3300006844 Ga0075428_100002460 Ga0075428_10000246020 226
1168 3300006844 Ga0075428_100080483 Ga0075428_1000804833 226
1169 3300006844 Ga0075428_100234143 Ga0075428_1002341434 226
1170 3300006852 Ga0075433_10009414 Ga0075433_100094143 226
1171 3300006871 Ga0075434_100288348 Ga0075434_1002883483 226
1172 3300006880 Ga0075429_100008378 Ga0075429_10000837810 226
1173 3300006880 Ga0075429_100036160 Ga0075429_1000361604 226
1174 3300006881 Ga0068865_100051004 Ga0068865_1000510044 226
1175 3300006931 Ga0097620_100148637 Ga0097620_1001486373 226
1176 3300009094 Ga0111539_10003095 Ga0111539_100030958 226
1177 3300009094 Ga0111539_10030994 Ga0111539_100309944 226
1178 3300009094 Ga0111539_10041021 Ga0111539_100410214 226
1179 3300009094 Ga0111539_10126644 Ga0111539_101266444 226
1180 3300009098 Ga0105245_10052550 Ga0105245_100525505 226
1181 3300009098 Ga0105245_10086893 Ga0105245_100868933 226
1182 3300009098 Ga0105245_10363411 Ga0105245_103634112 226
1183 3300009101 Ga0105247_10145025 Ga0105247_101450253 226
1184 3300009101 Ga0105247_10404747 Ga0105247_104047471 226
1185 3300009147 Ga0114129_10003813 Ga0114129_1000381312 226
1186 3300009147 Ga0114129_10088100 Ga0114129_100881004 226
1187 3300009147 Ga0114129_10420980 Ga0114129_104209803 226
1188 3300009147 Ga0114129_10959911 Ga0114129_109599112 226
1189 3300009148 Ga0105243_10329942 Ga0105243_103299422 226
1190 3300009174 Ga0105241_10354024 Ga0105241_103540243 226
1191 3300009176 Ga0105242_10047409 Ga0105242_100474093 226
1192 3300009177 Ga0105248_10081493 Ga0105248_100814933 226
1193 3300009553 Ga0105249_10666508 Ga0105249_106665082 226
1194 3300009553 Ga0105249_10839255 Ga0105249_108392553 226
1195 3300010375 Ga0105239_10012359 Ga0105239_100123598 226
1196 3300010375 Ga0105239_10352233 Ga0105239_103522333 226
1197 3300011119 Ga0105246_10055089 Ga0105246_100550892 226
1198 3300011119 Ga0105246_10141948 Ga0105246_101419483 226
1199 3300011119 Ga0105246_10207489 Ga0105246_102074892 226
1200 3300011119 Ga0105246_10225978 Ga0105246_102259783 226
1201 3300012494 Ga0157341_1005889 Ga0157341_10058892 226
1202 3300013102 Ga0157371_10090251 Ga0157371_100902513 226
1203 3300013104 Ga0157370_10058868 Ga0157370_100588684 226
1204 3300013297 Ga0157378_10292743 Ga0157378_102927432 226
1205 3300013306 Ga0163162_10195742 Ga0163162_101957424 226
1206 3300013308 Ga0157375_10055724 Ga0157375_100557243 226
1207 3300014326 Ga0157380_10005200 Ga0157380_100052007 226
1208 3300014969 Ga0157376_10100708 Ga0157376_101007084 226
1209 3300014969 Ga0157376_10116142 Ga0157376_101161422 226
1210 3300022467 Ga0224712_10242124 Ga0224712_102421242 226
1211 3300025893 Ga0207682_10124742 Ga0207682_101247422 226
1212 3300025900 Ga0207710_10076752 Ga0207710_100767523 226
1213 3300025901 Ga0207688_10057005 Ga0207688_100570053 226
1214 3300025903 Ga0207680_10109330 Ga0207680_101093302 226
1215 3300025906 Ga0207699_10046539 Ga0207699_100465392 226
1216 3300025907 Ga0207645_10097001 Ga0207645_100970013 226
1217 3300025907 Ga0207645_10196677 Ga0207645_101966773 226
1218 3300025908 Ga0207643_10051830 Ga0207643_100518302 226
1219 3300025908 Ga0207643_10060656 Ga0207643_100606563 226
1220 3300025911 Ga0207654_10095181 Ga0207654_100951812 226
1221 3300025912 Ga0207707_10285806 Ga0207707_102858061 226
1222 3300025916 Ga0207663_10029168 Ga0207663_100291683 226
1223 3300025918 Ga0207662_10011183 Ga0207662_100111833 226
1224 3300025919 Ga0207657_10130814 Ga0207657_101308144 226
1225 3300025923 Ga0207681_10701772 Ga0207681_107017722 226
1226 3300025926 Ga0207659_10096084 Ga0207659_100960842 226
1227 3300025926 Ga0207659_10334060 Ga0207659_103340602 226
1228 3300025927 Ga0207687_10075625 Ga0207687_100756253 226
1229 3300025927 Ga0207687_10357902 Ga0207687_103579023 226
1230 3300025932 Ga0207690_10105094 Ga0207690_101050943 226
1231 3300025932 Ga0207690_10320382 Ga0207690_103203822 226
1232 3300025933 Ga0207706_10011753 Ga0207706_100117533 226
1233 3300025933 Ga0207706_10037457 Ga0207706_100374573 226
1234 3300025935 Ga0207709_10083475 Ga0207709_100834752 226
1235 3300025935 Ga0207709_10156025 Ga0207709_101560252 226
1236 3300025935 Ga0207709_10425720 Ga0207709_104257202 226
1237 3300025937 Ga0207669_10044853 Ga0207669_100448533 226
1238 3300025937 Ga0207669_10374982 Ga0207669_103749823 226
1239 3300025938 Ga0207704_10070439 Ga0207704_100704392 226
1240 3300025939 Ga0207665_10021412 Ga0207665_100214124 226
1241 3300025940 Ga0207691_10002465 Ga0207691_1000246510 226
1242 3300025944 Ga0207661_10004552 Ga0207661_100045527 226
1243 3300025944 Ga0207661_10097117 Ga0207661_100971174 226
1244 3300025944 Ga0207661_10293074 Ga0207661_102930743 226
1245 3300025945 Ga0207679_10010073 Ga0207679_100100737 226
1246 3300025945 Ga0207679_10074519 Ga0207679_100745193 226
1247 3300025949 Ga0207667_10455580 Ga0207667_104555803 226
1248 3300025961 Ga0207712_10057414 Ga0207712_100574143 226
1249 3300025972 Ga0207668_10054370 Ga0207668_100543704 226
1250 3300025972 Ga0207668_10107660 Ga0207668_101076601 226
1251 3300025981 Ga0207640_10015709 Ga0207640_100157094 226
1252 3300026023 Ga0207677_10035672 Ga0207677_100356724 226
1253 3300026067 Ga0207678_10008133 Ga0207678_100081339 226
1254 3300026078 Ga0207702_10071311 Ga0207702_100713113 226
1255 3300026089 Ga0207648_10355679 Ga0207648_103556793 226
1256 3300026095 Ga0207676_10175334 Ga0207676_101753343 226
1257 3300026095 Ga0207676_10327114 Ga0207676_103271142 226
1258 3300026116 Ga0207674_10132097 Ga0207674_101320972 226
1259 3300026116 Ga0207674_10163430 Ga0207674_101634303 226
1260 3300026116 Ga0207674_10487926 Ga0207674_104879262 226
1261 3300026118 Ga0207675_100015139 Ga0207675_1000151395 226
1262 3300026118 Ga0207675_100037084 Ga0207675_1000370847 226
1263 3300026121 Ga0207683_10002760 Ga0207683_1000276016 226
1264 3300026121 Ga0207683_10037498 Ga0207683_100374982 226
1265 3300026142 Ga0207698_10025008 Ga0207698_100250086 226
1266 3300026142 Ga0207698_10257935 Ga0207698_102579353 226
1267 3300027907 Ga0207428_10000108 Ga0207428_1000010899 226
1268 3300027907 Ga0207428_10009737 Ga0207428_100097376 226
1269 3300027907 Ga0207428_10105882 Ga0207428_101058823 226
1270 3300028379 Ga0268266_10773543 Ga0268266_107735431 226
1271 3300028380 Ga0268265_10112257 Ga0268265_101122572 226
1272 3300028381 Ga0268264_10515331 Ga0268264_105153311 226
1273 3300034817 Ga0373948_0007592 Ga0373948_0007592_182_889 226
1274 3300034820 Ga0373959_0008251 Ga0373959_0008251_496_1203 226
1275 3300035084 Ga0373928_0019562 Ga0373928_0019562_236_943 226
1276 3300035092 Ga0373952_0027172 Ga0373952_0027172_358_1065 226
1277 3300035112 Ga0373932_0012406 Ga0373932_0012406_477_1184 226
1278 3300035114 Ga0373939_0018485 Ga0373939_0018485_67_774 226
1279 3300035115 Ga0373941_0056776 Ga0373941_0056776_231_938 226
1280 3300035121 Ga0373960_0003986 Ga0373960_0003986_1831_2538 226
1281 3300035121 Ga0373960_0008369 Ga0373960_0008369_1459_2145 226
1282 3300035207 Ga0373942_0026801 Ga0373942_0026801_736_1443 226
1283 3300035241 Ga0373961_0014760 Ga0373961_0014760_972_1658 226
1284 3300035241 Ga0373961_0071548 Ga0373961_0071548_111_818 226
1285 3300035242 Ga0373962_0042591 Ga0373962_0042591_511_1197 226
1286 3300037312 Ga0395899_0112011 Ga0395899_0112011_534_1229 226
1287 3300037418 Ga0395900_0001485 Ga0395900_0001485_25406_26113 226
1288 3300037418 Ga0395900_0097378 Ga0395900_0097378_995_1690 226
1289 3300037466 Ga0395898_0020108 Ga0395898_0020108_4255_4962 226
1290 3300037471 Ga0395905_0093548 Ga0395905_0093548_777_1484 226
1291 3300038443 Ga0395901_0011802 Ga0395901_0011802_6669_7376 226
1292 3300038443 Ga0395901_0233828 Ga0395901_0233828_844_1539 226
1293 3300042005 Ga0439448_0032735 Ga0439448_0032735_839_1546 226
1294 3300042145 Ga0450906_006151 Ga0450906_006151_834_1514 226
1295 3300042461 Ga0439460_0068507 Ga0439460_0068507_386_1072 226
1296 3300042530 Ga0450916_015947 Ga0450916_015947_138_830 226
1297 3300046455 Ga0495603_0011869 Ga0495603_0011869_2213_2899 226
1298 3300048903 Ga0496100_0226444 Ga0496100_0226444_397_1083 226
1299 3300048904 Ga0496101_0276894 Ga0496101_0276894_270_956 226
1300 3300048906 Ga0496103_0216909 Ga0496103_0216909_513_1220 226
1301 3300048909 Ga0496106_0021917 Ga0496106_0021917_879_1586 226
1302 3300048909 Ga0496106_0245184 Ga0496106_0245184_262_948 226
1303 3300048909 Ga0496106_0250987 Ga0496106_0250987_574_1260 226
1304 3300048910 Ga0496107_0260884 Ga0496107_0260884_574_1260 226
1305 3300048911 Ga0496108_0007413 Ga0496108_0007413_1515_2195 226
1306 3300048911 Ga0496108_0104312 Ga0496108_0104312_585_1271 226
1307 3300048911 Ga0496108_0114151 Ga0496108_0114151_1135_1821 226
1308 3300048912 Ga0496109_0008523 Ga0496109_0008523_3690_4376 226
1309 3300048913 Ga0496110_0048867 Ga0496110_0048867_2463_3149 226
1310 3300048913 Ga0496110_0182517 Ga0496110_0182517_309_989 226
1311 3300048914 Ga0496111_0061619 Ga0496111_0061619_1373_2059 226
1312 3300048914 Ga0496111_0175990 Ga0496111_0175990_337_1023 226
1313 3300048915 Ga0496112_0151505 Ga0496112_0151505_1131_1838 226
1314 3300048915 Ga0496112_0200576 Ga0496112_0200576_357_1037 226
1315 3300048917 Ga0496114_0205513 Ga0496114_0205513_1024_1710 226
1316 3300048918 Ga0496115_0127647 Ga0496115_0127647_971_1678 226
1317 3300049569 Ga0501032_0094572 Ga0501032_0094572_581_1267 226
1318 3300049570 Ga0501033_0023427 Ga0501033_0023427_2945_3631 226
1319 3300049572 Ga0501036_0090347 Ga0501036_0090347_104_784 226
1320 3300049572 Ga0501036_0140509 Ga0501036_0140509_1216_1902 226
1321 3300049573 Ga0501037_0053601 Ga0501037_0053601_470_1156 226
1322 3300049573 Ga0501037_0194278 Ga0501037_0194278_192_872 226
1323 3300049574 Ga0501038_0026061 Ga0501038_0026061_4064_4750 226
1324 3300049574 Ga0501038_0239755 Ga0501038_0239755_436_1116 226
1325 3300049575 Ga0501039_0017235 Ga0501039_0017235_3286_3966 226
1326 3300049575 Ga0501039_0020134 Ga0501039_0020134_1633_2319 226
1327 3300049575 Ga0501039_0485891 Ga0501039_0485891_197_883 226
1328 3300049576 Ga0501040_0005466 Ga0501040_0005466_4147_4827 226
1329 3300049576 Ga0501040_0078527 Ga0501040_0078527_1288_2040 226
1330 3300049577 Ga0501041_0011567 Ga0501041_0011567_2080_2760 226
1331 3300049577 Ga0501041_0041093 Ga0501041_0041093_140_826 226
1332 3300049578 Ga0501042_0005804 Ga0501042_0005804_1695_2375 226
1333 3300049578 Ga0501042_0160223 Ga0501042_0160223_203_889 226
1334 3300049579 Ga0501043_0084261 Ga0501043_0084261_950_1636 226
1335 3300049579 Ga0501043_0175239 Ga0501043_0175239_607_1287 226
1336 3300049580 Ga0501046_0037860 Ga0501046_0037860_500_1186 226
1337 3300049582 Ga0501048_0068055 Ga0501048_0068055_445_1146 226
1338 3300049584 Ga0501068_0030111 Ga0501068_0030111_1672_2358 226
1339 3300049585 Ga0501069_0010781 Ga0501069_0010781_3876_4562 226
1340 3300049586 Ga0501070_0050977 Ga0501070_0050977_1523_2209 226
1341 3300049587 Ga0501071_0000330 Ga0501071_0000330_12221_12901 226
1342 3300049588 Ga0501072_0001627 Ga0501072_0001627_6324_7004 226
1343 3300049588 Ga0501072_0082255 Ga0501072_0082255_1412_2098 226
1344 3300049588 Ga0501072_0084943 Ga0501072_0084943_819_1505 226
1345 3300049589 Ga0501073_0006657 Ga0501073_0006657_7624_8310 226
1346 3300049589 Ga0501073_0028017 Ga0501073_0028017_2062_2742 226
1347 3300049590 Ga0501074_0012136 Ga0501074_0012136_4738_5418 226
1348 3300049590 Ga0501074_0053199 Ga0501074_0053199_816_1502 226
1349 3300049591 Ga0501075_0017103 Ga0501075_0017103_3235_3915 226
1350 3300049591 Ga0501075_0111672 Ga0501075_0111672_367_1053 226
1351 3300049592 Ga0501076_0088873 Ga0501076_0088873_267_953 226
1352 3300049592 Ga0501076_0191130 Ga0501076_0191130_619_1305 226
1353 3300049593 Ga0501077_0000576 Ga0501077_0000576_15142_15843 226
1354 3300049593 Ga0501077_0061776 Ga0501077_0061776_666_1352 226
1355 3300049593 Ga0501077_0072820 Ga0501077_0072820_1377_2129 226
1356 3300049593 Ga0501077_0123252 Ga0501077_0123252_756_1442 226
1357 3300049741 Ga0501079_0001513 Ga0501079_0001513_5962_6663 226
1358 3300049741 Ga0501079_0288348 Ga0501079_0288348_455_1141 226
1359 3300049741 Ga0501079_0294796 Ga0501079_0294796_366_1052 226
1360 3300049742 Ga0501080_0004620 Ga0501080_0004620_10916_11596 226
1361 3300049743 Ga0501081_0005108 Ga0501081_0005108_6526_7206 226
1362 3300049743 Ga0501081_0025513 Ga0501081_0025513_891_1643 226
1363 3300049743 Ga0501081_0068445 Ga0501081_0068445_1022_1708 226
1364 3300049744 Ga0501083_0015159 Ga0501083_0015159_1708_2409 226
1365 3300049744 Ga0501083_0229740 Ga0501083_0229740_256_942 226
1366 3300049823 Ga0501044_0084921 Ga0501044_0084921_793_1479 226
1367 3300049824 Ga0501045_0180790 Ga0501045_0180790_180_866 226
1368 3300050507 nmdc:mga05p37_19624_c1 nmdc:mga05p37_19624_c1_6010_6690 226
1369 3300050507 nmdc:mga05p37_436128_c1 nmdc:mga05p37_436128_c1_249_956 226
1370 3300050507 nmdc:mga05p37_659808_c1 nmdc:mga05p37_659808_c1_227_940 226
1371 3300050508 nmdc:mga09592_28270_c2 nmdc:mga09592_28270_c2_296_1009 226
1372 3300050508 nmdc:mga09592_5828_c1 nmdc:mga09592_5828_c1_3516_4196 226
1373 3300050508 nmdc:mga09592_62805_c1 nmdc:mga09592_62805_c1_2300_3007 226
1374 3300050509 nmdc:mga0qj67_27683_c1 nmdc:mga0qj67_27683_c1_1504_2217 226
1375 3300050511 nmdc:mga08y16_41387_c1 nmdc:mga08y16_41387_c1_336_1043 226
1376 3300050511 nmdc:mga08y16_43999_c1 nmdc:mga08y16_43999_c1_1013_1693 226
1377 3300050511 nmdc:mga08y16_50495_c1 nmdc:mga08y16_50495_c1_2611_3324 226
1378 3300050511 nmdc:mga08y16_59520_c1 nmdc:mga08y16_59520_c1_3266_3946 226
1379 3300050512 nmdc:mga0n895_226365_c1 nmdc:mga0n895_226365_c1_169_876 226
1380 3300050513 nmdc:mga0rr50_172883_c1 nmdc:mga0rr50_172883_c1_246_953 226
1381 3300050515 nmdc:mga0a205_10353_c1 nmdc:mga0a205_10353_c1_1423_2103 226
1382 3300050515 nmdc:mga0a205_137886_c1 nmdc:mga0a205_137886_c1_394_1101 226
1383 3300054114 Ga0501084_0000985 Ga0501084_0000985_9798_10478 226
1384 3300054114 Ga0501084_0153354 Ga0501084_0153354_822_1508 226
1385 3300054114 Ga0501084_0201607 Ga0501084_0201607_248_934 226
1386 3300054114 Ga0501084_0222672 Ga0501084_0222672_393_1145 226
1387 3300054114 Ga0501084_0320820 Ga0501084_0320820_59_745 226
1388 3300060353 Ga0501082_0021375 Ga0501082_0021375_1458_2138 226
1389 3300060353 Ga0501082_0051109 Ga0501082_0051109_1524_2276 226
1390 3300060353 Ga0501082_0098824 Ga0501082_0098824_1027_1713 226
1391 3300061734 Ga0530510_0008980 Ga0530510_0008980_5983_6669 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

9

197

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8188 6 221
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.7616 6 221
7s9z-assembly1.cif.gz_A helicobacter hepaticus ccsba closed conformation 0.6525 35 194
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.607 40 167
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.6065 45 165
ID Description Score Start End Superfamily
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7064 44 168 1.20.120.1770
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6678 44 168 1.20.120.1770
af_P27732_1254_1382_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6511 39 161 1.20.120.350
af_Q4CZM6_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6418 48 164 1.20.120.350
af_Q6H474_2_116_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6238 44 159 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A538HAR9-F1-model_v4 Heme exporter protein C 0.9776 6 224 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7W0SRM7-F1-model_v4 Heme exporter protein C 0.9763 6 208 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A538CJC3-F1-model_v4 Heme exporter protein C 0.9751 3 224 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A538F2K1-F1-model_v4 Heme exporter protein C 0.9739 3 224 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7W1N3C0-F1-model_v4 Heme exporter protein C 0.9738 6 224 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
86.21 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map