metagRoot

F493595

General Info

Members	Datasets	Scaffolds	Average Seq Length
1391	825	2782	443

Family's Representative Sequence

Representative Sequence	3300046660\|Ga0495625_0017887\|Ga0495625_0017887_1654_3144
Length	496
Sequence	MKTGAAKVSLPRSVGRLAIADPRCQKPPVIFSTSPSLADSGAASNRTNFDMAHDAQKMVFEPGGPLRGTVTVPGDKSISHRSLMLSALAVGESHVSGLLEGEDVLATAAAMRALGAQIERDADGTWRIYGVGVGSLVQPTTALDMGNSGTSTRLLMGLLASHALTATFVGDASLSKRPMGRVTDPLGLMGATFTASPGGRLPLTMRGIVPAVPIEYRLPVASAQVKSAVLLAGLNTPGITRIIEPVPTRDHSERMLRGFGADLTVEVDDDGTRHIAIRGEAELKPQTLVVPGDPSSAAFPVVAALITPGSEVRVNNVGMNPTRTGVFKMLQAMGADLTFTNERDVGGEPVADLVARYSRLTGIDVPSDIAPSMIDEFPIFFVAASFAKGRTTTSGLDELRVKESDRLALMAKNLARIGARVEEQDDGLLIDGTDGEPLDGGNKAPTIGAELDHRIAMSFAVAGQATKGGLAIDDMSPVATSFPGFVGLLRTLKGEA

Samples

	Sample ID	Description	Type	Environment
1	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
2	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
3	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
8	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
9	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
10	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
11	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
12	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
13	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
14	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
15	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
16	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
17	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
18	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
19	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
20	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
21	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
22	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
23	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
24	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
25	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
26	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
27	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
28	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
29	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
30	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
31	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
32	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
33	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
34	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
35	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
36	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
37	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
38	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
39	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
40	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
41	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
42	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
43	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
44	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
45	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
46	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
47	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
48	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
49	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
50	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
51	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
52	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
53	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
54	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
55	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
56	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
57	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
58	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
59	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
60	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
61	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
62	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
63	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
64	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
65	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
66	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
67	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
68	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
69	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
70	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
71	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
72	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
73	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
74	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
75	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
76	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
77	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
78	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
79	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
80	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
81	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
82	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
83	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
84	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
85	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
86	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
87	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
88	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
89	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
90	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
91	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
94	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
95	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
96	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
97	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
98	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
99	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
101	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
102	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
103	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
104	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
105	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
106	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
107	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
108	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
109	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
110	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
112	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
113	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
114	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
115	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
116	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
117	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
118	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
119	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
120	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
121	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
122	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
123	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
124	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
125	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
126	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
127	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
128	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
129	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
130	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
131	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
132	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
133	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
134	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
135	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
136	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
137	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
138	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
139	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
140	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
141	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
142	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
143	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
144	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
145	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
149	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
150	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
152	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
153	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
155	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
157	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
159	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
161	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
162	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
163	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
165	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
218	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
219	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
220	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
222	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
226	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
227	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
228	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
229	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
230	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
231	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
232	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
233	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
234	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
235	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
236	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
237	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
238	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
239	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
240	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
241	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
242	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
243	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
244	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
245	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
246	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
247	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
248	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
249	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
250	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
251	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
252	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
253	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
254	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
255	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
256	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
257	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
258	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
259	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
260	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
261	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
262	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
263	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
264	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
265	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
266	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
267	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
268	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
269	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
270	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
271	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
272	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
273	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
274	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
275	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
276	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
277	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
278	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
279	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
280	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
281	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
282	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
283	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
284	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
285	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
286	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
287	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
288	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
289	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
290	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
291	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
292	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
293	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
294	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
295	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
296	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
297	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
298	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
299	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
300	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
301	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
302	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
303	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
304	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
305	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
306	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
307	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
308	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
309	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
310	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
311	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
312	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
313	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
314	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
315	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
316	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
317	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
318	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
319	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
320	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
321	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
322	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
323	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
324	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
325	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
326	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
327	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
328	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
329	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
330	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
331	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
332	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
333	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
334	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
335	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
336	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
337	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
338	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
339	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
340	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
341	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
342	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
343	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
344	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
345	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
346	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
347	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
348	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
349	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
350	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
351	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
352	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
353	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
354	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
355	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
356	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
357	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
358	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
359	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
360	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
361	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
362	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
363	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
364	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
365	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
366	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
367	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
368	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
369	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
370	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
371	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
372	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
373	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
374	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
375	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
376	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
377	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
378	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
379	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
380	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
381	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
382	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
383	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
384	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
385	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
386	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
387	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
388	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
389	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
390	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
391	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
392	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
393	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
394	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
395	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
396	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
397	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
398	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
399	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
400	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
401	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
402	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
403	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
404	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
405	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
406	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
407	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
408	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
409	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
410	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
411	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
412	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
413	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
414	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
415	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
416	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
417	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
418	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
419	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
420	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
421	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
422	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
423	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
424	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
425	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
426	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
427	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
428	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
429	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
430	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
431	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
432	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
433	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
434	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
435	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
436	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
437	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
438	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
439	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
440	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
441	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
442	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
443	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
444	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
445	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
446	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
447	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
448	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
449	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
450	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
451	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
452	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
453	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
454	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
455	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
456	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
457	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
458	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
459	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
460	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
461	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
462	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
463	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
464	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
465	2509276019	Ensifer aridi TW10	Isolate	Nodule
466	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
467	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
468	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
469	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
470	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
471	2512564014	Sphingobium sp. AP49	Isolate	Rhizosphere
472	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
473	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
474	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
475	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
476	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
477	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
478	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
479	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
480	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
481	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
482	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
483	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
484	2516143018	Ensifer sp. BR816	Isolate	Nodule
485	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
486	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
487	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
488	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
489	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
490	2534681786	Brucella suis 92/29	Isolate	Unclassified
491	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
492	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
493	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
494	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
495	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
496	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
497	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
498	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
499	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
500	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
501	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
502	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
503	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
504	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
505	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
506	2599185354	Sphingomonas sp. NFR15	Isolate	Rhizoplane
507	2599185359	Sphingomonas sp. NFR04	Isolate	Rhizoplane
508	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
509	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
510	2643221541	Sphingomonas sp. Root50	Isolate	Unclassified
511	2643221557	Ensifer sp. Root558	Isolate	Unclassified
512	2643221605	Sphingomonas sp. Root710	Isolate	Unclassified
513	2643221606	Sphingomonas sp. Root720	Isolate	Unclassified
514	2643221610	Ensifer sp. Root74	Isolate	Unclassified
515	2643221618	Ensifer sp. Root231	Isolate	Unclassified
516	2643221622	Sphingomonas sp. Root241	Isolate	Unclassified
517	2643221626	Ensifer sp. Root31	Isolate	Unclassified
518	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
519	2643221659	Ensifer sp. Root127	Isolate	Unclassified
520	2643221668	Ensifer sp. Root423	Isolate	Unclassified
521	2643221671	Sphingomonas sp. Root1294	Isolate	Unclassified
522	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
523	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
524	2643221698	Ensifer sp. Root142	Isolate	Unclassified
525	2643221712	Ensifer sp. Root258	Isolate	Unclassified
526	2643221723	Ensifer sp. Root278	Isolate	Unclassified
527	2643221726	Ensifer sp. Root954	Isolate	Unclassified
528	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
529	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
530	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
531	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
532	2739367664	Novosphingobium sp. GV002	Isolate	Unclassified
533	2739367865	Novosphingobium sp. GV013	Isolate	Unclassified
534	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
535	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
536	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
537	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
538	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
539	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
540	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
541	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
542	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
543	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
544	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
545	2775507255	Sphingobium indicum B90A	Isolate	Rhizosphere
546	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
547	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
548	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
549	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
550	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
551	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
552	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
553	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
554	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
555	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
556	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
557	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
558	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
559	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
560	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
561	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
562	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
563	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
564	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
565	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
566	2830075706	Sphingomonas jinjuensis DSM 21457	Isolate	Rhizosphere
567	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
568	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
569	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
570	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
571	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
572	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
573	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
574	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
575	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
576	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
577	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
578	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
579	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
580	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
581	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
582	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
583	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
584	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
585	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
586	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
587	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
588	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
589	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
590	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
591	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
592	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
593	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
594	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
595	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
596	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
597	2854911287	Brucella lupini LUP21	Isolate	Unclassified
598	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
599	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
600	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
601	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
602	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
603	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
604	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
605	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
606	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
607	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
608	2896253425	Aurantiacibacter rhizosphaerae GH3-10	Isolate	Rhizosphere
609	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
610	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
611	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
612	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
613	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
614	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
615	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
616	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
617	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
618	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
619	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
620	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
621	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
622	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
623	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
624	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
625	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
626	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
627	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
628	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
629	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
630	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
631	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
632	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
633	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
634	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
635	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
636	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
637	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
638	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
639	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
640	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
641	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
642	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
643	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
644	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
645	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
646	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
647	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
648	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
649	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
650	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
651	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
652	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
653	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
654	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
655	2928027323	Sphingomonas sp. 1185	Isolate	Unclassified
656	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
657	2928526807	Sphingomonas trueperi 1770	Isolate	Rhizosphere
658	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
659	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
660	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
661	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
662	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
663	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
664	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
665	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
666	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
667	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
668	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
669	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
670	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
671	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
672	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
673	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
674	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
675	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
676	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
677	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
678	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
679	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
680	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
681	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
682	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
683	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
684	2946787523	Sphingomonas faeni W4I17	Isolate	Rhizosphere
685	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
686	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
687	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
688	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
689	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
690	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
691	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
692	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
693	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
694	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
695	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
696	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
697	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
698	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
699	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
700	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
701	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
702	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
703	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
704	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
705	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
706	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
707	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
708	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
709	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
710	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
711	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
712	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
713	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
714	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
715	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
716	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
717	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
718	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
719	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
720	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
721	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
722	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
723	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
724	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
725	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
726	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
727	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
728	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
729	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
730	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
731	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
732	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
733	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
734	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
735	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
736	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
737	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
738	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
739	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
740	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
741	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
742	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
743	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
744	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
745	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
746	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
747	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
748	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
749	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
750	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
751	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
752	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
753	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
754	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
755	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
756	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
757	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
758	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
759	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
760	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
761	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
762	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
763	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
764	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
765	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
766	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
767	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
768	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
769	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
770	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
771	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
772	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
773	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
774	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
775	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
776	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
777	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
778	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
779	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
780	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
781	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
782	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
783	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
784	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
785	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
786	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
787	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
788	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
789	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
790	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
791	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
792	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
793	2984555340	Sphingomonas sp. SORGH_AS789	Isolate	Aerial Root
794	2984564862	Sphingomonas sp. SORGH_AS870	Isolate	Aerial Root
795	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
796	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
797	2990265787	Sphingomonas sp. SORGH_AS802	Isolate	Aerial Root
798	2993356040	Sphingomonas sp. SORGH_AS742	Isolate	Aerial Root
799	2993693658	Sphingomonas sp. SORGH_AS438	Isolate	Aerial Root
800	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
801	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
802	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
803	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
804	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
805	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
806	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
807	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
808	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
809	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
810	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
811	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
812	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
813	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
814	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
815	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
816	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
817	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
818	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
819	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
820	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
821	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
822	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
823	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
824	8057101203	Sphingomonas lycopersici MMSM20	Isolate	Rhizosphere
825	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	73.47
Metatranscriptomes	0.5
Isolates	26.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0.36
Bulb	0
Endosphere	11.79
Nodule	19.48
Rhizoplane	2.95
Rhizosphere	54.35
Stem	0
Stem Tuber	0
Unclassified	1.01

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495625_0017887	3300046660	Bacteria	5541
2	JGI24736J21556_1000185	3300001904	Bacteria	11068
3	JGI24736J21556_1001548	3300001904	Bacteria	4184
4	JGI24741J21665_1000045	3300001915	Bacteria	30044
5	JGI24739J22299_10000095	3300001989	Bacteria	25993
6	JGI24739J22299_10003612	3300001989	Bacteria	5909
7	JGI24739J22299_10011937	3300001989	Bacteria	3195
8	JGI24737J22298_10014256	3300001990	Bacteria	2582
9	JGI24735J21928_10004127	3300002067	Bacteria	4906
10	JGI24735J21928_10008073	3300002067	Bacteria	3416
11	JGI24735J21928_10014478	3300002067	Bacteria	2469
12	JGI24735J21928_10023493	3300002067	Bacteria	1869
13	JGI24750J21931_1000436	3300002070	Bacteria	6775
14	JGI24748J21848_1000063	3300002074	Bacteria	40664
15	JGI24738J21930_10000967	3300002075	Bacteria	8242
16	JGI24749J21850_1000018	3300002076	Bacteria	32428
17	JGI24034J26672_10000007	3300002239	Bacteria	224370
18	JGI24751J29686_10000115	3300002459	Bacteria	42174
19	JGI24751J29686_10000235	3300002459	Bacteria	22528
20	JGI24751J29686_10004035	3300002459	Bacteria	2970
21	JGI25155J39150_1000069	3300002704	Bacteria	64645
22	JGI25156J39149_1000095	3300002705	Bacteria	64645
23	JGI25154J39366_1000866	3300002738	Bacteria	13083
24	JGI25157J39369_1000732	3300002741	Bacteria	17479
25	JGI25150J39212_1000126	3300002774	Bacteria	42982
26	JGI25159J45721_1003717	3300002987	Bacteria	5291
27	JGI25159J45721_1006593	3300002987	Bacteria	3456
28	JGI25151J46595_10003658	3300003187	Bacteria	8381
29	JGI25151J46595_10007368	3300003187	Bacteria	5402
30	JGI25165J46597_1000041	3300003214	Bacteria	272566
31	JGI25165J46597_1000043	3300003214	Bacteria	264515
32	JGI25153J46596_10000115	3300003215	Bacteria	91366
33	JGI25153J46596_10000305	3300003215	Bacteria	36679
34	JGI25153J46596_10009756	3300003215	Bacteria	4416
35	JGI25153J46596_10019462	3300003215	Bacteria	2600
36	JGI25153J46596_10021828	3300003215	Bacteria	2378
37	rootL2_10134394	3300003322	Bacteria	7000
38	JGI25160J50197_1000003	3300003354	Bacteria	482719
39	JGI25160J50197_1000287	3300003354	Bacteria	36528
40	JGI25160J50197_1005283	3300003354	Bacteria	5402
41	JGI25161J50226_1000176	3300003374	Bacteria	42677
42	JGI25161J50226_1000299	3300003374	Bacteria	27879
43	JGI25161J50226_1003479	3300003374	Bacteria	3584
44	Ga0055525_1000104	3300003759	Bacteria	134560
45	Ga0055542_1000025	3300003762	Bacteria	263538
46	Ga0055529_1000014	3300003763	Bacteria	367283
47	Ga0055526_1004618	3300003771	Bacteria	8205
48	Ga0055526_1007718	3300003771	Bacteria	5523
49	Ga0055526_1007837	3300003771	Bacteria	5462
50	Ga0055524_1000056	3300003775	Bacteria	141764
51	Ga0055524_1006032	3300003775	Bacteria	5317
52	Ga0055524_1006689	3300003775	Bacteria	4979
53	Ga0055536_1001996	3300003781	Bacteria	11706
54	Ga0055528_1018190	3300003790	Bacteria	2393
55	Ga0055530_10000027	3300003791	Bacteria	129838
56	Ga0055530_10000931	3300003791	Bacteria	23980
57	Ga0055530_10011442	3300003791	Bacteria	3186
58	Ga0055530_10013499	3300003791	Bacteria	2785
59	Ga0055540_1001336	3300003792	Bacteria	14852
60	Ga0055531_10000013	3300003794	Bacteria	187583
61	Ga0055531_10014149	3300003794	Bacteria	3616
62	Ga0055531_10027395	3300003794	Bacteria	2001
63	Ga0055543_1000034	3300004625	Bacteria	128668
64	Ga0055543_1000114	3300004625	Bacteria	69144
65	Ga0055543_1001135	3300004625	Bacteria	11409
66	Ga0058863_11910898	3300004799	Bacteria	1853
67	Ga0058861_12061624	3300004800	Bacteria	1765
68	Ga0058862_12737959	3300004803	Bacteria	1855
69	Ga0065165_1000047	3300005262	Bacteria	197811
70	Ga0065165_1003833	3300005262	Bacteria	10014
71	Ga0065165_1004051	3300005262	Bacteria	9518
72	Ga0065165_1012721	3300005262	Bacteria	3403
73	Ga0065165_1013057	3300005262	Bacteria	3328
74	Ga0065704_10002519	3300005289	Bacteria	5081
75	Ga0065704_10070744	3300005289	Bacteria	16791
76	Ga0065707_10084641	3300005295	Bacteria	6937
77	Ga0065707_10149171	3300005295	Bacteria	1677
78	Ga0070658_10000033	3300005327	Bacteria	147380
79	Ga0070658_10014420	3300005327	Bacteria	6342
80	Ga0070658_10107179	3300005327	Bacteria	2312
81	Ga0070676_10003672	3300005328	Bacteria	8035
82	Ga0070690_100000024	3300005330	Bacteria	69563
83	Ga0070690_100000483	3300005330	Bacteria	20028
84	Ga0070690_100014932	3300005330	Bacteria	4620
85	Ga0070690_100043813	3300005330	Bacteria	2839
86	Ga0070670_100000074	3300005331	Bacteria	97530
87	Ga0070670_100000409	3300005331	Bacteria	35372
88	Ga0070670_100004278	3300005331	Bacteria	11948
89	Ga0070670_100044213	3300005331	Bacteria	3830
90	Ga0070670_100221670	3300005331	Bacteria	1645
91	Ga0070666_10000017	3300005335	Bacteria	190526
92	Ga0070666_10000160	3300005335	Bacteria	46166
93	Ga0070666_10001625	3300005335	Bacteria	13672
94	Ga0070666_10026239	3300005335	Bacteria	3804
95	Ga0070666_10026566	3300005335	Bacteria	3784
96	Ga0070680_100169761	3300005336	Bacteria	1835
97	Ga0068868_100002423	3300005338	Bacteria	12922
98	Ga0070660_100000225	3300005339	Bacteria	37405
99	Ga0070660_100006402	3300005339	Bacteria	8160
100	Ga0070660_100022696	3300005339	Bacteria	4645
101	Ga0070660_100043168	3300005339	Bacteria	3444
102	Ga0070660_100108019	3300005339	Bacteria	2211
103	Ga0070689_100043036	3300005340	Bacteria	3469
104	Ga0070689_100095475	3300005340	Bacteria	2348
105	Ga0070661_100224086	3300005344	Bacteria	1443
106	Ga0070692_10005729	3300005345	Bacteria	5334
107	Ga0070668_100000197	3300005347	Bacteria	39485
108	Ga0070668_100031066	3300005347	Bacteria	4063
109	Ga0070668_100080044	3300005347	Bacteria	2559
110	Ga0070668_100103426	3300005347	Bacteria	2259
111	Ga0070668_100174904	3300005347	Bacteria	1750
112	Ga0070668_100197028	3300005347	Bacteria	1652
113	Ga0070669_100000013	3300005353	Bacteria	210577
114	Ga0070669_100000058	3300005353	Bacteria	110162
115	Ga0070669_100003312	3300005353	Bacteria	11582
116	Ga0070669_100013530	3300005353	Bacteria	5800
117	Ga0070669_100045809	3300005353	Bacteria	3188
118	Ga0070675_100007844	3300005354	Bacteria	8273
119	Ga0070671_100000009	3300005355	Bacteria	206508
120	Ga0070671_100000482	3300005355	Bacteria	27745
121	Ga0070671_100004829	3300005355	Bacteria	10718
122	Ga0070671_100013940	3300005355	Bacteria	6487
123	Ga0070671_100015118	3300005355	Bacteria	6233
124	Ga0070671_100016699	3300005355	Bacteria	5935
125	Ga0070671_100032053	3300005355	Unclassified	4345
126	Ga0070674_100010775	3300005356	Bacteria	5543
127	Ga0070674_100020424	3300005356	Bacteria	4232
128	Ga0070673_100000138	3300005364	Bacteria	34274
129	Ga0070673_100010149	3300005364	Bacteria	6360
130	Ga0070659_100023655	3300005366	Bacteria	4704
131	Ga0070659_100038689	3300005366	Bacteria	3721
132	Ga0070659_100041111	3300005366	Bacteria	3613
133	Ga0070659_100062954	3300005366	Bacteria	2934
134	Ga0070659_100097236	3300005366	Bacteria	2366
135	Ga0070659_100119598	3300005366	Bacteria	2132
136	Ga0070667_100000017	3300005367	Bacteria	230531
137	Ga0070667_100000024	3300005367	Bacteria	191216
138	Ga0070667_100003990	3300005367	Bacteria	12503
139	Ga0070667_100008843	3300005367	Bacteria	8338
140	Ga0070667_100012637	3300005367	Bacteria	6982
141	Ga0070667_100063753	3300005367	Bacteria	3124
142	Ga0070667_100122428	3300005367	Bacteria	2264
143	Ga0070709_10000892	3300005434	Bacteria	16688
144	Ga0070714_100015160	3300005435	Bacteria	6198
145	Ga0070714_100078232	3300005435	Bacteria	2874
146	Ga0070713_100000003	3300005436	Bacteria	245840
147	Ga0070710_10045250	3300005437	Bacteria	2446
148	Ga0070711_100033038	3300005439	Bacteria	3444
149	Ga0070663_100015679	3300005455	Bacteria	4900
150	Ga0070678_100000057	3300005456	Bacteria	40248
151	Ga0070678_100001464	3300005456	Bacteria	12579
152	Ga0070662_100048101	3300005457	Bacteria	3071
153	Ga0070662_100096720	3300005457	Bacteria	2227
154	Ga0070685_10000389	3300005466	Bacteria	26431
155	Ga0070679_100143648	3300005530	Bacteria	2365
156	Ga0070679_100199771	3300005530	Bacteria	1966
157	Ga0070697_100097945	3300005536	Bacteria	2434
158	Ga0068853_100013242	3300005539	Bacteria	6731
159	Ga0068853_100017003	3300005539	Bacteria	5997
160	Ga0068853_100036747	3300005539	Bacteria	4166
161	Ga0070672_100005400	3300005543	Bacteria	8462
162	Ga0070686_100010480	3300005544	Bacteria	5229
163	Ga0070695_100079773	3300005545	Bacteria	2162
164	Ga0070665_100000042	3300005548	Bacteria	292582
165	Ga0070665_100000319	3300005548	Bacteria	74295
166	Ga0070665_100007081	3300005548	Bacteria	11395
167	Ga0070665_100010626	3300005548	Bacteria	9318
168	Ga0070665_100049096	3300005548	Bacteria	4235
169	Ga0070665_100074881	3300005548	Bacteria	3391
170	Ga0070665_100144530	3300005548	Bacteria	2382
171	Ga0070665_100241459	3300005548	Bacteria	1807
172	Ga0068855_100000608	3300005563	Bacteria	43919
173	Ga0068855_100155318	3300005563	Bacteria	2600
174	Ga0070664_100021787	3300005564	Bacteria	5284
175	Ga0068857_100005280	3300005577	Bacteria	11000
176	Ga0068857_100049639	3300005577	Bacteria	3723
177	Ga0068857_100066411	3300005577	Bacteria	3209
178	Ga0068857_100100978	3300005577	Bacteria	2588
179	Ga0068857_100144066	3300005577	Bacteria	2155
180	Ga0068854_100134981	3300005578	Bacteria	1888
181	Ga0068856_100000719	3300005614	Bacteria	36011
182	Ga0068856_100003762	3300005614	Bacteria	15216
183	Ga0068856_100009436	3300005614	Bacteria	9475
184	Ga0068856_100171757	3300005614	Bacteria	2180
185	Ga0068856_100179211	3300005614	Bacteria	2132
186	Ga0068852_100000753	3300005616	Bacteria	21299
187	Ga0068852_100165021	3300005616	Unclassified	2072
188	Ga0068859_100001232	3300005617	Bacteria	26157
189	Ga0068859_100003906	3300005617	Bacteria	15207
190	Ga0068859_100006922	3300005617	Bacteria	11512
191	Ga0068859_100023002	3300005617	Bacteria	6251
192	Ga0068859_100103822	3300005617	Bacteria	2901
193	Ga0068859_100141475	3300005617	Bacteria	2480
194	Ga0068864_100000260	3300005618	Bacteria	47076
195	Ga0068864_100003187	3300005618	Bacteria	13568
196	Ga0068864_100017327	3300005618	Bacteria	6004
197	Ga0068864_100030494	3300005618	Bacteria	4571
198	Ga0068861_100000074	3300005719	Bacteria	48480
199	Ga0068861_100001071	3300005719	Bacteria	16866
200	Ga0068861_100004608	3300005719	Bacteria	9251
201	Ga0068861_100010221	3300005719	Bacteria	6515
202	Ga0068861_100011989	3300005719	Bacteria	6037
203	Ga0068863_100000082	3300005841	Bacteria	105688
204	Ga0068863_100000280	3300005841	Bacteria	52729
205	Ga0068863_100007010	3300005841	Bacteria	11048
206	Ga0068863_100027387	3300005841	Bacteria	5436
207	Ga0068863_100055600	3300005841	Bacteria	3747
208	Ga0068863_100173781	3300005841	Bacteria	2067
209	Ga0068858_100000303	3300005842	Bacteria	52646
210	Ga0068858_100000591	3300005842	Bacteria	37967
211	Ga0068858_100001032	3300005842	Bacteria	28756
212	Ga0068858_100003432	3300005842	Bacteria	15745
213	Ga0068858_100013493	3300005842	Bacteria	7709
214	Ga0068858_100014160	3300005842	Bacteria	7520
215	Ga0068858_100162541	3300005842	Bacteria	2103
216	Ga0068860_100000056	3300005843	Bacteria	202751
217	Ga0068860_100000062	3300005843	Bacteria	190526
218	Ga0068860_100000944	3300005843	Bacteria	32201
219	Ga0068860_100018956	3300005843	Bacteria	6684
220	Ga0068860_100047514	3300005843	Bacteria	4091
221	Ga0068862_100000081	3300005844	Bacteria	113133
222	Ga0068862_100000280	3300005844	Bacteria	56780
223	Ga0068862_100000308	3300005844	Bacteria	53687
224	Ga0068862_100004544	3300005844	Bacteria	11698
225	Ga0068862_100017500	3300005844	Bacteria	5970
226	Ga0068862_100019008	3300005844	Bacteria	5729
227	Ga0081455_10000255	3300005937	Bacteria	69927
228	Ga0081540_1009297	3300005983	Bacteria	6781
229	Ga0081539_10006765	3300005985	Bacteria	10759
230	Ga0070717_10193808	3300006028	Bacteria	1777
231	Ga0070717_10220193	3300006028	Bacteria	1668
232	Ga0075365_10013351	3300006038	Bacteria	4908
233	Ga0075365_10074003	3300006038	Bacteria	2297
234	Ga0070712_100000169	3300006175	Bacteria	35660
235	Ga0075362_10004292	3300006177	Bacteria	5098
236	Ga0075367_10012269	3300006178	Bacteria	4563
237	Ga0075369_10005723	3300006186	Bacteria	4663
238	Ga0097621_100013780	3300006237	Bacteria	6037
239	Ga0075370_10010246	3300006353	Bacteria	4893
240	Ga0068871_100008468	3300006358	Bacteria	7400
241	Ga0068871_100024042	3300006358	Unclassified	4721
242	Ga0075430_100151222	3300006846	Bacteria	1933
243	Ga0075431_100004735	3300006847	Bacteria	13375
244	Ga0075431_100014844	3300006847	Bacteria	7886
245	Ga0075433_10031628	3300006852	Bacteria	4525
246	Ga0075434_100129812	3300006871	Bacteria	2539
247	Ga0075436_100000038	3300006914	Bacteria	82918
248	Ga0075436_100045939	3300006914	Bacteria	3013
249	Ga0097620_100001232	3300006931	Bacteria	26157
250	Ga0097620_100003906	3300006931	Bacteria	15207
251	Ga0097620_100006922	3300006931	Bacteria	11512
252	Ga0097620_100022995	3300006931	Bacteria	6251
253	Ga0097620_100103821	3300006931	Bacteria	2901
254	Ga0097620_100141468	3300006931	Bacteria	2480
255	Ga0079104_1000125	3300006946	Bacteria	110104
256	Ga0079104_1004867	3300006946	Bacteria	5564
257	Ga0079104_1006152	3300006946	Bacteria	4617
258	Ga0105240_10008524	3300009093	Bacteria	14649
259	Ga0105240_10098810	3300009093	Bacteria	3553
260	Ga0105240_10361753	3300009093	Bacteria	1643
261	Ga0111539_10000890	3300009094	Bacteria	39032
262	Ga0114129_10001654	3300009147	Bacteria	30326
263	Ga0114129_10026011	3300009147	Bacteria	8288
264	Ga0114129_10034137	3300009147	Bacteria	7185
265	Ga0114129_10443639	3300009147	Bacteria	1703
266	Ga0114129_10524881	3300009147	Bacteria	1543
267	Ga0105243_10000033	3300009148	Bacteria	180464
268	Ga0105241_10013534	3300009174	Bacteria	5979
269	Ga0105241_10017676	3300009174	Bacteria	5243
270	Ga0105241_10030093	3300009174	Bacteria	4055
271	Ga0105248_10001187	3300009177	Bacteria	29143
272	Ga0105248_10008690	3300009177	Bacteria	11160
273	Ga0105248_10016997	3300009177	Bacteria	8013
274	Ga0105248_10017774	3300009177	Bacteria	7846
275	Ga0105248_10025390	3300009177	Bacteria	6588
276	Ga0105248_10152523	3300009177	Bacteria	2607
277	Ga0105248_10315041	3300009177	Bacteria	1762
278	Ga0105237_10002470	3300009545	Bacteria	22937
279	Ga0105238_10003588	3300009551	Bacteria	15470
280	Ga0105238_10113471	3300009551	Bacteria	2690
281	Ga0105249_10000012	3300009553	Bacteria	292640
282	Ga0105249_10000103	3300009553	Bacteria	118397
283	Ga0105249_10020498	3300009553	Bacteria	5909
284	Ga0105246_10116683	3300011119	Bacteria	1971
285	Ga0157326_1000338	3300012513	Bacteria	5509
286	Ga0157371_10000059	3300013102	Bacteria	170541
287	Ga0157371_10025477	3300013102	Bacteria	4310
288	Ga0157370_10000069	3300013104	Bacteria	112889
289	Ga0157370_10049403	3300013104	Bacteria	4026
290	Ga0157369_10004747	3300013105	Bacteria	15970
291	Ga0157369_10030829	3300013105	Bacteria	5911
292	Ga0157369_10038626	3300013105	Bacteria	5219
293	Ga0157369_10097133	3300013105	Bacteria	3142
294	Ga0171463_1001	3300013249	Bacteria	1406070
295	Ga0157378_10002131	3300013297	Bacteria	17601
296	Ga0157378_10137652	3300013297	Bacteria	2265
297	Ga0163162_10001741	3300013306	Bacteria	20418
298	Ga0163162_10005593	3300013306	Bacteria	12158
299	Ga0163162_10013689	3300013306	Bacteria	7926
300	Ga0163162_10046965	3300013306	Bacteria	4328
301	Ga0163162_10066770	3300013306	Bacteria	3646
302	Ga0163162_10102190	3300013306	Bacteria	2960
303	Ga0157372_10232582	3300013307	Bacteria	2137
304	Ga0157375_10002592	3300013308	Bacteria	15698
305	Ga0157375_10006186	3300013308	Bacteria	10435
306	Ga0157375_10065252	3300013308	Bacteria	3629
307	Ga0163163_10022274	3300014325	Bacteria	5996
308	Ga0157380_10000151	3300014326	Bacteria	39765
309	Ga0157380_10001425	3300014326	Bacteria	15655
310	Ga0157379_10036388	3300014968	Bacteria	4390
311	Ga0157379_10137507	3300014968	Bacteria	2202
312	Ga0157376_10000903	3300014969	Bacteria	19363
313	Ga0183363_1004	3300015690	Bacteria	416766
314	Ga0183363_1053	3300015690	Bacteria	36839
315	Ga0163161_10000025	3300017792	Bacteria	201127
316	Ga0163161_10038310	3300017792	Bacteria	3438
317	Ga0206356_11309587	3300020070	Bacteria	1807
318	Ga0206350_11038354	3300020080	Eukaryota	1789
319	Ga0206354_10710180	3300020081	Bacteria	1848
320	Ga0214544_1000434	3300021320	Bacteria	75507
321	Ga0214542_1000146	3300021321	Bacteria	103035
322	Ga0214542_1027236	3300021321	Bacteria	2648
323	Ga0214543_1000049	3300021327	Bacteria	149506
324	Ga0214543_1000054	3300021327	Bacteria	140288
325	Ga0213876_10000310	3300021384	Bacteria	42816
326	Ga0224712_10035483	3300022467	Bacteria	1841
327	Ga0228711_1000006	3300022739	Bacteria	202437
328	Ga0228710_1000004	3300022740	Bacteria	250560
329	Ga0209435_100049	3300025206	Bacteria	92067
330	Ga0207672_1000205	3300025223	Bacteria	8314
331	Ga0209563_100116	3300025230	Bacteria	134661
332	Ga0207425_1000041	3300025245	Bacteria	210441
333	Ga0207425_1004457	3300025245	Bacteria	4194
334	Ga0209646_1000159	3300025246	Bacteria	92067
335	Ga0209026_1000183	3300025250	Bacteria	92067
336	Ga0209026_1000650	3300025250	Bacteria	21317
337	Ga0209148_1000011	3300025254	Bacteria	1196503
338	Ga0209148_1000238	3300025254	Bacteria	87836
339	Ga0209148_1003278	3300025254	Bacteria	4582
340	Ga0209759_1000206	3300025256	Bacteria	92067
341	Ga0209129_1000359	3300025258	Bacteria	37937
342	Ga0209129_1006060	3300025258	Bacteria	4043
343	Ga0209233_1000079	3300025261	Bacteria	346944
344	Ga0209233_1000104	3300025261	Bacteria	272675
345	Ga0209565_1000008	3300025263	Bacteria	774179
346	Ga0209565_1000134	3300025263	Bacteria	104013
347	Ga0209455_1000006	3300025272	Bacteria	1196503
348	Ga0209673_1000584	3300025273	Bacteria	57616
349	Ga0209673_1003724	3300025273	Bacteria	8722
350	Ga0209673_1004104	3300025273	Bacteria	8005
351	Ga0209130_1000005	3300025284	Bacteria	599620
352	Ga0209130_1000642	3300025284	Bacteria	32652
353	Ga0209675_1003991	3300025291	Bacteria	6740
354	Ga0209676_1001593	3300025292	Bacteria	20182
355	Ga0209025_1000037	3300025294	Bacteria	383429
356	Ga0209025_1000068	3300025294	Bacteria	294129
357	Ga0209025_1000814	3300025294	Bacteria	50030
358	Ga0209025_1011026	3300025294	Bacteria	6026
359	Ga0209564_1000113	3300025295	Bacteria	211564
360	Ga0209564_1001020	3300025295	Bacteria	34568
361	Ga0209564_1006879	3300025295	Bacteria	5996
362	Ga0209758_1000001	3300025297	Bacteria	1981790
363	Ga0209758_1000004	3300025297	Bacteria	1375322
364	Ga0209758_1001197	3300025297	Bacteria	32795
365	Ga0209758_1004151	3300025297	Bacteria	12343
366	Ga0209758_1008214	3300025297	Bacteria	6837
367	Ga0209050_1000001	3300025298	Bacteria	3563507
368	Ga0209050_1000014	3300025298	Bacteria	774327
369	Ga0209050_1002150	3300025298	Bacteria	17933
370	Ga0209050_1009997	3300025298	Bacteria	4747
371	Ga0209256_1000009	3300025299	Bacteria	922071
372	Ga0209256_1000010	3300025299	Bacteria	912110
373	Ga0209256_1000819	3300025299	Bacteria	39621
374	Ga0209256_1002787	3300025299	Bacteria	13398
375	Ga0209256_1007106	3300025299	Bacteria	5646
376	Ga0207426_1000015	3300025302	Bacteria	599316
377	Ga0207426_1000330	3300025302	Bacteria	89992
378	Ga0207426_1000812	3300025302	Bacteria	33529
379	Ga0207426_1028357	3300025302	Bacteria	1857
380	Ga0209051_1000232	3300025303	Bacteria	93680
381	Ga0209051_1009681	3300025303	Bacteria	4943
382	Ga0209257_1000019	3300025304	Bacteria	774261
383	Ga0209257_1003713	3300025304	Bacteria	12689
384	Ga0209257_1005528	3300025304	Bacteria	8809
385	Ga0209257_1018206	3300025304	Bacteria	2718
386	Ga0207656_10043107	3300025321	Bacteria	1923
387	Ga0207713_1004595	3300025735	Bacteria	8919
388	Ga0207682_10011989	3300025893	Bacteria	3383
389	Ga0207680_10000012	3300025903	Bacteria	293810
390	Ga0207680_10001210	3300025903	Bacteria	12223
391	Ga0207680_10005315	3300025903	Bacteria	6148
392	Ga0207680_10025252	3300025903	Bacteria	3275
393	Ga0207647_10000497	3300025904	Bacteria	31453
394	Ga0207647_10001733	3300025904	Bacteria	16727
395	Ga0207647_10025680	3300025904	Bacteria	3865
396	Ga0207647_10043369	3300025904	Bacteria	2816
397	Ga0207699_10000676	3300025906	Bacteria	16381
398	Ga0207645_10002209	3300025907	Bacteria	15534
399	Ga0207705_10000002	3300025909	Bacteria	2046852
400	Ga0207705_10000197	3300025909	Bacteria	61058
401	Ga0207705_10016169	3300025909	Bacteria	5353
402	Ga0207705_10179745	3300025909	Bacteria	1596
403	Ga0207654_10000222	3300025911	Bacteria	34847
404	Ga0207654_10000293	3300025911	Bacteria	30167
405	Ga0207707_10160961	3300025912	Bacteria	1963
406	Ga0207695_10000641	3300025913	Bacteria	69705
407	Ga0207695_10033073	3300025913	Bacteria	5648
408	Ga0207695_10069418	3300025913	Bacteria	3605
409	Ga0207695_10080915	3300025913	Bacteria	3289
410	Ga0207671_10002072	3300025914	Bacteria	21940
411	Ga0207671_10003353	3300025914	Bacteria	16074
412	Ga0207657_10041918	3300025919	Bacteria	4043
413	Ga0207657_10087798	3300025919	Bacteria	2601
414	Ga0207657_10105879	3300025919	Bacteria	2328
415	Ga0207657_10119347	3300025919	Bacteria	2170
416	Ga0207657_10134006	3300025919	Bacteria	2028
417	Ga0207649_10000319	3300025920	Bacteria	36478
418	Ga0207649_10055003	3300025920	Bacteria	2479
419	Ga0207652_10056019	3300025921	Bacteria	3393
420	Ga0207646_10046513	3300025922	Unclassified	3893
421	Ga0207681_10000003	3300025923	Bacteria	713245
422	Ga0207681_10000008	3300025923	Bacteria	414329
423	Ga0207681_10000221	3300025923	Bacteria	45206
424	Ga0207681_10000259	3300025923	Bacteria	40452
425	Ga0207681_10000667	3300025923	Bacteria	22714
426	Ga0207681_10044582	3300025923	Bacteria	2973
427	Ga0207694_10003805	3300025924	Bacteria	11940
428	Ga0207694_10055561	3300025924	Bacteria	3073
429	Ga0207650_10000038	3300025925	Bacteria	206081
430	Ga0207650_10001576	3300025925	Bacteria	16287
431	Ga0207650_10002138	3300025925	Bacteria	13823
432	Ga0207650_10007425	3300025925	Bacteria	7470
433	Ga0207650_10027164	3300025925	Bacteria	4094
434	Ga0207650_10100427	3300025925	Bacteria	2226
435	Ga0207659_10002827	3300025926	Bacteria	10358
436	Ga0207659_10118854	3300025926	Bacteria	2022
437	Ga0207687_10039346	3300025927	Bacteria	3237
438	Ga0207700_10000083	3300025928	Bacteria	58710
439	Ga0207700_10034972	3300025928	Bacteria	3613
440	Ga0207664_10011315	3300025929	Bacteria	6331
441	Ga0207644_10000006	3300025931	Bacteria	408793
442	Ga0207644_10000060	3300025931	Bacteria	79209
443	Ga0207644_10000385	3300025931	Bacteria	28685
444	Ga0207644_10000927	3300025931	Bacteria	18628
445	Ga0207644_10002506	3300025931	Bacteria	11823
446	Ga0207644_10017065	3300025931	Bacteria	4896
447	Ga0207644_10017956	3300025931	Unclassified	4783
448	Ga0207644_10037322	3300025931	Bacteria	3417
449	Ga0207690_10010226	3300025932	Bacteria	5570
450	Ga0207690_10010856	3300025932	Bacteria	5428
451	Ga0207690_10013890	3300025932	Bacteria	4851
452	Ga0207690_10087993	3300025932	Bacteria	2187
453	Ga0207690_10142117	3300025932	Bacteria	1770
454	Ga0207690_10148204	3300025932	Unclassified	1737
455	Ga0207706_10003677	3300025933	Bacteria	14643
456	Ga0207706_10009415	3300025933	Bacteria	8967
457	Ga0207706_10141341	3300025933	Bacteria	2118
458	Ga0207709_10000059	3300025935	Bacteria	211914
459	Ga0207669_10005970	3300025937	Bacteria	5520
460	Ga0207691_10000019	3300025940	Bacteria	133680
461	Ga0207711_10002994	3300025941	Bacteria	14761
462	Ga0207711_10011653	3300025941	Bacteria	7305
463	Ga0207711_10014565	3300025941	Bacteria	6536
464	Ga0207711_10029281	3300025941	Bacteria	4643
465	Ga0207711_10224428	3300025941	Bacteria	1719
466	Ga0207711_10268308	3300025941	Bacteria	1570
467	Ga0207679_10017290	3300025945	Unclassified	4807
468	Ga0207679_10067410	3300025945	Bacteria	2685
469	Ga0207667_10000002	3300025949	Bacteria	895662
470	Ga0207667_10000916	3300025949	Bacteria	37599
471	Ga0207667_10005514	3300025949	Bacteria	15433
472	Ga0207667_10020324	3300025949	Bacteria	7390
473	Ga0207667_10044809	3300025949	Bacteria	4686
474	Ga0207667_10086736	3300025949	Bacteria	3239
475	Ga0207651_10001213	3300025960	Bacteria	11549
476	Ga0207651_10059026	3300025960	Bacteria	2654
477	Ga0207712_10000021	3300025961	Bacteria	292649
478	Ga0207712_10000069	3300025961	Bacteria	127318
479	Ga0207712_10020513	3300025961	Bacteria	4328
480	Ga0207668_10000178	3300025972	Bacteria	43552
481	Ga0207668_10000647	3300025972	Bacteria	21409
482	Ga0207668_10001332	3300025972	Bacteria	14663
483	Ga0207668_10022777	3300025972	Bacteria	4015
484	Ga0207668_10109414	3300025972	Bacteria	2070
485	Ga0207640_10117499	3300025981	Bacteria	1898
486	Ga0207658_10000011	3300025986	Bacteria	239620
487	Ga0207658_10000022	3300025986	Bacteria	191235
488	Ga0207658_10005443	3300025986	Bacteria	8730
489	Ga0207658_10014406	3300025986	Bacteria	5414
490	Ga0207658_10045858	3300025986	Bacteria	3189
491	Ga0207658_10064739	3300025986	Bacteria	2743
492	Ga0207658_10079952	3300025986	Bacteria	2502
493	Ga0207677_10002920	3300026023	Bacteria	9029
494	Ga0207703_10000205	3300026035	Bacteria	69078
495	Ga0207703_10000639	3300026035	Bacteria	35173
496	Ga0207703_10000714	3300026035	Bacteria	32756
497	Ga0207703_10014160	3300026035	Bacteria	6219
498	Ga0207639_10000691	3300026041	Bacteria	23195
499	Ga0207639_10003585	3300026041	Bacteria	10426
500	Ga0207678_10000218	3300026067	Bacteria	51096
501	Ga0207678_10025364	3300026067	Bacteria	5175
502	Ga0207702_10000045	3300026078	Bacteria	144714
503	Ga0207702_10002451	3300026078	Bacteria	17572
504	Ga0207702_10002929	3300026078	Bacteria	15968
505	Ga0207702_10028110	3300026078	Bacteria	4672
506	Ga0207702_10032499	3300026078	Bacteria	4354
507	Ga0207702_10104638	3300026078	Bacteria	2505
508	Ga0207641_10000115	3300026088	Bacteria	118497
509	Ga0207641_10000139	3300026088	Bacteria	105740
510	Ga0207641_10000414	3300026088	Bacteria	49835
511	Ga0207641_10002917	3300026088	Bacteria	15486
512	Ga0207641_10008887	3300026088	Bacteria	8296
513	Ga0207641_10033804	3300026088	Bacteria	4249
514	Ga0207641_10236824	3300026088	Bacteria	1699
515	Ga0207641_10321469	3300026088	Bacteria	1467
516	Ga0207648_10096920	3300026089	Bacteria	2581
517	Ga0207676_10000034	3300026095	Bacteria	206058
518	Ga0207676_10000613	3300026095	Bacteria	29202
519	Ga0207676_10001417	3300026095	Bacteria	17820
520	Ga0207676_10005994	3300026095	Bacteria	8574
521	Ga0207676_10035291	3300026095	Bacteria	3794
522	Ga0207674_10000026	3300026116	Bacteria	151359
523	Ga0207674_10027999	3300026116	Bacteria	5955
524	Ga0207674_10037284	3300026116	Bacteria	5058
525	Ga0207674_10041996	3300026116	Bacteria	4726
526	Ga0207674_10050697	3300026116	Bacteria	4239
527	Ga0207674_10057730	3300026116	Bacteria	3934
528	Ga0207674_10086805	3300026116	Bacteria	3123
529	Ga0207674_10164988	3300026116	Bacteria	2169
530	Ga0207675_100000244	3300026118	Bacteria	51844
531	Ga0207675_100000360	3300026118	Bacteria	43597
532	Ga0207675_100000533	3300026118	Bacteria	37022
533	Ga0207675_100006658	3300026118	Bacteria	10932
534	Ga0207675_100028656	3300026118	Bacteria	5187
535	Ga0207683_10002984	3300026121	Bacteria	14769
536	Ga0207683_10020489	3300026121	Bacteria	5656
537	Ga0207683_10020696	3300026121	Bacteria	5628
538	Ga0207698_10000130	3300026142	Bacteria	47043
539	Ga0207698_10274655	3300026142	Unclassified	1555
540	Ga0209281_1000102	3300027111	Bacteria	221665
541	Ga0209281_1000242	3300027111	Bacteria	110116
542	Ga0209281_1000695	3300027111	Bacteria	34292
543	Ga0209282_1000013	3300027666	Bacteria	215053
544	Ga0209813_10000111	3300027866	Bacteria	29673
545	Ga0209974_10004804	3300027876	Bacteria	4792
546	Ga0207428_10047662	3300027907	Bacteria	3440
547	Ga0268266_10000002	3300028379	Bacteria	3059047
548	Ga0268266_10000054	3300028379	Bacteria	292717
549	Ga0268266_10000212	3300028379	Bacteria	101029
550	Ga0268266_10012740	3300028379	Bacteria	7267
551	Ga0268266_10031160	3300028379	Bacteria	4528
552	Ga0268266_10056372	3300028379	Bacteria	3381
553	Ga0268266_10115169	3300028379	Bacteria	2386
554	Ga0268265_10000030	3300028380	Bacteria	228157
555	Ga0268265_10000292	3300028380	Bacteria	56426
556	Ga0268265_10000601	3300028380	Bacteria	36169
557	Ga0268265_10000739	3300028380	Bacteria	31842
558	Ga0268265_10006464	3300028380	Bacteria	7943
559	Ga0268264_10000074	3300028381	Bacteria	259555
560	Ga0268264_10000089	3300028381	Bacteria	234760
561	Ga0268264_10000310	3300028381	Bacteria	78142
562	Ga0268264_10002308	3300028381	Bacteria	16874
563	Ga0268264_10018414	3300028381	Bacteria	5711
564	Ga0268264_10046657	3300028381	Bacteria	3599
565	Ga0307517_10015953	3300028786	Bacteria	9920
566	Ga0307517_10028410	3300028786	Bacteria	6666
567	Ga0307517_10094042	3300028786	Bacteria	2424
568	Ga0268256_1004680	3300030500	Bacteria	5590
569	Ga0307513_10054454	3300031456	Bacteria	4289
570	Ga0307513_10109370	3300031456	Bacteria	2762
571	Ga0307408_100002167	3300031548	Bacteria	14050
572	Ga0307408_100134083	3300031548	Bacteria	1935
573	Ga0307508_10000398	3300031616	Bacteria	52452
574	Ga0307516_10137322	3300031730	Bacteria	2218
575	Ga0307405_10029241	3300031731	Bacteria	3219
576	Ga0307405_10047559	3300031731	Bacteria	2642
577	Ga0307405_10049815	3300031731	Bacteria	2591
578	Ga0307405_10086253	3300031731	Bacteria	2066
579	Ga0307405_10098046	3300031731	Bacteria	1958
580	Ga0307413_10053302	3300031824	Bacteria	2448
581	Ga0307406_10039675	3300031901	Bacteria	2923
582	Ga0307406_10176625	3300031901	Bacteria	1551
583	Ga0307407_10019922	3300031903	Bacteria	3424
584	Ga0307412_10019148	3300031911	Bacteria	4137
585	Ga0307412_10023819	3300031911	Bacteria	3772
586	Ga0315914_1000004	3300031967	Bacteria	288534
587	Ga0307409_100106263	3300031995	Bacteria	2342
588	Ga0307414_10016847	3300032004	Bacteria	4456
589	Ga0307414_10083941	3300032004	Bacteria	2341
590	Ga0307414_10224461	3300032004	Bacteria	1544
591	Ga0307415_100159691	3300032126	Bacteria	1746
592	Ga0307510_10008962	3300033180	Bacteria	11914
593	Ga0307510_10052621	3300033180	Bacteria	4289
594	Ga0315913_1000011	3300033430	Bacteria	140532
595	Ga0315915_1000003	3300033464	Bacteria	407996
596	Ga0373926_0012290	3300035083	Bacteria	2893
597	Ga0373936_0042425	3300035113	Bacteria	1826
598	Ga0373954_0006557	3300035118	Bacteria	5074
599	Ga0373954_0101270	3300035118	Bacteria	1390
600	Ga0373957_0005881	3300035120	Bacteria	3832
601	Ga0373943_0004815	3300035170	Bacteria	6097
602	Ga0373943_0036081	3300035170	Bacteria	2367
603	Ga0373943_0046767	3300035170	Bacteria	2113
604	Ga0373943_0081973	3300035170	Bacteria	1656
605	Ga0373955_0051397	3300035172	Bacteria	2245
606	Ga0373935_0004136	3300035692	Bacteria	8491
607	Ga0373935_0025842	3300035692	Bacteria	3619
608	Ga0373927_0013012	3300035695	Bacteria	5534
609	Ga0373927_0156870	3300035695	Bacteria	1491
610	Ga0373933_0014844	3300035724	Bacteria	4335
611	Ga0373933_0045726	3300035724	Bacteria	2597
612	Ga0373947_0016497	3300035725	Bacteria	4244
613	Ga0373947_0086858	3300035725	Bacteria	1945
614	Ga0373937_0004279	3300036401	Bacteria	12093
615	Ga0373937_0016703	3300036401	Bacteria	6522
616	Ga0373937_0027529	3300036401	Bacteria	5140
617	Ga0373937_0110922	3300036401	Bacteria	2551
618	Ga0373937_0144920	3300036401	Bacteria	2223
619	Ga0373925_0002642	3300037068	Bacteria	14220
620	Ga0373925_0038558	3300037068	Bacteria	3533
621	Ga0373925_0054265	3300037068	Bacteria	2997
622	Ga0373925_0131705	3300037068	Bacteria	1950
623	Ga0395899_0001521	3300037312	Bacteria	19608
624	Ga0395905_0109712	3300037471	Bacteria	2591
625	Ga0436364_0910692	3300037853	Bacteria	15334
626	Ga0436364_1027058	3300037853	Bacteria	7297
627	Ga0395901_0091535	3300038443	Bacteria	3184
628	Ga0237819_00949	3300038705	Bacteria	8836
629	Ga0237816_00649	3300039145	Bacteria	2933
630	Ga0436365_1654841	3300039437	Bacteria	47529
631	Ga0436360_0036174	3300039438	Bacteria	2882
632	Ga0436360_1255809	3300039438	Bacteria	2632
633	Ga0436362_1291891	3300039453	Bacteria	4496
634	Ga0439461_0000133	3300041410	Bacteria	9890
635	Ga0439461_0003201	3300041410	Bacteria	2680
636	Ga0439465_0002515	3300041413	Bacteria	5984
637	Ga0439465_0007006	3300041413	Bacteria	3582
638	Ga0439465_0010080	3300041413	Bacteria	2972
639	Ga0451793_0729188	3300041452	Bacteria	1990
640	Ga0451806_691803	3300041462	Bacteria	2065
641	Ga0451835_0937263	3300041492	Bacteria	6890
642	Ga0451849_0603856	3300041505	Bacteria	2074
643	Ga0439431_0000794	3300041997	Bacteria	6831
644	Ga0439431_0007345	3300041997	Bacteria	2456
645	Ga0439432_010870	3300042006	Bacteria	3144
646	Ga0439449_0002709	3300042007	Bacteria	6901
647	Ga0439462_0002763	3300042015	Bacteria	4122
648	Ga0439446_0003437	3300042156	Bacteria	3935
649	Ga0466972_0012842	3300044658	Bacteria	4206
650	Ga0466966_0060715	3300044684	Bacteria	2386
651	Ga0466968_0007104	3300044735	Bacteria	4248
652	Ga0466968_0014787	3300044735	Bacteria	3087
653	Ga0466970_0042451	3300044765	Bacteria	2419
654	Ga0466960_0058600	3300044901	Bacteria	1881
655	Ga0466959_0019769	3300045049	Bacteria	4955
656	Ga0451576_0000023	3300045051	Bacteria	477965
657	Ga0451576_0032757	3300045051	Bacteria	5527
658	Ga0495627_000157	3300046453	Bacteria	78082
659	Ga0495627_000318	3300046453	Bacteria	47190
660	Ga0495592_0087492	3300046454	Bacteria	2241
661	Ga0495592_0096045	3300046454	Bacteria	2119
662	Ga0495638_0000018	3300046460	Bacteria	389696
663	Ga0495638_0000214	3300046460	Bacteria	81426
664	Ga0495638_0003200	3300046460	Bacteria	12944
665	Ga0495638_0009219	3300046460	Bacteria	6938
666	Ga0495638_0013831	3300046460	Bacteria	5477
667	Ga0495651_0071686	3300046462	Bacteria	2633
668	Ga0495650_0000174	3300046471	Bacteria	142519
669	Ga0495650_0006704	3300046471	Bacteria	7130
670	Ga0495580_0017783	3300046472	Bacteria	5303
671	Ga0495582_0042330	3300046473	Bacteria	2508
672	Ga0495605_0002064	3300046474	Bacteria	12659
673	Ga0495639_0000789	3300046475	Bacteria	14448
674	Ga0495664_0007587	3300046477	Bacteria	6031
675	Ga0495584_0018885	3300046491	Bacteria	3503
676	Ga0495585_0016115	3300046492	Bacteria	4332
677	Ga0495585_0017595	3300046492	Bacteria	4128
678	Ga0495594_0015378	3300046499	Bacteria	4020
679	Ga0495596_0006273	3300046500	Bacteria	5499
680	Ga0495607_0037983	3300046501	Bacteria	2888
681	Ga0495583_0000038	3300046506	Bacteria	243395
682	Ga0495583_0002170	3300046506	Bacteria	17516
683	Ga0495583_0006072	3300046506	Bacteria	7988
684	Ga0495583_0017689	3300046506	Bacteria	3778
685	Ga0495583_0028306	3300046506	Bacteria	2756
686	Ga0495583_0035876	3300046506	Bacteria	2362
687	Ga0495606_0003780	3300046507	Bacteria	15734
688	Ga0495606_0017420	3300046507	Bacteria	5433
689	Ga0495606_0080258	3300046507	Bacteria	2030
690	Ga0495610_0000389	3300046512	Bacteria	45473
691	Ga0495610_0053919	3300046512	Bacteria	1945
692	Ga0495616_0000880	3300046513	Bacteria	21796
693	Ga0495616_0030509	3300046513	Bacteria	2833
694	Ga0495620_0013645	3300046515	Bacteria	4154
695	Ga0495630_0012981	3300046517	Bacteria	6052
696	Ga0495631_0001695	3300046518	Bacteria	13089
697	Ga0495632_0000042	3300046519	Bacteria	145186
698	Ga0495632_0001274	3300046519	Bacteria	21337
699	Ga0495632_0011422	3300046519	Bacteria	5182
700	Ga0495637_0001047	3300046520	Bacteria	17342
701	Ga0495637_0007051	3300046520	Bacteria	5597
702	Ga0495643_0000005	3300046522	Bacteria	443135
703	Ga0495643_0005203	3300046522	Bacteria	8863
704	Ga0495643_0020654	3300046522	Bacteria	3793
705	Ga0495643_0031010	3300046522	Bacteria	2979
706	Ga0495643_0065559	3300046522	Bacteria	1917
707	Ga0495648_0000144	3300046524	Bacteria	85412
708	Ga0495648_0000147	3300046524	Bacteria	84418
709	Ga0495648_0033238	3300046524	Bacteria	3372
710	Ga0495648_0034396	3300046524	Bacteria	3298
711	Ga0495663_0000015	3300046525	Bacteria	145185
712	Ga0495663_0005738	3300046525	Bacteria	3438
713	Ga0495663_0010363	3300046525	Bacteria	2592
714	Ga0495663_0017105	3300046525	Bacteria	2055
715	Ga0495652_0163682	3300046529	Bacteria	1724
716	Ga0495654_0000236	3300046530	Bacteria	51913
717	Ga0495654_0010002	3300046530	Bacteria	5180
718	Ga0495654_0015312	3300046530	Bacteria	4074
719	Ga0495665_0001769	3300046531	Bacteria	11640
720	Ga0495645_0003119	3300046543	Bacteria	11232
721	Ga0495633_0000197	3300046558	Bacteria	76903
722	Ga0495633_0000262	3300046558	Bacteria	62524
723	Ga0495633_0033295	3300046558	Bacteria	2485
724	Ga0495633_0073505	3300046558	Bacteria	1593
725	Ga0495667_0008176	3300046559	Bacteria	7100
726	Ga0495667_0025775	3300046559	Bacteria	3961
727	Ga0495656_0026297	3300046615	Bacteria	2316
728	Ga0495668_0000072	3300046616	Bacteria	167170
729	Ga0495668_0006134	3300046616	Bacteria	7956
730	Ga0495668_0028551	3300046616	Bacteria	3155
731	Ga0495668_0028910	3300046616	Bacteria	3133
732	Ga0495611_0007195	3300046648	Bacteria	4730
733	Ga0495625_0001386	3300046660	Bacteria	29753
734	Ga0495625_0002794	3300046660	Bacteria	18407
735	Ga0495625_0008722	3300046660	Bacteria	8594
736	Ga0495625_0109602	3300046660	Bacteria	1888
737	Ga0495625_0125954	3300046660	Bacteria	1739
738	Ga0495661_0070079	3300046665	Bacteria	2053
739	Ga0495661_0088828	3300046665	Bacteria	1763
740	Ga0495588_0005144	3300046674	Bacteria	5810
741	Ga0495599_0093830	3300046678	Bacteria	1872
742	Ga0495658_0002931	3300046683	Bacteria	8560
743	Ga0495669_0000258	3300046684	Bacteria	30670
744	Ga0495613_0025023	3300046689	Bacteria	4449
745	Ga0495670_0018659	3300046691	Bacteria	3417
746	Ga0495670_0028758	3300046691	Bacteria	2756
747	Ga0495671_0000007	3300046692	Bacteria	443069
748	Ga0495671_0000060	3300046692	Bacteria	107734
749	Ga0495589_0011649	3300046794	Bacteria	4565
750	Ga0495660_0006209	3300046810	Bacteria	7090
751	Ga0495581_0007959	3300047315	Bacteria	6140
752	Ga0495604_0048025	3300047317	Bacteria	3321
753	Ga0495674_0033062	3300047319	Bacteria	4688
754	Ga0495672_0007359	3300047320	Bacteria	8292
755	Ga0495672_0009409	3300047320	Bacteria	7084
756	Ga0495680_0129972	3300047322	Bacteria	1852
757	Ga0495683_0024537	3300047323	Bacteria	3094
758	Ga0495687_000045	3300047443	Bacteria	211968
759	Ga0495687_000240	3300047443	Bacteria	75621
760	Ga0495675_0034447	3300047444	Bacteria	3233
761	Ga0495673_0000088	3300047469	Bacteria	189812
762	Ga0495673_0016447	3300047469	Bacteria	3781
763	Ga0495673_0041921	3300047469	Bacteria	2058
764	Ga0495681_0000006	3300047470	Bacteria	221565
765	Ga0495681_0004911	3300047470	Bacteria	9033
766	Ga0495681_0016802	3300047470	Bacteria	4084
767	Ga0495686_0000197	3300047472	Bacteria	112818
768	Ga0495686_0000544	3300047472	Bacteria	53939
769	Ga0495686_0000588	3300047472	Bacteria	51272
770	Ga0495686_0004312	3300047472	Bacteria	11764
771	Ga0495686_0010969	3300047472	Bacteria	6416
772	Ga0495686_0021400	3300047472	Bacteria	4295
773	Ga0495686_0054433	3300047472	Bacteria	2505
774	Ga0495686_0125900	3300047472	Bacteria	1523
775	Ga0495593_0002299	3300047673	Bacteria	11458
776	Ga0495602_0003534	3300048088	Bacteria	16152
777	Ga0495614_0002616	3300048089	Bacteria	8001
778	Ga0495626_0045817	3300048091	Bacteria	2040
779	Ga0496101_0004194	3300048904	Bacteria	9032
780	Ga0496102_0000043	3300048905	Bacteria	189201
781	Ga0496102_0000106	3300048905	Bacteria	118841
782	Ga0496102_0011122	3300048905	Bacteria	7750
783	Ga0496103_0000069	3300048906	Bacteria	121542
784	Ga0496103_0000095	3300048906	Bacteria	98260
785	Ga0496103_0000133	3300048906	Bacteria	78740
786	Ga0496103_0002980	3300048906	Bacteria	10483
787	Ga0496104_0000060	3300048907	Bacteria	117966
788	Ga0496104_0067340	3300048907	Bacteria	3401
789	Ga0496104_0077771	3300048907	Bacteria	3161
790	Ga0496104_0109404	3300048907	Bacteria	2649
791	Ga0496105_0000274	3300048908	Bacteria	34048
792	Ga0496105_0041343	3300048908	Bacteria	3799
793	Ga0496105_0062920	3300048908	Bacteria	3062
794	Ga0496105_0079109	3300048908	Bacteria	2715
795	Ga0496106_0000338	3300048909	Bacteria	32910
796	Ga0496106_0001196	3300048909	Bacteria	19346
797	Ga0496107_0002397	3300048910	Bacteria	12134
798	Ga0496108_0001297	3300048911	Bacteria	19637
799	Ga0496108_0045490	3300048911	Bacteria	3666
800	Ga0496109_0056144	3300048912	Bacteria	3593
801	Ga0496110_0038618	3300048913	Bacteria	4155
802	Ga0496111_0000685	3300048914	Bacteria	17853
803	Ga0496111_0034979	3300048914	Bacteria	3588
804	Ga0496112_0175508	3300048915	Bacteria	2108
805	Ga0496113_0001855	3300048916	Bacteria	12041
806	Ga0496113_0002586	3300048916	Bacteria	10570
807	Ga0496113_0023903	3300048916	Bacteria	4338
808	Ga0496114_0003386	3300048917	Bacteria	12242
809	Ga0496115_0000009	3300048918	Bacteria	234372
810	Ga0496115_0001130	3300048918	Bacteria	19264
811	Ga0496116_0007300	3300048919	Bacteria	9843
812	Ga0496116_0014376	3300048919	Bacteria	6327
813	Ga0496116_0041259	3300048919	Bacteria	3168
814	Ga0496117_0000104	3300048920	Bacteria	189201
815	Ga0496117_0000185	3300048920	Bacteria	127413
816	Ga0496117_0000366	3300048920	Bacteria	78816
817	Ga0496117_0002165	3300048920	Bacteria	25611
818	Ga0496117_0013629	3300048920	Bacteria	7080
819	Ga0496117_0015041	3300048920	Bacteria	6628
820	Ga0496118_0000077	3300048921	Bacteria	192298
821	Ga0496118_0000080	3300048921	Bacteria	189201
822	Ga0496118_0003332	3300048921	Bacteria	20326
823	Ga0496118_0013982	3300048921	Bacteria	7539
824	Ga0496118_0031034	3300048921	Bacteria	4443
825	Ga0496118_0041709	3300048921	Bacteria	3629
826	Ga0496119_0001213	3300048922	Bacteria	32201
827	Ga0496119_0008938	3300048922	Bacteria	8700
828	Ga0496119_0052767	3300048922	Bacteria	2488
829	Ga0496120_0001109	3300048923	Bacteria	35064
830	Ga0496121_0001230	3300048924	Bacteria	44601
831	Ga0496121_0001994	3300048924	Bacteria	32423
832	Ga0496121_0002144	3300048924	Bacteria	30983
833	Ga0496121_0002478	3300048924	Bacteria	28115
834	Ga0496121_0003590	3300048924	Bacteria	21898
835	Ga0496121_0006338	3300048924	Bacteria	14748
836	Ga0496121_0089230	3300048924	Bacteria	2415
837	Ga0496122_0000018	3300048925	Bacteria	426350
838	Ga0496122_0000147	3300048925	Bacteria	165589
839	Ga0496122_0002719	3300048925	Bacteria	24543
840	Ga0496122_0002984	3300048925	Bacteria	23033
841	Ga0496122_0004287	3300048925	Bacteria	17866
842	Ga0496122_0011451	3300048925	Bacteria	8977
843	Ga0496122_0011913	3300048925	Bacteria	8732
844	Ga0496122_0017578	3300048925	Bacteria	6674
845	Ga0496122_0088083	3300048925	Bacteria	2130
846	Ga0496122_0096638	3300048925	Bacteria	1991
847	Ga0496123_0000015	3300048926	Bacteria	426088
848	Ga0496123_0000158	3300048926	Bacteria	136078
849	Ga0496123_0002233	3300048926	Bacteria	24544
850	Ga0496123_0009579	3300048926	Bacteria	8700
851	Ga0496123_0020668	3300048926	Bacteria	5144
852	Ga0496123_0020817	3300048926	Bacteria	5117
853	Ga0496123_0060977	3300048926	Bacteria	2428
854	Ga0496123_0074867	3300048926	Bacteria	2093
855	Ga0496124_0000050	3300048927	Bacteria	258041
856	Ga0496124_0000093	3300048927	Bacteria	189201
857	Ga0496124_0000703	3300048927	Bacteria	54743
858	Ga0496124_0001819	3300048927	Bacteria	29505
859	Ga0496124_0046920	3300048927	Bacteria	3698
860	Ga0496124_0053549	3300048927	Bacteria	3419
861	Ga0496124_0109096	3300048927	Bacteria	2231
862	Ga0496125_0000114	3300048928	Bacteria	182012
863	Ga0496125_0002943	3300048928	Bacteria	21430
864	Ga0496125_0051834	3300048928	Bacteria	3380
865	Ga0496126_0000113	3300048929	Bacteria	192212
866	Ga0496126_0000195	3300048929	Bacteria	135582
867	Ga0496126_0000294	3300048929	Bacteria	106327
868	Ga0496126_0014568	3300048929	Bacteria	7942
869	Ga0496126_0018207	3300048929	Bacteria	6970
870	Ga0496126_0055342	3300048929	Bacteria	3590
871	Ga0496126_0055898	3300048929	Bacteria	3569
872	Ga0496126_0093366	3300048929	Bacteria	2642
873	Ga0496126_0122718	3300048929	Bacteria	2251
874	Ga0495682_0010402	3300049460	Bacteria	3605
875	Ga0501292_000117	3300049515	Bacteria	14110
876	Ga0501294_000670	3300049517	Bacteria	3854
877	Ga0501032_0003709	3300049569	Bacteria	11594
878	Ga0501033_0011114	3300049570	Bacteria	6897
879	Ga0501033_0110784	3300049570	Bacteria	1998
880	Ga0501033_0133467	3300049570	Bacteria	1797
881	Ga0501034_0002130	3300049571	Bacteria	24593
882	Ga0501034_0035340	3300049571	Bacteria	5066
883	Ga0501034_0236801	3300049571	Bacteria	1773
884	Ga0501036_0052198	3300049572	Bacteria	3462
885	Ga0501037_0010333	3300049573	Bacteria	6848
886	Ga0501037_0017394	3300049573	Bacteria	5295
887	Ga0501038_0000423	3300049574	Bacteria	36823
888	Ga0501038_0059572	3300049574	Bacteria	3270
889	Ga0501038_0280500	3300049574	Bacteria	1312
890	Ga0501039_0000228	3300049575	Bacteria	40749
891	Ga0501040_0000401	3300049576	Bacteria	25582
892	Ga0501041_0000068	3300049577	Bacteria	39067
893	Ga0501042_0000225	3300049578	Bacteria	27025
894	Ga0501042_0004646	3300049578	Bacteria	8764
895	Ga0501043_0006877	3300049579	Bacteria	9077
896	Ga0501043_0026913	3300049579	Bacteria	4513
897	Ga0501043_0058007	3300049579	Bacteria	3039
898	Ga0501043_0058400	3300049579	Unclassified	3028
899	Ga0501046_0047770	3300049580	Bacteria	3392
900	Ga0501046_0064267	3300049580	Bacteria	2865
901	Ga0501047_0015644	3300049581	Bacteria	7228
902	Ga0501048_0033352	3300049582	Bacteria	3719
903	Ga0501068_0006265	3300049584	Bacteria	6547
904	Ga0501068_0057140	3300049584	Bacteria	2365
905	Ga0501068_0090858	3300049584	Bacteria	1884
906	Ga0501071_0000943	3300049587	Bacteria	15815
907	Ga0501071_0041124	3300049587	Unclassified	3310
908	Ga0501072_0000133	3300049588	Bacteria	55596
909	Ga0501073_0008046	3300049589	Bacteria	7827
910	Ga0501074_0040848	3300049590	Unclassified	3358
911	Ga0501075_0000065	3300049591	Bacteria	46049
912	Ga0501075_0003810	3300049591	Bacteria	10148
913	Ga0501075_0006150	3300049591	Bacteria	8252
914	Ga0501075_0029149	3300049591	Bacteria	4080
915	Ga0501076_0000120	3300049592	Bacteria	43155
916	Ga0501076_0010487	3300049592	Bacteria	6878
917	Ga0501076_0073841	3300049592	Unclassified	2731
918	Ga0501077_0000108	3300049593	Bacteria	43917
919	Ga0501222_001581	3300049662	Bacteria	3166
920	Ga0501223_000025	3300049663	Bacteria	58092
921	Ga0501223_000367	3300049663	Bacteria	11110
922	Ga0501224_000028	3300049664	Bacteria	53596
923	Ga0501233_000183	3300049668	Bacteria	9154
924	Ga0501249_001102	3300049679	Bacteria	5711
925	Ga0501257_002893	3300049686	Bacteria	3640
926	Ga0501261_000498	3300049690	Bacteria	5028
927	Ga0501225_0000842	3300049705	Bacteria	9554
928	Ga0501225_0001033	3300049705	Bacteria	8731
929	Ga0501079_0003036	3300049741	Bacteria	12287
930	Ga0501079_0007424	3300049741	Bacteria	8295
931	Ga0501080_0003323	3300049742	Bacteria	14193
932	Ga0501081_0000705	3300049743	Bacteria	19322
933	Ga0501081_0031876	3300049743	Unclassified	3573
934	Ga0501083_0009775	3300049744	Bacteria	6772
935	Ga0501241_001834	3300049758	Bacteria	4185
936	Ga0501279_000004	3300049775	Bacteria	175612
937	Ga0501280_000014	3300049776	Bacteria	57720
938	Ga0501281_00189	3300049777	Bacteria	7123
939	Ga0501035_0044401	3300049822	Bacteria	4002
940	Ga0501035_0075331	3300049822	Unclassified	2985
941	Ga0501035_0118966	3300049822	Bacteria	2311
942	Ga0501035_0140319	3300049822	Bacteria	2101
943	Ga0501044_0026843	3300049823	Bacteria	6095
944	Ga0501044_0040197	3300049823	Bacteria	4875
945	Ga0501044_0102020	3300049823	Bacteria	2886
946	Ga0501045_0000389	3300049824	Bacteria	26607
947	Ga0501226_000191	3300049853	Bacteria	9822
948	nmdc:mga03683_6454_c1	3300050489	Bacteria	4017
949	nmdc:mga0yw44_12216_c1	3300050492	Bacteria	4467
950	nmdc:mga0k408_16763_c1	3300050493	Bacteria	4071
951	nmdc:mga06z11_195_c1	3300050494	Bacteria	24343
952	nmdc:mga04h51_420_c1	3300050495	Bacteria	10192
953	nmdc:mga07m45_6743_c1	3300050496	Bacteria	5827
954	nmdc:mga05p37_21251_c1	3300050507	Bacteria	7857
955	nmdc:mga05p37_32544_c1	3300050507	Bacteria	6378
956	nmdc:mga05p37_446694_c1	3300050507	Bacteria	1498
957	nmdc:mga08y16_11558_c1	3300050511	Bacteria	9280
958	nmdc:mga08y16_1414_c1	3300050511	Bacteria	24082
959	nmdc:mga0n895_45942_c1	3300050512	Bacteria	4264
960	nmdc:mga0rr50_50701_c1	3300050513	Bacteria	3076
961	nmdc:mga08x19_95_c1	3300050514	Bacteria	78182
962	nmdc:mga0a205_18078_c1	3300050515	Bacteria	6623
963	nmdc:mga0a205_276294_c1	3300050515	Bacteria	1556
964	nmdc:mga0a205_41220_c1	3300050515	Bacteria	4446
965	nmdc:mga0sz30_40997_c1	3300050516	Bacteria	1946
966	Ga0495612_0000632	3300053078	Bacteria	14129
967	Ga0500610_0000364	3300053079	Bacteria	13658
968	Ga0500610_0025760	3300053079	Bacteria	2937
969	Ga0495619_0015018	3300053085	Bacteria	4894
970	Ga0500643_000093	3300053087	Bacteria	93451
971	Ga0500643_000135	3300053087	Bacteria	74911
972	Ga0500643_000606	3300053087	Bacteria	24434
973	Ga0500643_001944	3300053087	Bacteria	11194
974	Ga0500643_003937	3300053087	Bacteria	6884
975	Ga0500643_025214	3300053087	Bacteria	1878
976	Ga0500566_0000696	3300053094	Bacteria	18967
977	Ga0500555_003899	3300053103	Bacteria	4243
978	Ga0500556_0000197	3300053104	Bacteria	49633
979	Ga0500557_000292	3300053105	Bacteria	6735
980	Ga0500562_011252	3300053108	Bacteria	2271
981	Ga0500569_014218	3300053109	Bacteria	1965
982	Ga0500592_000056	3300053116	Bacteria	31914
983	Ga0500592_001060	3300053116	Bacteria	4499
984	Ga0500595_002230	3300053119	Bacteria	9841
985	Ga0500595_002716	3300053119	Bacteria	8574
986	Ga0500597_023742	3300053120	Bacteria	2454
987	Ga0500607_003805	3300053121	Bacteria	10780
988	Ga0500618_002112	3300053125	Bacteria	7866
989	Ga0500642_0000011	3300053130	Bacteria	215963
990	Ga0500642_0013377	3300053130	Bacteria	3013
991	Ga0500658_0001519	3300053134	Bacteria	9303
992	Ga0500658_0005819	3300053134	Bacteria	4592
993	Ga0500658_0010069	3300053134	Bacteria	3489
994	Ga0500559_0007673	3300053136	Bacteria	4764
995	Ga0500559_0017644	3300053136	Bacteria	3015
996	Ga0500559_0044993	3300053136	Bacteria	1931
997	Ga0500564_006756	3300053138	Bacteria	4810
998	Ga0500568_0001075	3300053139	Bacteria	18488
999	Ga0500568_0048447	3300053139	Bacteria	1680
1000	Ga0500590_002666	3300053148	Bacteria	8015
1001	Ga0500616_0009045	3300053153	Bacteria	6098
1002	Ga0500616_0017475	3300053153	Bacteria	4068
1003	Ga0500616_0041719	3300053153	Bacteria	2460
1004	Ga0500616_0072211	3300053153	Bacteria	1755
1005	Ga0500622_0061457	3300053156	Bacteria	1915
1006	Ga0500622_0105632	3300053156	Bacteria	1381
1007	Ga0500624_000024	3300053157	Bacteria	114404
1008	Ga0500624_000062	3300053157	Bacteria	66317
1009	Ga0500624_000105	3300053157	Bacteria	40162
1010	Ga0500627_0000844	3300053158	Bacteria	8195
1011	Ga0500627_0000889	3300053158	Bacteria	8007
1012	Ga0500627_0011244	3300053158	Bacteria	3296
1013	Ga0500636_0003773	3300053177	Bacteria	8558
1014	Ga0500636_0034004	3300053177	Bacteria	3016
1015	Ga0500637_0000692	3300053178	Bacteria	13419
1016	Ga0500567_009748	3300053723	Bacteria	4580
1017	Ga0500611_004434	3300053727	Bacteria	1894
1018	Ga0500625_000039	3300053729	Bacteria	43868
1019	Ga0500645_000134	3300053730	Bacteria	58275
1020	Ga0500645_000767	3300053730	Bacteria	19511
1021	Ga0500596_005462	3300053735	Bacteria	2233
1022	Ga0501084_0003536	3300054114	Bacteria	12682
1023	Ga0590071_004250	3300059421	Bacteria	3486
1024	Ga0590075_001519	3300059424	Bacteria	5778
1025	Ga0501082_0001005	3300060353	Bacteria	24909
1026	Ga0501082_0060529	3300060353	Bacteria	3260
1027	Ga0501082_0199736	3300060353	Bacteria	1740
1028	Ga0530510_0000050	3300061734	Bacteria	55919
1029	Ga0530510_0122252	3300061734	Bacteria	1911
1030	2509111528	2508501122	Bacteria	6292184
1031	2509375475	2509276019	Bacteria	6802256
1032	2510307088	2510065057	Bacteria	6649661
1033	2511132166	2510917022	Bacteria	6504556
1034	2511392031	2511231027	Bacteria	5013807
1035	2511498857	2511231052	Bacteria	6974333
1036	2512534993	2512047086	Bacteria	6850303
1037	2512643021	2512564014	Bacteria	4639632
1038	2512973187	2512875026	Bacteria	6861065
1039	2513570728	2513237084	Bacteria	7231967
1040	2513575053	2513237085	Bacteria	7695351
1041	2513588295	2513237086	Bacteria	7265287
1042	2513603547	2513237089	Bacteria	6553624
1043	2513619082	2513237091	Bacteria	6900273
1044	2513882570	2513237140	Bacteria	7076289
1045	2513904554	2513237143	Bacteria	6664116
1046	2513983251	2513237156	Bacteria	6402557
1047	2514005787	2513237160	Bacteria	6650282
1048	2515607283	2515154107	Bacteria	6795637
1049	2515741279	2515154134	Bacteria	7220242
1050	2516204823	2516143018	Bacteria	6951533
1051	2516895134	2516653046	Bacteria	6989037
1052	2517078629	2516653085	Bacteria	7346596
1053	2517571810	2517487022	Bacteria	7227575
1054	2524452462	2524023207	Bacteria	6813453
1055	2524462170	2524023209	Bacteria	6679728
1056	2535485645	2534681786	Bacteria	3308809
1057	2551678399	2551306084	Bacteria	8942552
1058	2551688990	2551306085	Bacteria	7347181
1059	2551696385	2551306086	Bacteria	6843938
1060	2551699360	2551306087	Bacteria	7351905
1061	2551711590	2551306089	Bacteria	7162724
1062	2551719850	2551306090	Bacteria	7953713
1063	2558866573	2558860100	Bacteria	8458965
1064	2585276344	2582581307	Bacteria	6597605
1065	2585524056	2585427526	Bacteria	7258840
1066	2585564144	2585427531	Bacteria	6992870
1067	2585897277	2585427608	Bacteria	6544331
1068	2585903009	2585427609	Bacteria	6667127
1069	2587978416	2585428125	Bacteria	6662905
1070	2599718554	2599185236	Bacteria	6875203
1071	2600195273	2599185352	Bacteria	7228948
1072	2600200336	2599185354	Bacteria	4398675
1073	2600225479	2599185359	Bacteria	4772316
1074	2600376829	2600254933	Bacteria	4750527
1075	2616551734	2615840698	Bacteria	7319877
1076	2643729421	2643221541	Bacteria	5498788
1077	2643805786	2643221557	Bacteria	7184309
1078	2644039139	2643221605	Bacteria	4772303
1079	2644045897	2643221606	Bacteria	5588032
1080	2644065962	2643221610	Bacteria	7480339
1081	2644103793	2643221618	Bacteria	7717186
1082	2644126070	2643221622	Bacteria	4212502
1083	2644144674	2643221626	Bacteria	8069654
1084	2644306723	2643221655	Bacteria	7722067
1085	2644330914	2643221659	Bacteria	7890716
1086	2644380266	2643221668	Bacteria	7306521
1087	2644393474	2643221671	Bacteria	5496681
1088	2644417293	2643221675	Bacteria	7473456
1089	2644450689	2643221680	Bacteria	7473610
1090	2644541133	2643221698	Bacteria	7756764
1091	2644612334	2643221712	Bacteria	7729434
1092	2644671467	2643221723	Bacteria	7095460
1093	2644692886	2643221726	Bacteria	7455827
1094	2657682796	2657244999	Bacteria	5946535
1095	2671693757	2671180139	Bacteria	4196045
1096	2692320617	2690316117	Bacteria	6800650
1097	2725947204	2724679232	Bacteria	7646494
1098	2739649478	2739367664	Bacteria	4114334
1099	2740027951	2739367865	Bacteria	4114482
1100	2753358372	2751185800	Bacteria	5467370
1101	2753459947	2751185821	Bacteria	6189929
1102	2753763883	2751185897	Bacteria	5322941
1103	2757570152	2757320392	Bacteria	3737298
1104	2758640596	2758568016	Bacteria	5645291
1105	2765465918	2765235802	Bacteria	5618596
1106	2766067306	2765235942	Bacteria	7445910
1107	2770196511	2767802442	Bacteria	5747986
1108	2776269364	2775506902	Bacteria	6208009
1109	2776283497	2775506904	Bacteria	5954060
1110	2776915866	2775507049	Bacteria	6284736
1111	2778124311	2775507255	Bacteria	3945731
1112	2792583400	2791355082	Bacteria	5973319
1113	2792620998	2791355091	Bacteria	6135441
1114	2792625213	2791355092	Bacteria	6248105
1115	2792637623	2791355094	Bacteria	7011481
1116	2802720828	2802428858	Bacteria	6636079
1117	2802724434	2802428859	Bacteria	6667919
1118	2802729901	2802428860	Bacteria	6525526
1119	2802737245	2802428861	Bacteria	6534206
1120	2802746375	2802428862	Bacteria	6633353
1121	2802751864	2802428863	Bacteria	6410669
1122	2804754016	2802429268	Bacteria	6094027
1123	2806049213	2802429633	Bacteria	7341974
1124	2806056130	2802429634	Bacteria	7083200
1125	2806063138	2802429635	Bacteria	7650140
1126	2806070736	2802429636	Bacteria	7597525
1127	2806077597	2802429637	Bacteria	7067217
1128	2819613225	2818991448	Bacteria	6772224
1129	2819685715	2818991461	Bacteria	7026071
1130	2819713914	2818991466	Bacteria	4748179
1131	2821123110	2821123053	Bacteria	7836056
1132	2830076954	2830075706	Bacteria	3855215
1133	2837651543	2837651117	Bacteria	3772164
1134	2838074885	2838074704	Bacteria	6785777
1135	2838689941	2838686498	Bacteria	7807632
1136	2838731330	2838729681	Bacteria	7400765
1137	2838739866	2838736955	Bacteria	5760694
1138	2838744271	2838742623	Bacteria	7396178
1139	2839993560	2839993093	Bacteria	5512535
1140	2840766535	2840764183	Bacteria	6358399
1141	2841844010	2841840854	Bacteria	5761912
1142	2841852844	2841851746	Bacteria	7532261
1143	2842112855	2842110456	Bacteria	7656360
1144	2842143731	2842140634	Bacteria	5759631
1145	2842160171	2842156927	Bacteria	6894975
1146	2842165850	2842163707	Bacteria	6916235
1147	2842184163	2842180545	Bacteria	6888678
1148	2842231745	2842229732	Bacteria	7475766
1149	2842245753	2842243621	Bacteria	7421798
1150	2842260131	2842257432	Bacteria	7401195
1151	2842273575	2842271015	Bacteria	7807131
1152	2842303528	2842298080	Bacteria	6123127
1153	2842308573	2842304105	Bacteria	7023636
1154	2842362799	2842357229	Bacteria	6485165
1155	2842515351	2842509118	Bacteria	6850950
1156	2842875008	2842871566	Bacteria	4827117
1157	2844164740	2844163670	Bacteria	7266046
1158	2844456689	2844454524	Bacteria	7952546
1159	2847421277	2847417321	Bacteria	6913799
1160	2848996065	2848992105	Bacteria	6810864
1161	2850079458	2850079185	Bacteria	6848280
1162	2852387646	2852387548	Bacteria	8025568
1163	2854913880	2854911287	Bacteria	5582813
1164	2855827778	2855825444	Bacteria	6785811
1165	2855843142	2855839649	Bacteria	7135830
1166	2855877773	2855872281	Bacteria	6964271
1167	2857520990	2857516855	Bacteria	7787325
1168	2857533937	2857531043	Bacteria	6754041
1169	2858802874	2858800743	Bacteria	6603254
1170	2879165962	2879163058	Bacteria	4223965
1171	2885430331	2885429604	Bacteria	3642894
1172	2891375031	2891373044	Bacteria	5202277
1173	2894653513	2894652903	Bacteria	4587256
1174	2896255487	2896253425	Bacteria	3418029
1175	2896388640	2896384573	Bacteria	7700774
1176	2904579777	2904578770	Bacteria	5302906
1177	2913298392	2913295892	Bacteria	6333755
1178	2915650754	2915650412	Bacteria	4288180
1179	2915982683	2915980308	Bacteria	6624279
1180	2915989870	2915986958	Bacteria	6739310
1181	2915999734	2915993759	Bacteria	7016183
1182	2916002244	2916000859	Bacteria	6865702
1183	2916008911	2916007675	Bacteria	6898660
1184	2916016259	2916014648	Bacteria	6946486
1185	2916022365	2916021584	Bacteria	6854472
1186	2916033415	2916028427	Bacteria	6748433
1187	2916037098	2916035215	Bacteria	6755766
1188	2916046969	2916041962	Bacteria	6820487
1189	2916054916	2916048683	Bacteria	6543552
1190	2916056745	2916055098	Bacteria	6758838
1191	2916063931	2916061851	Bacteria	6737736
1192	2916078739	2916076590	Bacteria	6596108
1193	2919120555	2919119836	Bacteria	5208557
1194	2919141165	2919138771	Bacteria	5281312
1195	2919709946	2919709256	Bacteria	4318106
1196	2920763869	2920760137	Bacteria	7427611
1197	2920822829	2920822456	Bacteria	6897201
1198	2921202015	2921201388	Bacteria	6926299
1199	2921209714	2921208531	Bacteria	6745326
1200	2921237990	2921237296	Bacteria	6876710
1201	2921244358	2921244191	Bacteria	6568419
1202	2921256342	2921250672	Bacteria	6677771
1203	2921261469	2921257292	Bacteria	6808382
1204	2921265815	2921263974	Bacteria	6864552
1205	2921283901	2921282425	Bacteria	6826397
1206	2921291484	2921289301	Bacteria	7316391
1207	2921303048	2921296804	Bacteria	7176999
1208	2924145304	2924144063	Bacteria	6883928
1209	2924155172	2924150972	Bacteria	7169444
1210	2924162530	2924158325	Bacteria	7188855
1211	2924167329	2924165586	Bacteria	7260590
1212	2924173449	2924172951	Bacteria	6749356
1213	2924182797	2924179722	Bacteria	6843264
1214	2924187065	2924186466	Bacteria	6876637
1215	2924197280	2924193448	Bacteria	6955718
1216	2924202157	2924200457	Bacteria	6757188
1217	2924210979	2924207177	Bacteria	6917007
1218	2924215374	2924214083	Bacteria	7080103
1219	2924225211	2924221636	Bacteria	7113495
1220	2924230383	2924228884	Bacteria	6633132
1221	2928030281	2928027323	Bacteria	4382488
1222	2928522580	2928521798	Bacteria	4960112
1223	2928528472	2928526807	Bacteria	4760224
1224	2928970019	2928968154	Bacteria	4633371
1225	2933575021	2933570622	Bacteria	7023390
1226	2933588255	2933586486	Bacteria	7667493
1227	2935902224	2935901341	Bacteria	7341747
1228	2936380379	2936375103	Bacteria	6652732
1229	2936998728	2936996657	Bacteria	6298727
1230	2937003451	2937002841	Bacteria	6934057
1231	2937010525	2937009748	Bacteria	6746052
1232	2937017296	2937016420	Bacteria	6782579
1233	2937025656	2937023124	Bacteria	6815156
1234	2937030569	2937029754	Bacteria	6424026
1235	2937039037	2937036028	Bacteria	6846469
1236	2937045701	2937042894	Bacteria	6741576
1237	2937054873	2937049772	Bacteria	6757901
1238	2937057692	2937056579	Bacteria	7107896
1239	2937070862	2937063883	Bacteria	7199456
1240	2937076146	2937071275	Bacteria	6984483
1241	2937083910	2937078374	Bacteria	6610289
1242	2937088557	2937084907	Bacteria	6618516
1243	2937096653	2937091812	Bacteria	6979387
1244	2937100679	2937098957	Bacteria	7249374
1245	2937111675	2937106411	Bacteria	6947143
1246	2937115897	2937113482	Bacteria	6505872
1247	2937125705	2937119839	Bacteria	6597547
1248	2937130831	2937126314	Bacteria	6771275
1249	2941504023	2941499720	Bacteria	7599444
1250	2946787723	2946787523	Bacteria	4366789
1251	2954014039	2954011201	Bacteria	4762601
1252	2957378003	2957375807	Bacteria	6425588
1253	2957383288	2957382221	Bacteria	6737050
1254	2957390585	2957388812	Bacteria	6778072
1255	2957401430	2957395598	Bacteria	6822399
1256	2957407386	2957402308	Bacteria	6741770
1257	2957409947	2957408893	Bacteria	6558585
1258	2957416529	2957415311	Bacteria	6991633
1259	2957422608	2957422303	Bacteria	7172205
1260	2957435166	2957430029	Bacteria	7022557
1261	2957441457	2957437181	Bacteria	6568994
1262	2957447808	2957443900	Bacteria	6869977
1263	2957451840	2957450854	Bacteria	6765715
1264	2957460712	2957457609	Bacteria	6967680
1265	2957468040	2957464669	Bacteria	6568877
1266	2957475928	2957471148	Bacteria	6797643
1267	2957484641	2957478035	Bacteria	6756658
1268	2957485502	2957484790	Bacteria	6703082
1269	2957492052	2957491536	Bacteria	6695180
1270	2957502969	2957498199	Bacteria	7126688
1271	2957506899	2957505466	Bacteria	7253085
1272	2960585956	2960584000	Bacteria	6864594
1273	2960593183	2960591022	Bacteria	6622873
1274	2960600932	2960597568	Bacteria	6550735
1275	2960607754	2960603979	Bacteria	6898737
1276	2960615663	2960610863	Bacteria	6691244
1277	2960620949	2960617483	Bacteria	6727748
1278	2960626196	2960624210	Bacteria	6875384
1279	2960635358	2960631154	Bacteria	6732508
1280	2960640416	2960637947	Bacteria	7296468
1281	2960646993	2960645483	Bacteria	7211087
1282	2960656376	2960652885	Bacteria	7083688
1283	2960664265	2960660292	Bacteria	7041660
1284	2960670913	2960667422	Bacteria	6763020
1285	2960677434	2960674078	Bacteria	6609048
1286	2960682643	2960680706	Bacteria	6624464
1287	2960692762	2960687367	Bacteria	6535474
1288	2960697788	2960693952	Bacteria	6749742
1289	2964609969	2964607997	Bacteria	7101408
1290	2964618223	2964615318	Bacteria	6809089
1291	2964627397	2964621998	Bacteria	6834995
1292	2964631552	2964628898	Bacteria	7083044
1293	2964641332	2964636051	Bacteria	7091832
1294	2964645445	2964643177	Bacteria	6820887
1295	2964651396	2964649959	Bacteria	6675118
1296	2964662965	2964656573	Bacteria	7100150
1297	2964668677	2964663802	Bacteria	7019362
1298	2964672328	2964670856	Bacteria	6851364
1299	2964682247	2964678106	Bacteria	6792020
1300	2964690663	2964685014	Bacteria	6839111
1301	2964695189	2964691889	Bacteria	6802758
1302	2964700000	2964698721	Bacteria	6765331
1303	2964710026	2964705432	Bacteria	7114648
1304	2964716072	2964712639	Bacteria	6695970
1305	2964725860	2964719344	Bacteria	7286602
1306	2967669276	2967664464	Bacteria	6948836
1307	2967673812	2967671571	Bacteria	7021409
1308	2967683504	2967678726	Bacteria	7264382
1309	2967688467	2967686174	Bacteria	6678622
1310	2967694595	2967693043	Bacteria	6804451
1311	2967705465	2967699805	Bacteria	6854538
1312	2967714015	2967706974	Bacteria	7186053
1313	2967716255	2967714385	Bacteria	7000047
1314	2967725899	2967721400	Bacteria	7073753
1315	2967733798	2967728569	Bacteria	6641507
1316	2967740902	2967735183	Bacteria	6827012
1317	2967742823	2967742019	Bacteria	6794534
1318	2967751544	2967748971	Bacteria	6733771
1319	2967758480	2967755722	Bacteria	6814706
1320	2967766394	2967762386	Bacteria	6923502
1321	2967775532	2967769361	Bacteria	6587838
1322	2967776969	2967775926	Bacteria	6738189
1323	2970021648	2970019648	Bacteria	7072033
1324	2970031947	2970026789	Bacteria	6785236
1325	2970038033	2970033650	Bacteria	7118744
1326	2970046758	2970040964	Bacteria	6731123
1327	2970054404	2970047711	Bacteria	7088379
1328	2970056023	2970054988	Bacteria	6611507
1329	2970064585	2970061556	Bacteria	7099761
1330	2970073417	2970068827	Bacteria	7123112
1331	2970077175	2970076120	Bacteria	6697332
1332	2970085092	2970082768	Bacteria	6183754
1333	2970095719	2970088815	Bacteria	6933825
1334	2970099319	2970095765	Bacteria	6936963
1335	2970106235	2970102677	Bacteria	6812532
1336	2970112622	2970109326	Bacteria	6863976
1337	2970118867	2970116247	Bacteria	6501857
1338	2970122764	2970122695	Bacteria	6625855
1339	2970130896	2970129317	Bacteria	6806560
1340	2970139340	2970136068	Bacteria	7207982
1341	2970145287	2970143518	Bacteria	6446480
1342	2970153331	2970149975	Bacteria	6779706
1343	2970160483	2970156795	Bacteria	7168044
1344	2970165615	2970164137	Bacteria	6861252
1345	2970177794	2970170962	Bacteria	6876229
1346	2970182080	2970177841	Bacteria	6768001
1347	2970186924	2970184632	Bacteria	7054431
1348	2970193263	2970191845	Bacteria	7032787
1349	2977522187	2977516862	Bacteria	6940108
1350	2977525544	2977523885	Bacteria	6960446
1351	2977530916	2977530762	Bacteria	6951399
1352	2977538807	2977537788	Bacteria	6929320
1353	2977546942	2977544691	Bacteria	6875412
1354	2977556311	2977551784	Bacteria	7125765
1355	2977561846	2977558990	Bacteria	6863948
1356	2977572402	2977565890	Bacteria	6901543
1357	2977576267	2977572785	Bacteria	6763888
1358	2977581071	2977579622	Bacteria	6772100
1359	2984558858	2984555340	Bacteria	4247089
1360	2984566628	2984564862	Bacteria	4339992
1361	2989351518	2989349275	Bacteria	6349068
1362	2989774462	2989771324	Bacteria	5605128
1363	2990266543	2990265787	Bacteria	3943888
1364	2993357824	2993356040	Bacteria	4247105
1365	2993695659	2993693658	Bacteria	4040749
1366	3002141873	3002141150	Bacteria	5254435
1367	3003931433	3003930520	Bacteria	5667563
1368	3005410531	3005409236	Bacteria	7188837
1369	3005419321	3005416602	Bacteria	7064308
1370	643827767	643692032	Bacteria	6891900
1371	648738288	648276728	Bacteria	6968865
1372	8003995728	8003992118	Bacteria	7266902
1373	8004003482	8003999396	Bacteria	7063185
1374	8005310154	8005307578	Bacteria	7395396
1375	8005317524	8005314921	Bacteria	7072929
1376	8005378198	8005376324	Bacteria	6590079
1377	8005489263	8005484373	Bacteria	6297373
1378	8005559868	8005556819	Bacteria	6908598
1379	8005564634	8005563573	Bacteria	7153261
1380	8005570998	8005570704	Bacteria	6957481
1381	8005645398	8005645114	Bacteria	6950293
1382	8005687757	8005682033	Bacteria	6726518
1383	8018167709	8018163183	Bacteria	7277977
1384	8023681370	8023680758	Bacteria	7729763
1385	8024481797	8024479707	Bacteria	6954785
1386	8046774115	8046767195	Bacteria	7547379
1387	8049296633	8049293176	Bacteria	6128433
1388	8054562443	8054558443	Bacteria	5204801
1389	8056878565	8056875544	Bacteria	4355797
1390	8057103754	8057101203	Bacteria	5034064
1391	8057577935	8057575449	Bacteria	7367519
1392	Ga0495625_0017887
1393	JGI24736J21556_1000185
1394	JGI24736J21556_1001548
1395	JGI24741J21665_1000045
1396	JGI24739J22299_10000095
1397	JGI24739J22299_10003612
1398	JGI24739J22299_10011937
1399	JGI24737J22298_10014256
1400	JGI24735J21928_10004127
1401	JGI24735J21928_10008073
1402	JGI24735J21928_10014478
1403	JGI24735J21928_10023493
1404	JGI24750J21931_1000436
1405	JGI24748J21848_1000063
1406	JGI24738J21930_10000967
1407	JGI24749J21850_1000018
1408	JGI24034J26672_10000007
1409	JGI24751J29686_10000115
1410	JGI24751J29686_10000235
1411	JGI24751J29686_10004035
1412	JGI25155J39150_1000069
1413	JGI25156J39149_1000095
1414	JGI25154J39366_1000866
1415	JGI25157J39369_1000732
1416	JGI25150J39212_1000126
1417	JGI25159J45721_1003717
1418	JGI25159J45721_1006593
1419	JGI25151J46595_10003658
1420	JGI25151J46595_10007368
1421	JGI25165J46597_1000041
1422	JGI25165J46597_1000043
1423	JGI25153J46596_10000115
1424	JGI25153J46596_10000305
1425	JGI25153J46596_10009756
1426	JGI25153J46596_10019462
1427	JGI25153J46596_10021828
1428	rootL2_10134394
1429	JGI25160J50197_1000003
1430	JGI25160J50197_1000287
1431	JGI25160J50197_1005283
1432	JGI25161J50226_1000176
1433	JGI25161J50226_1000299
1434	JGI25161J50226_1003479
1435	Ga0055525_1000104
1436	Ga0055542_1000025
1437	Ga0055529_1000014
1438	Ga0055526_1004618
1439	Ga0055526_1007718
1440	Ga0055526_1007837
1441	Ga0055524_1000056
1442	Ga0055524_1006032
1443	Ga0055524_1006689
1444	Ga0055536_1001996
1445	Ga0055528_1018190
1446	Ga0055530_10000027
1447	Ga0055530_10000931
1448	Ga0055530_10011442
1449	Ga0055530_10013499
1450	Ga0055540_1001336
1451	Ga0055531_10000013
1452	Ga0055531_10014149
1453	Ga0055531_10027395
1454	Ga0055543_1000034
1455	Ga0055543_1000114
1456	Ga0055543_1001135
1457	Ga0058863_11910898
1458	Ga0058861_12061624
1459	Ga0058862_12737959
1460	Ga0065165_1000047
1461	Ga0065165_1003833
1462	Ga0065165_1004051
1463	Ga0065165_1012721
1464	Ga0065165_1013057
1465	Ga0065704_10002519
1466	Ga0065704_10070744
1467	Ga0065707_10084641
1468	Ga0065707_10149171
1469	Ga0070658_10000033
1470	Ga0070658_10014420
1471	Ga0070658_10107179
1472	Ga0070676_10003672
1473	Ga0070690_100000024
1474	Ga0070690_100000483
1475	Ga0070690_100014932
1476	Ga0070690_100043813
1477	Ga0070670_100000074
1478	Ga0070670_100000409
1479	Ga0070670_100004278
1480	Ga0070670_100044213
1481	Ga0070670_100221670
1482	Ga0070666_10000017
1483	Ga0070666_10000160
1484	Ga0070666_10001625
1485	Ga0070666_10026239
1486	Ga0070666_10026566
1487	Ga0070680_100169761
1488	Ga0068868_100002423
1489	Ga0070660_100000225
1490	Ga0070660_100006402
1491	Ga0070660_100022696
1492	Ga0070660_100043168
1493	Ga0070660_100108019
1494	Ga0070689_100043036
1495	Ga0070689_100095475
1496	Ga0070661_100224086
1497	Ga0070692_10005729
1498	Ga0070668_100000197
1499	Ga0070668_100031066
1500	Ga0070668_100080044
1501	Ga0070668_100103426
1502	Ga0070668_100174904
1503	Ga0070668_100197028
1504	Ga0070669_100000013
1505	Ga0070669_100000058
1506	Ga0070669_100003312
1507	Ga0070669_100013530
1508	Ga0070669_100045809
1509	Ga0070675_100007844
1510	Ga0070671_100000009
1511	Ga0070671_100000482
1512	Ga0070671_100004829
1513	Ga0070671_100013940
1514	Ga0070671_100015118
1515	Ga0070671_100016699
1516	Ga0070671_100032053
1517	Ga0070674_100010775
1518	Ga0070674_100020424
1519	Ga0070673_100000138
1520	Ga0070673_100010149
1521	Ga0070659_100023655
1522	Ga0070659_100038689
1523	Ga0070659_100041111
1524	Ga0070659_100062954
1525	Ga0070659_100097236
1526	Ga0070659_100119598
1527	Ga0070667_100000017
1528	Ga0070667_100000024
1529	Ga0070667_100003990
1530	Ga0070667_100008843
1531	Ga0070667_100012637
1532	Ga0070667_100063753
1533	Ga0070667_100122428
1534	Ga0070709_10000892
1535	Ga0070714_100015160
1536	Ga0070714_100078232
1537	Ga0070713_100000003
1538	Ga0070710_10045250
1539	Ga0070711_100033038
1540	Ga0070663_100015679
1541	Ga0070678_100000057
1542	Ga0070678_100001464
1543	Ga0070662_100048101
1544	Ga0070662_100096720
1545	Ga0070685_10000389
1546	Ga0070679_100143648
1547	Ga0070679_100199771
1548	Ga0070697_100097945
1549	Ga0068853_100013242
1550	Ga0068853_100017003
1551	Ga0068853_100036747
1552	Ga0070672_100005400
1553	Ga0070686_100010480
1554	Ga0070695_100079773
1555	Ga0070665_100000042
1556	Ga0070665_100000319
1557	Ga0070665_100007081
1558	Ga0070665_100010626
1559	Ga0070665_100049096
1560	Ga0070665_100074881
1561	Ga0070665_100144530
1562	Ga0070665_100241459
1563	Ga0068855_100000608
1564	Ga0068855_100155318
1565	Ga0070664_100021787
1566	Ga0068857_100005280
1567	Ga0068857_100049639
1568	Ga0068857_100066411
1569	Ga0068857_100100978
1570	Ga0068857_100144066
1571	Ga0068854_100134981
1572	Ga0068856_100000719
1573	Ga0068856_100003762
1574	Ga0068856_100009436
1575	Ga0068856_100171757
1576	Ga0068856_100179211
1577	Ga0068852_100000753
1578	Ga0068852_100165021
1579	Ga0068859_100001232
1580	Ga0068859_100003906
1581	Ga0068859_100006922
1582	Ga0068859_100023002
1583	Ga0068859_100103822
1584	Ga0068859_100141475
1585	Ga0068864_100000260
1586	Ga0068864_100003187
1587	Ga0068864_100017327
1588	Ga0068864_100030494
1589	Ga0068861_100000074
1590	Ga0068861_100001071
1591	Ga0068861_100004608
1592	Ga0068861_100010221
1593	Ga0068861_100011989
1594	Ga0068863_100000082
1595	Ga0068863_100000280
1596	Ga0068863_100007010
1597	Ga0068863_100027387
1598	Ga0068863_100055600
1599	Ga0068863_100173781
1600	Ga0068858_100000303
1601	Ga0068858_100000591
1602	Ga0068858_100001032
1603	Ga0068858_100003432
1604	Ga0068858_100013493
1605	Ga0068858_100014160
1606	Ga0068858_100162541
1607	Ga0068860_100000056
1608	Ga0068860_100000062
1609	Ga0068860_100000944
1610	Ga0068860_100018956
1611	Ga0068860_100047514
1612	Ga0068862_100000081
1613	Ga0068862_100000280
1614	Ga0068862_100000308
1615	Ga0068862_100004544
1616	Ga0068862_100017500
1617	Ga0068862_100019008
1618	Ga0081455_10000255
1619	Ga0081540_1009297
1620	Ga0081539_10006765
1621	Ga0070717_10193808
1622	Ga0070717_10220193
1623	Ga0075365_10013351
1624	Ga0075365_10074003
1625	Ga0070712_100000169
1626	Ga0075362_10004292
1627	Ga0075367_10012269
1628	Ga0075369_10005723
1629	Ga0097621_100013780
1630	Ga0075370_10010246
1631	Ga0068871_100008468
1632	Ga0068871_100024042
1633	Ga0075430_100151222
1634	Ga0075431_100004735
1635	Ga0075431_100014844
1636	Ga0075433_10031628
1637	Ga0075434_100129812
1638	Ga0075436_100000038
1639	Ga0075436_100045939
1640	Ga0097620_100001232
1641	Ga0097620_100003906
1642	Ga0097620_100006922
1643	Ga0097620_100022995
1644	Ga0097620_100103821
1645	Ga0097620_100141468
1646	Ga0079104_1000125
1647	Ga0079104_1004867
1648	Ga0079104_1006152
1649	Ga0105240_10008524
1650	Ga0105240_10098810
1651	Ga0105240_10361753
1652	Ga0111539_10000890
1653	Ga0114129_10001654
1654	Ga0114129_10026011
1655	Ga0114129_10034137
1656	Ga0114129_10443639
1657	Ga0114129_10524881
1658	Ga0105243_10000033
1659	Ga0105241_10013534
1660	Ga0105241_10017676
1661	Ga0105241_10030093
1662	Ga0105248_10001187
1663	Ga0105248_10008690
1664	Ga0105248_10016997
1665	Ga0105248_10017774
1666	Ga0105248_10025390
1667	Ga0105248_10152523
1668	Ga0105248_10315041
1669	Ga0105237_10002470
1670	Ga0105238_10003588
1671	Ga0105238_10113471
1672	Ga0105249_10000012
1673	Ga0105249_10000103
1674	Ga0105249_10020498
1675	Ga0105246_10116683
1676	Ga0157326_1000338
1677	Ga0157371_10000059
1678	Ga0157371_10025477
1679	Ga0157370_10000069
1680	Ga0157370_10049403
1681	Ga0157369_10004747
1682	Ga0157369_10030829
1683	Ga0157369_10038626
1684	Ga0157369_10097133
1685	Ga0171463_1001
1686	Ga0157378_10002131
1687	Ga0157378_10137652
1688	Ga0163162_10001741
1689	Ga0163162_10005593
1690	Ga0163162_10013689
1691	Ga0163162_10046965
1692	Ga0163162_10066770
1693	Ga0163162_10102190
1694	Ga0157372_10232582
1695	Ga0157375_10002592
1696	Ga0157375_10006186
1697	Ga0157375_10065252
1698	Ga0163163_10022274
1699	Ga0157380_10000151
1700	Ga0157380_10001425
1701	Ga0157379_10036388
1702	Ga0157379_10137507
1703	Ga0157376_10000903
1704	Ga0183363_1004
1705	Ga0183363_1053
1706	Ga0163161_10000025
1707	Ga0163161_10038310
1708	Ga0206356_11309587
1709	Ga0206350_11038354
1710	Ga0206354_10710180
1711	Ga0214544_1000434
1712	Ga0214542_1000146
1713	Ga0214542_1027236
1714	Ga0214543_1000049
1715	Ga0214543_1000054
1716	Ga0213876_10000310
1717	Ga0224712_10035483
1718	Ga0228711_1000006
1719	Ga0228710_1000004
1720	Ga0209435_100049
1721	Ga0207672_1000205
1722	Ga0209563_100116
1723	Ga0207425_1000041
1724	Ga0207425_1004457
1725	Ga0209646_1000159
1726	Ga0209026_1000183
1727	Ga0209026_1000650
1728	Ga0209148_1000011
1729	Ga0209148_1000238
1730	Ga0209148_1003278
1731	Ga0209759_1000206
1732	Ga0209129_1000359
1733	Ga0209129_1006060
1734	Ga0209233_1000079
1735	Ga0209233_1000104
1736	Ga0209565_1000008
1737	Ga0209565_1000134
1738	Ga0209455_1000006
1739	Ga0209673_1000584
1740	Ga0209673_1003724
1741	Ga0209673_1004104
1742	Ga0209130_1000005
1743	Ga0209130_1000642
1744	Ga0209675_1003991
1745	Ga0209676_1001593
1746	Ga0209025_1000037
1747	Ga0209025_1000068
1748	Ga0209025_1000814
1749	Ga0209025_1011026
1750	Ga0209564_1000113
1751	Ga0209564_1001020
1752	Ga0209564_1006879
1753	Ga0209758_1000001
1754	Ga0209758_1000004
1755	Ga0209758_1001197
1756	Ga0209758_1004151
1757	Ga0209758_1008214
1758	Ga0209050_1000001
1759	Ga0209050_1000014
1760	Ga0209050_1002150
1761	Ga0209050_1009997
1762	Ga0209256_1000009
1763	Ga0209256_1000010
1764	Ga0209256_1000819
1765	Ga0209256_1002787
1766	Ga0209256_1007106
1767	Ga0207426_1000015
1768	Ga0207426_1000330
1769	Ga0207426_1000812
1770	Ga0207426_1028357
1771	Ga0209051_1000232
1772	Ga0209051_1009681
1773	Ga0209257_1000019
1774	Ga0209257_1003713
1775	Ga0209257_1005528
1776	Ga0209257_1018206
1777	Ga0207656_10043107
1778	Ga0207713_1004595
1779	Ga0207682_10011989
1780	Ga0207680_10000012
1781	Ga0207680_10001210
1782	Ga0207680_10005315
1783	Ga0207680_10025252
1784	Ga0207647_10000497
1785	Ga0207647_10001733
1786	Ga0207647_10025680
1787	Ga0207647_10043369
1788	Ga0207699_10000676
1789	Ga0207645_10002209
1790	Ga0207705_10000002
1791	Ga0207705_10000197
1792	Ga0207705_10016169
1793	Ga0207705_10179745
1794	Ga0207654_10000222
1795	Ga0207654_10000293
1796	Ga0207707_10160961
1797	Ga0207695_10000641
1798	Ga0207695_10033073
1799	Ga0207695_10069418
1800	Ga0207695_10080915
1801	Ga0207671_10002072
1802	Ga0207671_10003353
1803	Ga0207657_10041918
1804	Ga0207657_10087798
1805	Ga0207657_10105879
1806	Ga0207657_10119347
1807	Ga0207657_10134006
1808	Ga0207649_10000319
1809	Ga0207649_10055003
1810	Ga0207652_10056019
1811	Ga0207646_10046513
1812	Ga0207681_10000003
1813	Ga0207681_10000008
1814	Ga0207681_10000221
1815	Ga0207681_10000259
1816	Ga0207681_10000667
1817	Ga0207681_10044582
1818	Ga0207694_10003805
1819	Ga0207694_10055561
1820	Ga0207650_10000038
1821	Ga0207650_10001576
1822	Ga0207650_10002138
1823	Ga0207650_10007425
1824	Ga0207650_10027164
1825	Ga0207650_10100427
1826	Ga0207659_10002827
1827	Ga0207659_10118854
1828	Ga0207687_10039346
1829	Ga0207700_10000083
1830	Ga0207700_10034972
1831	Ga0207664_10011315
1832	Ga0207644_10000006
1833	Ga0207644_10000060
1834	Ga0207644_10000385
1835	Ga0207644_10000927
1836	Ga0207644_10002506
1837	Ga0207644_10017065
1838	Ga0207644_10017956
1839	Ga0207644_10037322
1840	Ga0207690_10010226
1841	Ga0207690_10010856
1842	Ga0207690_10013890
1843	Ga0207690_10087993
1844	Ga0207690_10142117
1845	Ga0207690_10148204
1846	Ga0207706_10003677
1847	Ga0207706_10009415
1848	Ga0207706_10141341
1849	Ga0207709_10000059
1850	Ga0207669_10005970
1851	Ga0207691_10000019
1852	Ga0207711_10002994
1853	Ga0207711_10011653
1854	Ga0207711_10014565
1855	Ga0207711_10029281
1856	Ga0207711_10224428
1857	Ga0207711_10268308
1858	Ga0207679_10017290
1859	Ga0207679_10067410
1860	Ga0207667_10000002
1861	Ga0207667_10000916
1862	Ga0207667_10005514
1863	Ga0207667_10020324
1864	Ga0207667_10044809
1865	Ga0207667_10086736
1866	Ga0207651_10001213
1867	Ga0207651_10059026
1868	Ga0207712_10000021
1869	Ga0207712_10000069
1870	Ga0207712_10020513
1871	Ga0207668_10000178
1872	Ga0207668_10000647
1873	Ga0207668_10001332
1874	Ga0207668_10022777
1875	Ga0207668_10109414
1876	Ga0207640_10117499
1877	Ga0207658_10000011
1878	Ga0207658_10000022
1879	Ga0207658_10005443
1880	Ga0207658_10014406
1881	Ga0207658_10045858
1882	Ga0207658_10064739
1883	Ga0207658_10079952
1884	Ga0207677_10002920
1885	Ga0207703_10000205
1886	Ga0207703_10000639
1887	Ga0207703_10000714
1888	Ga0207703_10014160
1889	Ga0207639_10000691
1890	Ga0207639_10003585
1891	Ga0207678_10000218
1892	Ga0207678_10025364
1893	Ga0207702_10000045
1894	Ga0207702_10002451
1895	Ga0207702_10002929
1896	Ga0207702_10028110
1897	Ga0207702_10032499
1898	Ga0207702_10104638
1899	Ga0207641_10000115
1900	Ga0207641_10000139
1901	Ga0207641_10000414
1902	Ga0207641_10002917
1903	Ga0207641_10008887
1904	Ga0207641_10033804
1905	Ga0207641_10236824
1906	Ga0207641_10321469
1907	Ga0207648_10096920
1908	Ga0207676_10000034
1909	Ga0207676_10000613
1910	Ga0207676_10001417
1911	Ga0207676_10005994
1912	Ga0207676_10035291
1913	Ga0207674_10000026
1914	Ga0207674_10027999
1915	Ga0207674_10037284
1916	Ga0207674_10041996
1917	Ga0207674_10050697
1918	Ga0207674_10057730
1919	Ga0207674_10086805
1920	Ga0207674_10164988
1921	Ga0207675_100000244
1922	Ga0207675_100000360
1923	Ga0207675_100000533
1924	Ga0207675_100006658
1925	Ga0207675_100028656
1926	Ga0207683_10002984
1927	Ga0207683_10020489
1928	Ga0207683_10020696
1929	Ga0207698_10000130
1930	Ga0207698_10274655
1931	Ga0209281_1000102
1932	Ga0209281_1000242
1933	Ga0209281_1000695
1934	Ga0209282_1000013
1935	Ga0209813_10000111
1936	Ga0209974_10004804
1937	Ga0207428_10047662
1938	Ga0268266_10000002
1939	Ga0268266_10000054
1940	Ga0268266_10000212
1941	Ga0268266_10012740
1942	Ga0268266_10031160
1943	Ga0268266_10056372
1944	Ga0268266_10115169
1945	Ga0268265_10000030
1946	Ga0268265_10000292
1947	Ga0268265_10000601
1948	Ga0268265_10000739
1949	Ga0268265_10006464
1950	Ga0268264_10000074
1951	Ga0268264_10000089
1952	Ga0268264_10000310
1953	Ga0268264_10002308
1954	Ga0268264_10018414
1955	Ga0268264_10046657
1956	Ga0307517_10015953
1957	Ga0307517_10028410
1958	Ga0307517_10094042
1959	Ga0268256_1004680
1960	Ga0307513_10054454
1961	Ga0307513_10109370
1962	Ga0307408_100002167
1963	Ga0307408_100134083
1964	Ga0307508_10000398
1965	Ga0307516_10137322
1966	Ga0307405_10029241
1967	Ga0307405_10047559
1968	Ga0307405_10049815
1969	Ga0307405_10086253
1970	Ga0307405_10098046
1971	Ga0307413_10053302
1972	Ga0307406_10039675
1973	Ga0307406_10176625
1974	Ga0307407_10019922
1975	Ga0307412_10019148
1976	Ga0307412_10023819
1977	Ga0315914_1000004
1978	Ga0307409_100106263
1979	Ga0307414_10016847
1980	Ga0307414_10083941
1981	Ga0307414_10224461
1982	Ga0307415_100159691
1983	Ga0307510_10008962
1984	Ga0307510_10052621
1985	Ga0315913_1000011
1986	Ga0315915_1000003
1987	Ga0373926_0012290
1988	Ga0373936_0042425
1989	Ga0373954_0006557
1990	Ga0373954_0101270
1991	Ga0373957_0005881
1992	Ga0373943_0004815
1993	Ga0373943_0036081
1994	Ga0373943_0046767
1995	Ga0373943_0081973
1996	Ga0373955_0051397
1997	Ga0373935_0004136
1998	Ga0373935_0025842
1999	Ga0373927_0013012
2000	Ga0373927_0156870
2001	Ga0373933_0014844
2002	Ga0373933_0045726
2003	Ga0373947_0016497
2004	Ga0373947_0086858
2005	Ga0373937_0004279
2006	Ga0373937_0016703
2007	Ga0373937_0027529
2008	Ga0373937_0110922
2009	Ga0373937_0144920
2010	Ga0373925_0002642
2011	Ga0373925_0038558
2012	Ga0373925_0054265
2013	Ga0373925_0131705
2014	Ga0395899_0001521
2015	Ga0395905_0109712
2016	Ga0436364_0910692
2017	Ga0436364_1027058
2018	Ga0395901_0091535
2019	Ga0237819_00949
2020	Ga0237816_00649
2021	Ga0436365_1654841
2022	Ga0436360_0036174
2023	Ga0436360_1255809
2024	Ga0436362_1291891
2025	Ga0439461_0000133
2026	Ga0439461_0003201
2027	Ga0439465_0002515
2028	Ga0439465_0007006
2029	Ga0439465_0010080
2030	Ga0451793_0729188
2031	Ga0451806_691803
2032	Ga0451835_0937263
2033	Ga0451849_0603856
2034	Ga0439431_0000794
2035	Ga0439431_0007345
2036	Ga0439432_010870
2037	Ga0439449_0002709
2038	Ga0439462_0002763
2039	Ga0439446_0003437
2040	Ga0466972_0012842
2041	Ga0466966_0060715
2042	Ga0466968_0007104
2043	Ga0466968_0014787
2044	Ga0466970_0042451
2045	Ga0466960_0058600
2046	Ga0466959_0019769
2047	Ga0451576_0000023
2048	Ga0451576_0032757
2049	Ga0495627_000157
2050	Ga0495627_000318
2051	Ga0495592_0087492
2052	Ga0495592_0096045
2053	Ga0495638_0000018
2054	Ga0495638_0000214
2055	Ga0495638_0003200
2056	Ga0495638_0009219
2057	Ga0495638_0013831
2058	Ga0495651_0071686
2059	Ga0495650_0000174
2060	Ga0495650_0006704
2061	Ga0495580_0017783
2062	Ga0495582_0042330
2063	Ga0495605_0002064
2064	Ga0495639_0000789
2065	Ga0495664_0007587
2066	Ga0495584_0018885
2067	Ga0495585_0016115
2068	Ga0495585_0017595
2069	Ga0495594_0015378
2070	Ga0495596_0006273
2071	Ga0495607_0037983
2072	Ga0495583_0000038
2073	Ga0495583_0002170
2074	Ga0495583_0006072
2075	Ga0495583_0017689
2076	Ga0495583_0028306
2077	Ga0495583_0035876
2078	Ga0495606_0003780
2079	Ga0495606_0017420
2080	Ga0495606_0080258
2081	Ga0495610_0000389
2082	Ga0495610_0053919
2083	Ga0495616_0000880
2084	Ga0495616_0030509
2085	Ga0495620_0013645
2086	Ga0495630_0012981
2087	Ga0495631_0001695
2088	Ga0495632_0000042
2089	Ga0495632_0001274
2090	Ga0495632_0011422
2091	Ga0495637_0001047
2092	Ga0495637_0007051
2093	Ga0495643_0000005
2094	Ga0495643_0005203
2095	Ga0495643_0020654
2096	Ga0495643_0031010
2097	Ga0495643_0065559
2098	Ga0495648_0000144
2099	Ga0495648_0000147
2100	Ga0495648_0033238
2101	Ga0495648_0034396
2102	Ga0495663_0000015
2103	Ga0495663_0005738
2104	Ga0495663_0010363
2105	Ga0495663_0017105
2106	Ga0495652_0163682
2107	Ga0495654_0000236
2108	Ga0495654_0010002
2109	Ga0495654_0015312
2110	Ga0495665_0001769
2111	Ga0495645_0003119
2112	Ga0495633_0000197
2113	Ga0495633_0000262
2114	Ga0495633_0033295
2115	Ga0495633_0073505
2116	Ga0495667_0008176
2117	Ga0495667_0025775
2118	Ga0495656_0026297
2119	Ga0495668_0000072
2120	Ga0495668_0006134
2121	Ga0495668_0028551
2122	Ga0495668_0028910
2123	Ga0495611_0007195
2124	Ga0495625_0001386
2125	Ga0495625_0002794
2126	Ga0495625_0008722
2127	Ga0495625_0109602
2128	Ga0495625_0125954
2129	Ga0495661_0070079
2130	Ga0495661_0088828
2131	Ga0495588_0005144
2132	Ga0495599_0093830
2133	Ga0495658_0002931
2134	Ga0495669_0000258
2135	Ga0495613_0025023
2136	Ga0495670_0018659
2137	Ga0495670_0028758
2138	Ga0495671_0000007
2139	Ga0495671_0000060
2140	Ga0495589_0011649
2141	Ga0495660_0006209
2142	Ga0495581_0007959
2143	Ga0495604_0048025
2144	Ga0495674_0033062
2145	Ga0495672_0007359
2146	Ga0495672_0009409
2147	Ga0495680_0129972
2148	Ga0495683_0024537
2149	Ga0495687_000045
2150	Ga0495687_000240
2151	Ga0495675_0034447
2152	Ga0495673_0000088
2153	Ga0495673_0016447
2154	Ga0495673_0041921
2155	Ga0495681_0000006
2156	Ga0495681_0004911
2157	Ga0495681_0016802
2158	Ga0495686_0000197
2159	Ga0495686_0000544
2160	Ga0495686_0000588
2161	Ga0495686_0004312
2162	Ga0495686_0010969
2163	Ga0495686_0021400
2164	Ga0495686_0054433
2165	Ga0495686_0125900
2166	Ga0495593_0002299
2167	Ga0495602_0003534
2168	Ga0495614_0002616
2169	Ga0495626_0045817
2170	Ga0496101_0004194
2171	Ga0496102_0000043
2172	Ga0496102_0000106
2173	Ga0496102_0011122
2174	Ga0496103_0000069
2175	Ga0496103_0000095
2176	Ga0496103_0000133
2177	Ga0496103_0002980
2178	Ga0496104_0000060
2179	Ga0496104_0067340
2180	Ga0496104_0077771
2181	Ga0496104_0109404
2182	Ga0496105_0000274
2183	Ga0496105_0041343
2184	Ga0496105_0062920
2185	Ga0496105_0079109
2186	Ga0496106_0000338
2187	Ga0496106_0001196
2188	Ga0496107_0002397
2189	Ga0496108_0001297
2190	Ga0496108_0045490
2191	Ga0496109_0056144
2192	Ga0496110_0038618
2193	Ga0496111_0000685
2194	Ga0496111_0034979
2195	Ga0496112_0175508
2196	Ga0496113_0001855
2197	Ga0496113_0002586
2198	Ga0496113_0023903
2199	Ga0496114_0003386
2200	Ga0496115_0000009
2201	Ga0496115_0001130
2202	Ga0496116_0007300
2203	Ga0496116_0014376
2204	Ga0496116_0041259
2205	Ga0496117_0000104
2206	Ga0496117_0000185
2207	Ga0496117_0000366
2208	Ga0496117_0002165
2209	Ga0496117_0013629
2210	Ga0496117_0015041
2211	Ga0496118_0000077
2212	Ga0496118_0000080
2213	Ga0496118_0003332
2214	Ga0496118_0013982
2215	Ga0496118_0031034
2216	Ga0496118_0041709
2217	Ga0496119_0001213
2218	Ga0496119_0008938
2219	Ga0496119_0052767
2220	Ga0496120_0001109
2221	Ga0496121_0001230
2222	Ga0496121_0001994
2223	Ga0496121_0002144
2224	Ga0496121_0002478
2225	Ga0496121_0003590
2226	Ga0496121_0006338
2227	Ga0496121_0089230
2228	Ga0496122_0000018
2229	Ga0496122_0000147
2230	Ga0496122_0002719
2231	Ga0496122_0002984
2232	Ga0496122_0004287
2233	Ga0496122_0011451
2234	Ga0496122_0011913
2235	Ga0496122_0017578
2236	Ga0496122_0088083
2237	Ga0496122_0096638
2238	Ga0496123_0000015
2239	Ga0496123_0000158
2240	Ga0496123_0002233
2241	Ga0496123_0009579
2242	Ga0496123_0020668
2243	Ga0496123_0020817
2244	Ga0496123_0060977
2245	Ga0496123_0074867
2246	Ga0496124_0000050
2247	Ga0496124_0000093
2248	Ga0496124_0000703
2249	Ga0496124_0001819
2250	Ga0496124_0046920
2251	Ga0496124_0053549
2252	Ga0496124_0109096
2253	Ga0496125_0000114
2254	Ga0496125_0002943
2255	Ga0496125_0051834
2256	Ga0496126_0000113
2257	Ga0496126_0000195
2258	Ga0496126_0000294
2259	Ga0496126_0014568
2260	Ga0496126_0018207
2261	Ga0496126_0055342
2262	Ga0496126_0055898
2263	Ga0496126_0093366
2264	Ga0496126_0122718
2265	Ga0495682_0010402
2266	Ga0501292_000117
2267	Ga0501294_000670
2268	Ga0501032_0003709
2269	Ga0501033_0011114
2270	Ga0501033_0110784
2271	Ga0501033_0133467
2272	Ga0501034_0002130
2273	Ga0501034_0035340
2274	Ga0501034_0236801
2275	Ga0501036_0052198
2276	Ga0501037_0010333
2277	Ga0501037_0017394
2278	Ga0501038_0000423
2279	Ga0501038_0059572
2280	Ga0501038_0280500
2281	Ga0501039_0000228
2282	Ga0501040_0000401
2283	Ga0501041_0000068
2284	Ga0501042_0000225
2285	Ga0501042_0004646
2286	Ga0501043_0006877
2287	Ga0501043_0026913
2288	Ga0501043_0058007
2289	Ga0501043_0058400
2290	Ga0501046_0047770
2291	Ga0501046_0064267
2292	Ga0501047_0015644
2293	Ga0501048_0033352
2294	Ga0501068_0006265
2295	Ga0501068_0057140
2296	Ga0501068_0090858
2297	Ga0501071_0000943
2298	Ga0501071_0041124
2299	Ga0501072_0000133
2300	Ga0501073_0008046
2301	Ga0501074_0040848
2302	Ga0501075_0000065
2303	Ga0501075_0003810
2304	Ga0501075_0006150
2305	Ga0501075_0029149
2306	Ga0501076_0000120
2307	Ga0501076_0010487
2308	Ga0501076_0073841
2309	Ga0501077_0000108
2310	Ga0501222_001581
2311	Ga0501223_000025
2312	Ga0501223_000367
2313	Ga0501224_000028
2314	Ga0501233_000183
2315	Ga0501249_001102
2316	Ga0501257_002893
2317	Ga0501261_000498
2318	Ga0501225_0000842
2319	Ga0501225_0001033
2320	Ga0501079_0003036
2321	Ga0501079_0007424
2322	Ga0501080_0003323
2323	Ga0501081_0000705
2324	Ga0501081_0031876
2325	Ga0501083_0009775
2326	Ga0501241_001834
2327	Ga0501279_000004
2328	Ga0501280_000014
2329	Ga0501281_00189
2330	Ga0501035_0044401
2331	Ga0501035_0075331
2332	Ga0501035_0118966
2333	Ga0501035_0140319
2334	Ga0501044_0026843
2335	Ga0501044_0040197
2336	Ga0501044_0102020
2337	Ga0501045_0000389
2338	Ga0501226_000191
2339	nmdc:mga03683_6454_c1
2340	nmdc:mga0yw44_12216_c1
2341	nmdc:mga0k408_16763_c1
2342	nmdc:mga06z11_195_c1
2343	nmdc:mga04h51_420_c1
2344	nmdc:mga07m45_6743_c1
2345	nmdc:mga05p37_21251_c1
2346	nmdc:mga05p37_32544_c1
2347	nmdc:mga05p37_446694_c1
2348	nmdc:mga08y16_11558_c1
2349	nmdc:mga08y16_1414_c1
2350	nmdc:mga0n895_45942_c1
2351	nmdc:mga0rr50_50701_c1
2352	nmdc:mga08x19_95_c1
2353	nmdc:mga0a205_18078_c1
2354	nmdc:mga0a205_276294_c1
2355	nmdc:mga0a205_41220_c1
2356	nmdc:mga0sz30_40997_c1
2357	Ga0495612_0000632
2358	Ga0500610_0000364
2359	Ga0500610_0025760
2360	Ga0495619_0015018
2361	Ga0500643_000093
2362	Ga0500643_000135
2363	Ga0500643_000606
2364	Ga0500643_001944
2365	Ga0500643_003937
2366	Ga0500643_025214
2367	Ga0500566_0000696
2368	Ga0500555_003899
2369	Ga0500556_0000197
2370	Ga0500557_000292
2371	Ga0500562_011252
2372	Ga0500569_014218
2373	Ga0500592_000056
2374	Ga0500592_001060
2375	Ga0500595_002230
2376	Ga0500595_002716
2377	Ga0500597_023742
2378	Ga0500607_003805
2379	Ga0500618_002112
2380	Ga0500642_0000011
2381	Ga0500642_0013377
2382	Ga0500658_0001519
2383	Ga0500658_0005819
2384	Ga0500658_0010069
2385	Ga0500559_0007673
2386	Ga0500559_0017644
2387	Ga0500559_0044993
2388	Ga0500564_006756
2389	Ga0500568_0001075
2390	Ga0500568_0048447
2391	Ga0500590_002666
2392	Ga0500616_0009045
2393	Ga0500616_0017475
2394	Ga0500616_0041719
2395	Ga0500616_0072211
2396	Ga0500622_0061457
2397	Ga0500622_0105632
2398	Ga0500624_000024
2399	Ga0500624_000062
2400	Ga0500624_000105
2401	Ga0500627_0000844
2402	Ga0500627_0000889
2403	Ga0500627_0011244
2404	Ga0500636_0003773
2405	Ga0500636_0034004
2406	Ga0500637_0000692
2407	Ga0500567_009748
2408	Ga0500611_004434
2409	Ga0500625_000039
2410	Ga0500645_000134
2411	Ga0500645_000767
2412	Ga0500596_005462
2413	Ga0501084_0003536
2414	Ga0590071_004250
2415	Ga0590075_001519
2416	Ga0501082_0001005
2417	Ga0501082_0060529
2418	Ga0501082_0199736
2419	Ga0530510_0000050
2420	Ga0530510_0122252
2421	2509111528
2422	2509375475
2423	2510307088
2424	2511132166
2425	2511392031
2426	2511498857
2427	2512534993
2428	2512643021
2429	2512973187
2430	2513570728
2431	2513575053
2432	2513588295
2433	2513603547
2434	2513619082
2435	2513882570
2436	2513904554
2437	2513983251
2438	2514005787
2439	2515607283
2440	2515741279
2441	2516204823
2442	2516895134
2443	2517078629
2444	2517571810
2445	2524452462
2446	2524462170
2447	2535485645
2448	2551678399
2449	2551688990
2450	2551696385
2451	2551699360
2452	2551711590
2453	2551719850
2454	2558866573
2455	2585276344
2456	2585524056
2457	2585564144
2458	2585897277
2459	2585903009
2460	2587978416
2461	2599718554
2462	2600195273
2463	2600200336
2464	2600225479
2465	2600376829
2466	2616551734
2467	2643729421
2468	2643805786
2469	2644039139
2470	2644045897
2471	2644065962
2472	2644103793
2473	2644126070
2474	2644144674
2475	2644306723
2476	2644330914
2477	2644380266
2478	2644393474
2479	2644417293
2480	2644450689
2481	2644541133
2482	2644612334
2483	2644671467
2484	2644692886
2485	2657682796
2486	2671693757
2487	2692320617
2488	2725947204
2489	2739649478
2490	2740027951
2491	2753358372
2492	2753459947
2493	2753763883
2494	2757570152
2495	2758640596
2496	2765465918
2497	2766067306
2498	2770196511
2499	2776269364
2500	2776283497
2501	2776915866
2502	2778124311
2503	2792583400
2504	2792620998
2505	2792625213
2506	2792637623
2507	2802720828
2508	2802724434
2509	2802729901
2510	2802737245
2511	2802746375
2512	2802751864
2513	2804754016
2514	2806049213
2515	2806056130
2516	2806063138
2517	2806070736
2518	2806077597
2519	2819613225
2520	2819685715
2521	2819713914
2522	2821123110
2523	2830076954
2524	2837651543
2525	2838074885
2526	2838689941
2527	2838731330
2528	2838739866
2529	2838744271
2530	2839993560
2531	2840766535
2532	2841844010
2533	2841852844
2534	2842112855
2535	2842143731
2536	2842160171
2537	2842165850
2538	2842184163
2539	2842231745
2540	2842245753
2541	2842260131
2542	2842273575
2543	2842303528
2544	2842308573
2545	2842362799
2546	2842515351
2547	2842875008
2548	2844164740
2549	2844456689
2550	2847421277
2551	2848996065
2552	2850079458
2553	2852387646
2554	2854913880
2555	2855827778
2556	2855843142
2557	2855877773
2558	2857520990
2559	2857533937
2560	2858802874
2561	2879165962
2562	2885430331
2563	2891375031
2564	2894653513
2565	2896255487
2566	2896388640
2567	2904579777
2568	2913298392
2569	2915650754
2570	2915982683
2571	2915989870
2572	2915999734
2573	2916002244
2574	2916008911
2575	2916016259
2576	2916022365
2577	2916033415
2578	2916037098
2579	2916046969
2580	2916054916
2581	2916056745
2582	2916063931
2583	2916078739
2584	2919120555
2585	2919141165
2586	2919709946
2587	2920763869
2588	2920822829
2589	2921202015
2590	2921209714
2591	2921237990
2592	2921244358
2593	2921256342
2594	2921261469
2595	2921265815
2596	2921283901
2597	2921291484
2598	2921303048
2599	2924145304
2600	2924155172
2601	2924162530
2602	2924167329
2603	2924173449
2604	2924182797
2605	2924187065
2606	2924197280
2607	2924202157
2608	2924210979
2609	2924215374
2610	2924225211
2611	2924230383
2612	2928030281
2613	2928522580
2614	2928528472
2615	2928970019
2616	2933575021
2617	2933588255
2618	2935902224
2619	2936380379
2620	2936998728
2621	2937003451
2622	2937010525
2623	2937017296
2624	2937025656
2625	2937030569
2626	2937039037
2627	2937045701
2628	2937054873
2629	2937057692
2630	2937070862
2631	2937076146
2632	2937083910
2633	2937088557
2634	2937096653
2635	2937100679
2636	2937111675
2637	2937115897
2638	2937125705
2639	2937130831
2640	2941504023
2641	2946787723
2642	2954014039
2643	2957378003
2644	2957383288
2645	2957390585
2646	2957401430
2647	2957407386
2648	2957409947
2649	2957416529
2650	2957422608
2651	2957435166
2652	2957441457
2653	2957447808
2654	2957451840
2655	2957460712
2656	2957468040
2657	2957475928
2658	2957484641
2659	2957485502
2660	2957492052
2661	2957502969
2662	2957506899
2663	2960585956
2664	2960593183
2665	2960600932
2666	2960607754
2667	2960615663
2668	2960620949
2669	2960626196
2670	2960635358
2671	2960640416
2672	2960646993
2673	2960656376
2674	2960664265
2675	2960670913
2676	2960677434
2677	2960682643
2678	2960692762
2679	2960697788
2680	2964609969
2681	2964618223
2682	2964627397
2683	2964631552
2684	2964641332
2685	2964645445
2686	2964651396
2687	2964662965
2688	2964668677
2689	2964672328
2690	2964682247
2691	2964690663
2692	2964695189
2693	2964700000
2694	2964710026
2695	2964716072
2696	2964725860
2697	2967669276
2698	2967673812
2699	2967683504
2700	2967688467
2701	2967694595
2702	2967705465
2703	2967714015
2704	2967716255
2705	2967725899
2706	2967733798
2707	2967740902
2708	2967742823
2709	2967751544
2710	2967758480
2711	2967766394
2712	2967775532
2713	2967776969
2714	2970021648
2715	2970031947
2716	2970038033
2717	2970046758
2718	2970054404
2719	2970056023
2720	2970064585
2721	2970073417
2722	2970077175
2723	2970085092
2724	2970095719
2725	2970099319
2726	2970106235
2727	2970112622
2728	2970118867
2729	2970122764
2730	2970130896
2731	2970139340
2732	2970145287
2733	2970153331
2734	2970160483
2735	2970165615
2736	2970177794
2737	2970182080
2738	2970186924
2739	2970193263
2740	2977522187
2741	2977525544
2742	2977530916
2743	2977538807
2744	2977546942
2745	2977556311
2746	2977561846
2747	2977572402
2748	2977576267
2749	2977581071
2750	2984558858
2751	2984566628
2752	2989351518
2753	2989774462
2754	2990266543
2755	2993357824
2756	2993695659
2757	3002141873
2758	3003931433
2759	3005410531
2760	3005419321
2761	643827767
2762	648738288
2763	8003995728
2764	8004003482
2765	8005310154
2766	8005317524
2767	8005378198
2768	8005489263
2769	8005559868
2770	8005564634
2771	8005570998
2772	8005645398
2773	8005687757
2774	8018167709
2775	8023681370
2776	8024481797
2777	8046774115
2778	8049296633
2779	8054562443
2780	8056878565
2781	8057103754
2782	8057577935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

60

489

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2pqc-assembly1.cif.gz_A	cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog	0.9835	2	435
2pqd-assembly1.cif.gz_A	a100g cp4 epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog	0.9834	2	435
3tr1-assembly1.cif.gz_A	structure of a 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii	0.9776	2	433
3slh-assembly3.cif.gz_C	1.70 angstrom resolution structure of 3-phosphoshikimate 1-carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate	0.9774	2	433
2pqc-assembly1.cif.gz_A	cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog	0.9768	2	435

ID	Description	Score	Start	End	Superfamily
2gg6A02	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9895	19	233	3.65.10.10
2gg6A02	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9849	19	233	3.65.10.10
2ggaA01	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9728	234	435	3.65.10.10
5bufA01	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9693	234	434	3.65.10.10
af_Q05615_22_211_3.65.10.10	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.957	18	209	3.65.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0E9MP87-F1-model_v4	3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS)	0.9955	1	432	GO:0003866 GO:0005737 GO:0008652 GO:0009073 GO:0009423
AF-A0A7U4LE28-F1-model_v4	3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS)	0.9953	1	432	GO:0003866 GO:0005737 GO:0008652 GO:0009073 GO:0009423
AF-A0A529LR22-F1-model_v4	3-phosphoshikimate 1-carboxyvinyltransferase	0.9945	196	342	GO:0003866 GO:0009423
AF-A0A1G7SGL2-F1-model_v4	3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS)	0.9929	2	434	GO:0003866 GO:0005737 GO:0008652 GO:0009073 GO:0009423
AF-A0A523G0H3-F1-model_v4	3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS)	0.9927	2	435	GO:0003866 GO:0005737 GO:0008652 GO:0009073 GO:0009423

F493595

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

60

489

0.92

Structural Annotation

Top 5 Hits

Map