F493601

General Info

Members Datasets Scaffolds Average Seq Length
1392 520 1387 142

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10204030|Ga0207648_102040302
Length 173
Sequence VSASKHDHDREEGLDFQPKFDASGLVTCVATDAATGDVLMVAHMNEEALRKTIASGEAWYFSRSRNALWRKGETSGQTQRVVEMRLDCDQDAVWIAKVDTDAFSLCAGPHHRPDLNGNTVFTQMPDRFLNRACPFETQITPAGRNGYTRVRLPGLARSMYVQLLFAKPISPSA

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
5 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
98 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
99 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
139 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
140 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
141 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
213 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
214 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
215 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
243 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
244 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
283 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
284 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
285 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
286 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
287 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
290 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
291 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
292 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
293 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
294 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
295 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
296 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
297 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
305 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
306 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
307 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
308 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
348 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
349 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
350 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
351 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
352 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
361 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
362 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
363 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
364 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
365 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
366 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
367 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
368 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
369 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
370 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
371 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
372 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
373 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
376 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
384 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
406 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
407 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
408 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
457 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
460 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
461 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
462 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
463 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
464 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
465 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
466 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
467 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
468 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
469 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
470 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
471 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
472 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
473 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
474 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
475 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
476 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
477 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
478 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
479 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
480 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
481 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
482 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
485 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
486 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
489 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
490 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
491 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
492 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
493 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
500 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
501 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
502 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
503 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
504 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
505 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
506 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
507 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
508 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
511 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
512 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
513 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
514 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
515 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
516 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
517 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
518 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
519 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.57
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 1.58
Rhizoplane 6.82
Rhizosphere 67.96
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026584 3300001979 Bacteria 1937
2 JGI24740J21852_10101045 3300001979 Bacteria 734
3 JGI24738J21930_10101359 3300002075 Bacteria 615
4 JGI25153J46596_10004677 3300003215 Bacteria 7315
5 JGI25153J46596_10017942 3300003215 Bacteria 2767
6 JGI25160J50197_1013544 3300003354 Bacteria 2774
7 JGI25160J50197_1036890 3300003354 Bacteria 1178
8 JGI25161J50226_1009260 3300003374 Bacteria 1422
9 JGI25404J52841_10009065 3300003659 Bacteria 2127
10 JGI25404J52841_10024640 3300003659 Bacteria 1296
11 Ga0055539_1013517 3300003752 Bacteria 999
12 Ga0055543_1005996 3300004625 Bacteria 3015
13 Ga0065165_1003569 3300005262 Bacteria 10751
14 Ga0065165_1007503 3300005262 Bacteria 5343
15 Ga0065165_1009639 3300005262 Bacteria 4295
16 Ga0065165_1031022 3300005262 Bacteria 1694
17 Ga0065715_10271731 3300005293 Bacteria 1109
18 Ga0070658_10048779 3300005327 Bacteria 3429
19 Ga0070658_10144495 3300005327 Bacteria 1988
20 Ga0070683_100007695 3300005329 Bacteria 9117
21 Ga0070683_100037619 3300005329 Bacteria 4430
22 Ga0068869_100017200 3300005334 Bacteria 4895
23 Ga0068869_100139057 3300005334 Bacteria 1873
24 Ga0068869_100838093 3300005334 Bacteria 792
25 Ga0068869_101709079 3300005334 Bacteria 562
26 Ga0070666_10912799 3300005335 Bacteria 650
27 Ga0070680_100004631 3300005336 Bacteria 10339
28 Ga0070680_100018149 3300005336 Bacteria 5558
29 Ga0070680_100640087 3300005336 Bacteria 913
30 Ga0070682_100028973 3300005337 Bacteria 3333
31 Ga0070682_100046870 3300005337 Bacteria 2685
32 Ga0070682_100199702 3300005337 Bacteria 1410
33 Ga0070682_100249988 3300005337 Bacteria 1278
34 Ga0068868_100161311 3300005338 Bacteria 1852
35 Ga0068868_100227730 3300005338 Bacteria 1563
36 Ga0068868_100344125 3300005338 Bacteria 1276
37 Ga0070660_100007944 3300005339 Bacteria 7406
38 Ga0070660_100161683 3300005339 Bacteria 1805
39 Ga0070660_100609937 3300005339 Bacteria 913
40 Ga0070660_100932119 3300005339 Bacteria 733
41 Ga0070691_10035653 3300005341 Bacteria 2343
42 Ga0070661_100116253 3300005344 Bacteria 2001
43 Ga0070661_100181949 3300005344 Bacteria 1599
44 Ga0070661_100220441 3300005344 Bacteria 1455
45 Ga0070661_100318800 3300005344 Bacteria 1214
46 Ga0070668_100037546 3300005347 Bacteria 3699
47 Ga0070668_100101845 3300005347 Bacteria 2276
48 Ga0070668_100175219 3300005347 Bacteria 1748
49 Ga0070668_100309786 3300005347 Bacteria 1326
50 Ga0070668_100400661 3300005347 Bacteria 1171
51 Ga0070668_101019475 3300005347 Bacteria 744
52 Ga0070669_100528292 3300005353 Bacteria 982
53 Ga0070671_100072935 3300005355 Bacteria 2867
54 Ga0070671_100191403 3300005355 Bacteria 1734
55 Ga0070671_100383341 3300005355 Bacteria 1201
56 Ga0070674_100477836 3300005356 Bacteria 1034
57 Ga0070659_100569554 3300005366 Bacteria 971
58 Ga0070667_100176034 3300005367 Bacteria 1891
59 Ga0070667_100681013 3300005367 Bacteria 950
60 Ga0070709_10001049 3300005434 Bacteria 15239
61 Ga0070709_10054092 3300005434 Bacteria 2529
62 Ga0070709_10469452 3300005434 Bacteria 951
63 Ga0070714_100001503 3300005435 Bacteria 16962
64 Ga0070714_100438034 3300005435 Bacteria 1240
65 Ga0070714_100531195 3300005435 Bacteria 1124
66 Ga0070713_100009241 3300005436 Bacteria 7041
67 Ga0070713_101317571 3300005436 Bacteria 700
68 Ga0070710_10004766 3300005437 Bacteria 6420
69 Ga0070710_10040600 3300005437 Bacteria 2565
70 Ga0070711_100003503 3300005439 Bacteria 9151
71 Ga0070711_100062200 3300005439 Bacteria 2601
72 Ga0070711_100502680 3300005439 Bacteria 1000
73 Ga0070711_101384808 3300005439 Bacteria 612
74 Ga0070700_100070735 3300005441 Bacteria 2225
75 Ga0070700_100625545 3300005441 Bacteria 847
76 Ga0070663_100020052 3300005455 Bacteria 4419
77 Ga0070663_100056176 3300005455 Bacteria 2820
78 Ga0070663_100106058 3300005455 Bacteria 2104
79 Ga0070663_100128105 3300005455 Bacteria 1924
80 Ga0070663_100129247 3300005455 Bacteria 1917
81 Ga0070663_100161439 3300005455 Bacteria 1725
82 Ga0070663_100436681 3300005455 Bacteria 1076
83 Ga0070663_100538085 3300005455 Bacteria 975
84 Ga0070678_100003659 3300005456 Bacteria 8584
85 Ga0070678_100118900 3300005456 Bacteria 2081
86 Ga0070678_100324030 3300005456 Bacteria 1317
87 Ga0070662_100035529 3300005457 Bacteria 3520
88 Ga0070662_100081802 3300005457 Bacteria 2407
89 Ga0070662_100085799 3300005457 Bacteria 2353
90 Ga0070662_100265020 3300005457 Bacteria 1385
91 Ga0070662_100748612 3300005457 Bacteria 829
92 Ga0070681_10035146 3300005458 Bacteria 5034
93 Ga0070681_10047129 3300005458 Bacteria 4308
94 Ga0070681_10720642 3300005458 Bacteria 913
95 Ga0068867_100349786 3300005459 Bacteria 1233
96 Ga0068867_100783578 3300005459 Bacteria 849
97 Ga0068867_100814829 3300005459 Bacteria 834
98 Ga0070706_100263515 3300005467 Bacteria 1609
99 Ga0070698_100040993 3300005471 Bacteria 4756
100 Ga0070699_101286957 3300005518 Bacteria 671
101 Ga0070679_100021982 3300005530 Bacteria 6232
102 Ga0070679_100051310 3300005530 Bacteria 4108
103 Ga0070679_100077530 3300005530 Bacteria 3312
104 Ga0070679_100215689 3300005530 Bacteria 1881
105 Ga0070679_100229794 3300005530 Bacteria 1815
106 Ga0070679_100397219 3300005530 Bacteria 1325
107 Ga0070679_100502166 3300005530 Bacteria 1157
108 Ga0070679_100750247 3300005530 Bacteria 919
109 Ga0070684_100011514 3300005535 Bacteria 7045
110 Ga0070684_100076765 3300005535 Bacteria 2949
111 Ga0070697_101063056 3300005536 Bacteria 720
112 Ga0068853_100005334 3300005539 Bacteria 10065
113 Ga0068853_100040711 3300005539 Bacteria 3966
114 Ga0068853_100062602 3300005539 Bacteria 3220
115 Ga0068853_100248236 3300005539 Bacteria 1632
116 Ga0068853_101994772 3300005539 Bacteria 563
117 Ga0070672_100187750 3300005543 Bacteria 1724
118 Ga0070686_100502978 3300005544 Bacteria 941
119 Ga0070695_100399860 3300005545 Bacteria 1041
120 Ga0070695_100538480 3300005545 Bacteria 908
121 Ga0070696_100391104 3300005546 Bacteria 1086
122 Ga0070693_100067081 3300005547 Bacteria 2102
123 Ga0070665_100018669 3300005548 Bacteria 6951
124 Ga0070665_100038117 3300005548 Bacteria 4831
125 Ga0070665_100044315 3300005548 Bacteria 4468
126 Ga0070665_100110097 3300005548 Bacteria 2757
127 Ga0070665_100140384 3300005548 Bacteria 2419
128 Ga0070665_100563601 3300005548 Bacteria 1152
129 Ga0070665_100601414 3300005548 Bacteria 1113
130 Ga0070665_100900290 3300005548 Bacteria 897
131 Ga0070665_101273400 3300005548 Bacteria 745
132 Ga0068855_100038159 3300005563 Bacteria 5708
133 Ga0068855_100052372 3300005563 Bacteria 4805
134 Ga0068855_100218469 3300005563 Bacteria 2139
135 Ga0068855_100275794 3300005563 Bacteria 1869
136 Ga0068855_100344202 3300005563 Bacteria 1643
137 Ga0068855_100838891 3300005563 Bacteria 975
138 Ga0068855_101579940 3300005563 Bacteria 671
139 Ga0068855_101721918 3300005563 Bacteria 639
140 Ga0068855_101797924 3300005563 Bacteria 623
141 Ga0070664_100227468 3300005564 Bacteria 1671
142 Ga0070664_101233676 3300005564 Bacteria 706
143 Ga0068857_100078149 3300005577 Bacteria 2953
144 Ga0068857_100265457 3300005577 Bacteria 1576
145 Ga0068857_100395122 3300005577 Bacteria 1286
146 Ga0068854_100076313 3300005578 Bacteria 2463
147 Ga0068854_100126538 3300005578 Bacteria 1947
148 Ga0068854_100287511 3300005578 Bacteria 1326
149 Ga0068854_100546618 3300005578 Bacteria 982
150 Ga0068856_100000535 3300005614 Bacteria 41862
151 Ga0068856_100036723 3300005614 Bacteria 4804
152 Ga0068856_100068097 3300005614 Bacteria 3518
153 Ga0068856_100071781 3300005614 Bacteria 3428
154 Ga0068856_100404857 3300005614 Bacteria 1384
155 Ga0068856_101627494 3300005614 Bacteria 659
156 Ga0070702_100274298 3300005615 Bacteria 1155
157 Ga0070702_100364868 3300005615 Bacteria 1022
158 Ga0070702_100800800 3300005615 Bacteria 729
159 Ga0068852_100004762 3300005616 Bacteria 9635
160 Ga0068852_100037938 3300005616 Bacteria 4045
161 Ga0068852_100127746 3300005616 Bacteria 2337
162 Ga0068852_100503297 3300005616 Bacteria 1206
163 Ga0068852_102639092 3300005616 Bacteria 522
164 Ga0068859_100195058 3300005617 Bacteria 2109
165 Ga0068859_100233047 3300005617 Bacteria 1930
166 Ga0068859_101758308 3300005617 Bacteria 685
167 Ga0068864_102264950 3300005618 Bacteria 550
168 Ga0068866_10041298 3300005718 Bacteria 2288
169 Ga0068866_10785214 3300005718 Bacteria 661
170 Ga0068866_10885531 3300005718 Bacteria 627
171 Ga0068866_10960974 3300005718 Bacteria 605
172 Ga0068861_100250689 3300005719 Bacteria 1510
173 Ga0068861_100528020 3300005719 Bacteria 1071
174 Ga0068861_100627970 3300005719 Bacteria 989
175 Ga0068861_101286184 3300005719 Bacteria 711
176 Ga0068861_101539450 3300005719 Bacteria 653
177 Ga0068851_10000835 3300005834 Bacteria 13259
178 Ga0068851_10006013 3300005834 Bacteria 5531
179 Ga0068851_10142660 3300005834 Bacteria 1304
180 Ga0068851_10158191 3300005834 Bacteria 1243
181 Ga0068851_10243997 3300005834 Bacteria 1017
182 Ga0068870_10103942 3300005840 Bacteria 1610
183 Ga0068870_11156037 3300005840 Bacteria 559
184 Ga0068863_100188289 3300005841 Bacteria 1983
185 Ga0068863_100731594 3300005841 Bacteria 984
186 Ga0068858_100408049 3300005842 Bacteria 1306
187 Ga0068858_100604751 3300005842 Bacteria 1064
188 Ga0068858_101185446 3300005842 Bacteria 750
189 Ga0068858_101219917 3300005842 Bacteria 740
190 Ga0068860_100200283 3300005843 Bacteria 1935
191 Ga0068860_100359876 3300005843 Bacteria 1433
192 Ga0068860_101377247 3300005843 Bacteria 726
193 Ga0068862_100141665 3300005844 Bacteria 2134
194 Ga0068862_100215223 3300005844 Bacteria 1737
195 Ga0068862_100370338 3300005844 Bacteria 1333
196 Ga0068862_100603629 3300005844 Bacteria 1054
197 Ga0068862_100867533 3300005844 Bacteria 885
198 Ga0081455_10001517 3300005937 Bacteria 28624
199 Ga0081455_10013697 3300005937 Bacteria 7986
200 Ga0081455_10482205 3300005937 Bacteria 838
201 Ga0081538_10031309 3300005981 Bacteria 3590
202 Ga0081540_1002249 3300005983 Bacteria 15898
203 Ga0081540_1003440 3300005983 Bacteria 12500
204 Ga0081540_1011448 3300005983 Bacteria 5926
205 Ga0081540_1031530 3300005983 Bacteria 2912
206 Ga0081540_1036980 3300005983 Bacteria 2594
207 Ga0081540_1116975 3300005983 Bacteria 1114
208 Ga0081540_1143122 3300005983 Bacteria 956
209 Ga0081540_1179174 3300005983 Bacteria 795
210 Ga0081539_10000203 3300005985 Bacteria 138096
211 Ga0081539_10074427 3300005985 Bacteria 1809
212 Ga0070717_10002312 3300006028 Bacteria 13387
213 Ga0070717_10144342 3300006028 Bacteria 2055
214 Ga0070717_10658516 3300006028 Bacteria 951
215 Ga0075365_10023032 3300006038 Bacteria 3912
216 Ga0075365_10125646 3300006038 Bacteria 1772
217 Ga0075365_10135841 3300006038 Bacteria 1704
218 Ga0075365_10178904 3300006038 Bacteria 1482
219 Ga0075365_10233601 3300006038 Bacteria 1291
220 Ga0075365_10445555 3300006038 Bacteria 914
221 Ga0075365_10686225 3300006038 Bacteria 724
222 Ga0075368_10135596 3300006042 Bacteria 1024
223 Ga0075368_10184296 3300006042 Bacteria 880
224 Ga0075368_10534277 3300006042 Bacteria 526
225 Ga0075363_100106437 3300006048 Bacteria 1556
226 Ga0075363_100257702 3300006048 Bacteria 1005
227 Ga0075363_100277714 3300006048 Bacteria 969
228 Ga0075364_10066812 3300006051 Bacteria 2362
229 Ga0075364_10494147 3300006051 Bacteria 836
230 Ga0070715_10000192 3300006163 Bacteria 14303
231 Ga0070715_10174292 3300006163 Bacteria 1074
232 Ga0070715_10346336 3300006163 Bacteria 810
233 Ga0070716_100063087 3300006173 Bacteria 2150
234 Ga0070716_100876830 3300006173 Bacteria 701
235 Ga0070712_100004044 3300006175 Bacteria 9002
236 Ga0070712_100008540 3300006175 Bacteria 6442
237 Ga0070712_100290120 3300006175 Bacteria 1320
238 Ga0075362_10117021 3300006177 Bacteria 1259
239 Ga0075362_10276076 3300006177 Bacteria 830
240 Ga0075367_10133459 3300006178 Bacteria 1535
241 Ga0075367_10210784 3300006178 Bacteria 1215
242 Ga0075367_10227221 3300006178 Bacteria 1169
243 Ga0075367_10264219 3300006178 Bacteria 1080
244 Ga0075367_10401998 3300006178 Bacteria 866
245 Ga0075367_10714363 3300006178 Bacteria 637
246 Ga0075369_10050776 3300006186 Bacteria 1794
247 Ga0075369_10155208 3300006186 Bacteria 1047
248 Ga0075369_10404673 3300006186 Bacteria 643
249 Ga0075366_10310403 3300006195 Bacteria 965
250 Ga0075366_10311518 3300006195 Bacteria 964
251 Ga0075366_10368542 3300006195 Bacteria 883
252 Ga0075366_10443540 3300006195 Bacteria 801
253 Ga0075366_10505038 3300006195 Bacteria 748
254 Ga0075366_10694709 3300006195 Bacteria 632
255 Ga0097621_100045438 3300006237 Bacteria 3548
256 Ga0097621_100336554 3300006237 Bacteria 1340
257 Ga0075370_10203699 3300006353 Bacteria 1167
258 Ga0075370_10591939 3300006353 Bacteria 672
259 Ga0068871_100278163 3300006358 Bacteria 1463
260 Ga0068871_100372732 3300006358 Bacteria 1266
261 Ga0068871_100625788 3300006358 Bacteria 981
262 Ga0075433_10937407 3300006852 Bacteria 755
263 Ga0075434_100840738 3300006871 Bacteria 934
264 Ga0075429_100484583 3300006880 Bacteria 1084
265 Ga0068865_100116722 3300006881 Bacteria 1977
266 Ga0068865_100212981 3300006881 Bacteria 1507
267 Ga0097620_100195051 3300006931 Bacteria 2109
268 Ga0097620_100233036 3300006931 Bacteria 1930
269 Ga0097620_101758776 3300006931 Bacteria 685
270 Ga0097620_102727967 3300006931 Bacteria 543
271 Ga0099824_1004186 3300006942 Bacteria 20854
272 Ga0099824_1011269 3300006942 Bacteria 10188
273 Ga0099822_1006118 3300006943 Bacteria 15692
274 Ga0099823_1095743 3300006944 Bacteria 958
275 Ga0075435_100180733 3300007076 Bacteria 1783
276 Ga0099794_10342109 3300007265 Bacteria 777
277 Ga0099795_10001203 3300007788 Bacteria 5456
278 Ga0099795_10031793 3300007788 Bacteria 1820
279 Ga0099795_10052099 3300007788 Bacteria 1494
280 Ga0099795_10411000 3300007788 Bacteria 617
281 Ga0105250_10077524 3300009092 Bacteria 1345
282 Ga0105240_10001503 3300009093 Bacteria 39730
283 Ga0105240_10012039 3300009093 Bacteria 11991
284 Ga0105240_10044376 3300009093 Bacteria 5649
285 Ga0105240_10065642 3300009093 Bacteria 4504
286 Ga0105240_10078471 3300009093 Bacteria 4066
287 Ga0105240_10348106 3300009093 Bacteria 1682
288 Ga0105240_10514575 3300009093 Bacteria 1329
289 Ga0105240_10874452 3300009093 Bacteria 968
290 Ga0111539_10081586 3300009094 Bacteria 3804
291 Ga0105245_10026228 3300009098 Bacteria 5129
292 Ga0105245_10027787 3300009098 Bacteria 4985
293 Ga0105245_10968357 3300009098 Bacteria 894
294 Ga0105245_11250060 3300009098 Bacteria 791
295 Ga0105245_11474897 3300009098 Bacteria 731
296 Ga0105247_10168177 3300009101 Bacteria 1456
297 Ga0114129_10780806 3300009147 Bacteria 1220
298 Ga0105243_10522834 3300009148 Bacteria 1129
299 Ga0105243_11566714 3300009148 Bacteria 684
300 Ga0105241_10073753 3300009174 Bacteria 2656
301 Ga0105241_10078013 3300009174 Bacteria 2587
302 Ga0105241_10094740 3300009174 Bacteria 2362
303 Ga0105241_10479027 3300009174 Bacteria 1106
304 Ga0105241_10768650 3300009174 Bacteria 885
305 Ga0105242_10088880 3300009176 Bacteria 2596
306 Ga0105242_10396170 3300009176 Bacteria 1287
307 Ga0105248_10135116 3300009177 Bacteria 2782
308 Ga0105248_10580318 3300009177 Bacteria 1265
309 Ga0105248_10666508 3300009177 Bacteria 1174
310 Ga0105248_11025023 3300009177 Bacteria 932
311 Ga0105237_10000992 3300009545 Bacteria 38167
312 Ga0105237_10007135 3300009545 Bacteria 12277
313 Ga0105237_10027416 3300009545 Bacteria 5816
314 Ga0105237_10042680 3300009545 Bacteria 4572
315 Ga0105237_10068125 3300009545 Bacteria 3553
316 Ga0105237_10150862 3300009545 Bacteria 2321
317 Ga0105237_10191711 3300009545 Bacteria 2044
318 Ga0105237_10310707 3300009545 Bacteria 1580
319 Ga0105237_10373604 3300009545 Bacteria 1430
320 Ga0105237_10788673 3300009545 Bacteria 957
321 Ga0105237_11155244 3300009545 Bacteria 781
322 Ga0105238_10008586 3300009551 Bacteria 10220
323 Ga0105238_10021123 3300009551 Bacteria 6635
324 Ga0105238_10021503 3300009551 Bacteria 6571
325 Ga0105238_10025858 3300009551 Bacteria 5985
326 Ga0105238_10173743 3300009551 Bacteria 2131
327 Ga0105238_10182278 3300009551 Bacteria 2077
328 Ga0105238_10311513 3300009551 Bacteria 1559
329 Ga0105238_10376017 3300009551 Bacteria 1412
330 Ga0105238_10516787 3300009551 Bacteria 1196
331 Ga0105238_11254211 3300009551 Bacteria 766
332 Ga0105249_10295127 3300009553 Bacteria 1624
333 Ga0099796_10021942 3300010159 Bacteria 1974
334 Ga0099796_10022456 3300010159 Bacteria 1957
335 Ga0105239_10008381 3300010375 Bacteria 11777
336 Ga0105239_10040184 3300010375 Bacteria 5125
337 Ga0105239_10085316 3300010375 Bacteria 3480
338 Ga0105239_10118569 3300010375 Bacteria 2937
339 Ga0105239_10124685 3300010375 Bacteria 2862
340 Ga0105239_10203365 3300010375 Bacteria 2219
341 Ga0105239_10617559 3300010375 Bacteria 1237
342 Ga0105239_10758819 3300010375 Bacteria 1110
343 Ga0105239_12120987 3300010375 Bacteria 653
344 Ga0105239_13093663 3300010375 Bacteria 542
345 Ga0105246_10525867 3300011119 Bacteria 1009
346 Ga0157370_10034059 3300013104 Bacteria 4963
347 Ga0157370_11362062 3300013104 Bacteria 639
348 Ga0157370_11895656 3300013104 Bacteria 535
349 Ga0157369_10009894 3300013105 Bacteria 10896
350 Ga0157369_10069789 3300013105 Bacteria 3775
351 Ga0157369_10103369 3300013105 Bacteria 3035
352 Ga0157369_10387188 3300013105 Bacteria 1451
353 Ga0157369_11551367 3300013105 Bacteria 674
354 Ga0157369_11695679 3300013105 Bacteria 642
355 Ga0157374_10003326 3300013296 Bacteria 13512
356 Ga0157374_10347053 3300013296 Bacteria 1474
357 Ga0157374_10517789 3300013296 Bacteria 1198
358 Ga0157374_10989339 3300013296 Bacteria 860
359 Ga0157374_11393735 3300013296 Bacteria 724
360 Ga0157378_10178253 3300013297 Bacteria 1998
361 Ga0157378_10561113 3300013297 Bacteria 1148
362 Ga0157378_10876248 3300013297 Bacteria 927
363 Ga0163162_10026850 3300013306 Bacteria 5693
364 Ga0163162_10367028 3300013306 Bacteria 1573
365 Ga0163162_10410342 3300013306 Bacteria 1487
366 Ga0163162_10438128 3300013306 Bacteria 1439
367 Ga0163162_10670628 3300013306 Bacteria 1160
368 Ga0157372_10189034 3300013307 Bacteria 2385
369 Ga0157372_10284026 3300013307 Bacteria 1924
370 Ga0157372_10329977 3300013307 Bacteria 1776
371 Ga0157372_11504618 3300013307 Bacteria 775
372 Ga0157375_10298571 3300013308 Bacteria 1774
373 Ga0157375_10789035 3300013308 Bacteria 1099
374 Ga0163163_10007553 3300014325 Bacteria 9597
375 Ga0163163_10399369 3300014325 Bacteria 1433
376 Ga0163163_10424397 3300014325 Bacteria 1389
377 Ga0163163_10693921 3300014325 Bacteria 1081
378 Ga0157380_10475671 3300014326 Bacteria 1207
379 Ga0182008_10145428 3300014497 Bacteria 1187
380 Ga0157377_10046781 3300014745 Bacteria 2421
381 Ga0157377_10842548 3300014745 Bacteria 680
382 Ga0157379_10245584 3300014968 Bacteria 1624
383 Ga0157379_10483493 3300014968 Bacteria 1146
384 Ga0157379_11818768 3300014968 Bacteria 599
385 Ga0157376_10017469 3300014969 Bacteria 5473
386 Ga0157376_10582566 3300014969 Bacteria 1111
387 Ga0157376_10591912 3300014969 Bacteria 1103
388 Ga0157376_11412126 3300014969 Bacteria 728
389 Ga0163161_10369875 3300017792 Bacteria 1143
390 Ga0163161_11204541 3300017792 Bacteria 655
391 Ga0184601_109990 3300019183 Bacteria 506
392 Ga0197907_11372531 3300020069 Bacteria 679
393 Ga0206356_10091318 3300020070 Bacteria 1189
394 Ga0206354_10938124 3300020081 Bacteria 1998
395 Ga0206353_12039802 3300020082 Bacteria 716
396 Ga0214544_1022606 3300021320 Bacteria 3743
397 Ga0214542_1000002 3300021321 Bacteria 720798
398 Ga0214542_1023298 3300021321 Bacteria 3743
399 Ga0214545_1000002 3300021324 Bacteria 727485
400 Ga0214545_1024282 3300021324 Bacteria 3776
401 Ga0214543_1000017 3300021327 Bacteria 290109
402 Ga0214543_1024476 3300021327 Bacteria 3722
403 Ga0213872_10120974 3300021361 Bacteria 1157
404 Ga0213874_10106109 3300021377 Bacteria 939
405 Ga0213876_10048574 3300021384 Bacteria 2242
406 Ga0213876_10217404 3300021384 Bacteria 1016
407 Ga0213876_10698814 3300021384 Bacteria 540
408 Ga0224712_10274410 3300022467 Bacteria 783
409 Ga0209563_101649 3300025230 Bacteria 5737
410 Ga0209677_100547 3300025253 Bacteria 20860
411 Ga0209677_101107 3300025253 Bacteria 12660
412 Ga0209233_1000908 3300025261 Bacteria 12943
413 Ga0209233_1004920 3300025261 Bacteria 4494
414 Ga0209455_1005799 3300025272 Bacteria 3752
415 Ga0209455_1021921 3300025272 Bacteria 1228
416 Ga0209673_1016891 3300025273 Bacteria 2711
417 Ga0209564_1005255 3300025295 Bacteria 7475
418 Ga0209758_1000189 3300025297 Bacteria 138296
419 Ga0209758_1000827 3300025297 Bacteria 43314
420 Ga0209758_1003142 3300025297 Bacteria 15539
421 Ga0209758_1020233 3300025297 Bacteria 3161
422 Ga0209758_1043163 3300025297 Bacteria 1664
423 Ga0209256_1084781 3300025299 Bacteria 685
424 Ga0207426_1001072 3300025302 Bacteria 25708
425 Ga0207426_1001657 3300025302 Bacteria 17321
426 Ga0207426_1010712 3300025302 Bacteria 3542
427 Ga0209257_1100216 3300025304 Bacteria 707
428 Ga0207697_10065228 3300025315 Bacteria 1519
429 Ga0207656_10001089 3300025321 Bacteria 8894
430 Ga0207656_10006242 3300025321 Bacteria 4270
431 Ga0207656_10286944 3300025321 Bacteria 813
432 Ga0207692_10000798 3300025898 Bacteria 11222
433 Ga0207692_10001866 3300025898 Bacteria 8006
434 Ga0207642_10031389 3300025899 Bacteria 2225
435 Ga0207642_10057482 3300025899 Bacteria 1790
436 Ga0207688_10030058 3300025901 Bacteria 2994
437 Ga0207688_10430996 3300025901 Bacteria 820
438 Ga0207647_10003452 3300025904 Bacteria 11858
439 Ga0207685_10017711 3300025905 Bacteria 2311
440 Ga0207685_10365411 3300025905 Bacteria 731
441 Ga0207699_10001678 3300025906 Bacteria 10478
442 Ga0207699_10028617 3300025906 Bacteria 3099
443 Ga0207699_10204874 3300025906 Bacteria 1339
444 Ga0207645_10415238 3300025907 Bacteria 906
445 Ga0207643_10113617 3300025908 Bacteria 1597
446 Ga0207705_10028471 3300025909 Bacteria 3983
447 Ga0207705_10771605 3300025909 Bacteria 747
448 Ga0207684_10441852 3300025910 Bacteria 1117
449 Ga0207684_10553006 3300025910 Bacteria 985
450 Ga0207654_10001074 3300025911 Bacteria 14855
451 Ga0207654_10040765 3300025911 Bacteria 2618
452 Ga0207654_10063717 3300025911 Bacteria 2165
453 Ga0207654_10462097 3300025911 Bacteria 891
454 Ga0207707_10002655 3300025912 Bacteria 15989
455 Ga0207707_10009378 3300025912 Bacteria 8490
456 Ga0207707_10025231 3300025912 Bacteria 5199
457 Ga0207707_10207609 3300025912 Bacteria 1707
458 Ga0207707_10733281 3300025912 Bacteria 827
459 Ga0207695_10000159 3300025913 Bacteria 201367
460 Ga0207695_10035634 3300025913 Bacteria 5392
461 Ga0207695_10135688 3300025913 Bacteria 2414
462 Ga0207695_11324059 3300025913 Bacteria 601
463 Ga0207671_10003280 3300025914 Bacteria 16284
464 Ga0207671_10177765 3300025914 Bacteria 1655
465 Ga0207671_10285934 3300025914 Bacteria 1301
466 Ga0207671_10372967 3300025914 Bacteria 1133
467 Ga0207671_10376283 3300025914 Bacteria 1128
468 Ga0207671_10524648 3300025914 Bacteria 944
469 Ga0207671_10939127 3300025914 Bacteria 683
470 Ga0207671_11182731 3300025914 Bacteria 599
471 Ga0207693_10001679 3300025915 Bacteria 19500
472 Ga0207693_10021981 3300025915 Bacteria 5071
473 Ga0207693_10105122 3300025915 Bacteria 2214
474 Ga0207663_10000672 3300025916 Bacteria 15122
475 Ga0207663_10590031 3300025916 Bacteria 872
476 Ga0207663_10602854 3300025916 Bacteria 863
477 Ga0207660_10028715 3300025917 Bacteria 3807
478 Ga0207660_10031077 3300025917 Bacteria 3674
479 Ga0207660_10041034 3300025917 Bacteria 3242
480 Ga0207660_10130755 3300025917 Bacteria 1911
481 Ga0207657_10004801 3300025919 Bacteria 14253
482 Ga0207657_10142420 3300025919 Bacteria 1958
483 Ga0207657_10967270 3300025919 Bacteria 654
484 Ga0207649_10129301 3300025920 Bacteria 1713
485 Ga0207649_10247779 3300025920 Bacteria 1282
486 Ga0207649_10400411 3300025920 Bacteria 1027
487 Ga0207649_10589917 3300025920 Bacteria 854
488 Ga0207652_10002660 3300025921 Bacteria 14994
489 Ga0207652_10009472 3300025921 Bacteria 7830
490 Ga0207652_10041605 3300025921 Bacteria 3907
491 Ga0207652_10451505 3300025921 Bacteria 1159
492 Ga0207694_10000271 3300025924 Bacteria 49284
493 Ga0207694_10017732 3300025924 Bacteria 5380
494 Ga0207694_10021788 3300025924 Bacteria 4857
495 Ga0207694_10126639 3300025924 Bacteria 2044
496 Ga0207694_10545562 3300025924 Bacteria 973
497 Ga0207687_10023036 3300025927 Bacteria 4148
498 Ga0207687_10852633 3300025927 Bacteria 778
499 Ga0207687_11691001 3300025927 Bacteria 542
500 Ga0207700_10005119 3300025928 Bacteria 7798
501 Ga0207700_10173713 3300025928 Bacteria 1799
502 Ga0207700_11494798 3300025928 Bacteria 599
503 Ga0207664_10012380 3300025929 Bacteria 6096
504 Ga0207664_10629235 3300025929 Bacteria 964
505 Ga0207664_10815116 3300025929 Bacteria 839
506 Ga0207664_11248387 3300025929 Bacteria 662
507 Ga0207644_10025554 3300025931 Bacteria 4061
508 Ga0207644_10464988 3300025931 Bacteria 1040
509 Ga0207644_10473889 3300025931 Bacteria 1030
510 Ga0207690_10179248 3300025932 Bacteria 1594
511 Ga0207690_10199483 3300025932 Bacteria 1519
512 Ga0207690_10449478 3300025932 Bacteria 1036
513 Ga0207690_11369522 3300025932 Bacteria 591
514 Ga0207706_10055641 3300025933 Bacteria 3488
515 Ga0207706_10093304 3300025933 Bacteria 2647
516 Ga0207706_10137433 3300025933 Bacteria 2150
517 Ga0207706_10173356 3300025933 Bacteria 1895
518 Ga0207706_10576871 3300025933 Bacteria 967
519 Ga0207706_10727540 3300025933 Bacteria 846
520 Ga0207686_10041734 3300025934 Bacteria 2800
521 Ga0207686_10299322 3300025934 Bacteria 1194
522 Ga0207709_10453503 3300025935 Bacteria 992
523 Ga0207709_10942025 3300025935 Bacteria 703
524 Ga0207669_10312440 3300025937 Bacteria 1199
525 Ga0207669_10353849 3300025937 Bacteria 1136
526 Ga0207669_11584645 3300025937 Bacteria 559
527 Ga0207704_10162045 3300025938 Bacteria 1593
528 Ga0207665_10000700 3300025939 Bacteria 22712
529 Ga0207665_10078292 3300025939 Bacteria 2271
530 Ga0207665_10119560 3300025939 Bacteria 1860
531 Ga0207691_10583621 3300025940 Bacteria 947
532 Ga0207711_10445075 3300025941 Bacteria 1206
533 Ga0207711_10780215 3300025941 Bacteria 890
534 Ga0207711_10805381 3300025941 Bacteria 875
535 Ga0207689_10080252 3300025942 Bacteria 2682
536 Ga0207689_10190000 3300025942 Bacteria 1694
537 Ga0207689_10260607 3300025942 Bacteria 1434
538 Ga0207689_10284579 3300025942 Bacteria 1369
539 Ga0207689_10483259 3300025942 Bacteria 1037
540 Ga0207661_10003040 3300025944 Bacteria 11601
541 Ga0207661_10331914 3300025944 Bacteria 1369
542 Ga0207661_10481903 3300025944 Bacteria 1132
543 Ga0207679_10797422 3300025945 Bacteria 861
544 Ga0207667_10003903 3300025949 Bacteria 18339
545 Ga0207667_10005344 3300025949 Bacteria 15656
546 Ga0207667_10047821 3300025949 Bacteria 4526
547 Ga0207667_10328127 3300025949 Bacteria 1563
548 Ga0207667_10348616 3300025949 Bacteria 1510
549 Ga0207667_10377288 3300025949 Bacteria 1445
550 Ga0207667_10443484 3300025949 Bacteria 1320
551 Ga0207668_10080257 3300025972 Bacteria 2363
552 Ga0207668_10249957 3300025972 Bacteria 1439
553 Ga0207668_10484392 3300025972 Bacteria 1061
554 Ga0207668_10560910 3300025972 Bacteria 990
555 Ga0207668_10754976 3300025972 Bacteria 858
556 Ga0207668_11446007 3300025972 Bacteria 620
557 Ga0207640_10007468 3300025981 Bacteria 6038
558 Ga0207640_10105171 3300025981 Bacteria 1988
559 Ga0207640_10289366 3300025981 Bacteria 1291
560 Ga0207658_10311950 3300025986 Bacteria 1359
561 Ga0207658_10484966 3300025986 Bacteria 1099
562 Ga0207658_10676960 3300025986 Bacteria 931
563 Ga0207677_10011044 3300026023 Bacteria 5132
564 Ga0207677_10420316 3300026023 Bacteria 1138
565 Ga0207703_10075453 3300026035 Bacteria 2794
566 Ga0207703_10683214 3300026035 Bacteria 975
567 Ga0207703_11851463 3300026035 Bacteria 580
568 Ga0207639_10172869 3300026041 Bacteria 1831
569 Ga0207639_10275687 3300026041 Bacteria 1477
570 Ga0207639_10295835 3300026041 Bacteria 1429
571 Ga0207639_11217495 3300026041 Bacteria 707
572 Ga0207639_11569602 3300026041 Bacteria 618
573 Ga0207639_11692278 3300026041 Bacteria 593
574 Ga0207678_10010552 3300026067 Bacteria 8114
575 Ga0207678_10028578 3300026067 Bacteria 4867
576 Ga0207678_10073165 3300026067 Bacteria 2938
577 Ga0207678_10089069 3300026067 Bacteria 2638
578 Ga0207678_10167906 3300026067 Bacteria 1874
579 Ga0207678_10234738 3300026067 Bacteria 1570
580 Ga0207678_11296226 3300026067 Bacteria 644
581 Ga0207708_10127250 3300026075 Bacteria 1989
582 Ga0207702_10000005 3300026078 Bacteria 420296
583 Ga0207702_10000081 3300026078 Bacteria 108009
584 Ga0207702_10056499 3300026078 Bacteria 3333
585 Ga0207702_10239096 3300026078 Bacteria 1701
586 Ga0207702_10249513 3300026078 Bacteria 1666
587 Ga0207641_10176651 3300026088 Bacteria 1953
588 Ga0207641_10848347 3300026088 Bacteria 905
589 Ga0207641_10995766 3300026088 Bacteria 835
590 Ga0207641_11796530 3300026088 Bacteria 615
591 Ga0207648_10199196 3300026089 Bacteria 1776
592 Ga0207648_10204030 3300026089 Bacteria 1754
593 Ga0207648_10884066 3300026089 Bacteria 834
594 Ga0207676_10604521 3300026095 Bacteria 1054
595 Ga0207676_12033745 3300026095 Bacteria 573
596 Ga0207674_10007442 3300026116 Bacteria 12762
597 Ga0207674_10024446 3300026116 Bacteria 6456
598 Ga0207674_10370937 3300026116 Bacteria 1383
599 Ga0207675_100467335 3300026118 Bacteria 1252
600 Ga0207675_100628200 3300026118 Bacteria 1079
601 Ga0207675_100632621 3300026118 Bacteria 1075
602 Ga0207675_101396566 3300026118 Bacteria 721
603 Ga0207675_101426250 3300026118 Bacteria 713
604 Ga0207683_10027486 3300026121 Bacteria 4916
605 Ga0207683_10032383 3300026121 Bacteria 4542
606 Ga0207683_10097580 3300026121 Bacteria 2621
607 Ga0207683_11210045 3300026121 Bacteria 700
608 Ga0207698_10065686 3300026142 Bacteria 2851
609 Ga0207698_10075603 3300026142 Bacteria 2693
610 Ga0207698_10779031 3300026142 Bacteria 957
611 Ga0207698_10835067 3300026142 Bacteria 925
612 Ga0209389_1000239 3300027296 Bacteria 35712
613 Ga0209389_1000690 3300027296 Bacteria 21019
614 Ga0209589_1000009 3300027357 Bacteria 252104
615 Ga0209589_1007787 3300027357 Bacteria 17039
616 Ga0209489_100010 3300027361 Bacteria 252139
617 Ga0209489_100030 3300027361 Bacteria 185999
618 Ga0209489_122501 3300027361 Bacteria 1351
619 Ga0209700_100017 3300027363 Bacteria 252104
620 Ga0268266_10016992 3300028379 Bacteria 6215
621 Ga0268266_10019219 3300028379 Bacteria 5818
622 Ga0268266_10023260 3300028379 Bacteria 5276
623 Ga0268266_10093175 3300028379 Bacteria 2643
624 Ga0268266_10335405 3300028379 Bacteria 1418
625 Ga0268266_10353387 3300028379 Bacteria 1381
626 Ga0268266_10416169 3300028379 Bacteria 1273
627 Ga0268266_10493004 3300028379 Bacteria 1169
628 Ga0268266_10907006 3300028379 Bacteria 852
629 Ga0268266_11155851 3300028379 Bacteria 749
630 Ga0268266_11258179 3300028379 Bacteria 715
631 Ga0268266_12108609 3300028379 Bacteria 536
632 Ga0268265_10080305 3300028380 Bacteria 2571
633 Ga0268265_10240729 3300028380 Bacteria 1596
634 Ga0268265_10355501 3300028380 Bacteria 1339
635 Ga0268265_10368469 3300028380 Bacteria 1318
636 Ga0268265_10557792 3300028380 Bacteria 1088
637 Ga0268265_11718478 3300028380 Bacteria 633
638 Ga0268264_10000035 3300028381 Bacteria 398196
639 Ga0268264_10211912 3300028381 Bacteria 1779
640 Ga0268264_10346086 3300028381 Bacteria 1413
641 Ga0268264_11024525 3300028381 Bacteria 832
642 Ga0268264_12374707 3300028381 Bacteria 536
643 Ga0307515_10141133 3300028794 Bacteria 2583
644 Ga0307515_10855676 3300028794 Bacteria 536
645 Ga0307512_10296696 3300030522 Bacteria 757
646 Ga0265330_10115115 3300031235 Bacteria 1147
647 Ga0265332_10012628 3300031238 Bacteria 3745
648 Ga0265332_10029389 3300031238 Bacteria 2403
649 Ga0265328_10136833 3300031239 Bacteria 918
650 Ga0265325_10001459 3300031241 Bacteria 16619
651 Ga0265339_10116551 3300031249 Bacteria 1377
652 Ga0265339_10125533 3300031249 Bacteria 1316
653 Ga0265331_10012884 3300031250 Bacteria 4511
654 Ga0265331_10067340 3300031250 Bacteria 1680
655 Ga0265316_10024414 3300031344 Bacteria 5066
656 Ga0265316_10116509 3300031344 Bacteria 2020
657 Ga0265316_10513478 3300031344 Bacteria 855
658 Ga0307513_10661536 3300031456 Bacteria 751
659 Ga0307513_10710277 3300031456 Bacteria 711
660 Ga0307509_10043479 3300031507 Bacteria 4862
661 Ga0307509_10111569 3300031507 Bacteria 2737
662 Ga0307408_100297283 3300031548 Bacteria 1351
663 Ga0307408_100478711 3300031548 Bacteria 1086
664 Ga0265313_10053430 3300031595 Bacteria 1923
665 Ga0307508_10433683 3300031616 Bacteria 906
666 Ga0307508_10470827 3300031616 Bacteria 850
667 Ga0307508_10474521 3300031616 Bacteria 844
668 Ga0307508_10481546 3300031616 Bacteria 835
669 Ga0265314_10002371 3300031711 Bacteria 19414
670 Ga0265342_10046188 3300031712 Bacteria 2618
671 Ga0265342_10255286 3300031712 Bacteria 934
672 Ga0307516_10009732 3300031730 Bacteria 10665
673 Ga0307516_10149556 3300031730 Bacteria 2097
674 Ga0307516_10244301 3300031730 Bacteria 1492
675 Ga0307407_10272742 3300031903 Bacteria 1168
676 Ga0307412_10245600 3300031911 Bacteria 1387
677 Ga0307409_100422445 3300031995 Bacteria 1279
678 Ga0307415_100358307 3300032126 Bacteria 1231
679 Ga0307507_10086856 3300033179 Bacteria 2708
680 Ga0307510_10004554 3300033180 Bacteria 16321
681 Ga0307510_10009746 3300033180 Bacteria 11432
682 Ga0307510_10048002 3300033180 Bacteria 4562
683 Ga0307510_10050493 3300033180 Bacteria 4411
684 Ga0315911_1000009 3300033442 Bacteria 379354
685 Ga0316215_1006418 3300033544 Bacteria 1140
686 Ga0373930_0069732 3300034816 Bacteria 797
687 Ga0373928_0222476 3300035084 Bacteria 553
688 Ga0373934_0015478 3300035086 Bacteria 2894
689 Ga0373934_0160854 3300035086 Bacteria 921
690 Ga0373940_0012311 3300035088 Bacteria 2048
691 Ga0373944_0125234 3300035089 Bacteria 889
692 Ga0373949_0091805 3300035090 Bacteria 822
693 Ga0373952_0008165 3300035092 Bacteria 1981
694 Ga0373952_0073418 3300035092 Bacteria 860
695 Ga0373923_0051235 3300035111 Bacteria 1731
696 Ga0373923_0051523 3300035111 Bacteria 1727
697 Ga0373936_0089725 3300035113 Bacteria 1288
698 Ga0373945_0021136 3300035116 Bacteria 2234
699 Ga0373953_0002753 3300035117 Bacteria 5341
700 Ga0373953_0069543 3300035117 Bacteria 1450
701 Ga0373953_0366716 3300035117 Bacteria 632
702 Ga0373954_0045183 3300035118 Bacteria 2057
703 Ga0373954_0046329 3300035118 Bacteria 2032
704 Ga0373954_0089602 3300035118 Bacteria 1476
705 Ga0373954_0185056 3300035118 Bacteria 1022
706 Ga0373956_0001884 3300035119 Bacteria 8647
707 Ga0373957_0000200 3300035120 Bacteria 15408
708 Ga0373957_0529496 3300035120 Bacteria 514
709 Ga0373943_0150435 3300035170 Bacteria 1261
710 Ga0373943_0513366 3300035170 Bacteria 701
711 Ga0373946_0124782 3300035171 Bacteria 1179
712 Ga0373955_0005004 3300035172 Bacteria 5921
713 Ga0373955_0028493 3300035172 Bacteria 2895
714 Ga0373942_0033816 3300035207 Bacteria 1365
715 Ga0373962_0178067 3300035242 Bacteria 710
716 Ga0373924_0006349 3300035410 Bacteria 4233
717 Ga0373931_0004494 3300035691 Bacteria 6377
718 Ga0373931_0216727 3300035691 Bacteria 1151
719 Ga0373935_0042994 3300035692 Bacteria 2842
720 Ga0373935_0082494 3300035692 Bacteria 2092
721 Ga0373935_0109527 3300035692 Bacteria 1831
722 Ga0373927_0026102 3300035695 Bacteria 3817
723 Ga0373927_0084944 3300035695 Bacteria 2053
724 Ga0373927_0128333 3300035695 Bacteria 1656
725 Ga0373927_0180331 3300035695 Bacteria 1385
726 Ga0373933_0022657 3300035724 Bacteria 3579
727 Ga0373933_0031995 3300035724 Bacteria 3055
728 Ga0373933_0773427 3300035724 Bacteria 632
729 Ga0373947_0017146 3300035725 Bacteria 4164
730 Ga0373947_0168552 3300035725 Bacteria 1420
731 Ga0373947_0253866 3300035725 Bacteria 1163
732 Ga0373947_0464391 3300035725 Bacteria 858
733 Ga0373947_0639787 3300035725 Bacteria 725
734 Ga0310104_03485 3300036242 Bacteria 1360
735 Ga0373937_0014785 3300036401 Bacteria 6891
736 Ga0373937_0036239 3300036401 Bacteria 4494
737 Ga0373937_0054734 3300036401 Bacteria 3662
738 Ga0373937_0767649 3300036401 Bacteria 911
739 Ga0372808_005034 3300036459 Bacteria 1722
740 Ga0373925_0043776 3300037068 Bacteria 3323
741 Ga0373925_0123549 3300037068 Bacteria 2012
742 Ga0373925_0204767 3300037068 Bacteria 1570
743 Ga0373925_0257427 3300037068 Bacteria 1401
744 Ga0373925_0328933 3300037068 Bacteria 1238
745 Ga0373925_0573898 3300037068 Bacteria 928
746 Ga0373925_0671226 3300037068 Bacteria 854
747 Ga0395900_0002922 3300037418 Bacteria 18612
748 Ga0395900_0428366 3300037418 Bacteria 1283
749 Ga0395900_1659015 3300037418 Bacteria 550
750 Ga0395898_0117507 3300037466 Bacteria 2548
751 Ga0395898_0136329 3300037466 Bacteria 2350
752 Ga0395898_0330553 3300037466 Bacteria 1453
753 Ga0395905_0008568 3300037471 Bacteria 10082
754 Ga0395905_0053544 3300037471 Bacteria 3777
755 Ga0395905_1211612 3300037471 Bacteria 658
756 Ga0436364_0243149 3300037853 Bacteria 1129
757 Ga0436364_0326406 3300037853 Bacteria 9677
758 Ga0395901_0062170 3300038443 Bacteria 3886
759 Ga0395901_0116181 3300038443 Bacteria 2811
760 Ga0395901_0822767 3300038443 Bacteria 916
761 Ga0436365_0712770 3300039437 Bacteria 2536
762 Ga0436365_1408544 3300039437 Bacteria 3153
763 Ga0436365_1587325 3300039437 Bacteria 554
764 Ga0436365_1694566 3300039437 Bacteria 2526
765 Ga0436360_0062375 3300039438 Bacteria 923
766 Ga0436360_0288357 3300039438 Bacteria 2373
767 Ga0436361_1160317 3300039447 Bacteria 1732
768 Ga0436363_0616419 3300039450 Bacteria 1033
769 Ga0436363_0674671 3300039450 Bacteria 1298
770 Ga0436363_0928946 3300039450 Bacteria 632
771 Ga0451789_1044976 3300041443 Bacteria 500
772 Ga0451791_0535527 3300041451 Bacteria 607
773 Ga0451793_0481979 3300041452 Bacteria 644
774 Ga0451793_1831426 3300041452 Bacteria 1445
775 Ga0451797_0276797 3300041453 Bacteria 799
776 Ga0451797_1068329 3300041453 Bacteria 1235
777 Ga0451795_0062024 3300041456 Bacteria 562
778 Ga0451795_1072685 3300041456 Bacteria 589
779 Ga0451795_1432725 3300041456 Bacteria 555
780 Ga0451802_0754618 3300041460 Bacteria 931
781 Ga0451807_0740528 3300041486 Bacteria 581
782 Ga0451807_2768343 3300041486 Bacteria 610
783 Ga0451835_0414532 3300041492 Bacteria 857
784 Ga0451837_1123549 3300041494 Bacteria 1188
785 Ga0451845_0348542 3300041501 Bacteria 975
786 Ga0451847_0288977 3300041503 Bacteria 503
787 Ga0451849_1171485 3300041505 Bacteria 572
788 Ga0451843_0960431 3300041509 Bacteria 734
789 Ga0451855_0132121 3300041511 Bacteria 1988
790 Ga0451853_0403605 3300041512 Bacteria 585
791 Ga0439459_0022833 3300042438 Bacteria 1214
792 Ga0466969_0138052 3300044656 Bacteria 1128
793 Ga0466972_0000465 3300044658 Bacteria 20617
794 Ga0466972_0018329 3300044658 Bacteria 3498
795 Ga0466972_0228571 3300044658 Bacteria 870
796 Ga0466965_0761563 3300044683 Bacteria 558
797 Ga0466966_0182565 3300044684 Bacteria 1273
798 Ga0466961_0000366 3300044693 Bacteria 29235
799 Ga0466961_0266891 3300044693 Bacteria 1049
800 Ga0466963_0004594 3300044694 Bacteria 8038
801 Ga0466963_0037426 3300044694 Bacteria 3168
802 Ga0466964_0404466 3300044706 Bacteria 714
803 Ga0466964_0718109 3300044706 Bacteria 558
804 Ga0466968_0004579 3300044735 Bacteria 5172
805 Ga0466968_0044827 3300044735 Bacteria 1875
806 Ga0466968_0219701 3300044735 Bacteria 895
807 Ga0466968_0236576 3300044735 Bacteria 864
808 Ga0466970_0087681 3300044765 Bacteria 1688
809 Ga0466970_0203228 3300044765 Bacteria 1103
810 Ga0466957_0115195 3300044842 Bacteria 1708
811 Ga0466957_0493296 3300044842 Bacteria 848
812 Ga0466960_0114897 3300044901 Bacteria 1403
813 Ga0466960_0483981 3300044901 Bacteria 723
814 Ga0466959_0002745 3300045049 Bacteria 11338
815 Ga0466959_0096611 3300045049 Bacteria 2118
816 Ga0466959_0155138 3300045049 Bacteria 1612
817 Ga0466967_0047144 3300045976 Bacteria 3756
818 Ga0466967_0168058 3300045976 Bacteria 2062
819 Ga0466967_0803791 3300045976 Bacteria 934
820 Ga0495617_213296 3300046452 Bacteria 601
821 Ga0495592_0002897 3300046454 Bacteria 12205
822 Ga0495592_0124744 3300046454 Bacteria 1808
823 Ga0495592_0150404 3300046454 Bacteria 1610
824 Ga0495603_0016547 3300046455 Bacteria 4462
825 Ga0495603_0031419 3300046455 Bacteria 3196
826 Ga0495603_0101068 3300046455 Bacteria 1683
827 Ga0495603_0388618 3300046455 Bacteria 800
828 Ga0495603_0486554 3300046455 Bacteria 707
829 Ga0495590_0337869 3300046457 Bacteria 571
830 Ga0495629_0064923 3300046459 Bacteria 2548
831 Ga0495629_0129488 3300046459 Bacteria 1758
832 Ga0495629_0219080 3300046459 Bacteria 1313
833 Ga0495638_0018849 3300046460 Bacteria 4575
834 Ga0495638_0074041 3300046460 Bacteria 2077
835 Ga0495638_0221135 3300046460 Bacteria 1058
836 Ga0495651_0001183 3300046462 Bacteria 20142
837 Ga0495651_0027081 3300046462 Bacteria 4465
838 Ga0495651_0193645 3300046462 Bacteria 1428
839 Ga0495651_0465031 3300046462 Bacteria 815
840 Ga0495653_0066003 3300046463 Bacteria 2722
841 Ga0495580_0021678 3300046472 Bacteria 4738
842 Ga0495582_0157122 3300046473 Bacteria 1292
843 Ga0495582_0173382 3300046473 Bacteria 1228
844 Ga0495582_0260536 3300046473 Bacteria 995
845 Ga0495639_0283323 3300046475 Bacteria 824
846 Ga0495639_0744274 3300046475 Bacteria 507
847 Ga0495662_0410640 3300046476 Bacteria 665
848 Ga0495664_0007504 3300046477 Bacteria 6062
849 Ga0495664_0010508 3300046477 Bacteria 5194
850 Ga0495664_0061043 3300046477 Bacteria 2245
851 Ga0495664_0416668 3300046477 Bacteria 806
852 Ga0495584_0087161 3300046491 Bacteria 1573
853 Ga0495584_0095500 3300046491 Bacteria 1501
854 Ga0495584_0100078 3300046491 Bacteria 1465
855 Ga0495584_0109102 3300046491 Bacteria 1400
856 Ga0495584_0217539 3300046491 Bacteria 971
857 Ga0495584_0350908 3300046491 Bacteria 749
858 Ga0495594_0111688 3300046499 Bacteria 1541
859 Ga0495594_0246695 3300046499 Bacteria 1017
860 Ga0495596_0266892 3300046500 Bacteria 664
861 Ga0495583_0126717 3300046506 Bacteria 1071
862 Ga0495606_0116860 3300046507 Bacteria 1601
863 Ga0495606_0141205 3300046507 Bacteria 1422
864 Ga0495606_0366619 3300046507 Bacteria 760
865 Ga0495606_0512640 3300046507 Bacteria 603
866 Ga0495606_0518053 3300046507 Bacteria 599
867 Ga0495606_0586742 3300046507 Bacteria 549
868 Ga0495608_0017985 3300046511 Bacteria 4883
869 Ga0495610_0061518 3300046512 Bacteria 1783
870 Ga0495616_0271533 3300046513 Bacteria 723
871 Ga0495616_0322104 3300046513 Bacteria 649
872 Ga0495618_0397787 3300046514 Bacteria 843
873 Ga0495620_0027074 3300046515 Bacteria 2688
874 Ga0495620_0033852 3300046515 Bacteria 2315
875 Ga0495628_0238409 3300046516 Bacteria 1361
876 Ga0495630_0107347 3300046517 Bacteria 2115
877 Ga0495630_0849392 3300046517 Bacteria 696
878 Ga0495631_0083502 3300046518 Bacteria 1376
879 Ga0495631_0184737 3300046518 Bacteria 893
880 Ga0495631_0400626 3300046518 Bacteria 584
881 Ga0495631_0417531 3300046518 Bacteria 571
882 Ga0495632_0116801 3300046519 Bacteria 1249
883 Ga0495643_0008653 3300046522 Bacteria 6422
884 Ga0495643_0058784 3300046522 Bacteria 2045
885 Ga0495643_0443470 3300046522 Bacteria 566
886 Ga0495648_0002079 3300046524 Bacteria 18947
887 Ga0495648_0004572 3300046524 Bacteria 11787
888 Ga0495648_0039173 3300046524 Bacteria 3019
889 Ga0495648_0190190 3300046524 Bacteria 1036
890 Ga0495666_0076926 3300046526 Bacteria 1582
891 Ga0495652_0023007 3300046529 Bacteria 5526
892 Ga0495652_0120252 3300046529 Bacteria 2096
893 Ga0495652_0196823 3300046529 Bacteria 1533
894 Ga0495652_0560670 3300046529 Bacteria 784
895 Ga0495654_0025118 3300046530 Bacteria 3071
896 Ga0495665_0007540 3300046531 Bacteria 5890
897 Ga0495665_0477316 3300046531 Bacteria 629
898 Ga0495640_0005616 3300046533 Bacteria 9978
899 Ga0495640_0192589 3300046533 Bacteria 1295
900 Ga0495640_0364683 3300046533 Bacteria 890
901 Ga0495586_0100571 3300046535 Bacteria 1604
902 Ga0495587_0004094 3300046536 Bacteria 9650
903 Ga0495587_0025519 3300046536 Bacteria 3611
904 Ga0495587_0292503 3300046536 Bacteria 912
905 Ga0495609_0434335 3300046538 Bacteria 523
906 Ga0495621_0131062 3300046539 Bacteria 975
907 Ga0495621_0369815 3300046539 Bacteria 604
908 Ga0495597_0048627 3300046542 Bacteria 1876
909 Ga0495645_0013424 3300046543 Bacteria 5791
910 Ga0495645_0060122 3300046543 Bacteria 2755
911 Ga0495645_0128923 3300046543 Bacteria 1775
912 Ga0495645_0541658 3300046543 Bacteria 722
913 Ga0495622_0008839 3300046557 Bacteria 4663
914 Ga0495622_0124130 3300046557 Bacteria 1178
915 Ga0495633_0086679 3300046558 Bacteria 1456
916 Ga0495633_0500550 3300046558 Bacteria 548
917 Ga0495667_0009980 3300046559 Bacteria 6430
918 Ga0495667_0131901 3300046559 Bacteria 1611
919 Ga0495656_0239858 3300046615 Bacteria 912
920 Ga0495656_0386857 3300046615 Bacteria 730
921 Ga0495668_0117761 3300046616 Bacteria 1453
922 Ga0495668_0144734 3300046616 Bacteria 1301
923 Ga0495668_0153470 3300046616 Bacteria 1261
924 Ga0495668_0370538 3300046616 Bacteria 786
925 Ga0495668_0410025 3300046616 Bacteria 745
926 Ga0495668_0556326 3300046616 Bacteria 633
927 Ga0495668_0804889 3300046616 Bacteria 520
928 Ga0495634_0019165 3300046642 Bacteria 4863
929 Ga0495634_0030090 3300046642 Bacteria 3753
930 Ga0495634_0034579 3300046642 Bacteria 3467
931 Ga0495634_0116016 3300046642 Bacteria 1718
932 Ga0495634_0174787 3300046642 Bacteria 1348
933 Ga0495611_0085823 3300046648 Bacteria 1452
934 Ga0495625_0029775 3300046660 Bacteria 4080
935 Ga0495625_0178398 3300046660 Bacteria 1414
936 Ga0495625_0400645 3300046660 Bacteria 857
937 Ga0495625_0613134 3300046660 Bacteria 652
938 Ga0495635_0001058 3300046663 Bacteria 18230
939 Ga0495635_0002199 3300046663 Bacteria 13260
940 Ga0495661_0133148 3300046665 Bacteria 1360
941 Ga0495661_0220214 3300046665 Bacteria 984
942 Ga0495657_0011029 3300046675 Bacteria 6776
943 Ga0495657_0011523 3300046675 Bacteria 6606
944 Ga0495657_0014422 3300046675 Bacteria 5801
945 Ga0495657_0439712 3300046675 Bacteria 764
946 Ga0495657_0853520 3300046675 Bacteria 519
947 Ga0495599_0082999 3300046678 Bacteria 2001
948 Ga0495599_0095311 3300046678 Bacteria 1856
949 Ga0495599_0257471 3300046678 Bacteria 1061
950 Ga0495599_0441992 3300046678 Bacteria 771
951 Ga0495623_0018971 3300046679 Bacteria 4440
952 Ga0495623_0043429 3300046679 Bacteria 2860
953 Ga0495623_0142637 3300046679 Bacteria 1423
954 Ga0495623_0153410 3300046679 Bacteria 1359
955 Ga0495646_0000934 3300046680 Bacteria 16609
956 Ga0495646_0076971 3300046680 Bacteria 1952
957 Ga0495646_0242207 3300046680 Bacteria 969
958 Ga0495647_0114158 3300046681 Bacteria 1130
959 Ga0495658_0038455 3300046683 Bacteria 2650
960 Ga0495658_0101562 3300046683 Bacteria 1718
961 Ga0495658_0759005 3300046683 Bacteria 621
962 Ga0495669_0071530 3300046684 Bacteria 1582
963 Ga0495669_0102379 3300046684 Bacteria 1331
964 Ga0495613_0044384 3300046689 Bacteria 3289
965 Ga0495613_0060313 3300046689 Bacteria 2779
966 Ga0495624_0038211 3300046690 Bacteria 3085
967 Ga0495624_0323741 3300046690 Bacteria 928
968 Ga0495624_0371965 3300046690 Bacteria 859
969 Ga0495670_0379468 3300046691 Bacteria 763
970 Ga0495671_0041406 3300046692 Bacteria 2319
971 Ga0495671_0052466 3300046692 Bacteria 2027
972 Ga0495671_0246860 3300046692 Bacteria 862
973 Ga0495649_0246153 3300046694 Bacteria 919
974 Ga0495649_0332373 3300046694 Bacteria 770
975 Ga0495589_0561386 3300046794 Bacteria 520
976 Ga0495600_0007371 3300046809 Bacteria 6726
977 Ga0495600_0012798 3300046809 Bacteria 5255
978 Ga0495581_0030696 3300047315 Bacteria 3113
979 Ga0495581_0155785 3300047315 Bacteria 1335
980 Ga0495604_0002274 3300047317 Bacteria 15383
981 Ga0495604_0075423 3300047317 Bacteria 2539
982 Ga0495604_0079461 3300047317 Bacteria 2459
983 Ga0495604_0111985 3300047317 Bacteria 1989
984 Ga0495604_0119190 3300047317 Bacteria 1912
985 Ga0495604_0155781 3300047317 Bacteria 1618
986 Ga0495604_0874925 3300047317 Bacteria 562
987 Ga0495674_0087619 3300047319 Bacteria 2664
988 Ga0495674_0091722 3300047319 Bacteria 2594
989 Ga0495674_0140758 3300047319 Bacteria 2028
990 Ga0495674_1192249 3300047319 Bacteria 576
991 Ga0495672_0025437 3300047320 Bacteria 3788
992 Ga0495672_0326863 3300047320 Bacteria 719
993 Ga0495676_0457552 3300047321 Bacteria 841
994 Ga0495676_0738591 3300047321 Bacteria 636
995 Ga0495680_0001595 3300047322 Bacteria 24172
996 Ga0495680_0020992 3300047322 Bacteria 5475
997 Ga0495680_0280875 3300047322 Bacteria 1173
998 Ga0495687_056061 3300047443 Bacteria 1645
999 Ga0495675_0004307 3300047444 Bacteria 8610
1000 Ga0495675_0017231 3300047444 Bacteria 4577
1001 Ga0495675_0521181 3300047444 Bacteria 680
1002 Ga0495685_095510 3300047447 Bacteria 983
1003 Ga0495673_0179709 3300047469 Bacteria 802
1004 Ga0495684_0015313 3300047471 Bacteria 5906
1005 Ga0495684_0016173 3300047471 Bacteria 5745
1006 Ga0495684_0046854 3300047471 Bacteria 3307
1007 Ga0495684_0065648 3300047471 Bacteria 2759
1008 Ga0495686_0083696 3300047472 Bacteria 1945
1009 Ga0495686_0310224 3300047472 Bacteria 868
1010 Ga0495686_0545627 3300047472 Bacteria 606
1011 Ga0495593_0007370 3300047673 Bacteria 6445
1012 Ga0495593_0038125 3300047673 Bacteria 2596
1013 Ga0495593_0094177 3300047673 Bacteria 1541
1014 Ga0495602_0023337 3300048088 Bacteria 6029
1015 Ga0495602_0115407 3300048088 Bacteria 2172
1016 Ga0495602_0123311 3300048088 Bacteria 2080
1017 Ga0495602_0734926 3300048088 Bacteria 667
1018 Ga0496100_0013579 3300048903 Bacteria 4703
1019 Ga0496100_0301952 3300048903 Bacteria 1198
1020 Ga0496100_0324962 3300048903 Bacteria 1156
1021 Ga0496100_0384937 3300048903 Bacteria 1066
1022 Ga0496101_0004886 3300048904 Bacteria 8508
1023 Ga0496101_0033122 3300048904 Bacteria 3643
1024 Ga0496101_0126230 3300048904 Bacteria 1939
1025 Ga0496101_0208392 3300048904 Bacteria 1513
1026 Ga0496101_0220684 3300048904 Bacteria 1471
1027 Ga0496101_1182723 3300048904 Bacteria 599
1028 Ga0496101_1448243 3300048904 Bacteria 535
1029 Ga0496102_0012642 3300048905 Bacteria 7310
1030 Ga0496102_0061059 3300048905 Bacteria 3449
1031 Ga0496102_0180783 3300048905 Bacteria 1987
1032 Ga0496102_0219217 3300048905 Bacteria 1793
1033 Ga0496102_0703514 3300048905 Bacteria 933
1034 Ga0496102_1418411 3300048905 Bacteria 613
1035 Ga0496103_0038684 3300048906 Bacteria 2928
1036 Ga0496103_0301794 3300048906 Bacteria 1030
1037 Ga0496103_0348816 3300048906 Bacteria 952
1038 Ga0496104_0020012 3300048907 Bacteria 6129
1039 Ga0496104_0022766 3300048907 Bacteria 5755
1040 Ga0496104_0074007 3300048907 Bacteria 3242
1041 Ga0496104_0263653 3300048907 Bacteria 1635
1042 Ga0496104_0819283 3300048907 Bacteria 837
1043 Ga0496105_0024293 3300048908 Bacteria 4924
1044 Ga0496105_0027000 3300048908 Bacteria 4686
1045 Ga0496105_0031039 3300048908 Bacteria 4380
1046 Ga0496105_0056915 3300048908 Bacteria 3228
1047 Ga0496105_0154296 3300048908 Bacteria 1886
1048 Ga0496105_0364340 3300048908 Bacteria 1152
1049 Ga0496105_0484394 3300048908 Bacteria 973
1050 Ga0496106_0000501 3300048909 Bacteria 27744
1051 Ga0496106_0003078 3300048909 Bacteria 12442
1052 Ga0496106_0014048 3300048909 Bacteria 5918
1053 Ga0496106_0130575 3300048909 Bacteria 1970
1054 Ga0496106_0151061 3300048909 Bacteria 1832
1055 Ga0496106_0237543 3300048909 Bacteria 1456
1056 Ga0496106_0260976 3300048909 Bacteria 1386
1057 Ga0496106_0575394 3300048909 Bacteria 903
1058 Ga0496106_1432746 3300048909 Bacteria 533
1059 Ga0496107_0006040 3300048910 Bacteria 8308
1060 Ga0496107_0075070 3300048910 Bacteria 2460
1061 Ga0496107_0175743 3300048910 Bacteria 1590
1062 Ga0496107_0700981 3300048910 Bacteria 745
1063 Ga0496108_0024615 3300048911 Bacteria 4957
1064 Ga0496108_1168535 3300048911 Bacteria 652
1065 Ga0496108_1314962 3300048911 Bacteria 608
1066 Ga0496108_1566029 3300048911 Bacteria 546
1067 Ga0496109_0000607 3300048912 Bacteria 29944
1068 Ga0496109_0033152 3300048912 Bacteria 4646
1069 Ga0496109_0095832 3300048912 Bacteria 2748
1070 Ga0496109_0220608 3300048912 Bacteria 1783
1071 Ga0496109_1139874 3300048912 Bacteria 717
1072 Ga0496110_0024161 3300048913 Bacteria 5176
1073 Ga0496110_0174904 3300048913 Bacteria 1948
1074 Ga0496110_0372904 3300048913 Bacteria 1300
1075 Ga0496110_0451001 3300048913 Bacteria 1172
1076 Ga0496111_0018238 3300048914 Bacteria 4860
1077 Ga0496111_0092813 3300048914 Bacteria 2213
1078 Ga0496111_0117826 3300048914 Bacteria 1960
1079 Ga0496111_0423681 3300048914 Bacteria 983
1080 Ga0496111_0609522 3300048914 Bacteria 799
1081 Ga0496111_0737202 3300048914 Bacteria 715
1082 Ga0496112_0025348 3300048915 Bacteria 5695
1083 Ga0496112_0042417 3300048915 Bacteria 4451
1084 Ga0496112_0065599 3300048915 Bacteria 3583
1085 Ga0496112_0075320 3300048915 Bacteria 3338
1086 Ga0496112_0154960 3300048915 Bacteria 2258
1087 Ga0496113_0062718 3300048916 Bacteria 2808
1088 Ga0496113_0079460 3300048916 Bacteria 2511
1089 Ga0496113_0117397 3300048916 Bacteria 2077
1090 Ga0496113_0486911 3300048916 Bacteria 991
1091 Ga0496113_1170086 3300048916 Bacteria 601
1092 Ga0496114_0010129 3300048917 Bacteria 7499
1093 Ga0496114_0279763 3300048917 Bacteria 1471
1094 Ga0496114_1580797 3300048917 Bacteria 544
1095 Ga0496115_0009019 3300048918 Bacteria 7400
1096 Ga0496115_0038929 3300048918 Bacteria 3776
1097 Ga0496115_0049091 3300048918 Bacteria 3377
1098 Ga0496115_0091716 3300048918 Bacteria 2483
1099 Ga0496115_0129663 3300048918 Bacteria 2078
1100 Ga0496115_0501600 3300048918 Bacteria 975
1101 Ga0496116_0036964 3300048919 Bacteria 3411
1102 Ga0496116_0168176 3300048919 Bacteria 1192
1103 Ga0496117_0037664 3300048920 Bacteria 3599
1104 Ga0496117_0055971 3300048920 Bacteria 2751
1105 Ga0496117_0182726 3300048920 Bacteria 1203
1106 Ga0496117_0191195 3300048920 Bacteria 1166
1107 Ga0496118_0005152 3300048921 Bacteria 14978
1108 Ga0496118_0012116 3300048921 Bacteria 8323
1109 Ga0496118_0166614 3300048921 Bacteria 1353
1110 Ga0496118_0266811 3300048921 Bacteria 962
1111 Ga0496118_0364382 3300048921 Bacteria 765
1112 Ga0496118_0402311 3300048921 Bacteria 711
1113 Ga0496119_0026902 3300048922 Bacteria 3973
1114 Ga0496119_0074232 3300048922 Bacteria 1981
1115 Ga0496119_0092035 3300048922 Bacteria 1721
1116 Ga0496119_0199268 3300048922 Bacteria 1037
1117 Ga0496120_0038951 3300048923 Bacteria 2809
1118 Ga0496120_0104950 3300048923 Bacteria 1486
1119 Ga0496120_0417887 3300048923 Bacteria 589
1120 Ga0496121_0001291 3300048924 Bacteria 43108
1121 Ga0496121_0026502 3300048924 Bacteria 5460
1122 Ga0496121_0029660 3300048924 Bacteria 5049
1123 Ga0496121_0054618 3300048924 Bacteria 3335
1124 Ga0496121_0056308 3300048924 Bacteria 3266
1125 Ga0496121_0087766 3300048924 Bacteria 2440
1126 Ga0496121_0106571 3300048924 Bacteria 2148
1127 Ga0496121_0123204 3300048924 Bacteria 1954
1128 Ga0496121_0143570 3300048924 Bacteria 1767
1129 Ga0496121_0331337 3300048924 Bacteria 1021
1130 Ga0496121_0333018 3300048924 Bacteria 1017
1131 Ga0496121_0480251 3300048924 Bacteria 794
1132 Ga0496121_0494450 3300048924 Bacteria 778
1133 Ga0496121_0695438 3300048924 Bacteria 613
1134 Ga0496121_0728812 3300048924 Bacteria 592
1135 Ga0496121_0804704 3300048924 Bacteria 552
1136 Ga0496122_0011608 3300048925 Bacteria 8893
1137 Ga0496122_0203625 3300048925 Bacteria 1154
1138 Ga0496122_0293427 3300048925 Bacteria 881
1139 Ga0496123_0154688 3300048926 Bacteria 1231
1140 Ga0496123_0315587 3300048926 Bacteria 740
1141 Ga0496124_0001238 3300048927 Bacteria 39220
1142 Ga0496124_0096808 3300048927 Bacteria 2397
1143 Ga0496124_0149863 3300048927 Bacteria 1831
1144 Ga0496124_0150343 3300048927 Bacteria 1827
1145 Ga0496124_0762197 3300048927 Bacteria 605
1146 Ga0496125_0000092 3300048928 Bacteria 211050
1147 Ga0496125_0010601 3300048928 Bacteria 9309
1148 Ga0496125_0036783 3300048928 Bacteria 4267
1149 Ga0496125_0049975 3300048928 Bacteria 3467
1150 Ga0496125_0056729 3300048928 Bacteria 3178
1151 Ga0496125_0128520 3300048928 Bacteria 1789
1152 Ga0496125_0171121 3300048928 Bacteria 1460
1153 Ga0496125_0178860 3300048928 Bacteria 1416
1154 Ga0496125_0253283 3300048928 Bacteria 1109
1155 Ga0496125_0464075 3300048928 Bacteria 722
1156 Ga0496125_0636384 3300048928 Bacteria 576
1157 Ga0496126_0003590 3300048929 Bacteria 19439
1158 Ga0496126_0004961 3300048929 Bacteria 15521
1159 Ga0496126_0011777 3300048929 Bacteria 9005
1160 Ga0496126_0026581 3300048929 Bacteria 5546
1161 Ga0496126_0040306 3300048929 Bacteria 4330
1162 Ga0496126_0049105 3300048929 Bacteria 3853
1163 Ga0496126_0114342 3300048929 Bacteria 2348
1164 Ga0496126_0178987 3300048929 Bacteria 1802
1165 Ga0496126_0226489 3300048929 Bacteria 1568
1166 Ga0496126_0299710 3300048929 Bacteria 1327
1167 Ga0496126_0319546 3300048929 Bacteria 1276
1168 Ga0496126_0342477 3300048929 Bacteria 1224
1169 Ga0496126_0392003 3300048929 Bacteria 1128
1170 Ga0496126_0479065 3300048929 Bacteria 997
1171 Ga0496126_0535824 3300048929 Bacteria 931
1172 Ga0496126_0537433 3300048929 Bacteria 929
1173 Ga0496126_0551668 3300048929 Bacteria 914
1174 Ga0496126_0581783 3300048929 Bacteria 884
1175 Ga0496126_0728904 3300048929 Bacteria 767
1176 Ga0496126_0743122 3300048929 Bacteria 758
1177 Ga0496126_0875188 3300048929 Bacteria 683
1178 Ga0496126_1057997 3300048929 Bacteria 605
1179 Ga0496126_1268002 3300048929 Bacteria 538
1180 Ga0501031_0249901 3300049568 Bacteria 1152
1181 Ga0501032_0530023 3300049569 Bacteria 752
1182 Ga0501033_0720908 3300049570 Bacteria 677
1183 Ga0501034_0036800 3300049571 Bacteria 4956
1184 Ga0501034_0063299 3300049571 Bacteria 3713
1185 Ga0501034_0310037 3300049571 Bacteria 1513
1186 Ga0501034_0820870 3300049571 Bacteria 821
1187 Ga0501036_0070788 3300049572 Bacteria 2949
1188 Ga0501036_0872669 3300049572 Bacteria 739
1189 Ga0501037_0100474 3300049573 Bacteria 2088
1190 Ga0501037_0176199 3300049573 Bacteria 1518
1191 Ga0501038_0004223 3300049574 Bacteria 13348
1192 Ga0501038_0004908 3300049574 Bacteria 12426
1193 Ga0501038_0051879 3300049574 Bacteria 3537
1194 Ga0501039_0163739 3300049575 Bacteria 1748
1195 Ga0501039_0503905 3300049575 Bacteria 950
1196 Ga0501039_0534060 3300049575 Bacteria 920
1197 Ga0501040_0075435 3300049576 Bacteria 2330
1198 Ga0501040_0410826 3300049576 Bacteria 972
1199 Ga0501041_0114700 3300049577 Bacteria 1673
1200 Ga0501042_0008276 3300049578 Bacteria 6854
1201 Ga0501043_0008239 3300049579 Bacteria 8214
1202 Ga0501043_0234816 3300049579 Bacteria 1415
1203 Ga0501043_0361846 3300049579 Bacteria 1101
1204 Ga0501046_0213472 3300049580 Bacteria 1431
1205 Ga0501047_0041815 3300049581 Bacteria 4428
1206 Ga0501047_0188735 3300049581 Bacteria 1925
1207 Ga0501047_1342315 3300049581 Bacteria 529
1208 Ga0501048_0008490 3300049582 Bacteria 7765
1209 Ga0501048_0379263 3300049582 Bacteria 1010
1210 Ga0501067_0002243 3300049583 Bacteria 10668
1211 Ga0501068_0149491 3300049584 Bacteria 1467
1212 Ga0501069_0016220 3300049585 Bacteria 3997
1213 Ga0501070_0011932 3300049586 Bacteria 7340
1214 Ga0501070_0441050 3300049586 Bacteria 1050
1215 Ga0501071_0414579 3300049587 Bacteria 1029
1216 Ga0501072_0057071 3300049588 Bacteria 3076
1217 Ga0501073_0094006 3300049589 Bacteria 2082
1218 Ga0501073_0134132 3300049589 Bacteria 1716
1219 Ga0501074_0000802 3300049590 Bacteria 19886
1220 Ga0501079_0010508 3300049741 Bacteria 7037
1221 Ga0501080_0017322 3300049742 Bacteria 6659
1222 Ga0501083_0005973 3300049744 Bacteria 8619
1223 Ga0501083_0801602 3300049744 Bacteria 613
1224 Ga0501035_0039707 3300049822 Bacteria 4258
1225 Ga0501035_0135271 3300049822 Bacteria 2146
1226 Ga0501044_0018546 3300049823 Bacteria 7456
1227 Ga0501044_0154009 3300049823 Bacteria 2279
1228 Ga0501045_0013471 3300049824 Bacteria 5775
1229 nmdc:mga03683_130126_c1 3300050489 Bacteria 1125
1230 nmdc:mga03683_214788_c1 3300050489 Bacteria 886
1231 nmdc:mga03683_64702_c1 3300050489 Bacteria 1552
1232 nmdc:mga03n38_14754_c1 3300050490 Bacteria 3003
1233 nmdc:mga03n38_147618_c1 3300050490 Bacteria 1180
1234 nmdc:mga03n38_225418_c1 3300050490 Bacteria 980
1235 nmdc:mga00v17_149961_c1 3300050491 Bacteria 1498
1236 nmdc:mga0yw44_106002_c1 3300050492 Bacteria 1796
1237 nmdc:mga0yw44_106378_c1 3300050492 Bacteria 1793
1238 nmdc:mga0yw44_120383_c1 3300050492 Bacteria 1690
1239 nmdc:mga0yw44_16105_c1 3300050492 Bacteria 4030
1240 nmdc:mga0yw44_268363_c1 3300050492 Bacteria 1139
1241 nmdc:mga0yw44_401629_c1 3300050492 Bacteria 927
1242 nmdc:mga0yw44_638244_c1 3300050492 Bacteria 724
1243 nmdc:mga0k408_120411_c1 3300050493 Bacteria 1554
1244 nmdc:mga0k408_174161_c1 3300050493 Bacteria 1283
1245 nmdc:mga0k408_232637_c1 3300050493 Bacteria 1100
1246 nmdc:mga0k408_327599_c1 3300050493 Bacteria 914
1247 nmdc:mga0k408_54832_c1 3300050493 Bacteria 2311
1248 nmdc:mga06z11_167677_c1 3300050494 Bacteria 1259
1249 nmdc:mga06z11_312782_c1 3300050494 Bacteria 936
1250 nmdc:mga06z11_373427_c1 3300050494 Bacteria 856
1251 nmdc:mga06z11_5269_c1 3300050494 Bacteria 5174
1252 nmdc:mga07m45_367100_c1 3300050496 Bacteria 836
1253 nmdc:mga07m45_4525_c1 3300050496 Bacteria 6809
1254 nmdc:mga05p37_174969_c1 3300050507 Bacteria 2615
1255 nmdc:mga08y16_1109593_c1 3300050511 Bacteria 766
1256 nmdc:mga0n895_484023_c1 3300050512 Bacteria 1248
1257 nmdc:mga08x19_488778_c1 3300050514 Bacteria 868
1258 nmdc:mga0sz30_100711_c1 3300050516 Bacteria 1262
1259 nmdc:mga0sz30_413337_c1 3300050516 Bacteria 605
1260 nmdc:mga0sz30_57216_c1 3300050516 Bacteria 962
1261 nmdc:mga0sz30_77783_c1 3300050516 Bacteria 1433
1262 Ga0495601_0015406 3300053077 Bacteria 4620
1263 Ga0495601_0016288 3300053077 Bacteria 4504
1264 Ga0495601_0526080 3300053077 Bacteria 762
1265 Ga0495601_0637574 3300053077 Bacteria 682
1266 Ga0500610_0287722 3300053079 Bacteria 733
1267 Ga0500635_0068970 3300053080 Bacteria 1250
1268 Ga0495655_0019265 3300053083 Bacteria 1513
1269 Ga0495655_0160756 3300053083 Bacteria 713
1270 Ga0495655_0303053 3300053083 Bacteria 549
1271 Ga0495595_0000335 3300053084 Bacteria 18133
1272 Ga0495595_0026690 3300053084 Bacteria 2567
1273 Ga0495595_0232091 3300053084 Bacteria 922
1274 Ga0495595_0554364 3300053084 Bacteria 587
1275 Ga0495619_0001292 3300053085 Bacteria 16456
1276 Ga0495619_0127621 3300053085 Bacteria 1747
1277 Ga0500578_0227955 3300053086 Bacteria 1130
1278 Ga0500643_000040 3300053087 Bacteria 168108
1279 Ga0500643_014119 3300053087 Bacteria 2790
1280 Ga0500644_0031257 3300053088 Bacteria 1691
1281 Ga0500581_258586 3300053089 Bacteria 724
1282 Ga0500647_0315650 3300053091 Bacteria 663
1283 Ga0500583_0141757 3300053092 Bacteria 1194
1284 Ga0500583_0202187 3300053092 Bacteria 987
1285 Ga0500583_0482640 3300053092 Bacteria 584
1286 Ga0500651_0003108 3300053093 Bacteria 8993
1287 Ga0500651_0316810 3300053093 Bacteria 891
1288 Ga0500651_0465797 3300053093 Bacteria 701
1289 Ga0500566_0000230 3300053094 Bacteria 29930
1290 Ga0500566_0000332 3300053094 Bacteria 25736
1291 Ga0500566_0011427 3300053094 Bacteria 5229
1292 Ga0500566_0179997 3300053094 Bacteria 1085
1293 Ga0500641_0021384 3300053096 Bacteria 2466
1294 Ga0500641_0113778 3300053096 Bacteria 1165
1295 Ga0500648_093476 3300053097 Bacteria 1681
1296 Ga0500648_157151 3300053097 Bacteria 1201
1297 Ga0500650_0028010 3300053098 Bacteria 2538
1298 Ga0500650_0113415 3300053098 Bacteria 1265
1299 Ga0500554_264146 3300053102 Bacteria 564
1300 Ga0500555_002003 3300053103 Bacteria 6011
1301 Ga0500555_125450 3300053103 Bacteria 639
1302 Ga0500569_029160 3300053109 Bacteria 1536
1303 Ga0500569_040307 3300053109 Bacteria 1364
1304 Ga0500572_028490 3300053111 Bacteria 1537
1305 Ga0500592_000477 3300053116 Bacteria 6663
1306 Ga0500592_004040 3300053116 Bacteria 2341
1307 Ga0500593_159797 3300053117 Bacteria 863
1308 Ga0500594_0031132 3300053118 Bacteria 1405
1309 Ga0500594_0119064 3300053118 Bacteria 828
1310 Ga0500595_000468 3300053119 Bacteria 24982
1311 Ga0500595_018935 3300053119 Bacteria 2507
1312 Ga0500595_085970 3300053119 Bacteria 915
1313 Ga0500595_100614 3300053119 Bacteria 828
1314 Ga0500607_228713 3300053121 Bacteria 765
1315 Ga0500608_000395 3300053122 Bacteria 16743
1316 Ga0500608_326497 3300053122 Bacteria 556
1317 Ga0500614_123950 3300053123 Bacteria 762
1318 Ga0500618_004648 3300053125 Bacteria 4325
1319 Ga0500618_031139 3300053125 Bacteria 1252
1320 Ga0500623_249849 3300053127 Bacteria 594
1321 Ga0500642_0000128 3300053130 Bacteria 34248
1322 Ga0500642_0160360 3300053130 Bacteria 1054
1323 Ga0500642_0255061 3300053130 Bacteria 804
1324 Ga0500652_000285 3300053131 Bacteria 18555
1325 Ga0500655_020750 3300053133 Bacteria 1229
1326 Ga0500658_0005983 3300053134 Bacteria 4522
1327 Ga0500658_0036152 3300053134 Bacteria 1958
1328 Ga0500658_0058503 3300053134 Bacteria 1596
1329 Ga0500658_0391449 3300053134 Bacteria 636
1330 Ga0500559_0000959 3300053136 Bacteria 18075
1331 Ga0500559_0009065 3300053136 Bacteria 4324
1332 Ga0500559_0042935 3300053136 Bacteria 1974
1333 Ga0500561_0024124 3300053137 Bacteria 1465
1334 Ga0500564_007088 3300053138 Bacteria 4730
1335 Ga0500568_0000741 3300053139 Bacteria 23280
1336 Ga0500568_0005161 3300053139 Bacteria 6809
1337 Ga0500568_0078915 3300053139 Bacteria 1252
1338 Ga0500573_0035584 3300053140 Bacteria 2873
1339 Ga0500577_0023967 3300053142 Bacteria 2046
1340 Ga0500586_002976 3300053145 Bacteria 3934
1341 Ga0500588_0249205 3300053146 Bacteria 666
1342 Ga0500589_067269 3300053147 Bacteria 1628
1343 Ga0500589_097143 3300053147 Bacteria 1286
1344 Ga0500590_119784 3300053148 Bacteria 1235
1345 Ga0500590_120403 3300053148 Bacteria 1230
1346 Ga0500603_001419 3300053150 Bacteria 5474
1347 Ga0500603_043302 3300053150 Bacteria 1209
1348 Ga0500603_182116 3300053150 Bacteria 661
1349 Ga0500604_0007792 3300053151 Bacteria 2838
1350 Ga0500604_0212605 3300053151 Bacteria 666
1351 Ga0500616_0000122 3300053153 Bacteria 140228
1352 Ga0500616_0016770 3300053153 Bacteria 4163
1353 Ga0500619_055454 3300053154 Bacteria 1292
1354 Ga0500619_157433 3300053154 Bacteria 772
1355 Ga0500620_010151 3300053155 Bacteria 2464
1356 Ga0500627_0005565 3300053158 Bacteria 4197
1357 Ga0500627_0126064 3300053158 Bacteria 1156
1358 Ga0500627_0477836 3300053158 Bacteria 521
1359 Ga0500634_0044424 3300053161 Bacteria 2405
1360 Ga0500638_002107 3300053162 Bacteria 6750
1361 Ga0500638_045751 3300053162 Bacteria 2123
1362 Ga0500638_122474 3300053162 Bacteria 1188
1363 Ga0500638_171331 3300053162 Bacteria 945
1364 Ga0500636_0000120 3300053177 Bacteria 41238
1365 Ga0500636_0006139 3300053177 Bacteria 6896
1366 Ga0500636_0095073 3300053177 Bacteria 1701
1367 Ga0500636_0116220 3300053177 Bacteria 1505
1368 Ga0500636_0183939 3300053177 Bacteria 1119
1369 Ga0500636_0321081 3300053177 Bacteria 752
1370 Ga0500637_0011077 3300053178 Bacteria 4645
1371 Ga0500637_0248512 3300053178 Bacteria 993
1372 Ga0500637_0268001 3300053178 Bacteria 946
1373 Ga0500637_0284938 3300053178 Bacteria 907
1374 Ga0500637_0362362 3300053178 Bacteria 767
1375 Ga0500649_059072 3300053722 Bacteria 1602
1376 Ga0500611_056842 3300053727 Bacteria 914
1377 Ga0500611_199304 3300053727 Bacteria 567
1378 Ga0500657_035869 3300053728 Bacteria 2321
1379 Ga0500645_013421 3300053730 Bacteria 2629
1380 Ga0500645_025920 3300053730 Bacteria 1786
1381 Ga0500609_000334 3300053731 Bacteria 6983
1382 Ga0500596_007063 3300053735 Bacteria 1857
1383 Ga0500601_000586 3300053737 Bacteria 5199
1384 Ga0500601_038210 3300053737 Bacteria 581
1385 Ga0501084_0248968 3300054114 Bacteria 1500
1386 Ga0500661_001956 3300055283 Bacteria 3887
1387 Ga0501082_0169383 3300060353 Bacteria 1898

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0083696 Ga0495686_0083696_819_1322 130
2 3300026089 Ga0207648_10204030 Ga0207648_102040302 133
3 3300049574 Ga0501038_0004908 Ga0501038_0004908_11138_11629 137
4 3300049579 Ga0501043_0234816 Ga0501043_0234816_790_1281 137
5 3300005985 Ga0081539_10000203 Ga0081539_1000020392 138
6 3300005985 Ga0081539_10074427 Ga0081539_100744272 138
7 3300048928 Ga0496125_0010601 Ga0496125_0010601_6819_7241 138
8 3300048929 Ga0496126_1268002 Ga0496126_1268002_76_501 138
9 3300049569 Ga0501032_0530023 Ga0501032_0530023_61_480 138
10 3300049571 Ga0501034_0310037 Ga0501034_0310037_1035_1454 138
11 iso_pu_bacteria 2721755755 2723846265 138
12 3300005334 Ga0068869_101709079 Ga0068869_1017090791 139
13 3300005347 Ga0070668_100400661 Ga0070668_1004006612 139
14 3300005441 Ga0070700_100625545 Ga0070700_1006255452 139
15 3300005456 Ga0070678_100324030 Ga0070678_1003240302 139
16 3300005459 Ga0068867_100814829 Ga0068867_1008148292 139
17 3300005543 Ga0070672_100187750 Ga0070672_1001877503 139
18 3300005844 Ga0068862_100370338 Ga0068862_1003703382 139
19 3300005937 Ga0081455_10001517 Ga0081455_100015174 139
20 3300006038 Ga0075365_10445555 Ga0075365_104455552 139
21 3300006051 Ga0075364_10494147 Ga0075364_104941472 139
22 3300006173 Ga0070716_100876830 Ga0070716_1008768302 139
23 3300006178 Ga0075367_10714363 Ga0075367_107143632 139
24 3300006195 Ga0075366_10311518 Ga0075366_103115181 139
25 3300006880 Ga0075429_100484583 Ga0075429_1004845832 139
26 3300006931 Ga0097620_102727967 Ga0097620_1027279671 139
27 3300009094 Ga0111539_10081586 Ga0111539_100815864 139
28 3300009147 Ga0114129_10780806 Ga0114129_107808062 139
29 3300013296 Ga0157374_11393735 Ga0157374_113937352 139
30 3300013306 Ga0163162_10438128 Ga0163162_104381281 139
31 3300014745 Ga0157377_10046781 Ga0157377_100467813 139
32 3300021384 Ga0213876_10048574 Ga0213876_100485742 139
33 3300025937 Ga0207669_11584645 Ga0207669_115846451 139
34 3300025940 Ga0207691_10583621 Ga0207691_105836212 139
35 3300025942 Ga0207689_10260607 Ga0207689_102606072 139
36 3300026075 Ga0207708_10127250 Ga0207708_101272502 139
37 3300026118 Ga0207675_100467335 Ga0207675_1004673352 139
38 3300028380 Ga0268265_10557792 Ga0268265_105577922 139
39 3300031456 Ga0307513_10661536 Ga0307513_106615361 139
40 3300039437 Ga0436365_1694566 Ga0436365_1694566_62_487 139
41 3300041453 Ga0451797_1068329 Ga0451797_1068329_757_1176 139
42 3300046473 Ga0495582_0260536 Ga0495582_0260536_259_678 139
43 3300046491 Ga0495584_0109102 Ga0495584_0109102_888_1307 139
44 3300046499 Ga0495594_0111688 Ga0495594_0111688_48_467 139
45 3300046507 Ga0495606_0116860 Ga0495606_0116860_705_1124 139
46 3300046518 Ga0495631_0400626 Ga0495631_0400626_46_468 139
47 3300046524 Ga0495648_0002079 Ga0495648_0002079_13086_13505 139
48 3300046539 Ga0495621_0131062 Ga0495621_0131062_222_641 139
49 3300046558 Ga0495633_0086679 Ga0495633_0086679_121_540 139
50 3300046615 Ga0495656_0239858 Ga0495656_0239858_373_792 139
51 3300046615 Ga0495656_0386857 Ga0495656_0386857_244_666 139
52 3300046616 Ga0495668_0117761 Ga0495668_0117761_505_927 139
53 3300046684 Ga0495669_0071530 Ga0495669_0071530_258_680 139
54 3300046684 Ga0495669_0102379 Ga0495669_0102379_166_585 139
55 3300046694 Ga0495649_0246153 Ga0495649_0246153_188_607 139
56 3300047447 Ga0495685_095510 Ga0495685_095510_246_665 139
57 3300048911 Ga0496108_1314962 Ga0496108_1314962_68_487 139
58 3300048912 Ga0496109_0220608 Ga0496109_0220608_676_1095 139
59 3300048924 Ga0496121_0804704 Ga0496121_0804704_15_449 139
60 3300049586 Ga0501070_0441050 Ga0501070_0441050_392_817 139
61 3300049823 Ga0501044_0154009 Ga0501044_0154009_1797_2222 139
62 3300050490 nmdc:mga03n38_147618_c1 nmdc:mga03n38_147618_c1_297_716 139
63 3300050493 nmdc:mga0k408_120411_c1 nmdc:mga0k408_120411_c1_758_1177 139
64 3300050507 nmdc:mga05p37_174969_c1 nmdc:mga05p37_174969_c1_439_858 139
65 3300050511 nmdc:mga08y16_1109593_c1 nmdc:mga08y16_1109593_c1_12_431 139
66 iso_pu_bacteria 2513237141 2513890790 139
67 iso_pu_bacteria 2857524615 2857528700 139
68 iso_pu_bacteria 2893066018 2893068892 139
69 iso_pu_bacteria 2919073203 2919075944 139
70 3300003215 JGI25153J46596_10017942 JGI25153J46596_100179422 140
71 3300003354 JGI25160J50197_1013544 JGI25160J50197_10135442 140
72 3300003354 JGI25160J50197_1036890 JGI25160J50197_10368901 140
73 3300003374 JGI25161J50226_1009260 JGI25161J50226_10092602 140
74 3300003752 Ga0055539_1013517 Ga0055539_10135172 140
75 3300004625 Ga0055543_1005996 Ga0055543_10059963 140
76 3300005262 Ga0065165_1003569 Ga0065165_100356912 140
77 3300005262 Ga0065165_1007503 Ga0065165_10075033 140
78 3300005262 Ga0065165_1009639 Ga0065165_10096395 140
79 3300005262 Ga0065165_1031022 Ga0065165_10310222 140
80 3300005327 Ga0070658_10048779 Ga0070658_100487793 140
81 3300005337 Ga0070682_100028973 Ga0070682_1000289732 140
82 3300005338 Ga0068868_100344125 Ga0068868_1003441252 140
83 3300005339 Ga0070660_100161683 Ga0070660_1001616832 140
84 3300005344 Ga0070661_100181949 Ga0070661_1001819492 140
85 3300005347 Ga0070668_100037546 Ga0070668_1000375463 140
86 3300005347 Ga0070668_101019475 Ga0070668_1010194751 140
87 3300005355 Ga0070671_100072935 Ga0070671_1000729353 140
88 3300005367 Ga0070667_100681013 Ga0070667_1006810132 140
89 3300005434 Ga0070709_10469452 Ga0070709_104694522 140
90 3300005436 Ga0070713_101317571 Ga0070713_1013175711 140
91 3300005455 Ga0070663_100128105 Ga0070663_1001281053 140
92 3300005455 Ga0070663_100161439 Ga0070663_1001614392 140
93 3300005457 Ga0070662_100085799 Ga0070662_1000857994 140
94 3300005457 Ga0070662_100748612 Ga0070662_1007486121 140
95 3300005459 Ga0068867_100349786 Ga0068867_1003497862 140
96 3300005539 Ga0068853_100248236 Ga0068853_1002482362 140
97 3300005539 Ga0068853_101994772 Ga0068853_1019947721 140
98 3300005548 Ga0070665_100038117 Ga0070665_1000381172 140
99 3300005548 Ga0070665_100563601 Ga0070665_1005636012 140
100 3300005563 Ga0068855_101579940 Ga0068855_1015799401 140
101 3300005564 Ga0070664_101233676 Ga0070664_1012336761 140
102 3300005614 Ga0068856_101627494 Ga0068856_1016274941 140
103 3300005616 Ga0068852_100037938 Ga0068852_1000379383 140
104 3300005616 Ga0068852_100503297 Ga0068852_1005032972 140
105 3300005617 Ga0068859_101758308 Ga0068859_1017583081 140
106 3300005840 Ga0068870_11156037 Ga0068870_111560371 140
107 3300005842 Ga0068858_101219917 Ga0068858_1012199172 140
108 3300005844 Ga0068862_100603629 Ga0068862_1006036292 140
109 3300005937 Ga0081455_10482205 Ga0081455_104822052 140
110 3300005983 Ga0081540_1002249 Ga0081540_10022492 140
111 3300005983 Ga0081540_1036980 Ga0081540_10369802 140
112 3300006038 Ga0075365_10023032 Ga0075365_100230322 140
113 3300006038 Ga0075365_10135841 Ga0075365_101358411 140
114 3300006038 Ga0075365_10233601 Ga0075365_102336012 140
115 3300006048 Ga0075363_100106437 Ga0075363_1001064372 140
116 3300006051 Ga0075364_10066812 Ga0075364_100668123 140
117 3300006177 Ga0075362_10117021 Ga0075362_101170212 140
118 3300006178 Ga0075367_10133459 Ga0075367_101334592 140
119 3300006178 Ga0075367_10227221 Ga0075367_102272212 140
120 3300006186 Ga0075369_10050776 Ga0075369_100507762 140
121 3300006195 Ga0075366_10368542 Ga0075366_103685421 140
122 3300006195 Ga0075366_10505038 Ga0075366_105050381 140
123 3300006353 Ga0075370_10203699 Ga0075370_102036992 140
124 3300006871 Ga0075434_100840738 Ga0075434_1008407382 140
125 3300006931 Ga0097620_101758776 Ga0097620_1017587761 140
126 3300006942 Ga0099824_1011269 Ga0099824_10112692 140
127 3300006944 Ga0099823_1095743 Ga0099823_10957432 140
128 3300007076 Ga0075435_100180733 Ga0075435_1001807332 140
129 3300009093 Ga0105240_10001503 Ga0105240_1000150313 140
130 3300009098 Ga0105245_11250060 Ga0105245_112500602 140
131 3300009148 Ga0105243_10522834 Ga0105243_105228342 140
132 3300009174 Ga0105241_10078013 Ga0105241_100780132 140
133 3300009174 Ga0105241_10094740 Ga0105241_100947402 140
134 3300009174 Ga0105241_10479027 Ga0105241_104790271 140
135 3300009177 Ga0105248_10580318 Ga0105248_105803182 140
136 3300009545 Ga0105237_10000992 Ga0105237_100009927 140
137 3300009545 Ga0105237_10788673 Ga0105237_107886731 140
138 3300009545 Ga0105237_11155244 Ga0105237_111552442 140
139 3300010375 Ga0105239_10118569 Ga0105239_101185693 140
140 3300010375 Ga0105239_12120987 Ga0105239_121209871 140
141 3300010375 Ga0105239_13093663 Ga0105239_130936631 140
142 3300011119 Ga0105246_10525867 Ga0105246_105258672 140
143 3300013104 Ga0157370_11362062 Ga0157370_113620622 140
144 3300013296 Ga0157374_10347053 Ga0157374_103470532 140
145 3300013297 Ga0157378_10561113 Ga0157378_105611132 140
146 3300013297 Ga0157378_10876248 Ga0157378_108762482 140
147 3300014497 Ga0182008_10145428 Ga0182008_101454282 140
148 3300014968 Ga0157379_10483493 Ga0157379_104834932 140
149 3300014969 Ga0157376_10582566 Ga0157376_105825662 140
150 3300021320 Ga0214544_1022606 Ga0214544_10226062 140
151 3300021321 Ga0214542_1000002 Ga0214542_100000293 140
152 3300021321 Ga0214542_1023298 Ga0214542_10232982 140
153 3300021324 Ga0214545_1000002 Ga0214545_1000002626 140
154 3300021324 Ga0214545_1024282 Ga0214545_10242822 140
155 3300021327 Ga0214543_1000017 Ga0214543_1000017229 140
156 3300021327 Ga0214543_1024476 Ga0214543_10244764 140
157 3300021384 Ga0213876_10698814 Ga0213876_106988141 140
158 3300025230 Ga0209563_101649 Ga0209563_1016491 140
159 3300025253 Ga0209677_100547 Ga0209677_1005478 140
160 3300025253 Ga0209677_101107 Ga0209677_1011078 140
161 3300025261 Ga0209233_1000908 Ga0209233_100090812 140
162 3300025261 Ga0209233_1004920 Ga0209233_10049203 140
163 3300025272 Ga0209455_1005799 Ga0209455_10057992 140
164 3300025272 Ga0209455_1021921 Ga0209455_10219211 140
165 3300025273 Ga0209673_1016891 Ga0209673_10168912 140
166 3300025295 Ga0209564_1005255 Ga0209564_10052552 140
167 3300025297 Ga0209758_1000189 Ga0209758_100018919 140
168 3300025297 Ga0209758_1000827 Ga0209758_100082717 140
169 3300025297 Ga0209758_1020233 Ga0209758_10202333 140
170 3300025297 Ga0209758_1043163 Ga0209758_10431632 140
171 3300025299 Ga0209256_1084781 Ga0209256_10847812 140
172 3300025302 Ga0207426_1001072 Ga0207426_100107216 140
173 3300025302 Ga0207426_1001657 Ga0207426_10016572 140
174 3300025302 Ga0207426_1010712 Ga0207426_10107124 140
175 3300025304 Ga0209257_1100216 Ga0209257_11002162 140
176 3300025901 Ga0207688_10430996 Ga0207688_104309961 140
177 3300025909 Ga0207705_10028471 Ga0207705_100284712 140
178 3300025909 Ga0207705_10771605 Ga0207705_107716051 140
179 3300025911 Ga0207654_10040765 Ga0207654_100407652 140
180 3300025911 Ga0207654_10063717 Ga0207654_100637172 140
181 3300025913 Ga0207695_10000159 Ga0207695_1000015956 140
182 3300025914 Ga0207671_10003280 Ga0207671_1000328012 140
183 3300025914 Ga0207671_10939127 Ga0207671_109391272 140
184 3300025919 Ga0207657_10142420 Ga0207657_101424202 140
185 3300025920 Ga0207649_10247779 Ga0207649_102477792 140
186 3300025920 Ga0207649_10589917 Ga0207649_105899172 140
187 3300025928 Ga0207700_11494798 Ga0207700_114947981 140
188 3300025931 Ga0207644_10025554 Ga0207644_100255543 140
189 3300025932 Ga0207690_10449478 Ga0207690_104494782 140
190 3300025933 Ga0207706_10137433 Ga0207706_101374333 140
191 3300025933 Ga0207706_10173356 Ga0207706_101733563 140
192 3300025941 Ga0207711_10445075 Ga0207711_104450752 140
193 3300025941 Ga0207711_10805381 Ga0207711_108053812 140
194 3300025949 Ga0207667_10443484 Ga0207667_104434842 140
195 3300025972 Ga0207668_10080257 Ga0207668_100802572 140
196 3300025972 Ga0207668_10754976 Ga0207668_107549762 140
197 3300025972 Ga0207668_11446007 Ga0207668_114460071 140
198 3300025986 Ga0207658_10676960 Ga0207658_106769602 140
199 3300026035 Ga0207703_11851463 Ga0207703_118514631 140
200 3300026041 Ga0207639_11569602 Ga0207639_115696022 140
201 3300026067 Ga0207678_10028578 Ga0207678_100285783 140
202 3300026088 Ga0207641_10995766 Ga0207641_109957662 140
203 3300026089 Ga0207648_10199196 Ga0207648_101991962 140
204 3300026095 Ga0207676_12033745 Ga0207676_120337451 140
205 3300026142 Ga0207698_10075603 Ga0207698_100756034 140
206 3300027296 Ga0209389_1000239 Ga0209389_100023922 140
207 3300027296 Ga0209389_1000690 Ga0209389_10006908 140
208 3300027357 Ga0209589_1007787 Ga0209589_100778722 140
209 3300027361 Ga0209489_100030 Ga0209489_100030183 140
210 3300027361 Ga0209489_122501 Ga0209489_1225012 140
211 3300028379 Ga0268266_10023260 Ga0268266_100232606 140
212 3300028379 Ga0268266_10493004 Ga0268266_104930042 140
213 3300028379 Ga0268266_11155851 Ga0268266_111558512 140
214 3300028380 Ga0268265_10355501 Ga0268265_103555012 140
215 3300031616 Ga0307508_10481546 Ga0307508_104815461 140
216 3300033180 Ga0307510_10004554 Ga0307510_100045546 140
217 3300033180 Ga0307510_10050493 Ga0307510_100504934 140
218 3300035118 Ga0373954_0185056 Ga0373954_0185056_210_632 140
219 3300037068 Ga0373925_0123549 Ga0373925_0123549_486_908 140
220 3300037418 Ga0395900_0002922 Ga0395900_0002922_5833_6255 140
221 3300037466 Ga0395898_0136329 Ga0395898_0136329_916_1338 140
222 3300037466 Ga0395898_0330553 Ga0395898_0330553_321_743 140
223 3300037471 Ga0395905_0008568 Ga0395905_0008568_7369_7791 140
224 3300037471 Ga0395905_1211612 Ga0395905_1211612_160_585 140
225 3300037853 Ga0436364_0243149 Ga0436364_0243149_413_835 140
226 3300038443 Ga0395901_0062170 Ga0395901_0062170_1277_1699 140
227 3300038443 Ga0395901_0822767 Ga0395901_0822767_251_673 140
228 3300039437 Ga0436365_1408544 Ga0436365_1408544_2254_2676 140
229 3300039450 Ga0436363_0616419 Ga0436363_0616419_258_680 140
230 3300041443 Ga0451789_1044976 Ga0451789_1044976_16_438 140
231 3300041456 Ga0451795_0062024 Ga0451795_0062024_129_551 140
232 3300041460 Ga0451802_0754618 Ga0451802_0754618_160_582 140
233 3300041501 Ga0451845_0348542 Ga0451845_0348542_211_633 140
234 3300041511 Ga0451855_0132121 Ga0451855_0132121_660_1082 140
235 3300044658 Ga0466972_0000465 Ga0466972_0000465_16403_16825 140
236 3300044658 Ga0466972_0018329 Ga0466972_0018329_2496_2918 140
237 3300044658 Ga0466972_0228571 Ga0466972_0228571_310_732 140
238 3300044683 Ga0466965_0761563 Ga0466965_0761563_107_529 140
239 3300044693 Ga0466961_0000366 Ga0466961_0000366_12076_12498 140
240 3300044693 Ga0466961_0266891 Ga0466961_0266891_328_750 140
241 3300044694 Ga0466963_0004594 Ga0466963_0004594_1160_1582 140
242 3300044706 Ga0466964_0718109 Ga0466964_0718109_84_506 140
243 3300044735 Ga0466968_0004579 Ga0466968_0004579_1483_1905 140
244 3300044735 Ga0466968_0044827 Ga0466968_0044827_970_1392 140
245 3300044735 Ga0466968_0219701 Ga0466968_0219701_252_674 140
246 3300044765 Ga0466970_0087681 Ga0466970_0087681_67_489 140
247 3300044765 Ga0466970_0203228 Ga0466970_0203228_670_1092 140
248 3300044842 Ga0466957_0115195 Ga0466957_0115195_1070_1492 140
249 3300044842 Ga0466957_0493296 Ga0466957_0493296_141_563 140
250 3300044901 Ga0466960_0114897 Ga0466960_0114897_474_896 140
251 3300044901 Ga0466960_0483981 Ga0466960_0483981_22_444 140
252 3300045049 Ga0466959_0002745 Ga0466959_0002745_3944_4366 140
253 3300045049 Ga0466959_0096611 Ga0466959_0096611_580_1002 140
254 3300045976 Ga0466967_0047144 Ga0466967_0047144_1273_1695 140
255 3300046454 Ga0495592_0124744 Ga0495592_0124744_500_922 140
256 3300046457 Ga0495590_0337869 Ga0495590_0337869_128_550 140
257 3300046462 Ga0495651_0001183 Ga0495651_0001183_1184_1606 140
258 3300046462 Ga0495651_0027081 Ga0495651_0027081_492_914 140
259 3300046477 Ga0495664_0007504 Ga0495664_0007504_386_808 140
260 3300046477 Ga0495664_0416668 Ga0495664_0416668_299_721 140
261 3300046491 Ga0495584_0217539 Ga0495584_0217539_448_870 140
262 3300046500 Ga0495596_0266892 Ga0495596_0266892_201_623 140
263 3300046506 Ga0495583_0126717 Ga0495583_0126717_84_506 140
264 3300046507 Ga0495606_0512640 Ga0495606_0512640_16_438 140
265 3300046507 Ga0495606_0518053 Ga0495606_0518053_53_481 140
266 3300046513 Ga0495616_0322104 Ga0495616_0322104_82_504 140
267 3300046514 Ga0495618_0397787 Ga0495618_0397787_176_598 140
268 3300046515 Ga0495620_0033852 Ga0495620_0033852_1105_1527 140
269 3300046517 Ga0495630_0107347 Ga0495630_0107347_1083_1505 140
270 3300046518 Ga0495631_0417531 Ga0495631_0417531_41_463 140
271 3300046522 Ga0495643_0008653 Ga0495643_0008653_341_763 140
272 3300046522 Ga0495643_0443470 Ga0495643_0443470_24_446 140
273 3300046524 Ga0495648_0039173 Ga0495648_0039173_965_1387 140
274 3300046529 Ga0495652_0120252 Ga0495652_0120252_119_541 140
275 3300046536 Ga0495587_0004094 Ga0495587_0004094_6226_6648 140
276 3300046543 Ga0495645_0541658 Ga0495645_0541658_121_543 140
277 3300046557 Ga0495622_0124130 Ga0495622_0124130_427_849 140
278 3300046559 Ga0495667_0131901 Ga0495667_0131901_828_1250 140
279 3300046616 Ga0495668_0144734 Ga0495668_0144734_268_690 140
280 3300046642 Ga0495634_0019165 Ga0495634_0019165_2175_2597 140
281 3300046642 Ga0495634_0116016 Ga0495634_0116016_818_1240 140
282 3300046648 Ga0495611_0085823 Ga0495611_0085823_232_654 140
283 3300046660 Ga0495625_0029775 Ga0495625_0029775_469_891 140
284 3300046663 Ga0495635_0002199 Ga0495635_0002199_6217_6639 140
285 3300046665 Ga0495661_0133148 Ga0495661_0133148_672_1094 140
286 3300046665 Ga0495661_0220214 Ga0495661_0220214_491_913 140
287 3300046675 Ga0495657_0011029 Ga0495657_0011029_2095_2517 140
288 3300046675 Ga0495657_0014422 Ga0495657_0014422_844_1266 140
289 3300046678 Ga0495599_0095311 Ga0495599_0095311_977_1399 140
290 3300046679 Ga0495623_0043429 Ga0495623_0043429_1934_2356 140
291 3300046680 Ga0495646_0076971 Ga0495646_0076971_1349_1771 140
292 3300046689 Ga0495613_0060313 Ga0495613_0060313_1978_2400 140
293 3300046690 Ga0495624_0323741 Ga0495624_0323741_159_581 140
294 3300046690 Ga0495624_0371965 Ga0495624_0371965_257_679 140
295 3300046692 Ga0495671_0052466 Ga0495671_0052466_80_502 140
296 3300046692 Ga0495671_0246860 Ga0495671_0246860_203_625 140
297 3300046809 Ga0495600_0012798 Ga0495600_0012798_548_970 140
298 3300047317 Ga0495604_0002274 Ga0495604_0002274_11998_12420 140
299 3300047317 Ga0495604_0079461 Ga0495604_0079461_1914_2336 140
300 3300047317 Ga0495604_0111985 Ga0495604_0111985_1442_1864 140
301 3300047319 Ga0495674_0140758 Ga0495674_0140758_1255_1677 140
302 3300047322 Ga0495680_0001595 Ga0495680_0001595_14931_15353 140
303 3300047443 Ga0495687_056061 Ga0495687_056061_341_763 140
304 3300047444 Ga0495675_0017231 Ga0495675_0017231_3601_4023 140
305 3300047471 Ga0495684_0065648 Ga0495684_0065648_500_922 140
306 3300047472 Ga0495686_0310224 Ga0495686_0310224_249_671 140
307 3300047673 Ga0495593_0094177 Ga0495593_0094177_246_668 140
308 3300048088 Ga0495602_0023337 Ga0495602_0023337_4814_5236 140
309 3300048903 Ga0496100_0301952 Ga0496100_0301952_238_663 140
310 3300048903 Ga0496100_0324962 Ga0496100_0324962_677_1099 140
311 3300048903 Ga0496100_0384937 Ga0496100_0384937_586_1008 140
312 3300048904 Ga0496101_0033122 Ga0496101_0033122_625_1047 140
313 3300048904 Ga0496101_0126230 Ga0496101_0126230_1085_1507 140
314 3300048904 Ga0496101_0208392 Ga0496101_0208392_950_1375 140
315 3300048904 Ga0496101_1182723 Ga0496101_1182723_24_446 140
316 3300048905 Ga0496102_0012642 Ga0496102_0012642_6797_7219 140
317 3300048905 Ga0496102_0061059 Ga0496102_0061059_407_829 140
318 3300048905 Ga0496102_0219217 Ga0496102_0219217_272_694 140
319 3300048906 Ga0496103_0038684 Ga0496103_0038684_1974_2396 140
320 3300048906 Ga0496103_0301794 Ga0496103_0301794_397_822 140
321 3300048907 Ga0496104_0020012 Ga0496104_0020012_2537_2959 140
322 3300048907 Ga0496104_0263653 Ga0496104_0263653_136_558 140
323 3300048907 Ga0496104_0819283 Ga0496104_0819283_92_514 140
324 3300048908 Ga0496105_0027000 Ga0496105_0027000_3831_4253 140
325 3300048908 Ga0496105_0031039 Ga0496105_0031039_1279_1701 140
326 3300048908 Ga0496105_0056915 Ga0496105_0056915_2546_2968 140
327 3300048908 Ga0496105_0154296 Ga0496105_0154296_1369_1791 140
328 3300048909 Ga0496106_0000501 Ga0496106_0000501_12757_13182 140
329 3300048909 Ga0496106_0130575 Ga0496106_0130575_279_701 140
330 3300048909 Ga0496106_0237543 Ga0496106_0237543_433_855 140
331 3300048910 Ga0496107_0006040 Ga0496107_0006040_5574_5999 140
332 3300048910 Ga0496107_0175743 Ga0496107_0175743_1004_1426 140
333 3300048911 Ga0496108_0024615 Ga0496108_0024615_3528_3953 140
334 3300048912 Ga0496109_0000607 Ga0496109_0000607_12316_12741 140
335 3300048912 Ga0496109_0095832 Ga0496109_0095832_1194_1616 140
336 3300048913 Ga0496110_0372904 Ga0496110_0372904_799_1221 140
337 3300048913 Ga0496110_0451001 Ga0496110_0451001_732_1154 140
338 3300048914 Ga0496111_0092813 Ga0496111_0092813_432_854 140
339 3300048914 Ga0496111_0117826 Ga0496111_0117826_1209_1631 140
340 3300048914 Ga0496111_0423681 Ga0496111_0423681_493_918 140
341 3300048915 Ga0496112_0025348 Ga0496112_0025348_1307_1729 140
342 3300048915 Ga0496112_0065599 Ga0496112_0065599_1979_2404 140
343 3300048916 Ga0496113_0117397 Ga0496113_0117397_448_870 140
344 3300048916 Ga0496113_1170086 Ga0496113_1170086_57_479 140
345 3300048917 Ga0496114_0279763 Ga0496114_0279763_1002_1424 140
346 3300048918 Ga0496115_0038929 Ga0496115_0038929_2923_3345 140
347 3300048918 Ga0496115_0091716 Ga0496115_0091716_740_1162 140
348 3300048918 Ga0496115_0501600 Ga0496115_0501600_402_827 140
349 3300048919 Ga0496116_0036964 Ga0496116_0036964_560_982 140
350 3300048921 Ga0496118_0012116 Ga0496118_0012116_5701_6126 140
351 3300048921 Ga0496118_0266811 Ga0496118_0266811_82_504 140
352 3300048921 Ga0496118_0364382 Ga0496118_0364382_253_675 140
353 3300048922 Ga0496119_0026902 Ga0496119_0026902_1719_2141 140
354 3300048922 Ga0496119_0074232 Ga0496119_0074232_854_1276 140
355 3300048922 Ga0496119_0092035 Ga0496119_0092035_1237_1662 140
356 3300048923 Ga0496120_0104950 Ga0496120_0104950_450_872 140
357 3300048924 Ga0496121_0029660 Ga0496121_0029660_268_693 140
358 3300048924 Ga0496121_0056308 Ga0496121_0056308_315_737 140
359 3300048924 Ga0496121_0087766 Ga0496121_0087766_840_1262 140
360 3300048924 Ga0496121_0480251 Ga0496121_0480251_361_783 140
361 3300048924 Ga0496121_0494450 Ga0496121_0494450_56_478 140
362 3300048925 Ga0496122_0011608 Ga0496122_0011608_3887_4309 140
363 3300048926 Ga0496123_0315587 Ga0496123_0315587_238_660 140
364 3300048927 Ga0496124_0762197 Ga0496124_0762197_66_488 140
365 3300048928 Ga0496125_0056729 Ga0496125_0056729_206_628 140
366 3300048928 Ga0496125_0171121 Ga0496125_0171121_529_951 140
367 3300048928 Ga0496125_0178860 Ga0496125_0178860_535_960 140
368 3300048928 Ga0496125_0464075 Ga0496125_0464075_191_613 140
369 3300048929 Ga0496126_0003590 Ga0496126_0003590_9815_10237 140
370 3300048929 Ga0496126_0040306 Ga0496126_0040306_514_936 140
371 3300048929 Ga0496126_0114342 Ga0496126_0114342_1833_2255 140
372 3300048929 Ga0496126_0551668 Ga0496126_0551668_419_841 140
373 3300048929 Ga0496126_0581783 Ga0496126_0581783_46_468 140
374 3300048929 Ga0496126_0728904 Ga0496126_0728904_324_746 140
375 3300048929 Ga0496126_0743122 Ga0496126_0743122_194_616 140
376 3300049579 Ga0501043_0361846 Ga0501043_0361846_641_1081 140
377 3300050491 nmdc:mga00v17_149961_c1 nmdc:mga00v17_149961_c1_389_811 140
378 3300050492 nmdc:mga0yw44_106002_c1 nmdc:mga0yw44_106002_c1_1206_1628 140
379 3300050492 nmdc:mga0yw44_106378_c1 nmdc:mga0yw44_106378_c1_138_560 140
380 3300050492 nmdc:mga0yw44_16105_c1 nmdc:mga0yw44_16105_c1_3272_3694 140
381 3300050494 nmdc:mga06z11_373427_c1 nmdc:mga06z11_373427_c1_182_604 140
382 3300050512 nmdc:mga0n895_484023_c1 nmdc:mga0n895_484023_c1_231_656 140
383 3300050516 nmdc:mga0sz30_77783_c1 nmdc:mga0sz30_77783_c1_759_1181 140
384 3300053077 Ga0495601_0637574 Ga0495601_0637574_127_549 140
385 3300053079 Ga0500610_0287722 Ga0500610_0287722_176_598 140
386 3300053083 Ga0495655_0160756 Ga0495655_0160756_113_535 140
387 3300053084 Ga0495595_0554364 Ga0495595_0554364_125_547 140
388 3300053086 Ga0500578_0227955 Ga0500578_0227955_181_603 140
389 3300053087 Ga0500643_000040 Ga0500643_000040_164904_165326 140
390 3300053092 Ga0500583_0202187 Ga0500583_0202187_378_800 140
391 3300053094 Ga0500566_0000230 Ga0500566_0000230_9916_10338 140
392 3300053094 Ga0500566_0179997 Ga0500566_0179997_339_761 140
393 3300053096 Ga0500641_0021384 Ga0500641_0021384_452_874 140
394 3300053097 Ga0500648_093476 Ga0500648_093476_535_957 140
395 3300053102 Ga0500554_264146 Ga0500554_264146_44_466 140
396 3300053103 Ga0500555_002003 Ga0500555_002003_5062_5484 140
397 3300053109 Ga0500569_040307 Ga0500569_040307_468_890 140
398 3300053111 Ga0500572_028490 Ga0500572_028490_155_577 140
399 3300053116 Ga0500592_004040 Ga0500592_004040_14_436 140
400 3300053118 Ga0500594_0119064 Ga0500594_0119064_123_545 140
401 3300053119 Ga0500595_085970 Ga0500595_085970_262_684 140
402 3300053123 Ga0500614_123950 Ga0500614_123950_266_688 140
403 3300053125 Ga0500618_031139 Ga0500618_031139_801_1223 140
404 3300053133 Ga0500655_020750 Ga0500655_020750_766_1188 140
405 3300053136 Ga0500559_0042935 Ga0500559_0042935_1304_1726 140
406 3300053138 Ga0500564_007088 Ga0500564_007088_1902_2324 140
407 3300053139 Ga0500568_0005161 Ga0500568_0005161_5938_6360 140
408 3300053142 Ga0500577_0023967 Ga0500577_0023967_1179_1601 140
409 3300053146 Ga0500588_0249205 Ga0500588_0249205_232_654 140
410 3300053148 Ga0500590_120403 Ga0500590_120403_640_1062 140
411 3300053150 Ga0500603_043302 Ga0500603_043302_289_711 140
412 3300053153 Ga0500616_0016770 Ga0500616_0016770_3010_3432 140
413 3300053154 Ga0500619_055454 Ga0500619_055454_63_485 140
414 3300053155 Ga0500620_010151 Ga0500620_010151_1892_2314 140
415 3300053158 Ga0500627_0477836 Ga0500627_0477836_84_506 140
416 3300053162 Ga0500638_122474 Ga0500638_122474_589_1011 140
417 3300053177 Ga0500636_0000120 Ga0500636_0000120_22609_23031 140
418 3300053177 Ga0500636_0095073 Ga0500636_0095073_817_1239 140
419 3300053177 Ga0500636_0321081 Ga0500636_0321081_131_553 140
420 3300053178 Ga0500637_0268001 Ga0500637_0268001_285_707 140
421 3300053722 Ga0500649_059072 Ga0500649_059072_13_435 140
422 3300053731 Ga0500609_000334 Ga0500609_000334_1706_2128 140
423 3300053737 Ga0500601_000586 Ga0500601_000586_4753_5175 140
424 3300053737 Ga0500601_038210 Ga0500601_038210_60_482 140
425 3300005329 Ga0070683_100037619 Ga0070683_1000376193 141
426 3300005336 Ga0070680_100004631 Ga0070680_1000046318 141
427 3300005336 Ga0070680_100640087 Ga0070680_1006400872 141
428 3300005337 Ga0070682_100199702 Ga0070682_1001997022 141
429 3300005434 Ga0070709_10001049 Ga0070709_1000104911 141
430 3300005437 Ga0070710_10040600 Ga0070710_100406002 141
431 3300005439 Ga0070711_100003503 Ga0070711_1000035038 141
432 3300005439 Ga0070711_101384808 Ga0070711_1013848081 141
433 3300005455 Ga0070663_100538085 Ga0070663_1005380852 141
434 3300005458 Ga0070681_10047129 Ga0070681_100471292 141
435 3300005458 Ga0070681_10720642 Ga0070681_107206422 141
436 3300005530 Ga0070679_100051310 Ga0070679_1000513107 141
437 3300005530 Ga0070679_100215689 Ga0070679_1002156892 141
438 3300005530 Ga0070679_100229794 Ga0070679_1002297942 141
439 3300005530 Ga0070679_100502166 Ga0070679_1005021662 141
440 3300005530 Ga0070679_100750247 Ga0070679_1007502472 141
441 3300005535 Ga0070684_100011514 Ga0070684_1000115144 141
442 3300005548 Ga0070665_100601414 Ga0070665_1006014142 141
443 3300005563 Ga0068855_100275794 Ga0068855_1002757942 141
444 3300005563 Ga0068855_100838891 Ga0068855_1008388912 141
445 3300005563 Ga0068855_101797924 Ga0068855_1017979241 141
446 3300005577 Ga0068857_100395122 Ga0068857_1003951222 141
447 3300005614 Ga0068856_100000535 Ga0068856_10000053529 141
448 3300005616 Ga0068852_102639092 Ga0068852_1026390921 141
449 3300005981 Ga0081538_10031309 Ga0081538_100313093 141
450 3300005983 Ga0081540_1116975 Ga0081540_11169752 141
451 3300006028 Ga0070717_10144342 Ga0070717_101443422 141
452 3300006038 Ga0075365_10686225 Ga0075365_106862252 141
453 3300006175 Ga0070712_100290120 Ga0070712_1002901202 141
454 3300006195 Ga0075366_10694709 Ga0075366_106947091 141
455 3300006358 Ga0068871_100625788 Ga0068871_1006257882 141
456 3300009093 Ga0105240_10012039 Ga0105240_100120394 141
457 3300009093 Ga0105240_10514575 Ga0105240_105145752 141
458 3300009148 Ga0105243_11566714 Ga0105243_115667141 141
459 3300009545 Ga0105237_10027416 Ga0105237_100274168 141
460 3300009545 Ga0105237_10068125 Ga0105237_100681252 141
461 3300009545 Ga0105237_10373604 Ga0105237_103736042 141
462 3300009551 Ga0105238_10021123 Ga0105238_100211237 141
463 3300009551 Ga0105238_10182278 Ga0105238_101822782 141
464 3300009551 Ga0105238_10311513 Ga0105238_103115132 141
465 3300009551 Ga0105238_10376017 Ga0105238_103760172 141
466 3300009551 Ga0105238_11254211 Ga0105238_112542112 141
467 3300010375 Ga0105239_10203365 Ga0105239_102033652 141
468 3300013104 Ga0157370_11895656 Ga0157370_118956561 141
469 3300013105 Ga0157369_10009894 Ga0157369_100098948 141
470 3300013105 Ga0157369_10103369 Ga0157369_101033694 141
471 3300013105 Ga0157369_11695679 Ga0157369_116956791 141
472 3300013296 Ga0157374_10517789 Ga0157374_105177892 141
473 3300013307 Ga0157372_10189034 Ga0157372_101890343 141
474 3300013307 Ga0157372_10284026 Ga0157372_102840262 141
475 3300013307 Ga0157372_11504618 Ga0157372_115046182 141
476 3300014745 Ga0157377_10842548 Ga0157377_108425482 141
477 3300020069 Ga0197907_11372531 Ga0197907_113725312 141
478 3300021384 Ga0213876_10217404 Ga0213876_102174042 141
479 3300022467 Ga0224712_10274410 Ga0224712_102744101 141
480 3300025906 Ga0207699_10204874 Ga0207699_102048741 141
481 3300025912 Ga0207707_10009378 Ga0207707_1000937810 141
482 3300025912 Ga0207707_10025231 Ga0207707_100252316 141
483 3300025912 Ga0207707_10207609 Ga0207707_102076091 141
484 3300025912 Ga0207707_10733281 Ga0207707_107332811 141
485 3300025913 Ga0207695_10035634 Ga0207695_100356345 141
486 3300025913 Ga0207695_11324059 Ga0207695_113240591 141
487 3300025914 Ga0207671_10285934 Ga0207671_102859342 141
488 3300025914 Ga0207671_10376283 Ga0207671_103762832 141
489 3300025915 Ga0207693_10021981 Ga0207693_100219815 141
490 3300025917 Ga0207660_10031077 Ga0207660_100310776 141
491 3300025921 Ga0207652_10009472 Ga0207652_100094728 141
492 3300025921 Ga0207652_10041605 Ga0207652_100416052 141
493 3300025921 Ga0207652_10451505 Ga0207652_104515051 141
494 3300025924 Ga0207694_10017732 Ga0207694_100177321 141
495 3300025924 Ga0207694_10545562 Ga0207694_105455622 141
496 3300025928 Ga0207700_10173713 Ga0207700_101737131 141
497 3300025929 Ga0207664_10629235 Ga0207664_106292351 141
498 3300025929 Ga0207664_11248387 Ga0207664_112483872 141
499 3300025944 Ga0207661_10003040 Ga0207661_100030403 141
500 3300025944 Ga0207661_10331914 Ga0207661_103319142 141
501 3300025949 Ga0207667_10328127 Ga0207667_103281272 141
502 3300025949 Ga0207667_10377288 Ga0207667_103772882 141
503 3300026041 Ga0207639_11692278 Ga0207639_116922781 141
504 3300026067 Ga0207678_10167906 Ga0207678_101679062 141
505 3300026078 Ga0207702_10000081 Ga0207702_1000008139 141
506 3300026078 Ga0207702_10056499 Ga0207702_100564993 141
507 3300026116 Ga0207674_10370937 Ga0207674_103709372 141
508 3300026121 Ga0207683_10097580 Ga0207683_100975802 141
509 3300026142 Ga0207698_10779031 Ga0207698_107790312 141
510 3300026142 Ga0207698_10835067 Ga0207698_108350671 141
511 3300032126 Ga0307415_100358307 Ga0307415_1003583072 141
512 3300035089 Ga0373944_0125234 Ga0373944_0125234_157_582 141
513 3300035111 Ga0373923_0051523 Ga0373923_0051523_59_484 141
514 3300035116 Ga0373945_0021136 Ga0373945_0021136_1311_1736 141
515 3300035117 Ga0373953_0069543 Ga0373953_0069543_389_814 141
516 3300035118 Ga0373954_0045183 Ga0373954_0045183_1604_2029 141
517 3300035172 Ga0373955_0028493 Ga0373955_0028493_177_602 141
518 3300035410 Ga0373924_0006349 Ga0373924_0006349_1706_2131 141
519 3300035692 Ga0373935_0042994 Ga0373935_0042994_158_583 141
520 3300035695 Ga0373927_0084944 Ga0373927_0084944_758_1183 141
521 3300035695 Ga0373927_0128333 Ga0373927_0128333_284_709 141
522 3300035724 Ga0373933_0031995 Ga0373933_0031995_313_777 141
523 3300035725 Ga0373947_0639787 Ga0373947_0639787_165_590 141
524 3300036401 Ga0373937_0036239 Ga0373937_0036239_2898_3362 141
525 3300037068 Ga0373925_0043776 Ga0373925_0043776_763_1188 141
526 3300037068 Ga0373925_0573898 Ga0373925_0573898_263_688 141
527 3300037068 Ga0373925_0671226 Ga0373925_0671226_82_507 141
528 3300037418 Ga0395900_1659015 Ga0395900_1659015_27_455 141
529 3300037466 Ga0395898_0117507 Ga0395898_0117507_279_704 141
530 3300037853 Ga0436364_0326406 Ga0436364_0326406_1043_1468 141
531 3300039437 Ga0436365_0712770 Ga0436365_0712770_1485_1910 141
532 3300039437 Ga0436365_1587325 Ga0436365_1587325_96_521 141
533 3300041451 Ga0451791_0535527 Ga0451791_0535527_160_585 141
534 3300041456 Ga0451795_1432725 Ga0451795_1432725_13_438 141
535 3300044694 Ga0466963_0037426 Ga0466963_0037426_2653_3078 141
536 3300044706 Ga0466964_0404466 Ga0466964_0404466_120_545 141
537 3300045976 Ga0466967_0168058 Ga0466967_0168058_124_549 141
538 3300045976 Ga0466967_0803791 Ga0466967_0803791_255_680 141
539 3300046455 Ga0495603_0486554 Ga0495603_0486554_189_614 141
540 3300046459 Ga0495629_0129488 Ga0495629_0129488_818_1243 141
541 3300046462 Ga0495651_0465031 Ga0495651_0465031_248_673 141
542 3300046472 Ga0495580_0021678 Ga0495580_0021678_379_804 141
543 3300046473 Ga0495582_0157122 Ga0495582_0157122_196_621 141
544 3300046477 Ga0495664_0010508 Ga0495664_0010508_2656_3120 141
545 3300046499 Ga0495594_0246695 Ga0495594_0246695_54_479 141
546 3300046516 Ga0495628_0238409 Ga0495628_0238409_94_519 141
547 3300046524 Ga0495648_0004572 Ga0495648_0004572_9907_10332 141
548 3300046526 Ga0495666_0076926 Ga0495666_0076926_915_1340 141
549 3300046531 Ga0495665_0007540 Ga0495665_0007540_2204_2629 141
550 3300046535 Ga0495586_0100571 Ga0495586_0100571_285_710 141
551 3300046536 Ga0495587_0292503 Ga0495587_0292503_169_594 141
552 3300046642 Ga0495634_0030090 Ga0495634_0030090_166_591 141
553 3300046675 Ga0495657_0853520 Ga0495657_0853520_66_491 141
554 3300046678 Ga0495599_0257471 Ga0495599_0257471_87_551 141
555 3300046681 Ga0495647_0114158 Ga0495647_0114158_436_900 141
556 3300046683 Ga0495658_0038455 Ga0495658_0038455_1637_2062 141
557 3300046683 Ga0495658_0759005 Ga0495658_0759005_61_486 141
558 3300046690 Ga0495624_0038211 Ga0495624_0038211_2155_2580 141
559 3300047315 Ga0495581_0030696 Ga0495581_0030696_348_773 141
560 3300047319 Ga0495674_0091722 Ga0495674_0091722_1161_1586 141
561 3300047471 Ga0495684_0015313 Ga0495684_0015313_2114_2539 141
562 3300047673 Ga0495593_0038125 Ga0495593_0038125_2006_2431 141
563 3300048924 Ga0496121_0026502 Ga0496121_0026502_2382_2807 141
564 3300048928 Ga0496125_0000092 Ga0496125_0000092_71394_71912 141
565 3300048929 Ga0496126_0479065 Ga0496126_0479065_126_551 141
566 3300049581 Ga0501047_0188735 Ga0501047_0188735_33_461 141
567 3300049744 Ga0501083_0801602 Ga0501083_0801602_99_527 141
568 3300050492 nmdc:mga0yw44_638244_c1 nmdc:mga0yw44_638244_c1_201_626 141
569 3300001979 JGI24740J21852_10026584 JGI24740J21852_100265842 142
570 3300001979 JGI24740J21852_10101045 JGI24740J21852_101010451 142
571 3300002075 JGI24738J21930_10101359 JGI24738J21930_101013592 142
572 3300003215 JGI25153J46596_10004677 JGI25153J46596_100046777 142
573 3300003659 JGI25404J52841_10009065 JGI25404J52841_100090653 142
574 3300003659 JGI25404J52841_10024640 JGI25404J52841_100246401 142
575 3300005293 Ga0065715_10271731 Ga0065715_102717312 142
576 3300005327 Ga0070658_10144495 Ga0070658_101444952 142
577 3300005329 Ga0070683_100007695 Ga0070683_1000076957 142
578 3300005334 Ga0068869_100017200 Ga0068869_1000172002 142
579 3300005334 Ga0068869_100139057 Ga0068869_1001390573 142
580 3300005334 Ga0068869_100838093 Ga0068869_1008380932 142
581 3300005335 Ga0070666_10912799 Ga0070666_109127992 142
582 3300005336 Ga0070680_100018149 Ga0070680_1000181494 142
583 3300005337 Ga0070682_100046870 Ga0070682_1000468703 142
584 3300005337 Ga0070682_100249988 Ga0070682_1002499881 142
585 3300005338 Ga0068868_100161311 Ga0068868_1001613112 142
586 3300005338 Ga0068868_100227730 Ga0068868_1002277302 142
587 3300005339 Ga0070660_100007944 Ga0070660_1000079446 142
588 3300005339 Ga0070660_100609937 Ga0070660_1006099371 142
589 3300005339 Ga0070660_100932119 Ga0070660_1009321191 142
590 3300005341 Ga0070691_10035653 Ga0070691_100356532 142
591 3300005344 Ga0070661_100116253 Ga0070661_1001162532 142
592 3300005344 Ga0070661_100220441 Ga0070661_1002204413 142
593 3300005344 Ga0070661_100318800 Ga0070661_1003188002 142
594 3300005347 Ga0070668_100101845 Ga0070668_1001018452 142
595 3300005347 Ga0070668_100175219 Ga0070668_1001752192 142
596 3300005347 Ga0070668_100309786 Ga0070668_1003097861 142
597 3300005353 Ga0070669_100528292 Ga0070669_1005282921 142
598 3300005355 Ga0070671_100191403 Ga0070671_1001914032 142
599 3300005355 Ga0070671_100383341 Ga0070671_1003833411 142
600 3300005356 Ga0070674_100477836 Ga0070674_1004778362 142
601 3300005366 Ga0070659_100569554 Ga0070659_1005695541 142
602 3300005367 Ga0070667_100176034 Ga0070667_1001760342 142
603 3300005434 Ga0070709_10054092 Ga0070709_100540923 142
604 3300005435 Ga0070714_100001503 Ga0070714_10000150312 142
605 3300005435 Ga0070714_100438034 Ga0070714_1004380342 142
606 3300005435 Ga0070714_100531195 Ga0070714_1005311952 142
607 3300005436 Ga0070713_100009241 Ga0070713_1000092416 142
608 3300005437 Ga0070710_10004766 Ga0070710_100047668 142
609 3300005439 Ga0070711_100062200 Ga0070711_1000622001 142
610 3300005439 Ga0070711_100502680 Ga0070711_1005026801 142
611 3300005441 Ga0070700_100070735 Ga0070700_1000707353 142
612 3300005455 Ga0070663_100020052 Ga0070663_1000200526 142
613 3300005455 Ga0070663_100056176 Ga0070663_1000561762 142
614 3300005455 Ga0070663_100106058 Ga0070663_1001060582 142
615 3300005455 Ga0070663_100129247 Ga0070663_1001292471 142
616 3300005455 Ga0070663_100436681 Ga0070663_1004366811 142
617 3300005456 Ga0070678_100003659 Ga0070678_1000036596 142
618 3300005456 Ga0070678_100118900 Ga0070678_1001189002 142
619 3300005457 Ga0070662_100035529 Ga0070662_1000355295 142
620 3300005457 Ga0070662_100081802 Ga0070662_1000818022 142
621 3300005457 Ga0070662_100265020 Ga0070662_1002650201 142
622 3300005458 Ga0070681_10035146 Ga0070681_100351466 142
623 3300005459 Ga0068867_100783578 Ga0068867_1007835782 142
624 3300005467 Ga0070706_100263515 Ga0070706_1002635152 142
625 3300005471 Ga0070698_100040993 Ga0070698_1000409932 142
626 3300005518 Ga0070699_101286957 Ga0070699_1012869571 142
627 3300005530 Ga0070679_100021982 Ga0070679_1000219824 142
628 3300005530 Ga0070679_100077530 Ga0070679_1000775302 142
629 3300005530 Ga0070679_100397219 Ga0070679_1003972191 142
630 3300005535 Ga0070684_100076765 Ga0070684_1000767653 142
631 3300005536 Ga0070697_101063056 Ga0070697_1010630561 142
632 3300005539 Ga0068853_100005334 Ga0068853_1000053348 142
633 3300005539 Ga0068853_100040711 Ga0068853_1000407114 142
634 3300005539 Ga0068853_100062602 Ga0068853_1000626022 142
635 3300005544 Ga0070686_100502978 Ga0070686_1005029781 142
636 3300005545 Ga0070695_100399860 Ga0070695_1003998602 142
637 3300005545 Ga0070695_100538480 Ga0070695_1005384802 142
638 3300005546 Ga0070696_100391104 Ga0070696_1003911042 142
639 3300005547 Ga0070693_100067081 Ga0070693_1000670813 142
640 3300005548 Ga0070665_100018669 Ga0070665_1000186693 142
641 3300005548 Ga0070665_100044315 Ga0070665_1000443156 142
642 3300005548 Ga0070665_100110097 Ga0070665_1001100972 142
643 3300005548 Ga0070665_100140384 Ga0070665_1001403842 142
644 3300005548 Ga0070665_100900290 Ga0070665_1009002902 142
645 3300005548 Ga0070665_101273400 Ga0070665_1012734002 142
646 3300005563 Ga0068855_100038159 Ga0068855_1000381592 142
647 3300005563 Ga0068855_100052372 Ga0068855_1000523722 142
648 3300005563 Ga0068855_100218469 Ga0068855_1002184692 142
649 3300005563 Ga0068855_100344202 Ga0068855_1003442022 142
650 3300005563 Ga0068855_101721918 Ga0068855_1017219181 142
651 3300005564 Ga0070664_100227468 Ga0070664_1002274682 142
652 3300005577 Ga0068857_100078149 Ga0068857_1000781491 142
653 3300005577 Ga0068857_100265457 Ga0068857_1002654572 142
654 3300005578 Ga0068854_100076313 Ga0068854_1000763133 142
655 3300005578 Ga0068854_100126538 Ga0068854_1001265383 142
656 3300005578 Ga0068854_100287511 Ga0068854_1002875112 142
657 3300005578 Ga0068854_100546618 Ga0068854_1005466182 142
658 3300005614 Ga0068856_100036723 Ga0068856_1000367232 142
659 3300005614 Ga0068856_100068097 Ga0068856_1000680973 142
660 3300005614 Ga0068856_100071781 Ga0068856_1000717812 142
661 3300005614 Ga0068856_100404857 Ga0068856_1004048572 142
662 3300005615 Ga0070702_100274298 Ga0070702_1002742982 142
663 3300005615 Ga0070702_100364868 Ga0070702_1003648682 142
664 3300005615 Ga0070702_100800800 Ga0070702_1008008001 142
665 3300005616 Ga0068852_100004762 Ga0068852_1000047623 142
666 3300005616 Ga0068852_100127746 Ga0068852_1001277463 142
667 3300005617 Ga0068859_100195058 Ga0068859_1001950582 142
668 3300005617 Ga0068859_100233047 Ga0068859_1002330471 142
669 3300005618 Ga0068864_102264950 Ga0068864_1022649501 142
670 3300005718 Ga0068866_10041298 Ga0068866_100412983 142
671 3300005718 Ga0068866_10785214 Ga0068866_107852141 142
672 3300005718 Ga0068866_10885531 Ga0068866_108855311 142
673 3300005718 Ga0068866_10960974 Ga0068866_109609741 142
674 3300005719 Ga0068861_100250689 Ga0068861_1002506892 142
675 3300005719 Ga0068861_100528020 Ga0068861_1005280202 142
676 3300005719 Ga0068861_100627970 Ga0068861_1006279702 142
677 3300005719 Ga0068861_101286184 Ga0068861_1012861841 142
678 3300005719 Ga0068861_101539450 Ga0068861_1015394501 142
679 3300005834 Ga0068851_10000835 Ga0068851_100008359 142
680 3300005834 Ga0068851_10006013 Ga0068851_100060133 142
681 3300005834 Ga0068851_10142660 Ga0068851_101426602 142
682 3300005834 Ga0068851_10158191 Ga0068851_101581912 142
683 3300005834 Ga0068851_10243997 Ga0068851_102439972 142
684 3300005840 Ga0068870_10103942 Ga0068870_101039422 142
685 3300005841 Ga0068863_100188289 Ga0068863_1001882892 142
686 3300005841 Ga0068863_100731594 Ga0068863_1007315942 142
687 3300005842 Ga0068858_100408049 Ga0068858_1004080492 142
688 3300005842 Ga0068858_100604751 Ga0068858_1006047512 142
689 3300005842 Ga0068858_101185446 Ga0068858_1011854461 142
690 3300005843 Ga0068860_100200283 Ga0068860_1002002833 142
691 3300005843 Ga0068860_100359876 Ga0068860_1003598762 142
692 3300005843 Ga0068860_101377247 Ga0068860_1013772472 142
693 3300005844 Ga0068862_100141665 Ga0068862_1001416653 142
694 3300005844 Ga0068862_100215223 Ga0068862_1002152232 142
695 3300005844 Ga0068862_100867533 Ga0068862_1008675332 142
696 3300005937 Ga0081455_10013697 Ga0081455_100136977 142
697 3300005983 Ga0081540_1003440 Ga0081540_100344012 142
698 3300005983 Ga0081540_1011448 Ga0081540_10114482 142
699 3300005983 Ga0081540_1031530 Ga0081540_10315303 142
700 3300005983 Ga0081540_1143122 Ga0081540_11431222 142
701 3300005983 Ga0081540_1179174 Ga0081540_11791741 142
702 3300006028 Ga0070717_10002312 Ga0070717_100023123 142
703 3300006028 Ga0070717_10658516 Ga0070717_106585162 142
704 3300006038 Ga0075365_10125646 Ga0075365_101256462 142
705 3300006038 Ga0075365_10178904 Ga0075365_101789042 142
706 3300006042 Ga0075368_10135596 Ga0075368_101355962 142
707 3300006042 Ga0075368_10184296 Ga0075368_101842962 142
708 3300006042 Ga0075368_10534277 Ga0075368_105342771 142
709 3300006048 Ga0075363_100257702 Ga0075363_1002577022 142
710 3300006048 Ga0075363_100277714 Ga0075363_1002777142 142
711 3300006163 Ga0070715_10000192 Ga0070715_100001923 142
712 3300006163 Ga0070715_10174292 Ga0070715_101742922 142
713 3300006163 Ga0070715_10346336 Ga0070715_103463362 142
714 3300006173 Ga0070716_100063087 Ga0070716_1000630871 142
715 3300006175 Ga0070712_100004044 Ga0070712_1000040447 142
716 3300006175 Ga0070712_100008540 Ga0070712_1000085401 142
717 3300006177 Ga0075362_10276076 Ga0075362_102760762 142
718 3300006178 Ga0075367_10210784 Ga0075367_102107842 142
719 3300006178 Ga0075367_10264219 Ga0075367_102642192 142
720 3300006178 Ga0075367_10401998 Ga0075367_104019982 142
721 3300006186 Ga0075369_10155208 Ga0075369_101552082 142
722 3300006186 Ga0075369_10404673 Ga0075369_104046732 142
723 3300006195 Ga0075366_10310403 Ga0075366_103104031 142
724 3300006195 Ga0075366_10443540 Ga0075366_104435402 142
725 3300006237 Ga0097621_100045438 Ga0097621_1000454381 142
726 3300006237 Ga0097621_100336554 Ga0097621_1003365542 142
727 3300006353 Ga0075370_10591939 Ga0075370_105919391 142
728 3300006358 Ga0068871_100278163 Ga0068871_1002781632 142
729 3300006358 Ga0068871_100372732 Ga0068871_1003727322 142
730 3300006852 Ga0075433_10937407 Ga0075433_109374071 142
731 3300006881 Ga0068865_100116722 Ga0068865_1001167222 142
732 3300006881 Ga0068865_100212981 Ga0068865_1002129812 142
733 3300006931 Ga0097620_100195051 Ga0097620_1001950512 142
734 3300006931 Ga0097620_100233036 Ga0097620_1002330361 142
735 3300006942 Ga0099824_1004186 Ga0099824_100418616 142
736 3300006943 Ga0099822_1006118 Ga0099822_100611814 142
737 3300007265 Ga0099794_10342109 Ga0099794_103421092 142
738 3300007788 Ga0099795_10001203 Ga0099795_100012038 142
739 3300007788 Ga0099795_10031793 Ga0099795_100317932 142
740 3300007788 Ga0099795_10052099 Ga0099795_100520992 142
741 3300007788 Ga0099795_10411000 Ga0099795_104110001 142
742 3300009092 Ga0105250_10077524 Ga0105250_100775242 142
743 3300009093 Ga0105240_10044376 Ga0105240_100443762 142
744 3300009093 Ga0105240_10065642 Ga0105240_100656425 142
745 3300009093 Ga0105240_10078471 Ga0105240_100784715 142
746 3300009093 Ga0105240_10348106 Ga0105240_103481061 142
747 3300009093 Ga0105240_10874452 Ga0105240_108744522 142
748 3300009098 Ga0105245_10026228 Ga0105245_100262283 142
749 3300009098 Ga0105245_10027787 Ga0105245_100277876 142
750 3300009098 Ga0105245_10968357 Ga0105245_109683572 142
751 3300009098 Ga0105245_11474897 Ga0105245_114748971 142
752 3300009101 Ga0105247_10168177 Ga0105247_101681772 142
753 3300009174 Ga0105241_10073753 Ga0105241_100737532 142
754 3300009174 Ga0105241_10768650 Ga0105241_107686501 142
755 3300009176 Ga0105242_10088880 Ga0105242_100888803 142
756 3300009176 Ga0105242_10396170 Ga0105242_103961702 142
757 3300009177 Ga0105248_10135116 Ga0105248_101351163 142
758 3300009177 Ga0105248_10666508 Ga0105248_106665082 142
759 3300009177 Ga0105248_11025023 Ga0105248_110250232 142
760 3300009545 Ga0105237_10007135 Ga0105237_100071353 142
761 3300009545 Ga0105237_10042680 Ga0105237_100426805 142
762 3300009545 Ga0105237_10150862 Ga0105237_101508624 142
763 3300009545 Ga0105237_10191711 Ga0105237_101917112 142
764 3300009545 Ga0105237_10310707 Ga0105237_103107071 142
765 3300009551 Ga0105238_10008586 Ga0105238_1000858611 142
766 3300009551 Ga0105238_10021503 Ga0105238_100215034 142
767 3300009551 Ga0105238_10025858 Ga0105238_100258582 142
768 3300009551 Ga0105238_10173743 Ga0105238_101737433 142
769 3300009551 Ga0105238_10516787 Ga0105238_105167872 142
770 3300009553 Ga0105249_10295127 Ga0105249_102951273 142
771 3300010159 Ga0099796_10021942 Ga0099796_100219422 142
772 3300010159 Ga0099796_10022456 Ga0099796_100224561 142
773 3300010375 Ga0105239_10008381 Ga0105239_1000838111 142
774 3300010375 Ga0105239_10040184 Ga0105239_100401842 142
775 3300010375 Ga0105239_10085316 Ga0105239_100853162 142
776 3300010375 Ga0105239_10124685 Ga0105239_101246853 142
777 3300010375 Ga0105239_10617559 Ga0105239_106175592 142
778 3300010375 Ga0105239_10758819 Ga0105239_107588192 142
779 3300013104 Ga0157370_10034059 Ga0157370_100340592 142
780 3300013105 Ga0157369_10069789 Ga0157369_100697892 142
781 3300013105 Ga0157369_10387188 Ga0157369_103871881 142
782 3300013105 Ga0157369_11551367 Ga0157369_115513671 142
783 3300013296 Ga0157374_10003326 Ga0157374_100033267 142
784 3300013296 Ga0157374_10989339 Ga0157374_109893392 142
785 3300013297 Ga0157378_10178253 Ga0157378_101782532 142
786 3300013306 Ga0163162_10026850 Ga0163162_100268504 142
787 3300013306 Ga0163162_10367028 Ga0163162_103670282 142
788 3300013306 Ga0163162_10410342 Ga0163162_104103422 142
789 3300013306 Ga0163162_10670628 Ga0163162_106706282 142
790 3300013307 Ga0157372_10329977 Ga0157372_103299773 142
791 3300013308 Ga0157375_10298571 Ga0157375_102985712 142
792 3300013308 Ga0157375_10789035 Ga0157375_107890352 142
793 3300014325 Ga0163163_10007553 Ga0163163_100075537 142
794 3300014325 Ga0163163_10399369 Ga0163163_103993693 142
795 3300014325 Ga0163163_10424397 Ga0163163_104243972 142
796 3300014325 Ga0163163_10693921 Ga0163163_106939212 142
797 3300014326 Ga0157380_10475671 Ga0157380_104756712 142
798 3300014968 Ga0157379_10245584 Ga0157379_102455843 142
799 3300014968 Ga0157379_11818768 Ga0157379_118187681 142
800 3300014969 Ga0157376_10017469 Ga0157376_100174696 142
801 3300014969 Ga0157376_10591912 Ga0157376_105919122 142
802 3300014969 Ga0157376_11412126 Ga0157376_114121262 142
803 3300017792 Ga0163161_10369875 Ga0163161_103698752 142
804 3300017792 Ga0163161_11204541 Ga0163161_112045411 142
805 3300019183 Ga0184601_109990 Ga0184601_1099901 142
806 3300020070 Ga0206356_10091318 Ga0206356_100913182 142
807 3300020081 Ga0206354_10938124 Ga0206354_109381242 142
808 3300020082 Ga0206353_12039802 Ga0206353_120398022 142
809 3300021361 Ga0213872_10120974 Ga0213872_101209742 142
810 3300021377 Ga0213874_10106109 Ga0213874_101061091 142
811 3300025297 Ga0209758_1003142 Ga0209758_100314211 142
812 3300025315 Ga0207697_10065228 Ga0207697_100652282 142
813 3300025321 Ga0207656_10001089 Ga0207656_100010899 142
814 3300025321 Ga0207656_10006242 Ga0207656_100062423 142
815 3300025321 Ga0207656_10286944 Ga0207656_102869441 142
816 3300025898 Ga0207692_10000798 Ga0207692_100007987 142
817 3300025898 Ga0207692_10001866 Ga0207692_100018664 142
818 3300025899 Ga0207642_10031389 Ga0207642_100313892 142
819 3300025899 Ga0207642_10057482 Ga0207642_100574822 142
820 3300025901 Ga0207688_10030058 Ga0207688_100300585 142
821 3300025904 Ga0207647_10003452 Ga0207647_1000345212 142
822 3300025905 Ga0207685_10017711 Ga0207685_100177114 142
823 3300025905 Ga0207685_10365411 Ga0207685_103654112 142
824 3300025906 Ga0207699_10001678 Ga0207699_100016782 142
825 3300025906 Ga0207699_10028617 Ga0207699_100286172 142
826 3300025907 Ga0207645_10415238 Ga0207645_104152382 142
827 3300025908 Ga0207643_10113617 Ga0207643_101136172 142
828 3300025910 Ga0207684_10441852 Ga0207684_104418522 142
829 3300025910 Ga0207684_10553006 Ga0207684_105530062 142
830 3300025911 Ga0207654_10001074 Ga0207654_1000107410 142
831 3300025911 Ga0207654_10462097 Ga0207654_104620971 142
832 3300025912 Ga0207707_10002655 Ga0207707_100026557 142
833 3300025913 Ga0207695_10135688 Ga0207695_101356882 142
834 3300025914 Ga0207671_10177765 Ga0207671_101777652 142
835 3300025914 Ga0207671_10372967 Ga0207671_103729672 142
836 3300025914 Ga0207671_10524648 Ga0207671_105246481 142
837 3300025914 Ga0207671_11182731 Ga0207671_111827311 142
838 3300025915 Ga0207693_10001679 Ga0207693_1000167913 142
839 3300025915 Ga0207693_10105122 Ga0207693_101051223 142
840 3300025916 Ga0207663_10000672 Ga0207663_100006728 142
841 3300025916 Ga0207663_10590031 Ga0207663_105900312 142
842 3300025916 Ga0207663_10602854 Ga0207663_106028542 142
843 3300025917 Ga0207660_10028715 Ga0207660_100287154 142
844 3300025917 Ga0207660_10041034 Ga0207660_100410344 142
845 3300025917 Ga0207660_10130755 Ga0207660_101307552 142
846 3300025919 Ga0207657_10004801 Ga0207657_100048019 142
847 3300025919 Ga0207657_10967270 Ga0207657_109672701 142
848 3300025920 Ga0207649_10129301 Ga0207649_101293012 142
849 3300025920 Ga0207649_10400411 Ga0207649_104004111 142
850 3300025921 Ga0207652_10002660 Ga0207652_100026609 142
851 3300025924 Ga0207694_10000271 Ga0207694_100002711 142
852 3300025924 Ga0207694_10021788 Ga0207694_100217887 142
853 3300025924 Ga0207694_10126639 Ga0207694_101266392 142
854 3300025927 Ga0207687_10023036 Ga0207687_100230363 142
855 3300025927 Ga0207687_10852633 Ga0207687_108526332 142
856 3300025927 Ga0207687_11691001 Ga0207687_116910011 142
857 3300025928 Ga0207700_10005119 Ga0207700_100051197 142
858 3300025929 Ga0207664_10012380 Ga0207664_100123806 142
859 3300025929 Ga0207664_10815116 Ga0207664_108151161 142
860 3300025931 Ga0207644_10464988 Ga0207644_104649881 142
861 3300025931 Ga0207644_10473889 Ga0207644_104738892 142
862 3300025932 Ga0207690_10179248 Ga0207690_101792482 142
863 3300025932 Ga0207690_10199483 Ga0207690_101994832 142
864 3300025932 Ga0207690_11369522 Ga0207690_113695221 142
865 3300025933 Ga0207706_10055641 Ga0207706_100556413 142
866 3300025933 Ga0207706_10093304 Ga0207706_100933042 142
867 3300025933 Ga0207706_10576871 Ga0207706_105768712 142
868 3300025933 Ga0207706_10727540 Ga0207706_107275401 142
869 3300025934 Ga0207686_10041734 Ga0207686_100417342 142
870 3300025934 Ga0207686_10299322 Ga0207686_102993222 142
871 3300025935 Ga0207709_10453503 Ga0207709_104535031 142
872 3300025935 Ga0207709_10942025 Ga0207709_109420252 142
873 3300025937 Ga0207669_10312440 Ga0207669_103124402 142
874 3300025937 Ga0207669_10353849 Ga0207669_103538492 142
875 3300025938 Ga0207704_10162045 Ga0207704_101620452 142
876 3300025939 Ga0207665_10000700 Ga0207665_1000070025 142
877 3300025939 Ga0207665_10078292 Ga0207665_100782921 142
878 3300025939 Ga0207665_10119560 Ga0207665_101195602 142
879 3300025941 Ga0207711_10780215 Ga0207711_107802152 142
880 3300025942 Ga0207689_10080252 Ga0207689_100802523 142
881 3300025942 Ga0207689_10190000 Ga0207689_101900003 142
882 3300025942 Ga0207689_10284579 Ga0207689_102845792 142
883 3300025942 Ga0207689_10483259 Ga0207689_104832592 142
884 3300025944 Ga0207661_10481903 Ga0207661_104819032 142
885 3300025945 Ga0207679_10797422 Ga0207679_107974222 142
886 3300025949 Ga0207667_10003903 Ga0207667_1000390311 142
887 3300025949 Ga0207667_10005344 Ga0207667_100053446 142
888 3300025949 Ga0207667_10047821 Ga0207667_100478216 142
889 3300025949 Ga0207667_10348616 Ga0207667_103486161 142
890 3300025972 Ga0207668_10249957 Ga0207668_102499572 142
891 3300025972 Ga0207668_10484392 Ga0207668_104843922 142
892 3300025972 Ga0207668_10560910 Ga0207668_105609102 142
893 3300025981 Ga0207640_10007468 Ga0207640_100074685 142
894 3300025981 Ga0207640_10105171 Ga0207640_101051712 142
895 3300025981 Ga0207640_10289366 Ga0207640_102893662 142
896 3300025986 Ga0207658_10311950 Ga0207658_103119502 142
897 3300025986 Ga0207658_10484966 Ga0207658_104849662 142
898 3300026023 Ga0207677_10011044 Ga0207677_100110446 142
899 3300026023 Ga0207677_10420316 Ga0207677_104203162 142
900 3300026035 Ga0207703_10075453 Ga0207703_100754531 142
901 3300026035 Ga0207703_10683214 Ga0207703_106832142 142
902 3300026041 Ga0207639_10172869 Ga0207639_101728693 142
903 3300026041 Ga0207639_10275687 Ga0207639_102756872 142
904 3300026041 Ga0207639_10295835 Ga0207639_102958352 142
905 3300026041 Ga0207639_11217495 Ga0207639_112174952 142
906 3300026067 Ga0207678_10010552 Ga0207678_100105526 142
907 3300026067 Ga0207678_10073165 Ga0207678_100731652 142
908 3300026067 Ga0207678_10089069 Ga0207678_100890693 142
909 3300026067 Ga0207678_10234738 Ga0207678_102347382 142
910 3300026067 Ga0207678_11296226 Ga0207678_112962261 142
911 3300026078 Ga0207702_10000005 Ga0207702_10000005253 142
912 3300026078 Ga0207702_10239096 Ga0207702_102390962 142
913 3300026078 Ga0207702_10249513 Ga0207702_102495132 142
914 3300026088 Ga0207641_10176651 Ga0207641_101766512 142
915 3300026088 Ga0207641_10848347 Ga0207641_108483472 142
916 3300026088 Ga0207641_11796530 Ga0207641_117965301 142
917 3300026089 Ga0207648_10884066 Ga0207648_108840662 142
918 3300026095 Ga0207676_10604521 Ga0207676_106045211 142
919 3300026116 Ga0207674_10007442 Ga0207674_100074425 142
920 3300026116 Ga0207674_10024446 Ga0207674_100244463 142
921 3300026118 Ga0207675_100628200 Ga0207675_1006282002 142
922 3300026118 Ga0207675_100632621 Ga0207675_1006326212 142
923 3300026118 Ga0207675_101396566 Ga0207675_1013965661 142
924 3300026118 Ga0207675_101426250 Ga0207675_1014262501 142
925 3300026121 Ga0207683_10027486 Ga0207683_100274862 142
926 3300026121 Ga0207683_10032383 Ga0207683_100323832 142
927 3300026121 Ga0207683_11210045 Ga0207683_112100452 142
928 3300026142 Ga0207698_10065686 Ga0207698_100656863 142
929 3300027357 Ga0209589_1000009 Ga0209589_1000009156 142
930 3300027361 Ga0209489_100010 Ga0209489_100010114 142
931 3300027363 Ga0209700_100017 Ga0209700_100017114 142
932 3300028379 Ga0268266_10016992 Ga0268266_100169922 142
933 3300028379 Ga0268266_10019219 Ga0268266_100192192 142
934 3300028379 Ga0268266_10093175 Ga0268266_100931753 142
935 3300028379 Ga0268266_10335405 Ga0268266_103354052 142
936 3300028379 Ga0268266_10353387 Ga0268266_103533872 142
937 3300028379 Ga0268266_10416169 Ga0268266_104161692 142
938 3300028379 Ga0268266_10907006 Ga0268266_109070062 142
939 3300028379 Ga0268266_11258179 Ga0268266_112581792 142
940 3300028379 Ga0268266_12108609 Ga0268266_121086091 142
941 3300028380 Ga0268265_10080305 Ga0268265_100803053 142
942 3300028380 Ga0268265_10240729 Ga0268265_102407292 142
943 3300028380 Ga0268265_10368469 Ga0268265_103684692 142
944 3300028380 Ga0268265_11718478 Ga0268265_117184781 142
945 3300028381 Ga0268264_10000035 Ga0268264_10000035277 142
946 3300028381 Ga0268264_10211912 Ga0268264_102119122 142
947 3300028381 Ga0268264_10346086 Ga0268264_103460862 142
948 3300028381 Ga0268264_11024525 Ga0268264_110245251 142
949 3300028381 Ga0268264_12374707 Ga0268264_123747072 142
950 3300028794 Ga0307515_10141133 Ga0307515_101411332 142
951 3300028794 Ga0307515_10855676 Ga0307515_108556761 142
952 3300030522 Ga0307512_10296696 Ga0307512_102966962 142
953 3300031235 Ga0265330_10115115 Ga0265330_101151152 142
954 3300031238 Ga0265332_10012628 Ga0265332_100126283 142
955 3300031238 Ga0265332_10029389 Ga0265332_100293892 142
956 3300031239 Ga0265328_10136833 Ga0265328_101368332 142
957 3300031241 Ga0265325_10001459 Ga0265325_1000145916 142
958 3300031249 Ga0265339_10116551 Ga0265339_101165512 142
959 3300031249 Ga0265339_10125533 Ga0265339_101255331 142
960 3300031250 Ga0265331_10012884 Ga0265331_100128844 142
961 3300031250 Ga0265331_10067340 Ga0265331_100673402 142
962 3300031344 Ga0265316_10024414 Ga0265316_100244147 142
963 3300031344 Ga0265316_10116509 Ga0265316_101165092 142
964 3300031344 Ga0265316_10513478 Ga0265316_105134782 142
965 3300031456 Ga0307513_10710277 Ga0307513_107102771 142
966 3300031507 Ga0307509_10043479 Ga0307509_100434794 142
967 3300031507 Ga0307509_10111569 Ga0307509_101115693 142
968 3300031548 Ga0307408_100297283 Ga0307408_1002972832 142
969 3300031548 Ga0307408_100478711 Ga0307408_1004787112 142
970 3300031595 Ga0265313_10053430 Ga0265313_100534303 142
971 3300031616 Ga0307508_10433683 Ga0307508_104336832 142
972 3300031616 Ga0307508_10470827 Ga0307508_104708272 142
973 3300031616 Ga0307508_10474521 Ga0307508_104745212 142
974 3300031711 Ga0265314_10002371 Ga0265314_1000237111 142
975 3300031712 Ga0265342_10046188 Ga0265342_100461881 142
976 3300031712 Ga0265342_10255286 Ga0265342_102552861 142
977 3300031730 Ga0307516_10009732 Ga0307516_1000973210 142
978 3300031730 Ga0307516_10149556 Ga0307516_101495563 142
979 3300031730 Ga0307516_10244301 Ga0307516_102443012 142
980 3300031903 Ga0307407_10272742 Ga0307407_102727422 142
981 3300031911 Ga0307412_10245600 Ga0307412_102456002 142
982 3300031995 Ga0307409_100422445 Ga0307409_1004224452 142
983 3300033179 Ga0307507_10086856 Ga0307507_100868563 142
984 3300033180 Ga0307510_10009746 Ga0307510_1000974612 142
985 3300033180 Ga0307510_10048002 Ga0307510_100480025 142
986 3300033442 Ga0315911_1000009 Ga0315911_1000009288 142
987 3300033544 Ga0316215_1006418 Ga0316215_10064182 142
988 3300034816 Ga0373930_0069732 Ga0373930_0069732_152_580 142
989 3300035084 Ga0373928_0222476 Ga0373928_0222476_17_469 142
990 3300035086 Ga0373934_0015478 Ga0373934_0015478_1327_1770 142
991 3300035086 Ga0373934_0160854 Ga0373934_0160854_45_473 142
992 3300035088 Ga0373940_0012311 Ga0373940_0012311_561_989 142
993 3300035090 Ga0373949_0091805 Ga0373949_0091805_18_446 142
994 3300035092 Ga0373952_0008165 Ga0373952_0008165_1270_1698 142
995 3300035092 Ga0373952_0073418 Ga0373952_0073418_204_632 142
996 3300035111 Ga0373923_0051235 Ga0373923_0051235_645_1088 142
997 3300035113 Ga0373936_0089725 Ga0373936_0089725_407_835 142
998 3300035117 Ga0373953_0002753 Ga0373953_0002753_2612_3055 142
999 3300035117 Ga0373953_0366716 Ga0373953_0366716_21_449 142
1000 3300035118 Ga0373954_0046329 Ga0373954_0046329_484_927 142
1001 3300035118 Ga0373954_0089602 Ga0373954_0089602_821_1249 142
1002 3300035119 Ga0373956_0001884 Ga0373956_0001884_5558_6001 142
1003 3300035120 Ga0373957_0000200 Ga0373957_0000200_594_1037 142
1004 3300035120 Ga0373957_0529496 Ga0373957_0529496_11_439 142
1005 3300035170 Ga0373943_0150435 Ga0373943_0150435_444_872 142
1006 3300035170 Ga0373943_0513366 Ga0373943_0513366_43_471 142
1007 3300035171 Ga0373946_0124782 Ga0373946_0124782_566_994 142
1008 3300035172 Ga0373955_0005004 Ga0373955_0005004_2866_3309 142
1009 3300035207 Ga0373942_0033816 Ga0373942_0033816_196_624 142
1010 3300035242 Ga0373962_0178067 Ga0373962_0178067_220_648 142
1011 3300035691 Ga0373931_0004494 Ga0373931_0004494_4156_4584 142
1012 3300035691 Ga0373931_0216727 Ga0373931_0216727_59_511 142
1013 3300035692 Ga0373935_0082494 Ga0373935_0082494_440_868 142
1014 3300035692 Ga0373935_0109527 Ga0373935_0109527_876_1304 142
1015 3300035695 Ga0373927_0026102 Ga0373927_0026102_361_789 142
1016 3300035695 Ga0373927_0180331 Ga0373927_0180331_896_1324 142
1017 3300035724 Ga0373933_0022657 Ga0373933_0022657_912_1355 142
1018 3300035724 Ga0373933_0773427 Ga0373933_0773427_28_456 142
1019 3300035725 Ga0373947_0017146 Ga0373947_0017146_2521_2949 142
1020 3300035725 Ga0373947_0168552 Ga0373947_0168552_270_698 142
1021 3300035725 Ga0373947_0253866 Ga0373947_0253866_29_457 142
1022 3300035725 Ga0373947_0464391 Ga0373947_0464391_285_713 142
1023 3300036242 Ga0310104_03485 Ga0310104_03485_835_1263 142
1024 3300036401 Ga0373937_0014785 Ga0373937_0014785_3431_3874 142
1025 3300036401 Ga0373937_0054734 Ga0373937_0054734_441_869 142
1026 3300036401 Ga0373937_0767649 Ga0373937_0767649_255_683 142
1027 3300036459 Ga0372808_005034 Ga0372808_005034_300_728 142
1028 3300037068 Ga0373925_0204767 Ga0373925_0204767_1030_1458 142
1029 3300037068 Ga0373925_0257427 Ga0373925_0257427_180_608 142
1030 3300037068 Ga0373925_0328933 Ga0373925_0328933_269_697 142
1031 3300037418 Ga0395900_0428366 Ga0395900_0428366_710_1138 142
1032 3300037471 Ga0395905_0053544 Ga0395905_0053544_2497_2925 142
1033 3300038443 Ga0395901_0116181 Ga0395901_0116181_1938_2366 142
1034 3300039438 Ga0436360_0062375 Ga0436360_0062375_390_818 142
1035 3300039438 Ga0436360_0288357 Ga0436360_0288357_1771_2199 142
1036 3300039447 Ga0436361_1160317 Ga0436361_1160317_1116_1565 142
1037 3300039450 Ga0436363_0674671 Ga0436363_0674671_685_1113 142
1038 3300039450 Ga0436363_0928946 Ga0436363_0928946_174_605 142
1039 3300041452 Ga0451793_0481979 Ga0451793_0481979_181_609 142
1040 3300041452 Ga0451793_1831426 Ga0451793_1831426_849_1277 142
1041 3300041453 Ga0451797_0276797 Ga0451797_0276797_110_538 142
1042 3300041456 Ga0451795_1072685 Ga0451795_1072685_94_522 142
1043 3300041486 Ga0451807_0740528 Ga0451807_0740528_131_559 142
1044 3300041486 Ga0451807_2768343 Ga0451807_2768343_30_458 142
1045 3300041492 Ga0451835_0414532 Ga0451835_0414532_330_758 142
1046 3300041494 Ga0451837_1123549 Ga0451837_1123549_750_1178 142
1047 3300041503 Ga0451847_0288977 Ga0451847_0288977_33_461 142
1048 3300041505 Ga0451849_1171485 Ga0451849_1171485_38_466 142
1049 3300041509 Ga0451843_0960431 Ga0451843_0960431_274_702 142
1050 3300041512 Ga0451853_0403605 Ga0451853_0403605_48_476 142
1051 3300042438 Ga0439459_0022833 Ga0439459_0022833_504_932 142
1052 3300044656 Ga0466969_0138052 Ga0466969_0138052_325_756 142
1053 3300044684 Ga0466966_0182565 Ga0466966_0182565_555_986 142
1054 3300044735 Ga0466968_0236576 Ga0466968_0236576_255_686 142
1055 3300045049 Ga0466959_0155138 Ga0466959_0155138_661_1092 142
1056 3300046452 Ga0495617_213296 Ga0495617_213296_55_483 142
1057 3300046454 Ga0495592_0002897 Ga0495592_0002897_10230_10673 142
1058 3300046454 Ga0495592_0150404 Ga0495592_0150404_1037_1465 142
1059 3300046455 Ga0495603_0016547 Ga0495603_0016547_960_1388 142
1060 3300046455 Ga0495603_0031419 Ga0495603_0031419_2529_2957 142
1061 3300046455 Ga0495603_0101068 Ga0495603_0101068_1118_1549 142
1062 3300046455 Ga0495603_0388618 Ga0495603_0388618_135_563 142
1063 3300046459 Ga0495629_0064923 Ga0495629_0064923_195_638 142
1064 3300046459 Ga0495629_0219080 Ga0495629_0219080_242_670 142
1065 3300046460 Ga0495638_0018849 Ga0495638_0018849_3110_3550 142
1066 3300046460 Ga0495638_0074041 Ga0495638_0074041_611_1051 142
1067 3300046460 Ga0495638_0221135 Ga0495638_0221135_194_622 142
1068 3300046462 Ga0495651_0193645 Ga0495651_0193645_669_1097 142
1069 3300046463 Ga0495653_0066003 Ga0495653_0066003_828_1271 142
1070 3300046473 Ga0495582_0173382 Ga0495582_0173382_690_1118 142
1071 3300046475 Ga0495639_0283323 Ga0495639_0283323_207_635 142
1072 3300046475 Ga0495639_0744274 Ga0495639_0744274_55_483 142
1073 3300046476 Ga0495662_0410640 Ga0495662_0410640_47_475 142
1074 3300046477 Ga0495664_0061043 Ga0495664_0061043_1568_1996 142
1075 3300046491 Ga0495584_0087161 Ga0495584_0087161_73_501 142
1076 3300046491 Ga0495584_0095500 Ga0495584_0095500_91_525 142
1077 3300046491 Ga0495584_0100078 Ga0495584_0100078_12_440 142
1078 3300046491 Ga0495584_0350908 Ga0495584_0350908_218_646 142
1079 3300046507 Ga0495606_0141205 Ga0495606_0141205_65_505 142
1080 3300046507 Ga0495606_0366619 Ga0495606_0366619_249_677 142
1081 3300046507 Ga0495606_0586742 Ga0495606_0586742_80_508 142
1082 3300046511 Ga0495608_0017985 Ga0495608_0017985_1761_2204 142
1083 3300046512 Ga0495610_0061518 Ga0495610_0061518_476_916 142
1084 3300046513 Ga0495616_0271533 Ga0495616_0271533_148_576 142
1085 3300046515 Ga0495620_0027074 Ga0495620_0027074_1898_2338 142
1086 3300046517 Ga0495630_0849392 Ga0495630_0849392_65_493 142
1087 3300046518 Ga0495631_0083502 Ga0495631_0083502_195_635 142
1088 3300046518 Ga0495631_0184737 Ga0495631_0184737_80_508 142
1089 3300046519 Ga0495632_0116801 Ga0495632_0116801_282_710 142
1090 3300046522 Ga0495643_0058784 Ga0495643_0058784_85_525 142
1091 3300046524 Ga0495648_0190190 Ga0495648_0190190_73_513 142
1092 3300046529 Ga0495652_0023007 Ga0495652_0023007_1580_2023 142
1093 3300046529 Ga0495652_0196823 Ga0495652_0196823_586_1014 142
1094 3300046529 Ga0495652_0560670 Ga0495652_0560670_65_493 142
1095 3300046530 Ga0495654_0025118 Ga0495654_0025118_775_1215 142
1096 3300046531 Ga0495665_0477316 Ga0495665_0477316_62_490 142
1097 3300046533 Ga0495640_0005616 Ga0495640_0005616_5627_6070 142
1098 3300046533 Ga0495640_0192589 Ga0495640_0192589_712_1140 142
1099 3300046533 Ga0495640_0364683 Ga0495640_0364683_136_576 142
1100 3300046536 Ga0495587_0025519 Ga0495587_0025519_2922_3365 142
1101 3300046538 Ga0495609_0434335 Ga0495609_0434335_68_496 142
1102 3300046539 Ga0495621_0369815 Ga0495621_0369815_15_443 142
1103 3300046542 Ga0495597_0048627 Ga0495597_0048627_365_793 142
1104 3300046543 Ga0495645_0013424 Ga0495645_0013424_835_1278 142
1105 3300046543 Ga0495645_0060122 Ga0495645_0060122_902_1330 142
1106 3300046543 Ga0495645_0128923 Ga0495645_0128923_426_869 142
1107 3300046557 Ga0495622_0008839 Ga0495622_0008839_4176_4616 142
1108 3300046558 Ga0495633_0500550 Ga0495633_0500550_83_523 142
1109 3300046559 Ga0495667_0009980 Ga0495667_0009980_955_1398 142
1110 3300046616 Ga0495668_0153470 Ga0495668_0153470_470_898 142
1111 3300046616 Ga0495668_0370538 Ga0495668_0370538_95_535 142
1112 3300046616 Ga0495668_0410025 Ga0495668_0410025_46_474 142
1113 3300046616 Ga0495668_0556326 Ga0495668_0556326_111_539 142
1114 3300046616 Ga0495668_0804889 Ga0495668_0804889_42_470 142
1115 3300046642 Ga0495634_0034579 Ga0495634_0034579_246_689 142
1116 3300046642 Ga0495634_0174787 Ga0495634_0174787_866_1294 142
1117 3300046660 Ga0495625_0178398 Ga0495625_0178398_143_583 142
1118 3300046660 Ga0495625_0400645 Ga0495625_0400645_59_487 142
1119 3300046660 Ga0495625_0613134 Ga0495625_0613134_78_506 142
1120 3300046663 Ga0495635_0001058 Ga0495635_0001058_2197_2640 142
1121 3300046675 Ga0495657_0011523 Ga0495657_0011523_2198_2641 142
1122 3300046675 Ga0495657_0439712 Ga0495657_0439712_255_683 142
1123 3300046678 Ga0495599_0082999 Ga0495599_0082999_742_1185 142
1124 3300046678 Ga0495599_0441992 Ga0495599_0441992_48_491 142
1125 3300046679 Ga0495623_0018971 Ga0495623_0018971_2418_2861 142
1126 3300046679 Ga0495623_0142637 Ga0495623_0142637_191_619 142
1127 3300046679 Ga0495623_0153410 Ga0495623_0153410_90_533 142
1128 3300046680 Ga0495646_0000934 Ga0495646_0000934_163_606 142
1129 3300046680 Ga0495646_0242207 Ga0495646_0242207_223_651 142
1130 3300046683 Ga0495658_0101562 Ga0495658_0101562_285_713 142
1131 3300046689 Ga0495613_0044384 Ga0495613_0044384_1214_1657 142
1132 3300046691 Ga0495670_0379468 Ga0495670_0379468_264_692 142
1133 3300046692 Ga0495671_0041406 Ga0495671_0041406_1343_1783 142
1134 3300046694 Ga0495649_0332373 Ga0495649_0332373_109_537 142
1135 3300046794 Ga0495589_0561386 Ga0495589_0561386_70_498 142
1136 3300046809 Ga0495600_0007371 Ga0495600_0007371_4832_5275 142
1137 3300047315 Ga0495581_0155785 Ga0495581_0155785_97_525 142
1138 3300047317 Ga0495604_0075423 Ga0495604_0075423_1089_1517 142
1139 3300047317 Ga0495604_0119190 Ga0495604_0119190_848_1291 142
1140 3300047317 Ga0495604_0155781 Ga0495604_0155781_1009_1452 142
1141 3300047317 Ga0495604_0874925 Ga0495604_0874925_100_528 142
1142 3300047319 Ga0495674_0087619 Ga0495674_0087619_1792_2235 142
1143 3300047319 Ga0495674_1192249 Ga0495674_1192249_107_535 142
1144 3300047320 Ga0495672_0025437 Ga0495672_0025437_1382_1810 142
1145 3300047320 Ga0495672_0326863 Ga0495672_0326863_44_472 142
1146 3300047321 Ga0495676_0457552 Ga0495676_0457552_191_619 142
1147 3300047321 Ga0495676_0738591 Ga0495676_0738591_15_455 142
1148 3300047322 Ga0495680_0020992 Ga0495680_0020992_1452_1895 142
1149 3300047322 Ga0495680_0280875 Ga0495680_0280875_679_1107 142
1150 3300047444 Ga0495675_0004307 Ga0495675_0004307_5640_6083 142
1151 3300047444 Ga0495675_0521181 Ga0495675_0521181_137_565 142
1152 3300047469 Ga0495673_0179709 Ga0495673_0179709_169_597 142
1153 3300047471 Ga0495684_0016173 Ga0495684_0016173_2855_3298 142
1154 3300047471 Ga0495684_0046854 Ga0495684_0046854_1733_2161 142
1155 3300047472 Ga0495686_0545627 Ga0495686_0545627_142_570 142
1156 3300047673 Ga0495593_0007370 Ga0495593_0007370_4186_4629 142
1157 3300048088 Ga0495602_0115407 Ga0495602_0115407_247_675 142
1158 3300048088 Ga0495602_0123311 Ga0495602_0123311_1106_1549 142
1159 3300048088 Ga0495602_0734926 Ga0495602_0734926_129_557 142
1160 3300048903 Ga0496100_0013579 Ga0496100_0013579_3588_4016 142
1161 3300048904 Ga0496101_0004886 Ga0496101_0004886_332_760 142
1162 3300048904 Ga0496101_0220684 Ga0496101_0220684_659_1087 142
1163 3300048904 Ga0496101_1448243 Ga0496101_1448243_79_507 142
1164 3300048905 Ga0496102_0180783 Ga0496102_0180783_207_635 142
1165 3300048905 Ga0496102_0703514 Ga0496102_0703514_495_923 142
1166 3300048905 Ga0496102_1418411 Ga0496102_1418411_99_545 142
1167 3300048906 Ga0496103_0348816 Ga0496103_0348816_115_549 142
1168 3300048907 Ga0496104_0022766 Ga0496104_0022766_295_723 142
1169 3300048907 Ga0496104_0074007 Ga0496104_0074007_207_635 142
1170 3300048908 Ga0496105_0024293 Ga0496105_0024293_3137_3565 142
1171 3300048908 Ga0496105_0364340 Ga0496105_0364340_106_534 142
1172 3300048908 Ga0496105_0484394 Ga0496105_0484394_208_636 142
1173 3300048909 Ga0496106_0003078 Ga0496106_0003078_1461_1889 142
1174 3300048909 Ga0496106_0014048 Ga0496106_0014048_4485_4913 142
1175 3300048909 Ga0496106_0151061 Ga0496106_0151061_176_616 142
1176 3300048909 Ga0496106_0260976 Ga0496106_0260976_834_1262 142
1177 3300048909 Ga0496106_0575394 Ga0496106_0575394_222_650 142
1178 3300048909 Ga0496106_1432746 Ga0496106_1432746_62_490 142
1179 3300048910 Ga0496107_0075070 Ga0496107_0075070_952_1380 142
1180 3300048910 Ga0496107_0700981 Ga0496107_0700981_129_557 142
1181 3300048911 Ga0496108_1168535 Ga0496108_1168535_107_553 142
1182 3300048911 Ga0496108_1566029 Ga0496108_1566029_22_456 142
1183 3300048912 Ga0496109_0033152 Ga0496109_0033152_832_1260 142
1184 3300048912 Ga0496109_1139874 Ga0496109_1139874_107_535 142
1185 3300048913 Ga0496110_0024161 Ga0496110_0024161_970_1398 142
1186 3300048913 Ga0496110_0174904 Ga0496110_0174904_1483_1911 142
1187 3300048914 Ga0496111_0018238 Ga0496111_0018238_1049_1477 142
1188 3300048914 Ga0496111_0609522 Ga0496111_0609522_344_778 142
1189 3300048914 Ga0496111_0737202 Ga0496111_0737202_119_565 142
1190 3300048915 Ga0496112_0042417 Ga0496112_0042417_2771_3199 142
1191 3300048915 Ga0496112_0075320 Ga0496112_0075320_1576_2004 142
1192 3300048915 Ga0496112_0154960 Ga0496112_0154960_147_581 142
1193 3300048916 Ga0496113_0062718 Ga0496113_0062718_1338_1766 142
1194 3300048916 Ga0496113_0079460 Ga0496113_0079460_404_832 142
1195 3300048916 Ga0496113_0486911 Ga0496113_0486911_347_775 142
1196 3300048917 Ga0496114_0010129 Ga0496114_0010129_4740_5168 142
1197 3300048917 Ga0496114_1580797 Ga0496114_1580797_13_441 142
1198 3300048918 Ga0496115_0009019 Ga0496115_0009019_4657_5085 142
1199 3300048918 Ga0496115_0049091 Ga0496115_0049091_2907_3335 142
1200 3300048918 Ga0496115_0129663 Ga0496115_0129663_468_896 142
1201 3300048919 Ga0496116_0168176 Ga0496116_0168176_252_686 142
1202 3300048920 Ga0496117_0037664 Ga0496117_0037664_1083_1511 142
1203 3300048920 Ga0496117_0055971 Ga0496117_0055971_1840_2280 142
1204 3300048920 Ga0496117_0182726 Ga0496117_0182726_125_565 142
1205 3300048920 Ga0496117_0191195 Ga0496117_0191195_114_542 142
1206 3300048921 Ga0496118_0005152 Ga0496118_0005152_2967_3395 142
1207 3300048921 Ga0496118_0166614 Ga0496118_0166614_467_907 142
1208 3300048921 Ga0496118_0402311 Ga0496118_0402311_134_562 142
1209 3300048922 Ga0496119_0199268 Ga0496119_0199268_503_943 142
1210 3300048923 Ga0496120_0038951 Ga0496120_0038951_1676_2116 142
1211 3300048923 Ga0496120_0417887 Ga0496120_0417887_64_492 142
1212 3300048924 Ga0496121_0001291 Ga0496121_0001291_27993_28421 142
1213 3300048924 Ga0496121_0054618 Ga0496121_0054618_2077_2517 142
1214 3300048924 Ga0496121_0106571 Ga0496121_0106571_886_1314 142
1215 3300048924 Ga0496121_0123204 Ga0496121_0123204_880_1308 142
1216 3300048924 Ga0496121_0143570 Ga0496121_0143570_1117_1545 142
1217 3300048924 Ga0496121_0331337 Ga0496121_0331337_394_822 142
1218 3300048924 Ga0496121_0333018 Ga0496121_0333018_442_876 142
1219 3300048924 Ga0496121_0695438 Ga0496121_0695438_67_495 142
1220 3300048924 Ga0496121_0728812 Ga0496121_0728812_145_573 142
1221 3300048925 Ga0496122_0203625 Ga0496122_0203625_200_640 142
1222 3300048925 Ga0496122_0293427 Ga0496122_0293427_356_796 142
1223 3300048926 Ga0496123_0154688 Ga0496123_0154688_62_502 142
1224 3300048927 Ga0496124_0001238 Ga0496124_0001238_10770_11198 142
1225 3300048927 Ga0496124_0096808 Ga0496124_0096808_1234_1674 142
1226 3300048927 Ga0496124_0149863 Ga0496124_0149863_126_554 142
1227 3300048927 Ga0496124_0150343 Ga0496124_0150343_1242_1676 142
1228 3300048928 Ga0496125_0036783 Ga0496125_0036783_2126_2554 142
1229 3300048928 Ga0496125_0049975 Ga0496125_0049975_832_1272 142
1230 3300048928 Ga0496125_0128520 Ga0496125_0128520_367_807 142
1231 3300048928 Ga0496125_0253283 Ga0496125_0253283_626_1054 142
1232 3300048928 Ga0496125_0636384 Ga0496125_0636384_87_521 142
1233 3300048929 Ga0496126_0004961 Ga0496126_0004961_4486_4914 142
1234 3300048929 Ga0496126_0011777 Ga0496126_0011777_3876_4304 142
1235 3300048929 Ga0496126_0026581 Ga0496126_0026581_1623_2051 142
1236 3300048929 Ga0496126_0049105 Ga0496126_0049105_3105_3533 142
1237 3300048929 Ga0496126_0178987 Ga0496126_0178987_994_1434 142
1238 3300048929 Ga0496126_0226489 Ga0496126_0226489_933_1361 142
1239 3300048929 Ga0496126_0299710 Ga0496126_0299710_576_1004 142
1240 3300048929 Ga0496126_0319546 Ga0496126_0319546_208_636 142
1241 3300048929 Ga0496126_0342477 Ga0496126_0342477_444_872 142
1242 3300048929 Ga0496126_0392003 Ga0496126_0392003_155_583 142
1243 3300048929 Ga0496126_0535824 Ga0496126_0535824_357_785 142
1244 3300048929 Ga0496126_0537433 Ga0496126_0537433_431_859 142
1245 3300048929 Ga0496126_0875188 Ga0496126_0875188_207_635 142
1246 3300048929 Ga0496126_1057997 Ga0496126_1057997_63_491 142
1247 3300049568 Ga0501031_0249901 Ga0501031_0249901_665_1105 142
1248 3300049570 Ga0501033_0720908 Ga0501033_0720908_176_667 142
1249 3300049571 Ga0501034_0036800 Ga0501034_0036800_1430_1921 142
1250 3300049571 Ga0501034_0063299 Ga0501034_0063299_419_859 142
1251 3300049571 Ga0501034_0820870 Ga0501034_0820870_371_811 142
1252 3300049572 Ga0501036_0070788 Ga0501036_0070788_1964_2455 142
1253 3300049572 Ga0501036_0872669 Ga0501036_0872669_77_514 142
1254 3300049573 Ga0501037_0100474 Ga0501037_0100474_581_1021 142
1255 3300049573 Ga0501037_0176199 Ga0501037_0176199_963_1454 142
1256 3300049574 Ga0501038_0004223 Ga0501038_0004223_4269_4709 142
1257 3300049574 Ga0501038_0051879 Ga0501038_0051879_11_502 142
1258 3300049575 Ga0501039_0163739 Ga0501039_0163739_937_1428 142
1259 3300049575 Ga0501039_0503905 Ga0501039_0503905_229_669 142
1260 3300049575 Ga0501039_0534060 Ga0501039_0534060_103_540 142
1261 3300049576 Ga0501040_0075435 Ga0501040_0075435_1217_1708 142
1262 3300049576 Ga0501040_0410826 Ga0501040_0410826_530_958 142
1263 3300049577 Ga0501041_0114700 Ga0501041_0114700_41_478 142
1264 3300049578 Ga0501042_0008276 Ga0501042_0008276_3328_3819 142
1265 3300049579 Ga0501043_0008239 Ga0501043_0008239_3278_3718 142
1266 3300049580 Ga0501046_0213472 Ga0501046_0213472_793_1284 142
1267 3300049581 Ga0501047_0041815 Ga0501047_0041815_638_1078 142
1268 3300049581 Ga0501047_1342315 Ga0501047_1342315_11_502 142
1269 3300049582 Ga0501048_0008490 Ga0501048_0008490_148_639 142
1270 3300049582 Ga0501048_0379263 Ga0501048_0379263_17_454 142
1271 3300049583 Ga0501067_0002243 Ga0501067_0002243_2344_2835 142
1272 3300049584 Ga0501068_0149491 Ga0501068_0149491_568_1059 142
1273 3300049585 Ga0501069_0016220 Ga0501069_0016220_2353_2844 142
1274 3300049586 Ga0501070_0011932 Ga0501070_0011932_5866_6357 142
1275 3300049587 Ga0501071_0414579 Ga0501071_0414579_501_992 142
1276 3300049588 Ga0501072_0057071 Ga0501072_0057071_761_1252 142
1277 3300049589 Ga0501073_0094006 Ga0501073_0094006_1015_1506 142
1278 3300049589 Ga0501073_0134132 Ga0501073_0134132_820_1260 142
1279 3300049590 Ga0501074_0000802 Ga0501074_0000802_10379_10870 142
1280 3300049741 Ga0501079_0010508 Ga0501079_0010508_6531_7022 142
1281 3300049742 Ga0501080_0017322 Ga0501080_0017322_6172_6612 142
1282 3300049744 Ga0501083_0005973 Ga0501083_0005973_439_930 142
1283 3300049822 Ga0501035_0039707 Ga0501035_0039707_3622_4062 142
1284 3300049822 Ga0501035_0135271 Ga0501035_0135271_1645_2136 142
1285 3300049823 Ga0501044_0018546 Ga0501044_0018546_5527_5967 142
1286 3300049824 Ga0501045_0013471 Ga0501045_0013471_2799_3290 142
1287 3300050489 nmdc:mga03683_130126_c1 nmdc:mga03683_130126_c1_547_975 142
1288 3300050489 nmdc:mga03683_214788_c1 nmdc:mga03683_214788_c1_212_640 142
1289 3300050489 nmdc:mga03683_64702_c1 nmdc:mga03683_64702_c1_892_1320 142
1290 3300050490 nmdc:mga03n38_14754_c1 nmdc:mga03n38_14754_c1_201_629 142
1291 3300050490 nmdc:mga03n38_225418_c1 nmdc:mga03n38_225418_c1_178_606 142
1292 3300050492 nmdc:mga0yw44_120383_c1 nmdc:mga0yw44_120383_c1_396_824 142
1293 3300050492 nmdc:mga0yw44_268363_c1 nmdc:mga0yw44_268363_c1_293_733 142
1294 3300050492 nmdc:mga0yw44_401629_c1 nmdc:mga0yw44_401629_c1_476_904 142
1295 3300050493 nmdc:mga0k408_174161_c1 nmdc:mga0k408_174161_c1_222_650 142
1296 3300050493 nmdc:mga0k408_232637_c1 nmdc:mga0k408_232637_c1_29_514 142
1297 3300050493 nmdc:mga0k408_327599_c1 nmdc:mga0k408_327599_c1_23_457 142
1298 3300050493 nmdc:mga0k408_54832_c1 nmdc:mga0k408_54832_c1_245_673 142
1299 3300050494 nmdc:mga06z11_167677_c1 nmdc:mga06z11_167677_c1_503_931 142
1300 3300050494 nmdc:mga06z11_312782_c1 nmdc:mga06z11_312782_c1_404_832 142
1301 3300050494 nmdc:mga06z11_5269_c1 nmdc:mga06z11_5269_c1_209_637 142
1302 3300050496 nmdc:mga07m45_367100_c1 nmdc:mga07m45_367100_c1_352_780 142
1303 3300050496 nmdc:mga07m45_4525_c1 nmdc:mga07m45_4525_c1_241_669 142
1304 3300050514 nmdc:mga08x19_488778_c1 nmdc:mga08x19_488778_c1_189_617 142
1305 3300050516 nmdc:mga0sz30_100711_c1 nmdc:mga0sz30_100711_c1_39_467 142
1306 3300050516 nmdc:mga0sz30_413337_c1 nmdc:mga0sz30_413337_c1_76_504 142
1307 3300050516 nmdc:mga0sz30_57216_c1 nmdc:mga0sz30_57216_c1_78_512 142
1308 3300053077 Ga0495601_0015406 Ga0495601_0015406_2377_2805 142
1309 3300053077 Ga0495601_0016288 Ga0495601_0016288_1024_1467 142
1310 3300053077 Ga0495601_0526080 Ga0495601_0526080_279_707 142
1311 3300053080 Ga0500635_0068970 Ga0500635_0068970_319_747 142
1312 3300053083 Ga0495655_0019265 Ga0495655_0019265_771_1199 142
1313 3300053083 Ga0495655_0303053 Ga0495655_0303053_30_458 142
1314 3300053084 Ga0495595_0000335 Ga0495595_0000335_15392_15835 142
1315 3300053084 Ga0495595_0026690 Ga0495595_0026690_1471_1899 142
1316 3300053084 Ga0495595_0232091 Ga0495595_0232091_369_797 142
1317 3300053085 Ga0495619_0001292 Ga0495619_0001292_1639_2082 142
1318 3300053085 Ga0495619_0127621 Ga0495619_0127621_122_550 142
1319 3300053087 Ga0500643_014119 Ga0500643_014119_1263_1691 142
1320 3300053088 Ga0500644_0031257 Ga0500644_0031257_759_1199 142
1321 3300053089 Ga0500581_258586 Ga0500581_258586_251_691 142
1322 3300053091 Ga0500647_0315650 Ga0500647_0315650_106_534 142
1323 3300053092 Ga0500583_0141757 Ga0500583_0141757_622_1050 142
1324 3300053092 Ga0500583_0482640 Ga0500583_0482640_145_573 142
1325 3300053093 Ga0500651_0003108 Ga0500651_0003108_7834_8274 142
1326 3300053093 Ga0500651_0316810 Ga0500651_0316810_49_477 142
1327 3300053093 Ga0500651_0465797 Ga0500651_0465797_230_658 142
1328 3300053094 Ga0500566_0000332 Ga0500566_0000332_21126_21566 142
1329 3300053094 Ga0500566_0011427 Ga0500566_0011427_4474_4902 142
1330 3300053096 Ga0500641_0113778 Ga0500641_0113778_484_912 142
1331 3300053097 Ga0500648_157151 Ga0500648_157151_456_884 142
1332 3300053098 Ga0500650_0028010 Ga0500650_0028010_1189_1629 142
1333 3300053098 Ga0500650_0113415 Ga0500650_0113415_678_1106 142
1334 3300053103 Ga0500555_125450 Ga0500555_125450_69_497 142
1335 3300053109 Ga0500569_029160 Ga0500569_029160_455_883 142
1336 3300053116 Ga0500592_000477 Ga0500592_000477_5691_6131 142
1337 3300053117 Ga0500593_159797 Ga0500593_159797_189_629 142
1338 3300053118 Ga0500594_0031132 Ga0500594_0031132_488_928 142
1339 3300053119 Ga0500595_000468 Ga0500595_000468_8355_8783 142
1340 3300053119 Ga0500595_018935 Ga0500595_018935_1139_1567 142
1341 3300053119 Ga0500595_100614 Ga0500595_100614_48_476 142
1342 3300053121 Ga0500607_228713 Ga0500607_228713_275_715 142
1343 3300053122 Ga0500608_000395 Ga0500608_000395_4580_5020 142
1344 3300053122 Ga0500608_326497 Ga0500608_326497_49_492 142
1345 3300053125 Ga0500618_004648 Ga0500618_004648_3860_4300 142
1346 3300053127 Ga0500623_249849 Ga0500623_249849_59_499 142
1347 3300053130 Ga0500642_0000128 Ga0500642_0000128_10587_11027 142
1348 3300053130 Ga0500642_0160360 Ga0500642_0160360_306_734 142
1349 3300053130 Ga0500642_0255061 Ga0500642_0255061_189_617 142
1350 3300053131 Ga0500652_000285 Ga0500652_000285_11741_12181 142
1351 3300053134 Ga0500658_0005983 Ga0500658_0005983_2197_2637 142
1352 3300053134 Ga0500658_0036152 Ga0500658_0036152_617_1045 142
1353 3300053134 Ga0500658_0058503 Ga0500658_0058503_836_1264 142
1354 3300053134 Ga0500658_0391449 Ga0500658_0391449_39_479 142
1355 3300053136 Ga0500559_0000959 Ga0500559_0000959_1740_2180 142
1356 3300053136 Ga0500559_0009065 Ga0500559_0009065_1157_1585 142
1357 3300053137 Ga0500561_0024124 Ga0500561_0024124_914_1342 142
1358 3300053139 Ga0500568_0000741 Ga0500568_0000741_16412_16852 142
1359 3300053139 Ga0500568_0078915 Ga0500568_0078915_753_1181 142
1360 3300053140 Ga0500573_0035584 Ga0500573_0035584_1636_2064 142
1361 3300053145 Ga0500586_002976 Ga0500586_002976_626_1066 142
1362 3300053147 Ga0500589_067269 Ga0500589_067269_83_511 142
1363 3300053147 Ga0500589_097143 Ga0500589_097143_412_840 142
1364 3300053148 Ga0500590_119784 Ga0500590_119784_423_851 142
1365 3300053150 Ga0500603_001419 Ga0500603_001419_4834_5265 142
1366 3300053150 Ga0500603_182116 Ga0500603_182116_197_625 142
1367 3300053151 Ga0500604_0007792 Ga0500604_0007792_24_464 142
1368 3300053151 Ga0500604_0212605 Ga0500604_0212605_205_633 142
1369 3300053153 Ga0500616_0000122 Ga0500616_0000122_10349_10789 142
1370 3300053154 Ga0500619_157433 Ga0500619_157433_247_675 142
1371 3300053158 Ga0500627_0005565 Ga0500627_0005565_1055_1495 142
1372 3300053158 Ga0500627_0126064 Ga0500627_0126064_392_820 142
1373 3300053161 Ga0500634_0044424 Ga0500634_0044424_1613_2041 142
1374 3300053162 Ga0500638_002107 Ga0500638_002107_519_947 142
1375 3300053162 Ga0500638_045751 Ga0500638_045751_613_1041 142
1376 3300053162 Ga0500638_171331 Ga0500638_171331_22_450 142
1377 3300053177 Ga0500636_0006139 Ga0500636_0006139_4732_5172 142
1378 3300053177 Ga0500636_0116220 Ga0500636_0116220_149_577 142
1379 3300053177 Ga0500636_0183939 Ga0500636_0183939_148_576 142
1380 3300053178 Ga0500637_0011077 Ga0500637_0011077_2387_2815 142
1381 3300053178 Ga0500637_0248512 Ga0500637_0248512_541_981 142
1382 3300053178 Ga0500637_0284938 Ga0500637_0284938_163_591 142
1383 3300053178 Ga0500637_0362362 Ga0500637_0362362_173_601 142
1384 3300053727 Ga0500611_056842 Ga0500611_056842_450_890 142
1385 3300053727 Ga0500611_199304 Ga0500611_199304_24_452 142
1386 3300053728 Ga0500657_035869 Ga0500657_035869_776_1204 142
1387 3300053730 Ga0500645_013421 Ga0500645_013421_1707_2147 142
1388 3300053730 Ga0500645_025920 Ga0500645_025920_461_889 142
1389 3300053735 Ga0500596_007063 Ga0500596_007063_324_752 142
1390 3300054114 Ga0501084_0248968 Ga0501084_0248968_1014_1454 142
1391 3300055283 Ga0500661_001956 Ga0500661_001956_134_562 142
1392 3300060353 Ga0501082_0169383 Ga0501082_0169383_1376_1867 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

40

111

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9703 18 116
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9703 18 113
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9614 18 116
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9353 23 112
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8989 20 112
ID Description Score Start End Superfamily
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9768 18 104 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9729 17 104 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9392 19 104 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8948 14 104 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.887 18 104 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A4Q2X420-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9884 7 102 GO:0000105
GO:0004635
AF-A0A846BZT2-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9838 7 102 GO:0000105
GO:0004635
AF-A0A1I2QMN9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9822 18 112 GO:0000105
GO:0004635
AF-A0A6J6EZC2-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) 0.9811 18 112 GO:0000105
GO:0004635
GO:0005737
AF-A0A2H1HXQ3-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9807 18 112 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270

Feature Viewer

pLDDT pTM Quality
84.35 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map