F493601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1392 | 520 | 1387 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10204030|Ga0207648_102040302 |
| Length | 173 |
| Sequence | VSASKHDHDREEGLDFQPKFDASGLVTCVATDAATGDVLMVAHMNEEALRKTIASGEAWYFSRSRNALWRKGETSGQTQRVVEMRLDCDQDAVWIAKVDTDAFSLCAGPHHRPDLNGNTVFTQMPDRFLNRACPFETQITPAGRNGYTRVRLPGLARSMYVQLLFAKPISPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 3 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 4 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 5 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 98 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 99 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 139 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 140 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 141 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 243 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 244 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 290 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 291 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 292 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 293 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 294 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 295 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 296 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 297 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 298 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 405 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 406 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 407 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 408 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 409 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 450 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 459 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 460 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 468 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 469 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 470 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 473 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 474 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 475 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 476 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 477 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 479 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 480 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 481 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 482 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 485 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 489 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 490 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 500 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 501 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 503 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 505 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 506 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 508 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 511 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 513 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 514 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 517 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 518 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 520 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.57 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.66 |
| Nodule | 1.58 |
| Rhizoplane | 6.82 |
| Rhizosphere | 67.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10026584 | 3300001979 | Bacteria | 1937 |
| 2 | JGI24740J21852_10101045 | 3300001979 | Bacteria | 734 |
| 3 | JGI24738J21930_10101359 | 3300002075 | Bacteria | 615 |
| 4 | JGI25153J46596_10004677 | 3300003215 | Bacteria | 7315 |
| 5 | JGI25153J46596_10017942 | 3300003215 | Bacteria | 2767 |
| 6 | JGI25160J50197_1013544 | 3300003354 | Bacteria | 2774 |
| 7 | JGI25160J50197_1036890 | 3300003354 | Bacteria | 1178 |
| 8 | JGI25161J50226_1009260 | 3300003374 | Bacteria | 1422 |
| 9 | JGI25404J52841_10009065 | 3300003659 | Bacteria | 2127 |
| 10 | JGI25404J52841_10024640 | 3300003659 | Bacteria | 1296 |
| 11 | Ga0055539_1013517 | 3300003752 | Bacteria | 999 |
| 12 | Ga0055543_1005996 | 3300004625 | Bacteria | 3015 |
| 13 | Ga0065165_1003569 | 3300005262 | Bacteria | 10751 |
| 14 | Ga0065165_1007503 | 3300005262 | Bacteria | 5343 |
| 15 | Ga0065165_1009639 | 3300005262 | Bacteria | 4295 |
| 16 | Ga0065165_1031022 | 3300005262 | Bacteria | 1694 |
| 17 | Ga0065715_10271731 | 3300005293 | Bacteria | 1109 |
| 18 | Ga0070658_10048779 | 3300005327 | Bacteria | 3429 |
| 19 | Ga0070658_10144495 | 3300005327 | Bacteria | 1988 |
| 20 | Ga0070683_100007695 | 3300005329 | Bacteria | 9117 |
| 21 | Ga0070683_100037619 | 3300005329 | Bacteria | 4430 |
| 22 | Ga0068869_100017200 | 3300005334 | Bacteria | 4895 |
| 23 | Ga0068869_100139057 | 3300005334 | Bacteria | 1873 |
| 24 | Ga0068869_100838093 | 3300005334 | Bacteria | 792 |
| 25 | Ga0068869_101709079 | 3300005334 | Bacteria | 562 |
| 26 | Ga0070666_10912799 | 3300005335 | Bacteria | 650 |
| 27 | Ga0070680_100004631 | 3300005336 | Bacteria | 10339 |
| 28 | Ga0070680_100018149 | 3300005336 | Bacteria | 5558 |
| 29 | Ga0070680_100640087 | 3300005336 | Bacteria | 913 |
| 30 | Ga0070682_100028973 | 3300005337 | Bacteria | 3333 |
| 31 | Ga0070682_100046870 | 3300005337 | Bacteria | 2685 |
| 32 | Ga0070682_100199702 | 3300005337 | Bacteria | 1410 |
| 33 | Ga0070682_100249988 | 3300005337 | Bacteria | 1278 |
| 34 | Ga0068868_100161311 | 3300005338 | Bacteria | 1852 |
| 35 | Ga0068868_100227730 | 3300005338 | Bacteria | 1563 |
| 36 | Ga0068868_100344125 | 3300005338 | Bacteria | 1276 |
| 37 | Ga0070660_100007944 | 3300005339 | Bacteria | 7406 |
| 38 | Ga0070660_100161683 | 3300005339 | Bacteria | 1805 |
| 39 | Ga0070660_100609937 | 3300005339 | Bacteria | 913 |
| 40 | Ga0070660_100932119 | 3300005339 | Bacteria | 733 |
| 41 | Ga0070691_10035653 | 3300005341 | Bacteria | 2343 |
| 42 | Ga0070661_100116253 | 3300005344 | Bacteria | 2001 |
| 43 | Ga0070661_100181949 | 3300005344 | Bacteria | 1599 |
| 44 | Ga0070661_100220441 | 3300005344 | Bacteria | 1455 |
| 45 | Ga0070661_100318800 | 3300005344 | Bacteria | 1214 |
| 46 | Ga0070668_100037546 | 3300005347 | Bacteria | 3699 |
| 47 | Ga0070668_100101845 | 3300005347 | Bacteria | 2276 |
| 48 | Ga0070668_100175219 | 3300005347 | Bacteria | 1748 |
| 49 | Ga0070668_100309786 | 3300005347 | Bacteria | 1326 |
| 50 | Ga0070668_100400661 | 3300005347 | Bacteria | 1171 |
| 51 | Ga0070668_101019475 | 3300005347 | Bacteria | 744 |
| 52 | Ga0070669_100528292 | 3300005353 | Bacteria | 982 |
| 53 | Ga0070671_100072935 | 3300005355 | Bacteria | 2867 |
| 54 | Ga0070671_100191403 | 3300005355 | Bacteria | 1734 |
| 55 | Ga0070671_100383341 | 3300005355 | Bacteria | 1201 |
| 56 | Ga0070674_100477836 | 3300005356 | Bacteria | 1034 |
| 57 | Ga0070659_100569554 | 3300005366 | Bacteria | 971 |
| 58 | Ga0070667_100176034 | 3300005367 | Bacteria | 1891 |
| 59 | Ga0070667_100681013 | 3300005367 | Bacteria | 950 |
| 60 | Ga0070709_10001049 | 3300005434 | Bacteria | 15239 |
| 61 | Ga0070709_10054092 | 3300005434 | Bacteria | 2529 |
| 62 | Ga0070709_10469452 | 3300005434 | Bacteria | 951 |
| 63 | Ga0070714_100001503 | 3300005435 | Bacteria | 16962 |
| 64 | Ga0070714_100438034 | 3300005435 | Bacteria | 1240 |
| 65 | Ga0070714_100531195 | 3300005435 | Bacteria | 1124 |
| 66 | Ga0070713_100009241 | 3300005436 | Bacteria | 7041 |
| 67 | Ga0070713_101317571 | 3300005436 | Bacteria | 700 |
| 68 | Ga0070710_10004766 | 3300005437 | Bacteria | 6420 |
| 69 | Ga0070710_10040600 | 3300005437 | Bacteria | 2565 |
| 70 | Ga0070711_100003503 | 3300005439 | Bacteria | 9151 |
| 71 | Ga0070711_100062200 | 3300005439 | Bacteria | 2601 |
| 72 | Ga0070711_100502680 | 3300005439 | Bacteria | 1000 |
| 73 | Ga0070711_101384808 | 3300005439 | Bacteria | 612 |
| 74 | Ga0070700_100070735 | 3300005441 | Bacteria | 2225 |
| 75 | Ga0070700_100625545 | 3300005441 | Bacteria | 847 |
| 76 | Ga0070663_100020052 | 3300005455 | Bacteria | 4419 |
| 77 | Ga0070663_100056176 | 3300005455 | Bacteria | 2820 |
| 78 | Ga0070663_100106058 | 3300005455 | Bacteria | 2104 |
| 79 | Ga0070663_100128105 | 3300005455 | Bacteria | 1924 |
| 80 | Ga0070663_100129247 | 3300005455 | Bacteria | 1917 |
| 81 | Ga0070663_100161439 | 3300005455 | Bacteria | 1725 |
| 82 | Ga0070663_100436681 | 3300005455 | Bacteria | 1076 |
| 83 | Ga0070663_100538085 | 3300005455 | Bacteria | 975 |
| 84 | Ga0070678_100003659 | 3300005456 | Bacteria | 8584 |
| 85 | Ga0070678_100118900 | 3300005456 | Bacteria | 2081 |
| 86 | Ga0070678_100324030 | 3300005456 | Bacteria | 1317 |
| 87 | Ga0070662_100035529 | 3300005457 | Bacteria | 3520 |
| 88 | Ga0070662_100081802 | 3300005457 | Bacteria | 2407 |
| 89 | Ga0070662_100085799 | 3300005457 | Bacteria | 2353 |
| 90 | Ga0070662_100265020 | 3300005457 | Bacteria | 1385 |
| 91 | Ga0070662_100748612 | 3300005457 | Bacteria | 829 |
| 92 | Ga0070681_10035146 | 3300005458 | Bacteria | 5034 |
| 93 | Ga0070681_10047129 | 3300005458 | Bacteria | 4308 |
| 94 | Ga0070681_10720642 | 3300005458 | Bacteria | 913 |
| 95 | Ga0068867_100349786 | 3300005459 | Bacteria | 1233 |
| 96 | Ga0068867_100783578 | 3300005459 | Bacteria | 849 |
| 97 | Ga0068867_100814829 | 3300005459 | Bacteria | 834 |
| 98 | Ga0070706_100263515 | 3300005467 | Bacteria | 1609 |
| 99 | Ga0070698_100040993 | 3300005471 | Bacteria | 4756 |
| 100 | Ga0070699_101286957 | 3300005518 | Bacteria | 671 |
| 101 | Ga0070679_100021982 | 3300005530 | Bacteria | 6232 |
| 102 | Ga0070679_100051310 | 3300005530 | Bacteria | 4108 |
| 103 | Ga0070679_100077530 | 3300005530 | Bacteria | 3312 |
| 104 | Ga0070679_100215689 | 3300005530 | Bacteria | 1881 |
| 105 | Ga0070679_100229794 | 3300005530 | Bacteria | 1815 |
| 106 | Ga0070679_100397219 | 3300005530 | Bacteria | 1325 |
| 107 | Ga0070679_100502166 | 3300005530 | Bacteria | 1157 |
| 108 | Ga0070679_100750247 | 3300005530 | Bacteria | 919 |
| 109 | Ga0070684_100011514 | 3300005535 | Bacteria | 7045 |
| 110 | Ga0070684_100076765 | 3300005535 | Bacteria | 2949 |
| 111 | Ga0070697_101063056 | 3300005536 | Bacteria | 720 |
| 112 | Ga0068853_100005334 | 3300005539 | Bacteria | 10065 |
| 113 | Ga0068853_100040711 | 3300005539 | Bacteria | 3966 |
| 114 | Ga0068853_100062602 | 3300005539 | Bacteria | 3220 |
| 115 | Ga0068853_100248236 | 3300005539 | Bacteria | 1632 |
| 116 | Ga0068853_101994772 | 3300005539 | Bacteria | 563 |
| 117 | Ga0070672_100187750 | 3300005543 | Bacteria | 1724 |
| 118 | Ga0070686_100502978 | 3300005544 | Bacteria | 941 |
| 119 | Ga0070695_100399860 | 3300005545 | Bacteria | 1041 |
| 120 | Ga0070695_100538480 | 3300005545 | Bacteria | 908 |
| 121 | Ga0070696_100391104 | 3300005546 | Bacteria | 1086 |
| 122 | Ga0070693_100067081 | 3300005547 | Bacteria | 2102 |
| 123 | Ga0070665_100018669 | 3300005548 | Bacteria | 6951 |
| 124 | Ga0070665_100038117 | 3300005548 | Bacteria | 4831 |
| 125 | Ga0070665_100044315 | 3300005548 | Bacteria | 4468 |
| 126 | Ga0070665_100110097 | 3300005548 | Bacteria | 2757 |
| 127 | Ga0070665_100140384 | 3300005548 | Bacteria | 2419 |
| 128 | Ga0070665_100563601 | 3300005548 | Bacteria | 1152 |
| 129 | Ga0070665_100601414 | 3300005548 | Bacteria | 1113 |
| 130 | Ga0070665_100900290 | 3300005548 | Bacteria | 897 |
| 131 | Ga0070665_101273400 | 3300005548 | Bacteria | 745 |
| 132 | Ga0068855_100038159 | 3300005563 | Bacteria | 5708 |
| 133 | Ga0068855_100052372 | 3300005563 | Bacteria | 4805 |
| 134 | Ga0068855_100218469 | 3300005563 | Bacteria | 2139 |
| 135 | Ga0068855_100275794 | 3300005563 | Bacteria | 1869 |
| 136 | Ga0068855_100344202 | 3300005563 | Bacteria | 1643 |
| 137 | Ga0068855_100838891 | 3300005563 | Bacteria | 975 |
| 138 | Ga0068855_101579940 | 3300005563 | Bacteria | 671 |
| 139 | Ga0068855_101721918 | 3300005563 | Bacteria | 639 |
| 140 | Ga0068855_101797924 | 3300005563 | Bacteria | 623 |
| 141 | Ga0070664_100227468 | 3300005564 | Bacteria | 1671 |
| 142 | Ga0070664_101233676 | 3300005564 | Bacteria | 706 |
| 143 | Ga0068857_100078149 | 3300005577 | Bacteria | 2953 |
| 144 | Ga0068857_100265457 | 3300005577 | Bacteria | 1576 |
| 145 | Ga0068857_100395122 | 3300005577 | Bacteria | 1286 |
| 146 | Ga0068854_100076313 | 3300005578 | Bacteria | 2463 |
| 147 | Ga0068854_100126538 | 3300005578 | Bacteria | 1947 |
| 148 | Ga0068854_100287511 | 3300005578 | Bacteria | 1326 |
| 149 | Ga0068854_100546618 | 3300005578 | Bacteria | 982 |
| 150 | Ga0068856_100000535 | 3300005614 | Bacteria | 41862 |
| 151 | Ga0068856_100036723 | 3300005614 | Bacteria | 4804 |
| 152 | Ga0068856_100068097 | 3300005614 | Bacteria | 3518 |
| 153 | Ga0068856_100071781 | 3300005614 | Bacteria | 3428 |
| 154 | Ga0068856_100404857 | 3300005614 | Bacteria | 1384 |
| 155 | Ga0068856_101627494 | 3300005614 | Bacteria | 659 |
| 156 | Ga0070702_100274298 | 3300005615 | Bacteria | 1155 |
| 157 | Ga0070702_100364868 | 3300005615 | Bacteria | 1022 |
| 158 | Ga0070702_100800800 | 3300005615 | Bacteria | 729 |
| 159 | Ga0068852_100004762 | 3300005616 | Bacteria | 9635 |
| 160 | Ga0068852_100037938 | 3300005616 | Bacteria | 4045 |
| 161 | Ga0068852_100127746 | 3300005616 | Bacteria | 2337 |
| 162 | Ga0068852_100503297 | 3300005616 | Bacteria | 1206 |
| 163 | Ga0068852_102639092 | 3300005616 | Bacteria | 522 |
| 164 | Ga0068859_100195058 | 3300005617 | Bacteria | 2109 |
| 165 | Ga0068859_100233047 | 3300005617 | Bacteria | 1930 |
| 166 | Ga0068859_101758308 | 3300005617 | Bacteria | 685 |
| 167 | Ga0068864_102264950 | 3300005618 | Bacteria | 550 |
| 168 | Ga0068866_10041298 | 3300005718 | Bacteria | 2288 |
| 169 | Ga0068866_10785214 | 3300005718 | Bacteria | 661 |
| 170 | Ga0068866_10885531 | 3300005718 | Bacteria | 627 |
| 171 | Ga0068866_10960974 | 3300005718 | Bacteria | 605 |
| 172 | Ga0068861_100250689 | 3300005719 | Bacteria | 1510 |
| 173 | Ga0068861_100528020 | 3300005719 | Bacteria | 1071 |
| 174 | Ga0068861_100627970 | 3300005719 | Bacteria | 989 |
| 175 | Ga0068861_101286184 | 3300005719 | Bacteria | 711 |
| 176 | Ga0068861_101539450 | 3300005719 | Bacteria | 653 |
| 177 | Ga0068851_10000835 | 3300005834 | Bacteria | 13259 |
| 178 | Ga0068851_10006013 | 3300005834 | Bacteria | 5531 |
| 179 | Ga0068851_10142660 | 3300005834 | Bacteria | 1304 |
| 180 | Ga0068851_10158191 | 3300005834 | Bacteria | 1243 |
| 181 | Ga0068851_10243997 | 3300005834 | Bacteria | 1017 |
| 182 | Ga0068870_10103942 | 3300005840 | Bacteria | 1610 |
| 183 | Ga0068870_11156037 | 3300005840 | Bacteria | 559 |
| 184 | Ga0068863_100188289 | 3300005841 | Bacteria | 1983 |
| 185 | Ga0068863_100731594 | 3300005841 | Bacteria | 984 |
| 186 | Ga0068858_100408049 | 3300005842 | Bacteria | 1306 |
| 187 | Ga0068858_100604751 | 3300005842 | Bacteria | 1064 |
| 188 | Ga0068858_101185446 | 3300005842 | Bacteria | 750 |
| 189 | Ga0068858_101219917 | 3300005842 | Bacteria | 740 |
| 190 | Ga0068860_100200283 | 3300005843 | Bacteria | 1935 |
| 191 | Ga0068860_100359876 | 3300005843 | Bacteria | 1433 |
| 192 | Ga0068860_101377247 | 3300005843 | Bacteria | 726 |
| 193 | Ga0068862_100141665 | 3300005844 | Bacteria | 2134 |
| 194 | Ga0068862_100215223 | 3300005844 | Bacteria | 1737 |
| 195 | Ga0068862_100370338 | 3300005844 | Bacteria | 1333 |
| 196 | Ga0068862_100603629 | 3300005844 | Bacteria | 1054 |
| 197 | Ga0068862_100867533 | 3300005844 | Bacteria | 885 |
| 198 | Ga0081455_10001517 | 3300005937 | Bacteria | 28624 |
| 199 | Ga0081455_10013697 | 3300005937 | Bacteria | 7986 |
| 200 | Ga0081455_10482205 | 3300005937 | Bacteria | 838 |
| 201 | Ga0081538_10031309 | 3300005981 | Bacteria | 3590 |
| 202 | Ga0081540_1002249 | 3300005983 | Bacteria | 15898 |
| 203 | Ga0081540_1003440 | 3300005983 | Bacteria | 12500 |
| 204 | Ga0081540_1011448 | 3300005983 | Bacteria | 5926 |
| 205 | Ga0081540_1031530 | 3300005983 | Bacteria | 2912 |
| 206 | Ga0081540_1036980 | 3300005983 | Bacteria | 2594 |
| 207 | Ga0081540_1116975 | 3300005983 | Bacteria | 1114 |
| 208 | Ga0081540_1143122 | 3300005983 | Bacteria | 956 |
| 209 | Ga0081540_1179174 | 3300005983 | Bacteria | 795 |
| 210 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 211 | Ga0081539_10074427 | 3300005985 | Bacteria | 1809 |
| 212 | Ga0070717_10002312 | 3300006028 | Bacteria | 13387 |
| 213 | Ga0070717_10144342 | 3300006028 | Bacteria | 2055 |
| 214 | Ga0070717_10658516 | 3300006028 | Bacteria | 951 |
| 215 | Ga0075365_10023032 | 3300006038 | Bacteria | 3912 |
| 216 | Ga0075365_10125646 | 3300006038 | Bacteria | 1772 |
| 217 | Ga0075365_10135841 | 3300006038 | Bacteria | 1704 |
| 218 | Ga0075365_10178904 | 3300006038 | Bacteria | 1482 |
| 219 | Ga0075365_10233601 | 3300006038 | Bacteria | 1291 |
| 220 | Ga0075365_10445555 | 3300006038 | Bacteria | 914 |
| 221 | Ga0075365_10686225 | 3300006038 | Bacteria | 724 |
| 222 | Ga0075368_10135596 | 3300006042 | Bacteria | 1024 |
| 223 | Ga0075368_10184296 | 3300006042 | Bacteria | 880 |
| 224 | Ga0075368_10534277 | 3300006042 | Bacteria | 526 |
| 225 | Ga0075363_100106437 | 3300006048 | Bacteria | 1556 |
| 226 | Ga0075363_100257702 | 3300006048 | Bacteria | 1005 |
| 227 | Ga0075363_100277714 | 3300006048 | Bacteria | 969 |
| 228 | Ga0075364_10066812 | 3300006051 | Bacteria | 2362 |
| 229 | Ga0075364_10494147 | 3300006051 | Bacteria | 836 |
| 230 | Ga0070715_10000192 | 3300006163 | Bacteria | 14303 |
| 231 | Ga0070715_10174292 | 3300006163 | Bacteria | 1074 |
| 232 | Ga0070715_10346336 | 3300006163 | Bacteria | 810 |
| 233 | Ga0070716_100063087 | 3300006173 | Bacteria | 2150 |
| 234 | Ga0070716_100876830 | 3300006173 | Bacteria | 701 |
| 235 | Ga0070712_100004044 | 3300006175 | Bacteria | 9002 |
| 236 | Ga0070712_100008540 | 3300006175 | Bacteria | 6442 |
| 237 | Ga0070712_100290120 | 3300006175 | Bacteria | 1320 |
| 238 | Ga0075362_10117021 | 3300006177 | Bacteria | 1259 |
| 239 | Ga0075362_10276076 | 3300006177 | Bacteria | 830 |
| 240 | Ga0075367_10133459 | 3300006178 | Bacteria | 1535 |
| 241 | Ga0075367_10210784 | 3300006178 | Bacteria | 1215 |
| 242 | Ga0075367_10227221 | 3300006178 | Bacteria | 1169 |
| 243 | Ga0075367_10264219 | 3300006178 | Bacteria | 1080 |
| 244 | Ga0075367_10401998 | 3300006178 | Bacteria | 866 |
| 245 | Ga0075367_10714363 | 3300006178 | Bacteria | 637 |
| 246 | Ga0075369_10050776 | 3300006186 | Bacteria | 1794 |
| 247 | Ga0075369_10155208 | 3300006186 | Bacteria | 1047 |
| 248 | Ga0075369_10404673 | 3300006186 | Bacteria | 643 |
| 249 | Ga0075366_10310403 | 3300006195 | Bacteria | 965 |
| 250 | Ga0075366_10311518 | 3300006195 | Bacteria | 964 |
| 251 | Ga0075366_10368542 | 3300006195 | Bacteria | 883 |
| 252 | Ga0075366_10443540 | 3300006195 | Bacteria | 801 |
| 253 | Ga0075366_10505038 | 3300006195 | Bacteria | 748 |
| 254 | Ga0075366_10694709 | 3300006195 | Bacteria | 632 |
| 255 | Ga0097621_100045438 | 3300006237 | Bacteria | 3548 |
| 256 | Ga0097621_100336554 | 3300006237 | Bacteria | 1340 |
| 257 | Ga0075370_10203699 | 3300006353 | Bacteria | 1167 |
| 258 | Ga0075370_10591939 | 3300006353 | Bacteria | 672 |
| 259 | Ga0068871_100278163 | 3300006358 | Bacteria | 1463 |
| 260 | Ga0068871_100372732 | 3300006358 | Bacteria | 1266 |
| 261 | Ga0068871_100625788 | 3300006358 | Bacteria | 981 |
| 262 | Ga0075433_10937407 | 3300006852 | Bacteria | 755 |
| 263 | Ga0075434_100840738 | 3300006871 | Bacteria | 934 |
| 264 | Ga0075429_100484583 | 3300006880 | Bacteria | 1084 |
| 265 | Ga0068865_100116722 | 3300006881 | Bacteria | 1977 |
| 266 | Ga0068865_100212981 | 3300006881 | Bacteria | 1507 |
| 267 | Ga0097620_100195051 | 3300006931 | Bacteria | 2109 |
| 268 | Ga0097620_100233036 | 3300006931 | Bacteria | 1930 |
| 269 | Ga0097620_101758776 | 3300006931 | Bacteria | 685 |
| 270 | Ga0097620_102727967 | 3300006931 | Bacteria | 543 |
| 271 | Ga0099824_1004186 | 3300006942 | Bacteria | 20854 |
| 272 | Ga0099824_1011269 | 3300006942 | Bacteria | 10188 |
| 273 | Ga0099822_1006118 | 3300006943 | Bacteria | 15692 |
| 274 | Ga0099823_1095743 | 3300006944 | Bacteria | 958 |
| 275 | Ga0075435_100180733 | 3300007076 | Bacteria | 1783 |
| 276 | Ga0099794_10342109 | 3300007265 | Bacteria | 777 |
| 277 | Ga0099795_10001203 | 3300007788 | Bacteria | 5456 |
| 278 | Ga0099795_10031793 | 3300007788 | Bacteria | 1820 |
| 279 | Ga0099795_10052099 | 3300007788 | Bacteria | 1494 |
| 280 | Ga0099795_10411000 | 3300007788 | Bacteria | 617 |
| 281 | Ga0105250_10077524 | 3300009092 | Bacteria | 1345 |
| 282 | Ga0105240_10001503 | 3300009093 | Bacteria | 39730 |
| 283 | Ga0105240_10012039 | 3300009093 | Bacteria | 11991 |
| 284 | Ga0105240_10044376 | 3300009093 | Bacteria | 5649 |
| 285 | Ga0105240_10065642 | 3300009093 | Bacteria | 4504 |
| 286 | Ga0105240_10078471 | 3300009093 | Bacteria | 4066 |
| 287 | Ga0105240_10348106 | 3300009093 | Bacteria | 1682 |
| 288 | Ga0105240_10514575 | 3300009093 | Bacteria | 1329 |
| 289 | Ga0105240_10874452 | 3300009093 | Bacteria | 968 |
| 290 | Ga0111539_10081586 | 3300009094 | Bacteria | 3804 |
| 291 | Ga0105245_10026228 | 3300009098 | Bacteria | 5129 |
| 292 | Ga0105245_10027787 | 3300009098 | Bacteria | 4985 |
| 293 | Ga0105245_10968357 | 3300009098 | Bacteria | 894 |
| 294 | Ga0105245_11250060 | 3300009098 | Bacteria | 791 |
| 295 | Ga0105245_11474897 | 3300009098 | Bacteria | 731 |
| 296 | Ga0105247_10168177 | 3300009101 | Bacteria | 1456 |
| 297 | Ga0114129_10780806 | 3300009147 | Bacteria | 1220 |
| 298 | Ga0105243_10522834 | 3300009148 | Bacteria | 1129 |
| 299 | Ga0105243_11566714 | 3300009148 | Bacteria | 684 |
| 300 | Ga0105241_10073753 | 3300009174 | Bacteria | 2656 |
| 301 | Ga0105241_10078013 | 3300009174 | Bacteria | 2587 |
| 302 | Ga0105241_10094740 | 3300009174 | Bacteria | 2362 |
| 303 | Ga0105241_10479027 | 3300009174 | Bacteria | 1106 |
| 304 | Ga0105241_10768650 | 3300009174 | Bacteria | 885 |
| 305 | Ga0105242_10088880 | 3300009176 | Bacteria | 2596 |
| 306 | Ga0105242_10396170 | 3300009176 | Bacteria | 1287 |
| 307 | Ga0105248_10135116 | 3300009177 | Bacteria | 2782 |
| 308 | Ga0105248_10580318 | 3300009177 | Bacteria | 1265 |
| 309 | Ga0105248_10666508 | 3300009177 | Bacteria | 1174 |
| 310 | Ga0105248_11025023 | 3300009177 | Bacteria | 932 |
| 311 | Ga0105237_10000992 | 3300009545 | Bacteria | 38167 |
| 312 | Ga0105237_10007135 | 3300009545 | Bacteria | 12277 |
| 313 | Ga0105237_10027416 | 3300009545 | Bacteria | 5816 |
| 314 | Ga0105237_10042680 | 3300009545 | Bacteria | 4572 |
| 315 | Ga0105237_10068125 | 3300009545 | Bacteria | 3553 |
| 316 | Ga0105237_10150862 | 3300009545 | Bacteria | 2321 |
| 317 | Ga0105237_10191711 | 3300009545 | Bacteria | 2044 |
| 318 | Ga0105237_10310707 | 3300009545 | Bacteria | 1580 |
| 319 | Ga0105237_10373604 | 3300009545 | Bacteria | 1430 |
| 320 | Ga0105237_10788673 | 3300009545 | Bacteria | 957 |
| 321 | Ga0105237_11155244 | 3300009545 | Bacteria | 781 |
| 322 | Ga0105238_10008586 | 3300009551 | Bacteria | 10220 |
| 323 | Ga0105238_10021123 | 3300009551 | Bacteria | 6635 |
| 324 | Ga0105238_10021503 | 3300009551 | Bacteria | 6571 |
| 325 | Ga0105238_10025858 | 3300009551 | Bacteria | 5985 |
| 326 | Ga0105238_10173743 | 3300009551 | Bacteria | 2131 |
| 327 | Ga0105238_10182278 | 3300009551 | Bacteria | 2077 |
| 328 | Ga0105238_10311513 | 3300009551 | Bacteria | 1559 |
| 329 | Ga0105238_10376017 | 3300009551 | Bacteria | 1412 |
| 330 | Ga0105238_10516787 | 3300009551 | Bacteria | 1196 |
| 331 | Ga0105238_11254211 | 3300009551 | Bacteria | 766 |
| 332 | Ga0105249_10295127 | 3300009553 | Bacteria | 1624 |
| 333 | Ga0099796_10021942 | 3300010159 | Bacteria | 1974 |
| 334 | Ga0099796_10022456 | 3300010159 | Bacteria | 1957 |
| 335 | Ga0105239_10008381 | 3300010375 | Bacteria | 11777 |
| 336 | Ga0105239_10040184 | 3300010375 | Bacteria | 5125 |
| 337 | Ga0105239_10085316 | 3300010375 | Bacteria | 3480 |
| 338 | Ga0105239_10118569 | 3300010375 | Bacteria | 2937 |
| 339 | Ga0105239_10124685 | 3300010375 | Bacteria | 2862 |
| 340 | Ga0105239_10203365 | 3300010375 | Bacteria | 2219 |
| 341 | Ga0105239_10617559 | 3300010375 | Bacteria | 1237 |
| 342 | Ga0105239_10758819 | 3300010375 | Bacteria | 1110 |
| 343 | Ga0105239_12120987 | 3300010375 | Bacteria | 653 |
| 344 | Ga0105239_13093663 | 3300010375 | Bacteria | 542 |
| 345 | Ga0105246_10525867 | 3300011119 | Bacteria | 1009 |
| 346 | Ga0157370_10034059 | 3300013104 | Bacteria | 4963 |
| 347 | Ga0157370_11362062 | 3300013104 | Bacteria | 639 |
| 348 | Ga0157370_11895656 | 3300013104 | Bacteria | 535 |
| 349 | Ga0157369_10009894 | 3300013105 | Bacteria | 10896 |
| 350 | Ga0157369_10069789 | 3300013105 | Bacteria | 3775 |
| 351 | Ga0157369_10103369 | 3300013105 | Bacteria | 3035 |
| 352 | Ga0157369_10387188 | 3300013105 | Bacteria | 1451 |
| 353 | Ga0157369_11551367 | 3300013105 | Bacteria | 674 |
| 354 | Ga0157369_11695679 | 3300013105 | Bacteria | 642 |
| 355 | Ga0157374_10003326 | 3300013296 | Bacteria | 13512 |
| 356 | Ga0157374_10347053 | 3300013296 | Bacteria | 1474 |
| 357 | Ga0157374_10517789 | 3300013296 | Bacteria | 1198 |
| 358 | Ga0157374_10989339 | 3300013296 | Bacteria | 860 |
| 359 | Ga0157374_11393735 | 3300013296 | Bacteria | 724 |
| 360 | Ga0157378_10178253 | 3300013297 | Bacteria | 1998 |
| 361 | Ga0157378_10561113 | 3300013297 | Bacteria | 1148 |
| 362 | Ga0157378_10876248 | 3300013297 | Bacteria | 927 |
| 363 | Ga0163162_10026850 | 3300013306 | Bacteria | 5693 |
| 364 | Ga0163162_10367028 | 3300013306 | Bacteria | 1573 |
| 365 | Ga0163162_10410342 | 3300013306 | Bacteria | 1487 |
| 366 | Ga0163162_10438128 | 3300013306 | Bacteria | 1439 |
| 367 | Ga0163162_10670628 | 3300013306 | Bacteria | 1160 |
| 368 | Ga0157372_10189034 | 3300013307 | Bacteria | 2385 |
| 369 | Ga0157372_10284026 | 3300013307 | Bacteria | 1924 |
| 370 | Ga0157372_10329977 | 3300013307 | Bacteria | 1776 |
| 371 | Ga0157372_11504618 | 3300013307 | Bacteria | 775 |
| 372 | Ga0157375_10298571 | 3300013308 | Bacteria | 1774 |
| 373 | Ga0157375_10789035 | 3300013308 | Bacteria | 1099 |
| 374 | Ga0163163_10007553 | 3300014325 | Bacteria | 9597 |
| 375 | Ga0163163_10399369 | 3300014325 | Bacteria | 1433 |
| 376 | Ga0163163_10424397 | 3300014325 | Bacteria | 1389 |
| 377 | Ga0163163_10693921 | 3300014325 | Bacteria | 1081 |
| 378 | Ga0157380_10475671 | 3300014326 | Bacteria | 1207 |
| 379 | Ga0182008_10145428 | 3300014497 | Bacteria | 1187 |
| 380 | Ga0157377_10046781 | 3300014745 | Bacteria | 2421 |
| 381 | Ga0157377_10842548 | 3300014745 | Bacteria | 680 |
| 382 | Ga0157379_10245584 | 3300014968 | Bacteria | 1624 |
| 383 | Ga0157379_10483493 | 3300014968 | Bacteria | 1146 |
| 384 | Ga0157379_11818768 | 3300014968 | Bacteria | 599 |
| 385 | Ga0157376_10017469 | 3300014969 | Bacteria | 5473 |
| 386 | Ga0157376_10582566 | 3300014969 | Bacteria | 1111 |
| 387 | Ga0157376_10591912 | 3300014969 | Bacteria | 1103 |
| 388 | Ga0157376_11412126 | 3300014969 | Bacteria | 728 |
| 389 | Ga0163161_10369875 | 3300017792 | Bacteria | 1143 |
| 390 | Ga0163161_11204541 | 3300017792 | Bacteria | 655 |
| 391 | Ga0184601_109990 | 3300019183 | Bacteria | 506 |
| 392 | Ga0197907_11372531 | 3300020069 | Bacteria | 679 |
| 393 | Ga0206356_10091318 | 3300020070 | Bacteria | 1189 |
| 394 | Ga0206354_10938124 | 3300020081 | Bacteria | 1998 |
| 395 | Ga0206353_12039802 | 3300020082 | Bacteria | 716 |
| 396 | Ga0214544_1022606 | 3300021320 | Bacteria | 3743 |
| 397 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 398 | Ga0214542_1023298 | 3300021321 | Bacteria | 3743 |
| 399 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 400 | Ga0214545_1024282 | 3300021324 | Bacteria | 3776 |
| 401 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 402 | Ga0214543_1024476 | 3300021327 | Bacteria | 3722 |
| 403 | Ga0213872_10120974 | 3300021361 | Bacteria | 1157 |
| 404 | Ga0213874_10106109 | 3300021377 | Bacteria | 939 |
| 405 | Ga0213876_10048574 | 3300021384 | Bacteria | 2242 |
| 406 | Ga0213876_10217404 | 3300021384 | Bacteria | 1016 |
| 407 | Ga0213876_10698814 | 3300021384 | Bacteria | 540 |
| 408 | Ga0224712_10274410 | 3300022467 | Bacteria | 783 |
| 409 | Ga0209563_101649 | 3300025230 | Bacteria | 5737 |
| 410 | Ga0209677_100547 | 3300025253 | Bacteria | 20860 |
| 411 | Ga0209677_101107 | 3300025253 | Bacteria | 12660 |
| 412 | Ga0209233_1000908 | 3300025261 | Bacteria | 12943 |
| 413 | Ga0209233_1004920 | 3300025261 | Bacteria | 4494 |
| 414 | Ga0209455_1005799 | 3300025272 | Bacteria | 3752 |
| 415 | Ga0209455_1021921 | 3300025272 | Bacteria | 1228 |
| 416 | Ga0209673_1016891 | 3300025273 | Bacteria | 2711 |
| 417 | Ga0209564_1005255 | 3300025295 | Bacteria | 7475 |
| 418 | Ga0209758_1000189 | 3300025297 | Bacteria | 138296 |
| 419 | Ga0209758_1000827 | 3300025297 | Bacteria | 43314 |
| 420 | Ga0209758_1003142 | 3300025297 | Bacteria | 15539 |
| 421 | Ga0209758_1020233 | 3300025297 | Bacteria | 3161 |
| 422 | Ga0209758_1043163 | 3300025297 | Bacteria | 1664 |
| 423 | Ga0209256_1084781 | 3300025299 | Bacteria | 685 |
| 424 | Ga0207426_1001072 | 3300025302 | Bacteria | 25708 |
| 425 | Ga0207426_1001657 | 3300025302 | Bacteria | 17321 |
| 426 | Ga0207426_1010712 | 3300025302 | Bacteria | 3542 |
| 427 | Ga0209257_1100216 | 3300025304 | Bacteria | 707 |
| 428 | Ga0207697_10065228 | 3300025315 | Bacteria | 1519 |
| 429 | Ga0207656_10001089 | 3300025321 | Bacteria | 8894 |
| 430 | Ga0207656_10006242 | 3300025321 | Bacteria | 4270 |
| 431 | Ga0207656_10286944 | 3300025321 | Bacteria | 813 |
| 432 | Ga0207692_10000798 | 3300025898 | Bacteria | 11222 |
| 433 | Ga0207692_10001866 | 3300025898 | Bacteria | 8006 |
| 434 | Ga0207642_10031389 | 3300025899 | Bacteria | 2225 |
| 435 | Ga0207642_10057482 | 3300025899 | Bacteria | 1790 |
| 436 | Ga0207688_10030058 | 3300025901 | Bacteria | 2994 |
| 437 | Ga0207688_10430996 | 3300025901 | Bacteria | 820 |
| 438 | Ga0207647_10003452 | 3300025904 | Bacteria | 11858 |
| 439 | Ga0207685_10017711 | 3300025905 | Bacteria | 2311 |
| 440 | Ga0207685_10365411 | 3300025905 | Bacteria | 731 |
| 441 | Ga0207699_10001678 | 3300025906 | Bacteria | 10478 |
| 442 | Ga0207699_10028617 | 3300025906 | Bacteria | 3099 |
| 443 | Ga0207699_10204874 | 3300025906 | Bacteria | 1339 |
| 444 | Ga0207645_10415238 | 3300025907 | Bacteria | 906 |
| 445 | Ga0207643_10113617 | 3300025908 | Bacteria | 1597 |
| 446 | Ga0207705_10028471 | 3300025909 | Bacteria | 3983 |
| 447 | Ga0207705_10771605 | 3300025909 | Bacteria | 747 |
| 448 | Ga0207684_10441852 | 3300025910 | Bacteria | 1117 |
| 449 | Ga0207684_10553006 | 3300025910 | Bacteria | 985 |
| 450 | Ga0207654_10001074 | 3300025911 | Bacteria | 14855 |
| 451 | Ga0207654_10040765 | 3300025911 | Bacteria | 2618 |
| 452 | Ga0207654_10063717 | 3300025911 | Bacteria | 2165 |
| 453 | Ga0207654_10462097 | 3300025911 | Bacteria | 891 |
| 454 | Ga0207707_10002655 | 3300025912 | Bacteria | 15989 |
| 455 | Ga0207707_10009378 | 3300025912 | Bacteria | 8490 |
| 456 | Ga0207707_10025231 | 3300025912 | Bacteria | 5199 |
| 457 | Ga0207707_10207609 | 3300025912 | Bacteria | 1707 |
| 458 | Ga0207707_10733281 | 3300025912 | Bacteria | 827 |
| 459 | Ga0207695_10000159 | 3300025913 | Bacteria | 201367 |
| 460 | Ga0207695_10035634 | 3300025913 | Bacteria | 5392 |
| 461 | Ga0207695_10135688 | 3300025913 | Bacteria | 2414 |
| 462 | Ga0207695_11324059 | 3300025913 | Bacteria | 601 |
| 463 | Ga0207671_10003280 | 3300025914 | Bacteria | 16284 |
| 464 | Ga0207671_10177765 | 3300025914 | Bacteria | 1655 |
| 465 | Ga0207671_10285934 | 3300025914 | Bacteria | 1301 |
| 466 | Ga0207671_10372967 | 3300025914 | Bacteria | 1133 |
| 467 | Ga0207671_10376283 | 3300025914 | Bacteria | 1128 |
| 468 | Ga0207671_10524648 | 3300025914 | Bacteria | 944 |
| 469 | Ga0207671_10939127 | 3300025914 | Bacteria | 683 |
| 470 | Ga0207671_11182731 | 3300025914 | Bacteria | 599 |
| 471 | Ga0207693_10001679 | 3300025915 | Bacteria | 19500 |
| 472 | Ga0207693_10021981 | 3300025915 | Bacteria | 5071 |
| 473 | Ga0207693_10105122 | 3300025915 | Bacteria | 2214 |
| 474 | Ga0207663_10000672 | 3300025916 | Bacteria | 15122 |
| 475 | Ga0207663_10590031 | 3300025916 | Bacteria | 872 |
| 476 | Ga0207663_10602854 | 3300025916 | Bacteria | 863 |
| 477 | Ga0207660_10028715 | 3300025917 | Bacteria | 3807 |
| 478 | Ga0207660_10031077 | 3300025917 | Bacteria | 3674 |
| 479 | Ga0207660_10041034 | 3300025917 | Bacteria | 3242 |
| 480 | Ga0207660_10130755 | 3300025917 | Bacteria | 1911 |
| 481 | Ga0207657_10004801 | 3300025919 | Bacteria | 14253 |
| 482 | Ga0207657_10142420 | 3300025919 | Bacteria | 1958 |
| 483 | Ga0207657_10967270 | 3300025919 | Bacteria | 654 |
| 484 | Ga0207649_10129301 | 3300025920 | Bacteria | 1713 |
| 485 | Ga0207649_10247779 | 3300025920 | Bacteria | 1282 |
| 486 | Ga0207649_10400411 | 3300025920 | Bacteria | 1027 |
| 487 | Ga0207649_10589917 | 3300025920 | Bacteria | 854 |
| 488 | Ga0207652_10002660 | 3300025921 | Bacteria | 14994 |
| 489 | Ga0207652_10009472 | 3300025921 | Bacteria | 7830 |
| 490 | Ga0207652_10041605 | 3300025921 | Bacteria | 3907 |
| 491 | Ga0207652_10451505 | 3300025921 | Bacteria | 1159 |
| 492 | Ga0207694_10000271 | 3300025924 | Bacteria | 49284 |
| 493 | Ga0207694_10017732 | 3300025924 | Bacteria | 5380 |
| 494 | Ga0207694_10021788 | 3300025924 | Bacteria | 4857 |
| 495 | Ga0207694_10126639 | 3300025924 | Bacteria | 2044 |
| 496 | Ga0207694_10545562 | 3300025924 | Bacteria | 973 |
| 497 | Ga0207687_10023036 | 3300025927 | Bacteria | 4148 |
| 498 | Ga0207687_10852633 | 3300025927 | Bacteria | 778 |
| 499 | Ga0207687_11691001 | 3300025927 | Bacteria | 542 |
| 500 | Ga0207700_10005119 | 3300025928 | Bacteria | 7798 |
| 501 | Ga0207700_10173713 | 3300025928 | Bacteria | 1799 |
| 502 | Ga0207700_11494798 | 3300025928 | Bacteria | 599 |
| 503 | Ga0207664_10012380 | 3300025929 | Bacteria | 6096 |
| 504 | Ga0207664_10629235 | 3300025929 | Bacteria | 964 |
| 505 | Ga0207664_10815116 | 3300025929 | Bacteria | 839 |
| 506 | Ga0207664_11248387 | 3300025929 | Bacteria | 662 |
| 507 | Ga0207644_10025554 | 3300025931 | Bacteria | 4061 |
| 508 | Ga0207644_10464988 | 3300025931 | Bacteria | 1040 |
| 509 | Ga0207644_10473889 | 3300025931 | Bacteria | 1030 |
| 510 | Ga0207690_10179248 | 3300025932 | Bacteria | 1594 |
| 511 | Ga0207690_10199483 | 3300025932 | Bacteria | 1519 |
| 512 | Ga0207690_10449478 | 3300025932 | Bacteria | 1036 |
| 513 | Ga0207690_11369522 | 3300025932 | Bacteria | 591 |
| 514 | Ga0207706_10055641 | 3300025933 | Bacteria | 3488 |
| 515 | Ga0207706_10093304 | 3300025933 | Bacteria | 2647 |
| 516 | Ga0207706_10137433 | 3300025933 | Bacteria | 2150 |
| 517 | Ga0207706_10173356 | 3300025933 | Bacteria | 1895 |
| 518 | Ga0207706_10576871 | 3300025933 | Bacteria | 967 |
| 519 | Ga0207706_10727540 | 3300025933 | Bacteria | 846 |
| 520 | Ga0207686_10041734 | 3300025934 | Bacteria | 2800 |
| 521 | Ga0207686_10299322 | 3300025934 | Bacteria | 1194 |
| 522 | Ga0207709_10453503 | 3300025935 | Bacteria | 992 |
| 523 | Ga0207709_10942025 | 3300025935 | Bacteria | 703 |
| 524 | Ga0207669_10312440 | 3300025937 | Bacteria | 1199 |
| 525 | Ga0207669_10353849 | 3300025937 | Bacteria | 1136 |
| 526 | Ga0207669_11584645 | 3300025937 | Bacteria | 559 |
| 527 | Ga0207704_10162045 | 3300025938 | Bacteria | 1593 |
| 528 | Ga0207665_10000700 | 3300025939 | Bacteria | 22712 |
| 529 | Ga0207665_10078292 | 3300025939 | Bacteria | 2271 |
| 530 | Ga0207665_10119560 | 3300025939 | Bacteria | 1860 |
| 531 | Ga0207691_10583621 | 3300025940 | Bacteria | 947 |
| 532 | Ga0207711_10445075 | 3300025941 | Bacteria | 1206 |
| 533 | Ga0207711_10780215 | 3300025941 | Bacteria | 890 |
| 534 | Ga0207711_10805381 | 3300025941 | Bacteria | 875 |
| 535 | Ga0207689_10080252 | 3300025942 | Bacteria | 2682 |
| 536 | Ga0207689_10190000 | 3300025942 | Bacteria | 1694 |
| 537 | Ga0207689_10260607 | 3300025942 | Bacteria | 1434 |
| 538 | Ga0207689_10284579 | 3300025942 | Bacteria | 1369 |
| 539 | Ga0207689_10483259 | 3300025942 | Bacteria | 1037 |
| 540 | Ga0207661_10003040 | 3300025944 | Bacteria | 11601 |
| 541 | Ga0207661_10331914 | 3300025944 | Bacteria | 1369 |
| 542 | Ga0207661_10481903 | 3300025944 | Bacteria | 1132 |
| 543 | Ga0207679_10797422 | 3300025945 | Bacteria | 861 |
| 544 | Ga0207667_10003903 | 3300025949 | Bacteria | 18339 |
| 545 | Ga0207667_10005344 | 3300025949 | Bacteria | 15656 |
| 546 | Ga0207667_10047821 | 3300025949 | Bacteria | 4526 |
| 547 | Ga0207667_10328127 | 3300025949 | Bacteria | 1563 |
| 548 | Ga0207667_10348616 | 3300025949 | Bacteria | 1510 |
| 549 | Ga0207667_10377288 | 3300025949 | Bacteria | 1445 |
| 550 | Ga0207667_10443484 | 3300025949 | Bacteria | 1320 |
| 551 | Ga0207668_10080257 | 3300025972 | Bacteria | 2363 |
| 552 | Ga0207668_10249957 | 3300025972 | Bacteria | 1439 |
| 553 | Ga0207668_10484392 | 3300025972 | Bacteria | 1061 |
| 554 | Ga0207668_10560910 | 3300025972 | Bacteria | 990 |
| 555 | Ga0207668_10754976 | 3300025972 | Bacteria | 858 |
| 556 | Ga0207668_11446007 | 3300025972 | Bacteria | 620 |
| 557 | Ga0207640_10007468 | 3300025981 | Bacteria | 6038 |
| 558 | Ga0207640_10105171 | 3300025981 | Bacteria | 1988 |
| 559 | Ga0207640_10289366 | 3300025981 | Bacteria | 1291 |
| 560 | Ga0207658_10311950 | 3300025986 | Bacteria | 1359 |
| 561 | Ga0207658_10484966 | 3300025986 | Bacteria | 1099 |
| 562 | Ga0207658_10676960 | 3300025986 | Bacteria | 931 |
| 563 | Ga0207677_10011044 | 3300026023 | Bacteria | 5132 |
| 564 | Ga0207677_10420316 | 3300026023 | Bacteria | 1138 |
| 565 | Ga0207703_10075453 | 3300026035 | Bacteria | 2794 |
| 566 | Ga0207703_10683214 | 3300026035 | Bacteria | 975 |
| 567 | Ga0207703_11851463 | 3300026035 | Bacteria | 580 |
| 568 | Ga0207639_10172869 | 3300026041 | Bacteria | 1831 |
| 569 | Ga0207639_10275687 | 3300026041 | Bacteria | 1477 |
| 570 | Ga0207639_10295835 | 3300026041 | Bacteria | 1429 |
| 571 | Ga0207639_11217495 | 3300026041 | Bacteria | 707 |
| 572 | Ga0207639_11569602 | 3300026041 | Bacteria | 618 |
| 573 | Ga0207639_11692278 | 3300026041 | Bacteria | 593 |
| 574 | Ga0207678_10010552 | 3300026067 | Bacteria | 8114 |
| 575 | Ga0207678_10028578 | 3300026067 | Bacteria | 4867 |
| 576 | Ga0207678_10073165 | 3300026067 | Bacteria | 2938 |
| 577 | Ga0207678_10089069 | 3300026067 | Bacteria | 2638 |
| 578 | Ga0207678_10167906 | 3300026067 | Bacteria | 1874 |
| 579 | Ga0207678_10234738 | 3300026067 | Bacteria | 1570 |
| 580 | Ga0207678_11296226 | 3300026067 | Bacteria | 644 |
| 581 | Ga0207708_10127250 | 3300026075 | Bacteria | 1989 |
| 582 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 583 | Ga0207702_10000081 | 3300026078 | Bacteria | 108009 |
| 584 | Ga0207702_10056499 | 3300026078 | Bacteria | 3333 |
| 585 | Ga0207702_10239096 | 3300026078 | Bacteria | 1701 |
| 586 | Ga0207702_10249513 | 3300026078 | Bacteria | 1666 |
| 587 | Ga0207641_10176651 | 3300026088 | Bacteria | 1953 |
| 588 | Ga0207641_10848347 | 3300026088 | Bacteria | 905 |
| 589 | Ga0207641_10995766 | 3300026088 | Bacteria | 835 |
| 590 | Ga0207641_11796530 | 3300026088 | Bacteria | 615 |
| 591 | Ga0207648_10199196 | 3300026089 | Bacteria | 1776 |
| 592 | Ga0207648_10204030 | 3300026089 | Bacteria | 1754 |
| 593 | Ga0207648_10884066 | 3300026089 | Bacteria | 834 |
| 594 | Ga0207676_10604521 | 3300026095 | Bacteria | 1054 |
| 595 | Ga0207676_12033745 | 3300026095 | Bacteria | 573 |
| 596 | Ga0207674_10007442 | 3300026116 | Bacteria | 12762 |
| 597 | Ga0207674_10024446 | 3300026116 | Bacteria | 6456 |
| 598 | Ga0207674_10370937 | 3300026116 | Bacteria | 1383 |
| 599 | Ga0207675_100467335 | 3300026118 | Bacteria | 1252 |
| 600 | Ga0207675_100628200 | 3300026118 | Bacteria | 1079 |
| 601 | Ga0207675_100632621 | 3300026118 | Bacteria | 1075 |
| 602 | Ga0207675_101396566 | 3300026118 | Bacteria | 721 |
| 603 | Ga0207675_101426250 | 3300026118 | Bacteria | 713 |
| 604 | Ga0207683_10027486 | 3300026121 | Bacteria | 4916 |
| 605 | Ga0207683_10032383 | 3300026121 | Bacteria | 4542 |
| 606 | Ga0207683_10097580 | 3300026121 | Bacteria | 2621 |
| 607 | Ga0207683_11210045 | 3300026121 | Bacteria | 700 |
| 608 | Ga0207698_10065686 | 3300026142 | Bacteria | 2851 |
| 609 | Ga0207698_10075603 | 3300026142 | Bacteria | 2693 |
| 610 | Ga0207698_10779031 | 3300026142 | Bacteria | 957 |
| 611 | Ga0207698_10835067 | 3300026142 | Bacteria | 925 |
| 612 | Ga0209389_1000239 | 3300027296 | Bacteria | 35712 |
| 613 | Ga0209389_1000690 | 3300027296 | Bacteria | 21019 |
| 614 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 615 | Ga0209589_1007787 | 3300027357 | Bacteria | 17039 |
| 616 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 617 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 618 | Ga0209489_122501 | 3300027361 | Bacteria | 1351 |
| 619 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 620 | Ga0268266_10016992 | 3300028379 | Bacteria | 6215 |
| 621 | Ga0268266_10019219 | 3300028379 | Bacteria | 5818 |
| 622 | Ga0268266_10023260 | 3300028379 | Bacteria | 5276 |
| 623 | Ga0268266_10093175 | 3300028379 | Bacteria | 2643 |
| 624 | Ga0268266_10335405 | 3300028379 | Bacteria | 1418 |
| 625 | Ga0268266_10353387 | 3300028379 | Bacteria | 1381 |
| 626 | Ga0268266_10416169 | 3300028379 | Bacteria | 1273 |
| 627 | Ga0268266_10493004 | 3300028379 | Bacteria | 1169 |
| 628 | Ga0268266_10907006 | 3300028379 | Bacteria | 852 |
| 629 | Ga0268266_11155851 | 3300028379 | Bacteria | 749 |
| 630 | Ga0268266_11258179 | 3300028379 | Bacteria | 715 |
| 631 | Ga0268266_12108609 | 3300028379 | Bacteria | 536 |
| 632 | Ga0268265_10080305 | 3300028380 | Bacteria | 2571 |
| 633 | Ga0268265_10240729 | 3300028380 | Bacteria | 1596 |
| 634 | Ga0268265_10355501 | 3300028380 | Bacteria | 1339 |
| 635 | Ga0268265_10368469 | 3300028380 | Bacteria | 1318 |
| 636 | Ga0268265_10557792 | 3300028380 | Bacteria | 1088 |
| 637 | Ga0268265_11718478 | 3300028380 | Bacteria | 633 |
| 638 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 639 | Ga0268264_10211912 | 3300028381 | Bacteria | 1779 |
| 640 | Ga0268264_10346086 | 3300028381 | Bacteria | 1413 |
| 641 | Ga0268264_11024525 | 3300028381 | Bacteria | 832 |
| 642 | Ga0268264_12374707 | 3300028381 | Bacteria | 536 |
| 643 | Ga0307515_10141133 | 3300028794 | Bacteria | 2583 |
| 644 | Ga0307515_10855676 | 3300028794 | Bacteria | 536 |
| 645 | Ga0307512_10296696 | 3300030522 | Bacteria | 757 |
| 646 | Ga0265330_10115115 | 3300031235 | Bacteria | 1147 |
| 647 | Ga0265332_10012628 | 3300031238 | Bacteria | 3745 |
| 648 | Ga0265332_10029389 | 3300031238 | Bacteria | 2403 |
| 649 | Ga0265328_10136833 | 3300031239 | Bacteria | 918 |
| 650 | Ga0265325_10001459 | 3300031241 | Bacteria | 16619 |
| 651 | Ga0265339_10116551 | 3300031249 | Bacteria | 1377 |
| 652 | Ga0265339_10125533 | 3300031249 | Bacteria | 1316 |
| 653 | Ga0265331_10012884 | 3300031250 | Bacteria | 4511 |
| 654 | Ga0265331_10067340 | 3300031250 | Bacteria | 1680 |
| 655 | Ga0265316_10024414 | 3300031344 | Bacteria | 5066 |
| 656 | Ga0265316_10116509 | 3300031344 | Bacteria | 2020 |
| 657 | Ga0265316_10513478 | 3300031344 | Bacteria | 855 |
| 658 | Ga0307513_10661536 | 3300031456 | Bacteria | 751 |
| 659 | Ga0307513_10710277 | 3300031456 | Bacteria | 711 |
| 660 | Ga0307509_10043479 | 3300031507 | Bacteria | 4862 |
| 661 | Ga0307509_10111569 | 3300031507 | Bacteria | 2737 |
| 662 | Ga0307408_100297283 | 3300031548 | Bacteria | 1351 |
| 663 | Ga0307408_100478711 | 3300031548 | Bacteria | 1086 |
| 664 | Ga0265313_10053430 | 3300031595 | Bacteria | 1923 |
| 665 | Ga0307508_10433683 | 3300031616 | Bacteria | 906 |
| 666 | Ga0307508_10470827 | 3300031616 | Bacteria | 850 |
| 667 | Ga0307508_10474521 | 3300031616 | Bacteria | 844 |
| 668 | Ga0307508_10481546 | 3300031616 | Bacteria | 835 |
| 669 | Ga0265314_10002371 | 3300031711 | Bacteria | 19414 |
| 670 | Ga0265342_10046188 | 3300031712 | Bacteria | 2618 |
| 671 | Ga0265342_10255286 | 3300031712 | Bacteria | 934 |
| 672 | Ga0307516_10009732 | 3300031730 | Bacteria | 10665 |
| 673 | Ga0307516_10149556 | 3300031730 | Bacteria | 2097 |
| 674 | Ga0307516_10244301 | 3300031730 | Bacteria | 1492 |
| 675 | Ga0307407_10272742 | 3300031903 | Bacteria | 1168 |
| 676 | Ga0307412_10245600 | 3300031911 | Bacteria | 1387 |
| 677 | Ga0307409_100422445 | 3300031995 | Bacteria | 1279 |
| 678 | Ga0307415_100358307 | 3300032126 | Bacteria | 1231 |
| 679 | Ga0307507_10086856 | 3300033179 | Bacteria | 2708 |
| 680 | Ga0307510_10004554 | 3300033180 | Bacteria | 16321 |
| 681 | Ga0307510_10009746 | 3300033180 | Bacteria | 11432 |
| 682 | Ga0307510_10048002 | 3300033180 | Bacteria | 4562 |
| 683 | Ga0307510_10050493 | 3300033180 | Bacteria | 4411 |
| 684 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 685 | Ga0316215_1006418 | 3300033544 | Bacteria | 1140 |
| 686 | Ga0373930_0069732 | 3300034816 | Bacteria | 797 |
| 687 | Ga0373928_0222476 | 3300035084 | Bacteria | 553 |
| 688 | Ga0373934_0015478 | 3300035086 | Bacteria | 2894 |
| 689 | Ga0373934_0160854 | 3300035086 | Bacteria | 921 |
| 690 | Ga0373940_0012311 | 3300035088 | Bacteria | 2048 |
| 691 | Ga0373944_0125234 | 3300035089 | Bacteria | 889 |
| 692 | Ga0373949_0091805 | 3300035090 | Bacteria | 822 |
| 693 | Ga0373952_0008165 | 3300035092 | Bacteria | 1981 |
| 694 | Ga0373952_0073418 | 3300035092 | Bacteria | 860 |
| 695 | Ga0373923_0051235 | 3300035111 | Bacteria | 1731 |
| 696 | Ga0373923_0051523 | 3300035111 | Bacteria | 1727 |
| 697 | Ga0373936_0089725 | 3300035113 | Bacteria | 1288 |
| 698 | Ga0373945_0021136 | 3300035116 | Bacteria | 2234 |
| 699 | Ga0373953_0002753 | 3300035117 | Bacteria | 5341 |
| 700 | Ga0373953_0069543 | 3300035117 | Bacteria | 1450 |
| 701 | Ga0373953_0366716 | 3300035117 | Bacteria | 632 |
| 702 | Ga0373954_0045183 | 3300035118 | Bacteria | 2057 |
| 703 | Ga0373954_0046329 | 3300035118 | Bacteria | 2032 |
| 704 | Ga0373954_0089602 | 3300035118 | Bacteria | 1476 |
| 705 | Ga0373954_0185056 | 3300035118 | Bacteria | 1022 |
| 706 | Ga0373956_0001884 | 3300035119 | Bacteria | 8647 |
| 707 | Ga0373957_0000200 | 3300035120 | Bacteria | 15408 |
| 708 | Ga0373957_0529496 | 3300035120 | Bacteria | 514 |
| 709 | Ga0373943_0150435 | 3300035170 | Bacteria | 1261 |
| 710 | Ga0373943_0513366 | 3300035170 | Bacteria | 701 |
| 711 | Ga0373946_0124782 | 3300035171 | Bacteria | 1179 |
| 712 | Ga0373955_0005004 | 3300035172 | Bacteria | 5921 |
| 713 | Ga0373955_0028493 | 3300035172 | Bacteria | 2895 |
| 714 | Ga0373942_0033816 | 3300035207 | Bacteria | 1365 |
| 715 | Ga0373962_0178067 | 3300035242 | Bacteria | 710 |
| 716 | Ga0373924_0006349 | 3300035410 | Bacteria | 4233 |
| 717 | Ga0373931_0004494 | 3300035691 | Bacteria | 6377 |
| 718 | Ga0373931_0216727 | 3300035691 | Bacteria | 1151 |
| 719 | Ga0373935_0042994 | 3300035692 | Bacteria | 2842 |
| 720 | Ga0373935_0082494 | 3300035692 | Bacteria | 2092 |
| 721 | Ga0373935_0109527 | 3300035692 | Bacteria | 1831 |
| 722 | Ga0373927_0026102 | 3300035695 | Bacteria | 3817 |
| 723 | Ga0373927_0084944 | 3300035695 | Bacteria | 2053 |
| 724 | Ga0373927_0128333 | 3300035695 | Bacteria | 1656 |
| 725 | Ga0373927_0180331 | 3300035695 | Bacteria | 1385 |
| 726 | Ga0373933_0022657 | 3300035724 | Bacteria | 3579 |
| 727 | Ga0373933_0031995 | 3300035724 | Bacteria | 3055 |
| 728 | Ga0373933_0773427 | 3300035724 | Bacteria | 632 |
| 729 | Ga0373947_0017146 | 3300035725 | Bacteria | 4164 |
| 730 | Ga0373947_0168552 | 3300035725 | Bacteria | 1420 |
| 731 | Ga0373947_0253866 | 3300035725 | Bacteria | 1163 |
| 732 | Ga0373947_0464391 | 3300035725 | Bacteria | 858 |
| 733 | Ga0373947_0639787 | 3300035725 | Bacteria | 725 |
| 734 | Ga0310104_03485 | 3300036242 | Bacteria | 1360 |
| 735 | Ga0373937_0014785 | 3300036401 | Bacteria | 6891 |
| 736 | Ga0373937_0036239 | 3300036401 | Bacteria | 4494 |
| 737 | Ga0373937_0054734 | 3300036401 | Bacteria | 3662 |
| 738 | Ga0373937_0767649 | 3300036401 | Bacteria | 911 |
| 739 | Ga0372808_005034 | 3300036459 | Bacteria | 1722 |
| 740 | Ga0373925_0043776 | 3300037068 | Bacteria | 3323 |
| 741 | Ga0373925_0123549 | 3300037068 | Bacteria | 2012 |
| 742 | Ga0373925_0204767 | 3300037068 | Bacteria | 1570 |
| 743 | Ga0373925_0257427 | 3300037068 | Bacteria | 1401 |
| 744 | Ga0373925_0328933 | 3300037068 | Bacteria | 1238 |
| 745 | Ga0373925_0573898 | 3300037068 | Bacteria | 928 |
| 746 | Ga0373925_0671226 | 3300037068 | Bacteria | 854 |
| 747 | Ga0395900_0002922 | 3300037418 | Bacteria | 18612 |
| 748 | Ga0395900_0428366 | 3300037418 | Bacteria | 1283 |
| 749 | Ga0395900_1659015 | 3300037418 | Bacteria | 550 |
| 750 | Ga0395898_0117507 | 3300037466 | Bacteria | 2548 |
| 751 | Ga0395898_0136329 | 3300037466 | Bacteria | 2350 |
| 752 | Ga0395898_0330553 | 3300037466 | Bacteria | 1453 |
| 753 | Ga0395905_0008568 | 3300037471 | Bacteria | 10082 |
| 754 | Ga0395905_0053544 | 3300037471 | Bacteria | 3777 |
| 755 | Ga0395905_1211612 | 3300037471 | Bacteria | 658 |
| 756 | Ga0436364_0243149 | 3300037853 | Bacteria | 1129 |
| 757 | Ga0436364_0326406 | 3300037853 | Bacteria | 9677 |
| 758 | Ga0395901_0062170 | 3300038443 | Bacteria | 3886 |
| 759 | Ga0395901_0116181 | 3300038443 | Bacteria | 2811 |
| 760 | Ga0395901_0822767 | 3300038443 | Bacteria | 916 |
| 761 | Ga0436365_0712770 | 3300039437 | Bacteria | 2536 |
| 762 | Ga0436365_1408544 | 3300039437 | Bacteria | 3153 |
| 763 | Ga0436365_1587325 | 3300039437 | Bacteria | 554 |
| 764 | Ga0436365_1694566 | 3300039437 | Bacteria | 2526 |
| 765 | Ga0436360_0062375 | 3300039438 | Bacteria | 923 |
| 766 | Ga0436360_0288357 | 3300039438 | Bacteria | 2373 |
| 767 | Ga0436361_1160317 | 3300039447 | Bacteria | 1732 |
| 768 | Ga0436363_0616419 | 3300039450 | Bacteria | 1033 |
| 769 | Ga0436363_0674671 | 3300039450 | Bacteria | 1298 |
| 770 | Ga0436363_0928946 | 3300039450 | Bacteria | 632 |
| 771 | Ga0451789_1044976 | 3300041443 | Bacteria | 500 |
| 772 | Ga0451791_0535527 | 3300041451 | Bacteria | 607 |
| 773 | Ga0451793_0481979 | 3300041452 | Bacteria | 644 |
| 774 | Ga0451793_1831426 | 3300041452 | Bacteria | 1445 |
| 775 | Ga0451797_0276797 | 3300041453 | Bacteria | 799 |
| 776 | Ga0451797_1068329 | 3300041453 | Bacteria | 1235 |
| 777 | Ga0451795_0062024 | 3300041456 | Bacteria | 562 |
| 778 | Ga0451795_1072685 | 3300041456 | Bacteria | 589 |
| 779 | Ga0451795_1432725 | 3300041456 | Bacteria | 555 |
| 780 | Ga0451802_0754618 | 3300041460 | Bacteria | 931 |
| 781 | Ga0451807_0740528 | 3300041486 | Bacteria | 581 |
| 782 | Ga0451807_2768343 | 3300041486 | Bacteria | 610 |
| 783 | Ga0451835_0414532 | 3300041492 | Bacteria | 857 |
| 784 | Ga0451837_1123549 | 3300041494 | Bacteria | 1188 |
| 785 | Ga0451845_0348542 | 3300041501 | Bacteria | 975 |
| 786 | Ga0451847_0288977 | 3300041503 | Bacteria | 503 |
| 787 | Ga0451849_1171485 | 3300041505 | Bacteria | 572 |
| 788 | Ga0451843_0960431 | 3300041509 | Bacteria | 734 |
| 789 | Ga0451855_0132121 | 3300041511 | Bacteria | 1988 |
| 790 | Ga0451853_0403605 | 3300041512 | Bacteria | 585 |
| 791 | Ga0439459_0022833 | 3300042438 | Bacteria | 1214 |
| 792 | Ga0466969_0138052 | 3300044656 | Bacteria | 1128 |
| 793 | Ga0466972_0000465 | 3300044658 | Bacteria | 20617 |
| 794 | Ga0466972_0018329 | 3300044658 | Bacteria | 3498 |
| 795 | Ga0466972_0228571 | 3300044658 | Bacteria | 870 |
| 796 | Ga0466965_0761563 | 3300044683 | Bacteria | 558 |
| 797 | Ga0466966_0182565 | 3300044684 | Bacteria | 1273 |
| 798 | Ga0466961_0000366 | 3300044693 | Bacteria | 29235 |
| 799 | Ga0466961_0266891 | 3300044693 | Bacteria | 1049 |
| 800 | Ga0466963_0004594 | 3300044694 | Bacteria | 8038 |
| 801 | Ga0466963_0037426 | 3300044694 | Bacteria | 3168 |
| 802 | Ga0466964_0404466 | 3300044706 | Bacteria | 714 |
| 803 | Ga0466964_0718109 | 3300044706 | Bacteria | 558 |
| 804 | Ga0466968_0004579 | 3300044735 | Bacteria | 5172 |
| 805 | Ga0466968_0044827 | 3300044735 | Bacteria | 1875 |
| 806 | Ga0466968_0219701 | 3300044735 | Bacteria | 895 |
| 807 | Ga0466968_0236576 | 3300044735 | Bacteria | 864 |
| 808 | Ga0466970_0087681 | 3300044765 | Bacteria | 1688 |
| 809 | Ga0466970_0203228 | 3300044765 | Bacteria | 1103 |
| 810 | Ga0466957_0115195 | 3300044842 | Bacteria | 1708 |
| 811 | Ga0466957_0493296 | 3300044842 | Bacteria | 848 |
| 812 | Ga0466960_0114897 | 3300044901 | Bacteria | 1403 |
| 813 | Ga0466960_0483981 | 3300044901 | Bacteria | 723 |
| 814 | Ga0466959_0002745 | 3300045049 | Bacteria | 11338 |
| 815 | Ga0466959_0096611 | 3300045049 | Bacteria | 2118 |
| 816 | Ga0466959_0155138 | 3300045049 | Bacteria | 1612 |
| 817 | Ga0466967_0047144 | 3300045976 | Bacteria | 3756 |
| 818 | Ga0466967_0168058 | 3300045976 | Bacteria | 2062 |
| 819 | Ga0466967_0803791 | 3300045976 | Bacteria | 934 |
| 820 | Ga0495617_213296 | 3300046452 | Bacteria | 601 |
| 821 | Ga0495592_0002897 | 3300046454 | Bacteria | 12205 |
| 822 | Ga0495592_0124744 | 3300046454 | Bacteria | 1808 |
| 823 | Ga0495592_0150404 | 3300046454 | Bacteria | 1610 |
| 824 | Ga0495603_0016547 | 3300046455 | Bacteria | 4462 |
| 825 | Ga0495603_0031419 | 3300046455 | Bacteria | 3196 |
| 826 | Ga0495603_0101068 | 3300046455 | Bacteria | 1683 |
| 827 | Ga0495603_0388618 | 3300046455 | Bacteria | 800 |
| 828 | Ga0495603_0486554 | 3300046455 | Bacteria | 707 |
| 829 | Ga0495590_0337869 | 3300046457 | Bacteria | 571 |
| 830 | Ga0495629_0064923 | 3300046459 | Bacteria | 2548 |
| 831 | Ga0495629_0129488 | 3300046459 | Bacteria | 1758 |
| 832 | Ga0495629_0219080 | 3300046459 | Bacteria | 1313 |
| 833 | Ga0495638_0018849 | 3300046460 | Bacteria | 4575 |
| 834 | Ga0495638_0074041 | 3300046460 | Bacteria | 2077 |
| 835 | Ga0495638_0221135 | 3300046460 | Bacteria | 1058 |
| 836 | Ga0495651_0001183 | 3300046462 | Bacteria | 20142 |
| 837 | Ga0495651_0027081 | 3300046462 | Bacteria | 4465 |
| 838 | Ga0495651_0193645 | 3300046462 | Bacteria | 1428 |
| 839 | Ga0495651_0465031 | 3300046462 | Bacteria | 815 |
| 840 | Ga0495653_0066003 | 3300046463 | Bacteria | 2722 |
| 841 | Ga0495580_0021678 | 3300046472 | Bacteria | 4738 |
| 842 | Ga0495582_0157122 | 3300046473 | Bacteria | 1292 |
| 843 | Ga0495582_0173382 | 3300046473 | Bacteria | 1228 |
| 844 | Ga0495582_0260536 | 3300046473 | Bacteria | 995 |
| 845 | Ga0495639_0283323 | 3300046475 | Bacteria | 824 |
| 846 | Ga0495639_0744274 | 3300046475 | Bacteria | 507 |
| 847 | Ga0495662_0410640 | 3300046476 | Bacteria | 665 |
| 848 | Ga0495664_0007504 | 3300046477 | Bacteria | 6062 |
| 849 | Ga0495664_0010508 | 3300046477 | Bacteria | 5194 |
| 850 | Ga0495664_0061043 | 3300046477 | Bacteria | 2245 |
| 851 | Ga0495664_0416668 | 3300046477 | Bacteria | 806 |
| 852 | Ga0495584_0087161 | 3300046491 | Bacteria | 1573 |
| 853 | Ga0495584_0095500 | 3300046491 | Bacteria | 1501 |
| 854 | Ga0495584_0100078 | 3300046491 | Bacteria | 1465 |
| 855 | Ga0495584_0109102 | 3300046491 | Bacteria | 1400 |
| 856 | Ga0495584_0217539 | 3300046491 | Bacteria | 971 |
| 857 | Ga0495584_0350908 | 3300046491 | Bacteria | 749 |
| 858 | Ga0495594_0111688 | 3300046499 | Bacteria | 1541 |
| 859 | Ga0495594_0246695 | 3300046499 | Bacteria | 1017 |
| 860 | Ga0495596_0266892 | 3300046500 | Bacteria | 664 |
| 861 | Ga0495583_0126717 | 3300046506 | Bacteria | 1071 |
| 862 | Ga0495606_0116860 | 3300046507 | Bacteria | 1601 |
| 863 | Ga0495606_0141205 | 3300046507 | Bacteria | 1422 |
| 864 | Ga0495606_0366619 | 3300046507 | Bacteria | 760 |
| 865 | Ga0495606_0512640 | 3300046507 | Bacteria | 603 |
| 866 | Ga0495606_0518053 | 3300046507 | Bacteria | 599 |
| 867 | Ga0495606_0586742 | 3300046507 | Bacteria | 549 |
| 868 | Ga0495608_0017985 | 3300046511 | Bacteria | 4883 |
| 869 | Ga0495610_0061518 | 3300046512 | Bacteria | 1783 |
| 870 | Ga0495616_0271533 | 3300046513 | Bacteria | 723 |
| 871 | Ga0495616_0322104 | 3300046513 | Bacteria | 649 |
| 872 | Ga0495618_0397787 | 3300046514 | Bacteria | 843 |
| 873 | Ga0495620_0027074 | 3300046515 | Bacteria | 2688 |
| 874 | Ga0495620_0033852 | 3300046515 | Bacteria | 2315 |
| 875 | Ga0495628_0238409 | 3300046516 | Bacteria | 1361 |
| 876 | Ga0495630_0107347 | 3300046517 | Bacteria | 2115 |
| 877 | Ga0495630_0849392 | 3300046517 | Bacteria | 696 |
| 878 | Ga0495631_0083502 | 3300046518 | Bacteria | 1376 |
| 879 | Ga0495631_0184737 | 3300046518 | Bacteria | 893 |
| 880 | Ga0495631_0400626 | 3300046518 | Bacteria | 584 |
| 881 | Ga0495631_0417531 | 3300046518 | Bacteria | 571 |
| 882 | Ga0495632_0116801 | 3300046519 | Bacteria | 1249 |
| 883 | Ga0495643_0008653 | 3300046522 | Bacteria | 6422 |
| 884 | Ga0495643_0058784 | 3300046522 | Bacteria | 2045 |
| 885 | Ga0495643_0443470 | 3300046522 | Bacteria | 566 |
| 886 | Ga0495648_0002079 | 3300046524 | Bacteria | 18947 |
| 887 | Ga0495648_0004572 | 3300046524 | Bacteria | 11787 |
| 888 | Ga0495648_0039173 | 3300046524 | Bacteria | 3019 |
| 889 | Ga0495648_0190190 | 3300046524 | Bacteria | 1036 |
| 890 | Ga0495666_0076926 | 3300046526 | Bacteria | 1582 |
| 891 | Ga0495652_0023007 | 3300046529 | Bacteria | 5526 |
| 892 | Ga0495652_0120252 | 3300046529 | Bacteria | 2096 |
| 893 | Ga0495652_0196823 | 3300046529 | Bacteria | 1533 |
| 894 | Ga0495652_0560670 | 3300046529 | Bacteria | 784 |
| 895 | Ga0495654_0025118 | 3300046530 | Bacteria | 3071 |
| 896 | Ga0495665_0007540 | 3300046531 | Bacteria | 5890 |
| 897 | Ga0495665_0477316 | 3300046531 | Bacteria | 629 |
| 898 | Ga0495640_0005616 | 3300046533 | Bacteria | 9978 |
| 899 | Ga0495640_0192589 | 3300046533 | Bacteria | 1295 |
| 900 | Ga0495640_0364683 | 3300046533 | Bacteria | 890 |
| 901 | Ga0495586_0100571 | 3300046535 | Bacteria | 1604 |
| 902 | Ga0495587_0004094 | 3300046536 | Bacteria | 9650 |
| 903 | Ga0495587_0025519 | 3300046536 | Bacteria | 3611 |
| 904 | Ga0495587_0292503 | 3300046536 | Bacteria | 912 |
| 905 | Ga0495609_0434335 | 3300046538 | Bacteria | 523 |
| 906 | Ga0495621_0131062 | 3300046539 | Bacteria | 975 |
| 907 | Ga0495621_0369815 | 3300046539 | Bacteria | 604 |
| 908 | Ga0495597_0048627 | 3300046542 | Bacteria | 1876 |
| 909 | Ga0495645_0013424 | 3300046543 | Bacteria | 5791 |
| 910 | Ga0495645_0060122 | 3300046543 | Bacteria | 2755 |
| 911 | Ga0495645_0128923 | 3300046543 | Bacteria | 1775 |
| 912 | Ga0495645_0541658 | 3300046543 | Bacteria | 722 |
| 913 | Ga0495622_0008839 | 3300046557 | Bacteria | 4663 |
| 914 | Ga0495622_0124130 | 3300046557 | Bacteria | 1178 |
| 915 | Ga0495633_0086679 | 3300046558 | Bacteria | 1456 |
| 916 | Ga0495633_0500550 | 3300046558 | Bacteria | 548 |
| 917 | Ga0495667_0009980 | 3300046559 | Bacteria | 6430 |
| 918 | Ga0495667_0131901 | 3300046559 | Bacteria | 1611 |
| 919 | Ga0495656_0239858 | 3300046615 | Bacteria | 912 |
| 920 | Ga0495656_0386857 | 3300046615 | Bacteria | 730 |
| 921 | Ga0495668_0117761 | 3300046616 | Bacteria | 1453 |
| 922 | Ga0495668_0144734 | 3300046616 | Bacteria | 1301 |
| 923 | Ga0495668_0153470 | 3300046616 | Bacteria | 1261 |
| 924 | Ga0495668_0370538 | 3300046616 | Bacteria | 786 |
| 925 | Ga0495668_0410025 | 3300046616 | Bacteria | 745 |
| 926 | Ga0495668_0556326 | 3300046616 | Bacteria | 633 |
| 927 | Ga0495668_0804889 | 3300046616 | Bacteria | 520 |
| 928 | Ga0495634_0019165 | 3300046642 | Bacteria | 4863 |
| 929 | Ga0495634_0030090 | 3300046642 | Bacteria | 3753 |
| 930 | Ga0495634_0034579 | 3300046642 | Bacteria | 3467 |
| 931 | Ga0495634_0116016 | 3300046642 | Bacteria | 1718 |
| 932 | Ga0495634_0174787 | 3300046642 | Bacteria | 1348 |
| 933 | Ga0495611_0085823 | 3300046648 | Bacteria | 1452 |
| 934 | Ga0495625_0029775 | 3300046660 | Bacteria | 4080 |
| 935 | Ga0495625_0178398 | 3300046660 | Bacteria | 1414 |
| 936 | Ga0495625_0400645 | 3300046660 | Bacteria | 857 |
| 937 | Ga0495625_0613134 | 3300046660 | Bacteria | 652 |
| 938 | Ga0495635_0001058 | 3300046663 | Bacteria | 18230 |
| 939 | Ga0495635_0002199 | 3300046663 | Bacteria | 13260 |
| 940 | Ga0495661_0133148 | 3300046665 | Bacteria | 1360 |
| 941 | Ga0495661_0220214 | 3300046665 | Bacteria | 984 |
| 942 | Ga0495657_0011029 | 3300046675 | Bacteria | 6776 |
| 943 | Ga0495657_0011523 | 3300046675 | Bacteria | 6606 |
| 944 | Ga0495657_0014422 | 3300046675 | Bacteria | 5801 |
| 945 | Ga0495657_0439712 | 3300046675 | Bacteria | 764 |
| 946 | Ga0495657_0853520 | 3300046675 | Bacteria | 519 |
| 947 | Ga0495599_0082999 | 3300046678 | Bacteria | 2001 |
| 948 | Ga0495599_0095311 | 3300046678 | Bacteria | 1856 |
| 949 | Ga0495599_0257471 | 3300046678 | Bacteria | 1061 |
| 950 | Ga0495599_0441992 | 3300046678 | Bacteria | 771 |
| 951 | Ga0495623_0018971 | 3300046679 | Bacteria | 4440 |
| 952 | Ga0495623_0043429 | 3300046679 | Bacteria | 2860 |
| 953 | Ga0495623_0142637 | 3300046679 | Bacteria | 1423 |
| 954 | Ga0495623_0153410 | 3300046679 | Bacteria | 1359 |
| 955 | Ga0495646_0000934 | 3300046680 | Bacteria | 16609 |
| 956 | Ga0495646_0076971 | 3300046680 | Bacteria | 1952 |
| 957 | Ga0495646_0242207 | 3300046680 | Bacteria | 969 |
| 958 | Ga0495647_0114158 | 3300046681 | Bacteria | 1130 |
| 959 | Ga0495658_0038455 | 3300046683 | Bacteria | 2650 |
| 960 | Ga0495658_0101562 | 3300046683 | Bacteria | 1718 |
| 961 | Ga0495658_0759005 | 3300046683 | Bacteria | 621 |
| 962 | Ga0495669_0071530 | 3300046684 | Bacteria | 1582 |
| 963 | Ga0495669_0102379 | 3300046684 | Bacteria | 1331 |
| 964 | Ga0495613_0044384 | 3300046689 | Bacteria | 3289 |
| 965 | Ga0495613_0060313 | 3300046689 | Bacteria | 2779 |
| 966 | Ga0495624_0038211 | 3300046690 | Bacteria | 3085 |
| 967 | Ga0495624_0323741 | 3300046690 | Bacteria | 928 |
| 968 | Ga0495624_0371965 | 3300046690 | Bacteria | 859 |
| 969 | Ga0495670_0379468 | 3300046691 | Bacteria | 763 |
| 970 | Ga0495671_0041406 | 3300046692 | Bacteria | 2319 |
| 971 | Ga0495671_0052466 | 3300046692 | Bacteria | 2027 |
| 972 | Ga0495671_0246860 | 3300046692 | Bacteria | 862 |
| 973 | Ga0495649_0246153 | 3300046694 | Bacteria | 919 |
| 974 | Ga0495649_0332373 | 3300046694 | Bacteria | 770 |
| 975 | Ga0495589_0561386 | 3300046794 | Bacteria | 520 |
| 976 | Ga0495600_0007371 | 3300046809 | Bacteria | 6726 |
| 977 | Ga0495600_0012798 | 3300046809 | Bacteria | 5255 |
| 978 | Ga0495581_0030696 | 3300047315 | Bacteria | 3113 |
| 979 | Ga0495581_0155785 | 3300047315 | Bacteria | 1335 |
| 980 | Ga0495604_0002274 | 3300047317 | Bacteria | 15383 |
| 981 | Ga0495604_0075423 | 3300047317 | Bacteria | 2539 |
| 982 | Ga0495604_0079461 | 3300047317 | Bacteria | 2459 |
| 983 | Ga0495604_0111985 | 3300047317 | Bacteria | 1989 |
| 984 | Ga0495604_0119190 | 3300047317 | Bacteria | 1912 |
| 985 | Ga0495604_0155781 | 3300047317 | Bacteria | 1618 |
| 986 | Ga0495604_0874925 | 3300047317 | Bacteria | 562 |
| 987 | Ga0495674_0087619 | 3300047319 | Bacteria | 2664 |
| 988 | Ga0495674_0091722 | 3300047319 | Bacteria | 2594 |
| 989 | Ga0495674_0140758 | 3300047319 | Bacteria | 2028 |
| 990 | Ga0495674_1192249 | 3300047319 | Bacteria | 576 |
| 991 | Ga0495672_0025437 | 3300047320 | Bacteria | 3788 |
| 992 | Ga0495672_0326863 | 3300047320 | Bacteria | 719 |
| 993 | Ga0495676_0457552 | 3300047321 | Bacteria | 841 |
| 994 | Ga0495676_0738591 | 3300047321 | Bacteria | 636 |
| 995 | Ga0495680_0001595 | 3300047322 | Bacteria | 24172 |
| 996 | Ga0495680_0020992 | 3300047322 | Bacteria | 5475 |
| 997 | Ga0495680_0280875 | 3300047322 | Bacteria | 1173 |
| 998 | Ga0495687_056061 | 3300047443 | Bacteria | 1645 |
| 999 | Ga0495675_0004307 | 3300047444 | Bacteria | 8610 |
| 1000 | Ga0495675_0017231 | 3300047444 | Bacteria | 4577 |
| 1001 | Ga0495675_0521181 | 3300047444 | Bacteria | 680 |
| 1002 | Ga0495685_095510 | 3300047447 | Bacteria | 983 |
| 1003 | Ga0495673_0179709 | 3300047469 | Bacteria | 802 |
| 1004 | Ga0495684_0015313 | 3300047471 | Bacteria | 5906 |
| 1005 | Ga0495684_0016173 | 3300047471 | Bacteria | 5745 |
| 1006 | Ga0495684_0046854 | 3300047471 | Bacteria | 3307 |
| 1007 | Ga0495684_0065648 | 3300047471 | Bacteria | 2759 |
| 1008 | Ga0495686_0083696 | 3300047472 | Bacteria | 1945 |
| 1009 | Ga0495686_0310224 | 3300047472 | Bacteria | 868 |
| 1010 | Ga0495686_0545627 | 3300047472 | Bacteria | 606 |
| 1011 | Ga0495593_0007370 | 3300047673 | Bacteria | 6445 |
| 1012 | Ga0495593_0038125 | 3300047673 | Bacteria | 2596 |
| 1013 | Ga0495593_0094177 | 3300047673 | Bacteria | 1541 |
| 1014 | Ga0495602_0023337 | 3300048088 | Bacteria | 6029 |
| 1015 | Ga0495602_0115407 | 3300048088 | Bacteria | 2172 |
| 1016 | Ga0495602_0123311 | 3300048088 | Bacteria | 2080 |
| 1017 | Ga0495602_0734926 | 3300048088 | Bacteria | 667 |
| 1018 | Ga0496100_0013579 | 3300048903 | Bacteria | 4703 |
| 1019 | Ga0496100_0301952 | 3300048903 | Bacteria | 1198 |
| 1020 | Ga0496100_0324962 | 3300048903 | Bacteria | 1156 |
| 1021 | Ga0496100_0384937 | 3300048903 | Bacteria | 1066 |
| 1022 | Ga0496101_0004886 | 3300048904 | Bacteria | 8508 |
| 1023 | Ga0496101_0033122 | 3300048904 | Bacteria | 3643 |
| 1024 | Ga0496101_0126230 | 3300048904 | Bacteria | 1939 |
| 1025 | Ga0496101_0208392 | 3300048904 | Bacteria | 1513 |
| 1026 | Ga0496101_0220684 | 3300048904 | Bacteria | 1471 |
| 1027 | Ga0496101_1182723 | 3300048904 | Bacteria | 599 |
| 1028 | Ga0496101_1448243 | 3300048904 | Bacteria | 535 |
| 1029 | Ga0496102_0012642 | 3300048905 | Bacteria | 7310 |
| 1030 | Ga0496102_0061059 | 3300048905 | Bacteria | 3449 |
| 1031 | Ga0496102_0180783 | 3300048905 | Bacteria | 1987 |
| 1032 | Ga0496102_0219217 | 3300048905 | Bacteria | 1793 |
| 1033 | Ga0496102_0703514 | 3300048905 | Bacteria | 933 |
| 1034 | Ga0496102_1418411 | 3300048905 | Bacteria | 613 |
| 1035 | Ga0496103_0038684 | 3300048906 | Bacteria | 2928 |
| 1036 | Ga0496103_0301794 | 3300048906 | Bacteria | 1030 |
| 1037 | Ga0496103_0348816 | 3300048906 | Bacteria | 952 |
| 1038 | Ga0496104_0020012 | 3300048907 | Bacteria | 6129 |
| 1039 | Ga0496104_0022766 | 3300048907 | Bacteria | 5755 |
| 1040 | Ga0496104_0074007 | 3300048907 | Bacteria | 3242 |
| 1041 | Ga0496104_0263653 | 3300048907 | Bacteria | 1635 |
| 1042 | Ga0496104_0819283 | 3300048907 | Bacteria | 837 |
| 1043 | Ga0496105_0024293 | 3300048908 | Bacteria | 4924 |
| 1044 | Ga0496105_0027000 | 3300048908 | Bacteria | 4686 |
| 1045 | Ga0496105_0031039 | 3300048908 | Bacteria | 4380 |
| 1046 | Ga0496105_0056915 | 3300048908 | Bacteria | 3228 |
| 1047 | Ga0496105_0154296 | 3300048908 | Bacteria | 1886 |
| 1048 | Ga0496105_0364340 | 3300048908 | Bacteria | 1152 |
| 1049 | Ga0496105_0484394 | 3300048908 | Bacteria | 973 |
| 1050 | Ga0496106_0000501 | 3300048909 | Bacteria | 27744 |
| 1051 | Ga0496106_0003078 | 3300048909 | Bacteria | 12442 |
| 1052 | Ga0496106_0014048 | 3300048909 | Bacteria | 5918 |
| 1053 | Ga0496106_0130575 | 3300048909 | Bacteria | 1970 |
| 1054 | Ga0496106_0151061 | 3300048909 | Bacteria | 1832 |
| 1055 | Ga0496106_0237543 | 3300048909 | Bacteria | 1456 |
| 1056 | Ga0496106_0260976 | 3300048909 | Bacteria | 1386 |
| 1057 | Ga0496106_0575394 | 3300048909 | Bacteria | 903 |
| 1058 | Ga0496106_1432746 | 3300048909 | Bacteria | 533 |
| 1059 | Ga0496107_0006040 | 3300048910 | Bacteria | 8308 |
| 1060 | Ga0496107_0075070 | 3300048910 | Bacteria | 2460 |
| 1061 | Ga0496107_0175743 | 3300048910 | Bacteria | 1590 |
| 1062 | Ga0496107_0700981 | 3300048910 | Bacteria | 745 |
| 1063 | Ga0496108_0024615 | 3300048911 | Bacteria | 4957 |
| 1064 | Ga0496108_1168535 | 3300048911 | Bacteria | 652 |
| 1065 | Ga0496108_1314962 | 3300048911 | Bacteria | 608 |
| 1066 | Ga0496108_1566029 | 3300048911 | Bacteria | 546 |
| 1067 | Ga0496109_0000607 | 3300048912 | Bacteria | 29944 |
| 1068 | Ga0496109_0033152 | 3300048912 | Bacteria | 4646 |
| 1069 | Ga0496109_0095832 | 3300048912 | Bacteria | 2748 |
| 1070 | Ga0496109_0220608 | 3300048912 | Bacteria | 1783 |
| 1071 | Ga0496109_1139874 | 3300048912 | Bacteria | 717 |
| 1072 | Ga0496110_0024161 | 3300048913 | Bacteria | 5176 |
| 1073 | Ga0496110_0174904 | 3300048913 | Bacteria | 1948 |
| 1074 | Ga0496110_0372904 | 3300048913 | Bacteria | 1300 |
| 1075 | Ga0496110_0451001 | 3300048913 | Bacteria | 1172 |
| 1076 | Ga0496111_0018238 | 3300048914 | Bacteria | 4860 |
| 1077 | Ga0496111_0092813 | 3300048914 | Bacteria | 2213 |
| 1078 | Ga0496111_0117826 | 3300048914 | Bacteria | 1960 |
| 1079 | Ga0496111_0423681 | 3300048914 | Bacteria | 983 |
| 1080 | Ga0496111_0609522 | 3300048914 | Bacteria | 799 |
| 1081 | Ga0496111_0737202 | 3300048914 | Bacteria | 715 |
| 1082 | Ga0496112_0025348 | 3300048915 | Bacteria | 5695 |
| 1083 | Ga0496112_0042417 | 3300048915 | Bacteria | 4451 |
| 1084 | Ga0496112_0065599 | 3300048915 | Bacteria | 3583 |
| 1085 | Ga0496112_0075320 | 3300048915 | Bacteria | 3338 |
| 1086 | Ga0496112_0154960 | 3300048915 | Bacteria | 2258 |
| 1087 | Ga0496113_0062718 | 3300048916 | Bacteria | 2808 |
| 1088 | Ga0496113_0079460 | 3300048916 | Bacteria | 2511 |
| 1089 | Ga0496113_0117397 | 3300048916 | Bacteria | 2077 |
| 1090 | Ga0496113_0486911 | 3300048916 | Bacteria | 991 |
| 1091 | Ga0496113_1170086 | 3300048916 | Bacteria | 601 |
| 1092 | Ga0496114_0010129 | 3300048917 | Bacteria | 7499 |
| 1093 | Ga0496114_0279763 | 3300048917 | Bacteria | 1471 |
| 1094 | Ga0496114_1580797 | 3300048917 | Bacteria | 544 |
| 1095 | Ga0496115_0009019 | 3300048918 | Bacteria | 7400 |
| 1096 | Ga0496115_0038929 | 3300048918 | Bacteria | 3776 |
| 1097 | Ga0496115_0049091 | 3300048918 | Bacteria | 3377 |
| 1098 | Ga0496115_0091716 | 3300048918 | Bacteria | 2483 |
| 1099 | Ga0496115_0129663 | 3300048918 | Bacteria | 2078 |
| 1100 | Ga0496115_0501600 | 3300048918 | Bacteria | 975 |
| 1101 | Ga0496116_0036964 | 3300048919 | Bacteria | 3411 |
| 1102 | Ga0496116_0168176 | 3300048919 | Bacteria | 1192 |
| 1103 | Ga0496117_0037664 | 3300048920 | Bacteria | 3599 |
| 1104 | Ga0496117_0055971 | 3300048920 | Bacteria | 2751 |
| 1105 | Ga0496117_0182726 | 3300048920 | Bacteria | 1203 |
| 1106 | Ga0496117_0191195 | 3300048920 | Bacteria | 1166 |
| 1107 | Ga0496118_0005152 | 3300048921 | Bacteria | 14978 |
| 1108 | Ga0496118_0012116 | 3300048921 | Bacteria | 8323 |
| 1109 | Ga0496118_0166614 | 3300048921 | Bacteria | 1353 |
| 1110 | Ga0496118_0266811 | 3300048921 | Bacteria | 962 |
| 1111 | Ga0496118_0364382 | 3300048921 | Bacteria | 765 |
| 1112 | Ga0496118_0402311 | 3300048921 | Bacteria | 711 |
| 1113 | Ga0496119_0026902 | 3300048922 | Bacteria | 3973 |
| 1114 | Ga0496119_0074232 | 3300048922 | Bacteria | 1981 |
| 1115 | Ga0496119_0092035 | 3300048922 | Bacteria | 1721 |
| 1116 | Ga0496119_0199268 | 3300048922 | Bacteria | 1037 |
| 1117 | Ga0496120_0038951 | 3300048923 | Bacteria | 2809 |
| 1118 | Ga0496120_0104950 | 3300048923 | Bacteria | 1486 |
| 1119 | Ga0496120_0417887 | 3300048923 | Bacteria | 589 |
| 1120 | Ga0496121_0001291 | 3300048924 | Bacteria | 43108 |
| 1121 | Ga0496121_0026502 | 3300048924 | Bacteria | 5460 |
| 1122 | Ga0496121_0029660 | 3300048924 | Bacteria | 5049 |
| 1123 | Ga0496121_0054618 | 3300048924 | Bacteria | 3335 |
| 1124 | Ga0496121_0056308 | 3300048924 | Bacteria | 3266 |
| 1125 | Ga0496121_0087766 | 3300048924 | Bacteria | 2440 |
| 1126 | Ga0496121_0106571 | 3300048924 | Bacteria | 2148 |
| 1127 | Ga0496121_0123204 | 3300048924 | Bacteria | 1954 |
| 1128 | Ga0496121_0143570 | 3300048924 | Bacteria | 1767 |
| 1129 | Ga0496121_0331337 | 3300048924 | Bacteria | 1021 |
| 1130 | Ga0496121_0333018 | 3300048924 | Bacteria | 1017 |
| 1131 | Ga0496121_0480251 | 3300048924 | Bacteria | 794 |
| 1132 | Ga0496121_0494450 | 3300048924 | Bacteria | 778 |
| 1133 | Ga0496121_0695438 | 3300048924 | Bacteria | 613 |
| 1134 | Ga0496121_0728812 | 3300048924 | Bacteria | 592 |
| 1135 | Ga0496121_0804704 | 3300048924 | Bacteria | 552 |
| 1136 | Ga0496122_0011608 | 3300048925 | Bacteria | 8893 |
| 1137 | Ga0496122_0203625 | 3300048925 | Bacteria | 1154 |
| 1138 | Ga0496122_0293427 | 3300048925 | Bacteria | 881 |
| 1139 | Ga0496123_0154688 | 3300048926 | Bacteria | 1231 |
| 1140 | Ga0496123_0315587 | 3300048926 | Bacteria | 740 |
| 1141 | Ga0496124_0001238 | 3300048927 | Bacteria | 39220 |
| 1142 | Ga0496124_0096808 | 3300048927 | Bacteria | 2397 |
| 1143 | Ga0496124_0149863 | 3300048927 | Bacteria | 1831 |
| 1144 | Ga0496124_0150343 | 3300048927 | Bacteria | 1827 |
| 1145 | Ga0496124_0762197 | 3300048927 | Bacteria | 605 |
| 1146 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 1147 | Ga0496125_0010601 | 3300048928 | Bacteria | 9309 |
| 1148 | Ga0496125_0036783 | 3300048928 | Bacteria | 4267 |
| 1149 | Ga0496125_0049975 | 3300048928 | Bacteria | 3467 |
| 1150 | Ga0496125_0056729 | 3300048928 | Bacteria | 3178 |
| 1151 | Ga0496125_0128520 | 3300048928 | Bacteria | 1789 |
| 1152 | Ga0496125_0171121 | 3300048928 | Bacteria | 1460 |
| 1153 | Ga0496125_0178860 | 3300048928 | Bacteria | 1416 |
| 1154 | Ga0496125_0253283 | 3300048928 | Bacteria | 1109 |
| 1155 | Ga0496125_0464075 | 3300048928 | Bacteria | 722 |
| 1156 | Ga0496125_0636384 | 3300048928 | Bacteria | 576 |
| 1157 | Ga0496126_0003590 | 3300048929 | Bacteria | 19439 |
| 1158 | Ga0496126_0004961 | 3300048929 | Bacteria | 15521 |
| 1159 | Ga0496126_0011777 | 3300048929 | Bacteria | 9005 |
| 1160 | Ga0496126_0026581 | 3300048929 | Bacteria | 5546 |
| 1161 | Ga0496126_0040306 | 3300048929 | Bacteria | 4330 |
| 1162 | Ga0496126_0049105 | 3300048929 | Bacteria | 3853 |
| 1163 | Ga0496126_0114342 | 3300048929 | Bacteria | 2348 |
| 1164 | Ga0496126_0178987 | 3300048929 | Bacteria | 1802 |
| 1165 | Ga0496126_0226489 | 3300048929 | Bacteria | 1568 |
| 1166 | Ga0496126_0299710 | 3300048929 | Bacteria | 1327 |
| 1167 | Ga0496126_0319546 | 3300048929 | Bacteria | 1276 |
| 1168 | Ga0496126_0342477 | 3300048929 | Bacteria | 1224 |
| 1169 | Ga0496126_0392003 | 3300048929 | Bacteria | 1128 |
| 1170 | Ga0496126_0479065 | 3300048929 | Bacteria | 997 |
| 1171 | Ga0496126_0535824 | 3300048929 | Bacteria | 931 |
| 1172 | Ga0496126_0537433 | 3300048929 | Bacteria | 929 |
| 1173 | Ga0496126_0551668 | 3300048929 | Bacteria | 914 |
| 1174 | Ga0496126_0581783 | 3300048929 | Bacteria | 884 |
| 1175 | Ga0496126_0728904 | 3300048929 | Bacteria | 767 |
| 1176 | Ga0496126_0743122 | 3300048929 | Bacteria | 758 |
| 1177 | Ga0496126_0875188 | 3300048929 | Bacteria | 683 |
| 1178 | Ga0496126_1057997 | 3300048929 | Bacteria | 605 |
| 1179 | Ga0496126_1268002 | 3300048929 | Bacteria | 538 |
| 1180 | Ga0501031_0249901 | 3300049568 | Bacteria | 1152 |
| 1181 | Ga0501032_0530023 | 3300049569 | Bacteria | 752 |
| 1182 | Ga0501033_0720908 | 3300049570 | Bacteria | 677 |
| 1183 | Ga0501034_0036800 | 3300049571 | Bacteria | 4956 |
| 1184 | Ga0501034_0063299 | 3300049571 | Bacteria | 3713 |
| 1185 | Ga0501034_0310037 | 3300049571 | Bacteria | 1513 |
| 1186 | Ga0501034_0820870 | 3300049571 | Bacteria | 821 |
| 1187 | Ga0501036_0070788 | 3300049572 | Bacteria | 2949 |
| 1188 | Ga0501036_0872669 | 3300049572 | Bacteria | 739 |
| 1189 | Ga0501037_0100474 | 3300049573 | Bacteria | 2088 |
| 1190 | Ga0501037_0176199 | 3300049573 | Bacteria | 1518 |
| 1191 | Ga0501038_0004223 | 3300049574 | Bacteria | 13348 |
| 1192 | Ga0501038_0004908 | 3300049574 | Bacteria | 12426 |
| 1193 | Ga0501038_0051879 | 3300049574 | Bacteria | 3537 |
| 1194 | Ga0501039_0163739 | 3300049575 | Bacteria | 1748 |
| 1195 | Ga0501039_0503905 | 3300049575 | Bacteria | 950 |
| 1196 | Ga0501039_0534060 | 3300049575 | Bacteria | 920 |
| 1197 | Ga0501040_0075435 | 3300049576 | Bacteria | 2330 |
| 1198 | Ga0501040_0410826 | 3300049576 | Bacteria | 972 |
| 1199 | Ga0501041_0114700 | 3300049577 | Bacteria | 1673 |
| 1200 | Ga0501042_0008276 | 3300049578 | Bacteria | 6854 |
| 1201 | Ga0501043_0008239 | 3300049579 | Bacteria | 8214 |
| 1202 | Ga0501043_0234816 | 3300049579 | Bacteria | 1415 |
| 1203 | Ga0501043_0361846 | 3300049579 | Bacteria | 1101 |
| 1204 | Ga0501046_0213472 | 3300049580 | Bacteria | 1431 |
| 1205 | Ga0501047_0041815 | 3300049581 | Bacteria | 4428 |
| 1206 | Ga0501047_0188735 | 3300049581 | Bacteria | 1925 |
| 1207 | Ga0501047_1342315 | 3300049581 | Bacteria | 529 |
| 1208 | Ga0501048_0008490 | 3300049582 | Bacteria | 7765 |
| 1209 | Ga0501048_0379263 | 3300049582 | Bacteria | 1010 |
| 1210 | Ga0501067_0002243 | 3300049583 | Bacteria | 10668 |
| 1211 | Ga0501068_0149491 | 3300049584 | Bacteria | 1467 |
| 1212 | Ga0501069_0016220 | 3300049585 | Bacteria | 3997 |
| 1213 | Ga0501070_0011932 | 3300049586 | Bacteria | 7340 |
| 1214 | Ga0501070_0441050 | 3300049586 | Bacteria | 1050 |
| 1215 | Ga0501071_0414579 | 3300049587 | Bacteria | 1029 |
| 1216 | Ga0501072_0057071 | 3300049588 | Bacteria | 3076 |
| 1217 | Ga0501073_0094006 | 3300049589 | Bacteria | 2082 |
| 1218 | Ga0501073_0134132 | 3300049589 | Bacteria | 1716 |
| 1219 | Ga0501074_0000802 | 3300049590 | Bacteria | 19886 |
| 1220 | Ga0501079_0010508 | 3300049741 | Bacteria | 7037 |
| 1221 | Ga0501080_0017322 | 3300049742 | Bacteria | 6659 |
| 1222 | Ga0501083_0005973 | 3300049744 | Bacteria | 8619 |
| 1223 | Ga0501083_0801602 | 3300049744 | Bacteria | 613 |
| 1224 | Ga0501035_0039707 | 3300049822 | Bacteria | 4258 |
| 1225 | Ga0501035_0135271 | 3300049822 | Bacteria | 2146 |
| 1226 | Ga0501044_0018546 | 3300049823 | Bacteria | 7456 |
| 1227 | Ga0501044_0154009 | 3300049823 | Bacteria | 2279 |
| 1228 | Ga0501045_0013471 | 3300049824 | Bacteria | 5775 |
| 1229 | nmdc:mga03683_130126_c1 | 3300050489 | Bacteria | 1125 |
| 1230 | nmdc:mga03683_214788_c1 | 3300050489 | Bacteria | 886 |
| 1231 | nmdc:mga03683_64702_c1 | 3300050489 | Bacteria | 1552 |
| 1232 | nmdc:mga03n38_14754_c1 | 3300050490 | Bacteria | 3003 |
| 1233 | nmdc:mga03n38_147618_c1 | 3300050490 | Bacteria | 1180 |
| 1234 | nmdc:mga03n38_225418_c1 | 3300050490 | Bacteria | 980 |
| 1235 | nmdc:mga00v17_149961_c1 | 3300050491 | Bacteria | 1498 |
| 1236 | nmdc:mga0yw44_106002_c1 | 3300050492 | Bacteria | 1796 |
| 1237 | nmdc:mga0yw44_106378_c1 | 3300050492 | Bacteria | 1793 |
| 1238 | nmdc:mga0yw44_120383_c1 | 3300050492 | Bacteria | 1690 |
| 1239 | nmdc:mga0yw44_16105_c1 | 3300050492 | Bacteria | 4030 |
| 1240 | nmdc:mga0yw44_268363_c1 | 3300050492 | Bacteria | 1139 |
| 1241 | nmdc:mga0yw44_401629_c1 | 3300050492 | Bacteria | 927 |
| 1242 | nmdc:mga0yw44_638244_c1 | 3300050492 | Bacteria | 724 |
| 1243 | nmdc:mga0k408_120411_c1 | 3300050493 | Bacteria | 1554 |
| 1244 | nmdc:mga0k408_174161_c1 | 3300050493 | Bacteria | 1283 |
| 1245 | nmdc:mga0k408_232637_c1 | 3300050493 | Bacteria | 1100 |
| 1246 | nmdc:mga0k408_327599_c1 | 3300050493 | Bacteria | 914 |
| 1247 | nmdc:mga0k408_54832_c1 | 3300050493 | Bacteria | 2311 |
| 1248 | nmdc:mga06z11_167677_c1 | 3300050494 | Bacteria | 1259 |
| 1249 | nmdc:mga06z11_312782_c1 | 3300050494 | Bacteria | 936 |
| 1250 | nmdc:mga06z11_373427_c1 | 3300050494 | Bacteria | 856 |
| 1251 | nmdc:mga06z11_5269_c1 | 3300050494 | Bacteria | 5174 |
| 1252 | nmdc:mga07m45_367100_c1 | 3300050496 | Bacteria | 836 |
| 1253 | nmdc:mga07m45_4525_c1 | 3300050496 | Bacteria | 6809 |
| 1254 | nmdc:mga05p37_174969_c1 | 3300050507 | Bacteria | 2615 |
| 1255 | nmdc:mga08y16_1109593_c1 | 3300050511 | Bacteria | 766 |
| 1256 | nmdc:mga0n895_484023_c1 | 3300050512 | Bacteria | 1248 |
| 1257 | nmdc:mga08x19_488778_c1 | 3300050514 | Bacteria | 868 |
| 1258 | nmdc:mga0sz30_100711_c1 | 3300050516 | Bacteria | 1262 |
| 1259 | nmdc:mga0sz30_413337_c1 | 3300050516 | Bacteria | 605 |
| 1260 | nmdc:mga0sz30_57216_c1 | 3300050516 | Bacteria | 962 |
| 1261 | nmdc:mga0sz30_77783_c1 | 3300050516 | Bacteria | 1433 |
| 1262 | Ga0495601_0015406 | 3300053077 | Bacteria | 4620 |
| 1263 | Ga0495601_0016288 | 3300053077 | Bacteria | 4504 |
| 1264 | Ga0495601_0526080 | 3300053077 | Bacteria | 762 |
| 1265 | Ga0495601_0637574 | 3300053077 | Bacteria | 682 |
| 1266 | Ga0500610_0287722 | 3300053079 | Bacteria | 733 |
| 1267 | Ga0500635_0068970 | 3300053080 | Bacteria | 1250 |
| 1268 | Ga0495655_0019265 | 3300053083 | Bacteria | 1513 |
| 1269 | Ga0495655_0160756 | 3300053083 | Bacteria | 713 |
| 1270 | Ga0495655_0303053 | 3300053083 | Bacteria | 549 |
| 1271 | Ga0495595_0000335 | 3300053084 | Bacteria | 18133 |
| 1272 | Ga0495595_0026690 | 3300053084 | Bacteria | 2567 |
| 1273 | Ga0495595_0232091 | 3300053084 | Bacteria | 922 |
| 1274 | Ga0495595_0554364 | 3300053084 | Bacteria | 587 |
| 1275 | Ga0495619_0001292 | 3300053085 | Bacteria | 16456 |
| 1276 | Ga0495619_0127621 | 3300053085 | Bacteria | 1747 |
| 1277 | Ga0500578_0227955 | 3300053086 | Bacteria | 1130 |
| 1278 | Ga0500643_000040 | 3300053087 | Bacteria | 168108 |
| 1279 | Ga0500643_014119 | 3300053087 | Bacteria | 2790 |
| 1280 | Ga0500644_0031257 | 3300053088 | Bacteria | 1691 |
| 1281 | Ga0500581_258586 | 3300053089 | Bacteria | 724 |
| 1282 | Ga0500647_0315650 | 3300053091 | Bacteria | 663 |
| 1283 | Ga0500583_0141757 | 3300053092 | Bacteria | 1194 |
| 1284 | Ga0500583_0202187 | 3300053092 | Bacteria | 987 |
| 1285 | Ga0500583_0482640 | 3300053092 | Bacteria | 584 |
| 1286 | Ga0500651_0003108 | 3300053093 | Bacteria | 8993 |
| 1287 | Ga0500651_0316810 | 3300053093 | Bacteria | 891 |
| 1288 | Ga0500651_0465797 | 3300053093 | Bacteria | 701 |
| 1289 | Ga0500566_0000230 | 3300053094 | Bacteria | 29930 |
| 1290 | Ga0500566_0000332 | 3300053094 | Bacteria | 25736 |
| 1291 | Ga0500566_0011427 | 3300053094 | Bacteria | 5229 |
| 1292 | Ga0500566_0179997 | 3300053094 | Bacteria | 1085 |
| 1293 | Ga0500641_0021384 | 3300053096 | Bacteria | 2466 |
| 1294 | Ga0500641_0113778 | 3300053096 | Bacteria | 1165 |
| 1295 | Ga0500648_093476 | 3300053097 | Bacteria | 1681 |
| 1296 | Ga0500648_157151 | 3300053097 | Bacteria | 1201 |
| 1297 | Ga0500650_0028010 | 3300053098 | Bacteria | 2538 |
| 1298 | Ga0500650_0113415 | 3300053098 | Bacteria | 1265 |
| 1299 | Ga0500554_264146 | 3300053102 | Bacteria | 564 |
| 1300 | Ga0500555_002003 | 3300053103 | Bacteria | 6011 |
| 1301 | Ga0500555_125450 | 3300053103 | Bacteria | 639 |
| 1302 | Ga0500569_029160 | 3300053109 | Bacteria | 1536 |
| 1303 | Ga0500569_040307 | 3300053109 | Bacteria | 1364 |
| 1304 | Ga0500572_028490 | 3300053111 | Bacteria | 1537 |
| 1305 | Ga0500592_000477 | 3300053116 | Bacteria | 6663 |
| 1306 | Ga0500592_004040 | 3300053116 | Bacteria | 2341 |
| 1307 | Ga0500593_159797 | 3300053117 | Bacteria | 863 |
| 1308 | Ga0500594_0031132 | 3300053118 | Bacteria | 1405 |
| 1309 | Ga0500594_0119064 | 3300053118 | Bacteria | 828 |
| 1310 | Ga0500595_000468 | 3300053119 | Bacteria | 24982 |
| 1311 | Ga0500595_018935 | 3300053119 | Bacteria | 2507 |
| 1312 | Ga0500595_085970 | 3300053119 | Bacteria | 915 |
| 1313 | Ga0500595_100614 | 3300053119 | Bacteria | 828 |
| 1314 | Ga0500607_228713 | 3300053121 | Bacteria | 765 |
| 1315 | Ga0500608_000395 | 3300053122 | Bacteria | 16743 |
| 1316 | Ga0500608_326497 | 3300053122 | Bacteria | 556 |
| 1317 | Ga0500614_123950 | 3300053123 | Bacteria | 762 |
| 1318 | Ga0500618_004648 | 3300053125 | Bacteria | 4325 |
| 1319 | Ga0500618_031139 | 3300053125 | Bacteria | 1252 |
| 1320 | Ga0500623_249849 | 3300053127 | Bacteria | 594 |
| 1321 | Ga0500642_0000128 | 3300053130 | Bacteria | 34248 |
| 1322 | Ga0500642_0160360 | 3300053130 | Bacteria | 1054 |
| 1323 | Ga0500642_0255061 | 3300053130 | Bacteria | 804 |
| 1324 | Ga0500652_000285 | 3300053131 | Bacteria | 18555 |
| 1325 | Ga0500655_020750 | 3300053133 | Bacteria | 1229 |
| 1326 | Ga0500658_0005983 | 3300053134 | Bacteria | 4522 |
| 1327 | Ga0500658_0036152 | 3300053134 | Bacteria | 1958 |
| 1328 | Ga0500658_0058503 | 3300053134 | Bacteria | 1596 |
| 1329 | Ga0500658_0391449 | 3300053134 | Bacteria | 636 |
| 1330 | Ga0500559_0000959 | 3300053136 | Bacteria | 18075 |
| 1331 | Ga0500559_0009065 | 3300053136 | Bacteria | 4324 |
| 1332 | Ga0500559_0042935 | 3300053136 | Bacteria | 1974 |
| 1333 | Ga0500561_0024124 | 3300053137 | Bacteria | 1465 |
| 1334 | Ga0500564_007088 | 3300053138 | Bacteria | 4730 |
| 1335 | Ga0500568_0000741 | 3300053139 | Bacteria | 23280 |
| 1336 | Ga0500568_0005161 | 3300053139 | Bacteria | 6809 |
| 1337 | Ga0500568_0078915 | 3300053139 | Bacteria | 1252 |
| 1338 | Ga0500573_0035584 | 3300053140 | Bacteria | 2873 |
| 1339 | Ga0500577_0023967 | 3300053142 | Bacteria | 2046 |
| 1340 | Ga0500586_002976 | 3300053145 | Bacteria | 3934 |
| 1341 | Ga0500588_0249205 | 3300053146 | Bacteria | 666 |
| 1342 | Ga0500589_067269 | 3300053147 | Bacteria | 1628 |
| 1343 | Ga0500589_097143 | 3300053147 | Bacteria | 1286 |
| 1344 | Ga0500590_119784 | 3300053148 | Bacteria | 1235 |
| 1345 | Ga0500590_120403 | 3300053148 | Bacteria | 1230 |
| 1346 | Ga0500603_001419 | 3300053150 | Bacteria | 5474 |
| 1347 | Ga0500603_043302 | 3300053150 | Bacteria | 1209 |
| 1348 | Ga0500603_182116 | 3300053150 | Bacteria | 661 |
| 1349 | Ga0500604_0007792 | 3300053151 | Bacteria | 2838 |
| 1350 | Ga0500604_0212605 | 3300053151 | Bacteria | 666 |
| 1351 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 1352 | Ga0500616_0016770 | 3300053153 | Bacteria | 4163 |
| 1353 | Ga0500619_055454 | 3300053154 | Bacteria | 1292 |
| 1354 | Ga0500619_157433 | 3300053154 | Bacteria | 772 |
| 1355 | Ga0500620_010151 | 3300053155 | Bacteria | 2464 |
| 1356 | Ga0500627_0005565 | 3300053158 | Bacteria | 4197 |
| 1357 | Ga0500627_0126064 | 3300053158 | Bacteria | 1156 |
| 1358 | Ga0500627_0477836 | 3300053158 | Bacteria | 521 |
| 1359 | Ga0500634_0044424 | 3300053161 | Bacteria | 2405 |
| 1360 | Ga0500638_002107 | 3300053162 | Bacteria | 6750 |
| 1361 | Ga0500638_045751 | 3300053162 | Bacteria | 2123 |
| 1362 | Ga0500638_122474 | 3300053162 | Bacteria | 1188 |
| 1363 | Ga0500638_171331 | 3300053162 | Bacteria | 945 |
| 1364 | Ga0500636_0000120 | 3300053177 | Bacteria | 41238 |
| 1365 | Ga0500636_0006139 | 3300053177 | Bacteria | 6896 |
| 1366 | Ga0500636_0095073 | 3300053177 | Bacteria | 1701 |
| 1367 | Ga0500636_0116220 | 3300053177 | Bacteria | 1505 |
| 1368 | Ga0500636_0183939 | 3300053177 | Bacteria | 1119 |
| 1369 | Ga0500636_0321081 | 3300053177 | Bacteria | 752 |
| 1370 | Ga0500637_0011077 | 3300053178 | Bacteria | 4645 |
| 1371 | Ga0500637_0248512 | 3300053178 | Bacteria | 993 |
| 1372 | Ga0500637_0268001 | 3300053178 | Bacteria | 946 |
| 1373 | Ga0500637_0284938 | 3300053178 | Bacteria | 907 |
| 1374 | Ga0500637_0362362 | 3300053178 | Bacteria | 767 |
| 1375 | Ga0500649_059072 | 3300053722 | Bacteria | 1602 |
| 1376 | Ga0500611_056842 | 3300053727 | Bacteria | 914 |
| 1377 | Ga0500611_199304 | 3300053727 | Bacteria | 567 |
| 1378 | Ga0500657_035869 | 3300053728 | Bacteria | 2321 |
| 1379 | Ga0500645_013421 | 3300053730 | Bacteria | 2629 |
| 1380 | Ga0500645_025920 | 3300053730 | Bacteria | 1786 |
| 1381 | Ga0500609_000334 | 3300053731 | Bacteria | 6983 |
| 1382 | Ga0500596_007063 | 3300053735 | Bacteria | 1857 |
| 1383 | Ga0500601_000586 | 3300053737 | Bacteria | 5199 |
| 1384 | Ga0500601_038210 | 3300053737 | Bacteria | 581 |
| 1385 | Ga0501084_0248968 | 3300054114 | Bacteria | 1500 |
| 1386 | Ga0500661_001956 | 3300055283 | Bacteria | 3887 |
| 1387 | Ga0501082_0169383 | 3300060353 | Bacteria | 1898 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0083696 | Ga0495686_0083696_819_1322 | 130 |
| 2 | 3300026089 | Ga0207648_10204030 | Ga0207648_102040302 | 133 |
| 3 | 3300049574 | Ga0501038_0004908 | Ga0501038_0004908_11138_11629 | 137 |
| 4 | 3300049579 | Ga0501043_0234816 | Ga0501043_0234816_790_1281 | 137 |
| 5 | 3300005985 | Ga0081539_10000203 | Ga0081539_1000020392 | 138 |
| 6 | 3300005985 | Ga0081539_10074427 | Ga0081539_100744272 | 138 |
| 7 | 3300048928 | Ga0496125_0010601 | Ga0496125_0010601_6819_7241 | 138 |
| 8 | 3300048929 | Ga0496126_1268002 | Ga0496126_1268002_76_501 | 138 |
| 9 | 3300049569 | Ga0501032_0530023 | Ga0501032_0530023_61_480 | 138 |
| 10 | 3300049571 | Ga0501034_0310037 | Ga0501034_0310037_1035_1454 | 138 |
| 11 | iso_pu_bacteria | 2721755755 | 2723846265 | 138 |
| 12 | 3300005334 | Ga0068869_101709079 | Ga0068869_1017090791 | 139 |
| 13 | 3300005347 | Ga0070668_100400661 | Ga0070668_1004006612 | 139 |
| 14 | 3300005441 | Ga0070700_100625545 | Ga0070700_1006255452 | 139 |
| 15 | 3300005456 | Ga0070678_100324030 | Ga0070678_1003240302 | 139 |
| 16 | 3300005459 | Ga0068867_100814829 | Ga0068867_1008148292 | 139 |
| 17 | 3300005543 | Ga0070672_100187750 | Ga0070672_1001877503 | 139 |
| 18 | 3300005844 | Ga0068862_100370338 | Ga0068862_1003703382 | 139 |
| 19 | 3300005937 | Ga0081455_10001517 | Ga0081455_100015174 | 139 |
| 20 | 3300006038 | Ga0075365_10445555 | Ga0075365_104455552 | 139 |
| 21 | 3300006051 | Ga0075364_10494147 | Ga0075364_104941472 | 139 |
| 22 | 3300006173 | Ga0070716_100876830 | Ga0070716_1008768302 | 139 |
| 23 | 3300006178 | Ga0075367_10714363 | Ga0075367_107143632 | 139 |
| 24 | 3300006195 | Ga0075366_10311518 | Ga0075366_103115181 | 139 |
| 25 | 3300006880 | Ga0075429_100484583 | Ga0075429_1004845832 | 139 |
| 26 | 3300006931 | Ga0097620_102727967 | Ga0097620_1027279671 | 139 |
| 27 | 3300009094 | Ga0111539_10081586 | Ga0111539_100815864 | 139 |
| 28 | 3300009147 | Ga0114129_10780806 | Ga0114129_107808062 | 139 |
| 29 | 3300013296 | Ga0157374_11393735 | Ga0157374_113937352 | 139 |
| 30 | 3300013306 | Ga0163162_10438128 | Ga0163162_104381281 | 139 |
| 31 | 3300014745 | Ga0157377_10046781 | Ga0157377_100467813 | 139 |
| 32 | 3300021384 | Ga0213876_10048574 | Ga0213876_100485742 | 139 |
| 33 | 3300025937 | Ga0207669_11584645 | Ga0207669_115846451 | 139 |
| 34 | 3300025940 | Ga0207691_10583621 | Ga0207691_105836212 | 139 |
| 35 | 3300025942 | Ga0207689_10260607 | Ga0207689_102606072 | 139 |
| 36 | 3300026075 | Ga0207708_10127250 | Ga0207708_101272502 | 139 |
| 37 | 3300026118 | Ga0207675_100467335 | Ga0207675_1004673352 | 139 |
| 38 | 3300028380 | Ga0268265_10557792 | Ga0268265_105577922 | 139 |
| 39 | 3300031456 | Ga0307513_10661536 | Ga0307513_106615361 | 139 |
| 40 | 3300039437 | Ga0436365_1694566 | Ga0436365_1694566_62_487 | 139 |
| 41 | 3300041453 | Ga0451797_1068329 | Ga0451797_1068329_757_1176 | 139 |
| 42 | 3300046473 | Ga0495582_0260536 | Ga0495582_0260536_259_678 | 139 |
| 43 | 3300046491 | Ga0495584_0109102 | Ga0495584_0109102_888_1307 | 139 |
| 44 | 3300046499 | Ga0495594_0111688 | Ga0495594_0111688_48_467 | 139 |
| 45 | 3300046507 | Ga0495606_0116860 | Ga0495606_0116860_705_1124 | 139 |
| 46 | 3300046518 | Ga0495631_0400626 | Ga0495631_0400626_46_468 | 139 |
| 47 | 3300046524 | Ga0495648_0002079 | Ga0495648_0002079_13086_13505 | 139 |
| 48 | 3300046539 | Ga0495621_0131062 | Ga0495621_0131062_222_641 | 139 |
| 49 | 3300046558 | Ga0495633_0086679 | Ga0495633_0086679_121_540 | 139 |
| 50 | 3300046615 | Ga0495656_0239858 | Ga0495656_0239858_373_792 | 139 |
| 51 | 3300046615 | Ga0495656_0386857 | Ga0495656_0386857_244_666 | 139 |
| 52 | 3300046616 | Ga0495668_0117761 | Ga0495668_0117761_505_927 | 139 |
| 53 | 3300046684 | Ga0495669_0071530 | Ga0495669_0071530_258_680 | 139 |
| 54 | 3300046684 | Ga0495669_0102379 | Ga0495669_0102379_166_585 | 139 |
| 55 | 3300046694 | Ga0495649_0246153 | Ga0495649_0246153_188_607 | 139 |
| 56 | 3300047447 | Ga0495685_095510 | Ga0495685_095510_246_665 | 139 |
| 57 | 3300048911 | Ga0496108_1314962 | Ga0496108_1314962_68_487 | 139 |
| 58 | 3300048912 | Ga0496109_0220608 | Ga0496109_0220608_676_1095 | 139 |
| 59 | 3300048924 | Ga0496121_0804704 | Ga0496121_0804704_15_449 | 139 |
| 60 | 3300049586 | Ga0501070_0441050 | Ga0501070_0441050_392_817 | 139 |
| 61 | 3300049823 | Ga0501044_0154009 | Ga0501044_0154009_1797_2222 | 139 |
| 62 | 3300050490 | nmdc:mga03n38_147618_c1 | nmdc:mga03n38_147618_c1_297_716 | 139 |
| 63 | 3300050493 | nmdc:mga0k408_120411_c1 | nmdc:mga0k408_120411_c1_758_1177 | 139 |
| 64 | 3300050507 | nmdc:mga05p37_174969_c1 | nmdc:mga05p37_174969_c1_439_858 | 139 |
| 65 | 3300050511 | nmdc:mga08y16_1109593_c1 | nmdc:mga08y16_1109593_c1_12_431 | 139 |
| 66 | iso_pu_bacteria | 2513237141 | 2513890790 | 139 |
| 67 | iso_pu_bacteria | 2857524615 | 2857528700 | 139 |
| 68 | iso_pu_bacteria | 2893066018 | 2893068892 | 139 |
| 69 | iso_pu_bacteria | 2919073203 | 2919075944 | 139 |
| 70 | 3300003215 | JGI25153J46596_10017942 | JGI25153J46596_100179422 | 140 |
| 71 | 3300003354 | JGI25160J50197_1013544 | JGI25160J50197_10135442 | 140 |
| 72 | 3300003354 | JGI25160J50197_1036890 | JGI25160J50197_10368901 | 140 |
| 73 | 3300003374 | JGI25161J50226_1009260 | JGI25161J50226_10092602 | 140 |
| 74 | 3300003752 | Ga0055539_1013517 | Ga0055539_10135172 | 140 |
| 75 | 3300004625 | Ga0055543_1005996 | Ga0055543_10059963 | 140 |
| 76 | 3300005262 | Ga0065165_1003569 | Ga0065165_100356912 | 140 |
| 77 | 3300005262 | Ga0065165_1007503 | Ga0065165_10075033 | 140 |
| 78 | 3300005262 | Ga0065165_1009639 | Ga0065165_10096395 | 140 |
| 79 | 3300005262 | Ga0065165_1031022 | Ga0065165_10310222 | 140 |
| 80 | 3300005327 | Ga0070658_10048779 | Ga0070658_100487793 | 140 |
| 81 | 3300005337 | Ga0070682_100028973 | Ga0070682_1000289732 | 140 |
| 82 | 3300005338 | Ga0068868_100344125 | Ga0068868_1003441252 | 140 |
| 83 | 3300005339 | Ga0070660_100161683 | Ga0070660_1001616832 | 140 |
| 84 | 3300005344 | Ga0070661_100181949 | Ga0070661_1001819492 | 140 |
| 85 | 3300005347 | Ga0070668_100037546 | Ga0070668_1000375463 | 140 |
| 86 | 3300005347 | Ga0070668_101019475 | Ga0070668_1010194751 | 140 |
| 87 | 3300005355 | Ga0070671_100072935 | Ga0070671_1000729353 | 140 |
| 88 | 3300005367 | Ga0070667_100681013 | Ga0070667_1006810132 | 140 |
| 89 | 3300005434 | Ga0070709_10469452 | Ga0070709_104694522 | 140 |
| 90 | 3300005436 | Ga0070713_101317571 | Ga0070713_1013175711 | 140 |
| 91 | 3300005455 | Ga0070663_100128105 | Ga0070663_1001281053 | 140 |
| 92 | 3300005455 | Ga0070663_100161439 | Ga0070663_1001614392 | 140 |
| 93 | 3300005457 | Ga0070662_100085799 | Ga0070662_1000857994 | 140 |
| 94 | 3300005457 | Ga0070662_100748612 | Ga0070662_1007486121 | 140 |
| 95 | 3300005459 | Ga0068867_100349786 | Ga0068867_1003497862 | 140 |
| 96 | 3300005539 | Ga0068853_100248236 | Ga0068853_1002482362 | 140 |
| 97 | 3300005539 | Ga0068853_101994772 | Ga0068853_1019947721 | 140 |
| 98 | 3300005548 | Ga0070665_100038117 | Ga0070665_1000381172 | 140 |
| 99 | 3300005548 | Ga0070665_100563601 | Ga0070665_1005636012 | 140 |
| 100 | 3300005563 | Ga0068855_101579940 | Ga0068855_1015799401 | 140 |
| 101 | 3300005564 | Ga0070664_101233676 | Ga0070664_1012336761 | 140 |
| 102 | 3300005614 | Ga0068856_101627494 | Ga0068856_1016274941 | 140 |
| 103 | 3300005616 | Ga0068852_100037938 | Ga0068852_1000379383 | 140 |
| 104 | 3300005616 | Ga0068852_100503297 | Ga0068852_1005032972 | 140 |
| 105 | 3300005617 | Ga0068859_101758308 | Ga0068859_1017583081 | 140 |
| 106 | 3300005840 | Ga0068870_11156037 | Ga0068870_111560371 | 140 |
| 107 | 3300005842 | Ga0068858_101219917 | Ga0068858_1012199172 | 140 |
| 108 | 3300005844 | Ga0068862_100603629 | Ga0068862_1006036292 | 140 |
| 109 | 3300005937 | Ga0081455_10482205 | Ga0081455_104822052 | 140 |
| 110 | 3300005983 | Ga0081540_1002249 | Ga0081540_10022492 | 140 |
| 111 | 3300005983 | Ga0081540_1036980 | Ga0081540_10369802 | 140 |
| 112 | 3300006038 | Ga0075365_10023032 | Ga0075365_100230322 | 140 |
| 113 | 3300006038 | Ga0075365_10135841 | Ga0075365_101358411 | 140 |
| 114 | 3300006038 | Ga0075365_10233601 | Ga0075365_102336012 | 140 |
| 115 | 3300006048 | Ga0075363_100106437 | Ga0075363_1001064372 | 140 |
| 116 | 3300006051 | Ga0075364_10066812 | Ga0075364_100668123 | 140 |
| 117 | 3300006177 | Ga0075362_10117021 | Ga0075362_101170212 | 140 |
| 118 | 3300006178 | Ga0075367_10133459 | Ga0075367_101334592 | 140 |
| 119 | 3300006178 | Ga0075367_10227221 | Ga0075367_102272212 | 140 |
| 120 | 3300006186 | Ga0075369_10050776 | Ga0075369_100507762 | 140 |
| 121 | 3300006195 | Ga0075366_10368542 | Ga0075366_103685421 | 140 |
| 122 | 3300006195 | Ga0075366_10505038 | Ga0075366_105050381 | 140 |
| 123 | 3300006353 | Ga0075370_10203699 | Ga0075370_102036992 | 140 |
| 124 | 3300006871 | Ga0075434_100840738 | Ga0075434_1008407382 | 140 |
| 125 | 3300006931 | Ga0097620_101758776 | Ga0097620_1017587761 | 140 |
| 126 | 3300006942 | Ga0099824_1011269 | Ga0099824_10112692 | 140 |
| 127 | 3300006944 | Ga0099823_1095743 | Ga0099823_10957432 | 140 |
| 128 | 3300007076 | Ga0075435_100180733 | Ga0075435_1001807332 | 140 |
| 129 | 3300009093 | Ga0105240_10001503 | Ga0105240_1000150313 | 140 |
| 130 | 3300009098 | Ga0105245_11250060 | Ga0105245_112500602 | 140 |
| 131 | 3300009148 | Ga0105243_10522834 | Ga0105243_105228342 | 140 |
| 132 | 3300009174 | Ga0105241_10078013 | Ga0105241_100780132 | 140 |
| 133 | 3300009174 | Ga0105241_10094740 | Ga0105241_100947402 | 140 |
| 134 | 3300009174 | Ga0105241_10479027 | Ga0105241_104790271 | 140 |
| 135 | 3300009177 | Ga0105248_10580318 | Ga0105248_105803182 | 140 |
| 136 | 3300009545 | Ga0105237_10000992 | Ga0105237_100009927 | 140 |
| 137 | 3300009545 | Ga0105237_10788673 | Ga0105237_107886731 | 140 |
| 138 | 3300009545 | Ga0105237_11155244 | Ga0105237_111552442 | 140 |
| 139 | 3300010375 | Ga0105239_10118569 | Ga0105239_101185693 | 140 |
| 140 | 3300010375 | Ga0105239_12120987 | Ga0105239_121209871 | 140 |
| 141 | 3300010375 | Ga0105239_13093663 | Ga0105239_130936631 | 140 |
| 142 | 3300011119 | Ga0105246_10525867 | Ga0105246_105258672 | 140 |
| 143 | 3300013104 | Ga0157370_11362062 | Ga0157370_113620622 | 140 |
| 144 | 3300013296 | Ga0157374_10347053 | Ga0157374_103470532 | 140 |
| 145 | 3300013297 | Ga0157378_10561113 | Ga0157378_105611132 | 140 |
| 146 | 3300013297 | Ga0157378_10876248 | Ga0157378_108762482 | 140 |
| 147 | 3300014497 | Ga0182008_10145428 | Ga0182008_101454282 | 140 |
| 148 | 3300014968 | Ga0157379_10483493 | Ga0157379_104834932 | 140 |
| 149 | 3300014969 | Ga0157376_10582566 | Ga0157376_105825662 | 140 |
| 150 | 3300021320 | Ga0214544_1022606 | Ga0214544_10226062 | 140 |
| 151 | 3300021321 | Ga0214542_1000002 | Ga0214542_100000293 | 140 |
| 152 | 3300021321 | Ga0214542_1023298 | Ga0214542_10232982 | 140 |
| 153 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002626 | 140 |
| 154 | 3300021324 | Ga0214545_1024282 | Ga0214545_10242822 | 140 |
| 155 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017229 | 140 |
| 156 | 3300021327 | Ga0214543_1024476 | Ga0214543_10244764 | 140 |
| 157 | 3300021384 | Ga0213876_10698814 | Ga0213876_106988141 | 140 |
| 158 | 3300025230 | Ga0209563_101649 | Ga0209563_1016491 | 140 |
| 159 | 3300025253 | Ga0209677_100547 | Ga0209677_1005478 | 140 |
| 160 | 3300025253 | Ga0209677_101107 | Ga0209677_1011078 | 140 |
| 161 | 3300025261 | Ga0209233_1000908 | Ga0209233_100090812 | 140 |
| 162 | 3300025261 | Ga0209233_1004920 | Ga0209233_10049203 | 140 |
| 163 | 3300025272 | Ga0209455_1005799 | Ga0209455_10057992 | 140 |
| 164 | 3300025272 | Ga0209455_1021921 | Ga0209455_10219211 | 140 |
| 165 | 3300025273 | Ga0209673_1016891 | Ga0209673_10168912 | 140 |
| 166 | 3300025295 | Ga0209564_1005255 | Ga0209564_10052552 | 140 |
| 167 | 3300025297 | Ga0209758_1000189 | Ga0209758_100018919 | 140 |
| 168 | 3300025297 | Ga0209758_1000827 | Ga0209758_100082717 | 140 |
| 169 | 3300025297 | Ga0209758_1020233 | Ga0209758_10202333 | 140 |
| 170 | 3300025297 | Ga0209758_1043163 | Ga0209758_10431632 | 140 |
| 171 | 3300025299 | Ga0209256_1084781 | Ga0209256_10847812 | 140 |
| 172 | 3300025302 | Ga0207426_1001072 | Ga0207426_100107216 | 140 |
| 173 | 3300025302 | Ga0207426_1001657 | Ga0207426_10016572 | 140 |
| 174 | 3300025302 | Ga0207426_1010712 | Ga0207426_10107124 | 140 |
| 175 | 3300025304 | Ga0209257_1100216 | Ga0209257_11002162 | 140 |
| 176 | 3300025901 | Ga0207688_10430996 | Ga0207688_104309961 | 140 |
| 177 | 3300025909 | Ga0207705_10028471 | Ga0207705_100284712 | 140 |
| 178 | 3300025909 | Ga0207705_10771605 | Ga0207705_107716051 | 140 |
| 179 | 3300025911 | Ga0207654_10040765 | Ga0207654_100407652 | 140 |
| 180 | 3300025911 | Ga0207654_10063717 | Ga0207654_100637172 | 140 |
| 181 | 3300025913 | Ga0207695_10000159 | Ga0207695_1000015956 | 140 |
| 182 | 3300025914 | Ga0207671_10003280 | Ga0207671_1000328012 | 140 |
| 183 | 3300025914 | Ga0207671_10939127 | Ga0207671_109391272 | 140 |
| 184 | 3300025919 | Ga0207657_10142420 | Ga0207657_101424202 | 140 |
| 185 | 3300025920 | Ga0207649_10247779 | Ga0207649_102477792 | 140 |
| 186 | 3300025920 | Ga0207649_10589917 | Ga0207649_105899172 | 140 |
| 187 | 3300025928 | Ga0207700_11494798 | Ga0207700_114947981 | 140 |
| 188 | 3300025931 | Ga0207644_10025554 | Ga0207644_100255543 | 140 |
| 189 | 3300025932 | Ga0207690_10449478 | Ga0207690_104494782 | 140 |
| 190 | 3300025933 | Ga0207706_10137433 | Ga0207706_101374333 | 140 |
| 191 | 3300025933 | Ga0207706_10173356 | Ga0207706_101733563 | 140 |
| 192 | 3300025941 | Ga0207711_10445075 | Ga0207711_104450752 | 140 |
| 193 | 3300025941 | Ga0207711_10805381 | Ga0207711_108053812 | 140 |
| 194 | 3300025949 | Ga0207667_10443484 | Ga0207667_104434842 | 140 |
| 195 | 3300025972 | Ga0207668_10080257 | Ga0207668_100802572 | 140 |
| 196 | 3300025972 | Ga0207668_10754976 | Ga0207668_107549762 | 140 |
| 197 | 3300025972 | Ga0207668_11446007 | Ga0207668_114460071 | 140 |
| 198 | 3300025986 | Ga0207658_10676960 | Ga0207658_106769602 | 140 |
| 199 | 3300026035 | Ga0207703_11851463 | Ga0207703_118514631 | 140 |
| 200 | 3300026041 | Ga0207639_11569602 | Ga0207639_115696022 | 140 |
| 201 | 3300026067 | Ga0207678_10028578 | Ga0207678_100285783 | 140 |
| 202 | 3300026088 | Ga0207641_10995766 | Ga0207641_109957662 | 140 |
| 203 | 3300026089 | Ga0207648_10199196 | Ga0207648_101991962 | 140 |
| 204 | 3300026095 | Ga0207676_12033745 | Ga0207676_120337451 | 140 |
| 205 | 3300026142 | Ga0207698_10075603 | Ga0207698_100756034 | 140 |
| 206 | 3300027296 | Ga0209389_1000239 | Ga0209389_100023922 | 140 |
| 207 | 3300027296 | Ga0209389_1000690 | Ga0209389_10006908 | 140 |
| 208 | 3300027357 | Ga0209589_1007787 | Ga0209589_100778722 | 140 |
| 209 | 3300027361 | Ga0209489_100030 | Ga0209489_100030183 | 140 |
| 210 | 3300027361 | Ga0209489_122501 | Ga0209489_1225012 | 140 |
| 211 | 3300028379 | Ga0268266_10023260 | Ga0268266_100232606 | 140 |
| 212 | 3300028379 | Ga0268266_10493004 | Ga0268266_104930042 | 140 |
| 213 | 3300028379 | Ga0268266_11155851 | Ga0268266_111558512 | 140 |
| 214 | 3300028380 | Ga0268265_10355501 | Ga0268265_103555012 | 140 |
| 215 | 3300031616 | Ga0307508_10481546 | Ga0307508_104815461 | 140 |
| 216 | 3300033180 | Ga0307510_10004554 | Ga0307510_100045546 | 140 |
| 217 | 3300033180 | Ga0307510_10050493 | Ga0307510_100504934 | 140 |
| 218 | 3300035118 | Ga0373954_0185056 | Ga0373954_0185056_210_632 | 140 |
| 219 | 3300037068 | Ga0373925_0123549 | Ga0373925_0123549_486_908 | 140 |
| 220 | 3300037418 | Ga0395900_0002922 | Ga0395900_0002922_5833_6255 | 140 |
| 221 | 3300037466 | Ga0395898_0136329 | Ga0395898_0136329_916_1338 | 140 |
| 222 | 3300037466 | Ga0395898_0330553 | Ga0395898_0330553_321_743 | 140 |
| 223 | 3300037471 | Ga0395905_0008568 | Ga0395905_0008568_7369_7791 | 140 |
| 224 | 3300037471 | Ga0395905_1211612 | Ga0395905_1211612_160_585 | 140 |
| 225 | 3300037853 | Ga0436364_0243149 | Ga0436364_0243149_413_835 | 140 |
| 226 | 3300038443 | Ga0395901_0062170 | Ga0395901_0062170_1277_1699 | 140 |
| 227 | 3300038443 | Ga0395901_0822767 | Ga0395901_0822767_251_673 | 140 |
| 228 | 3300039437 | Ga0436365_1408544 | Ga0436365_1408544_2254_2676 | 140 |
| 229 | 3300039450 | Ga0436363_0616419 | Ga0436363_0616419_258_680 | 140 |
| 230 | 3300041443 | Ga0451789_1044976 | Ga0451789_1044976_16_438 | 140 |
| 231 | 3300041456 | Ga0451795_0062024 | Ga0451795_0062024_129_551 | 140 |
| 232 | 3300041460 | Ga0451802_0754618 | Ga0451802_0754618_160_582 | 140 |
| 233 | 3300041501 | Ga0451845_0348542 | Ga0451845_0348542_211_633 | 140 |
| 234 | 3300041511 | Ga0451855_0132121 | Ga0451855_0132121_660_1082 | 140 |
| 235 | 3300044658 | Ga0466972_0000465 | Ga0466972_0000465_16403_16825 | 140 |
| 236 | 3300044658 | Ga0466972_0018329 | Ga0466972_0018329_2496_2918 | 140 |
| 237 | 3300044658 | Ga0466972_0228571 | Ga0466972_0228571_310_732 | 140 |
| 238 | 3300044683 | Ga0466965_0761563 | Ga0466965_0761563_107_529 | 140 |
| 239 | 3300044693 | Ga0466961_0000366 | Ga0466961_0000366_12076_12498 | 140 |
| 240 | 3300044693 | Ga0466961_0266891 | Ga0466961_0266891_328_750 | 140 |
| 241 | 3300044694 | Ga0466963_0004594 | Ga0466963_0004594_1160_1582 | 140 |
| 242 | 3300044706 | Ga0466964_0718109 | Ga0466964_0718109_84_506 | 140 |
| 243 | 3300044735 | Ga0466968_0004579 | Ga0466968_0004579_1483_1905 | 140 |
| 244 | 3300044735 | Ga0466968_0044827 | Ga0466968_0044827_970_1392 | 140 |
| 245 | 3300044735 | Ga0466968_0219701 | Ga0466968_0219701_252_674 | 140 |
| 246 | 3300044765 | Ga0466970_0087681 | Ga0466970_0087681_67_489 | 140 |
| 247 | 3300044765 | Ga0466970_0203228 | Ga0466970_0203228_670_1092 | 140 |
| 248 | 3300044842 | Ga0466957_0115195 | Ga0466957_0115195_1070_1492 | 140 |
| 249 | 3300044842 | Ga0466957_0493296 | Ga0466957_0493296_141_563 | 140 |
| 250 | 3300044901 | Ga0466960_0114897 | Ga0466960_0114897_474_896 | 140 |
| 251 | 3300044901 | Ga0466960_0483981 | Ga0466960_0483981_22_444 | 140 |
| 252 | 3300045049 | Ga0466959_0002745 | Ga0466959_0002745_3944_4366 | 140 |
| 253 | 3300045049 | Ga0466959_0096611 | Ga0466959_0096611_580_1002 | 140 |
| 254 | 3300045976 | Ga0466967_0047144 | Ga0466967_0047144_1273_1695 | 140 |
| 255 | 3300046454 | Ga0495592_0124744 | Ga0495592_0124744_500_922 | 140 |
| 256 | 3300046457 | Ga0495590_0337869 | Ga0495590_0337869_128_550 | 140 |
| 257 | 3300046462 | Ga0495651_0001183 | Ga0495651_0001183_1184_1606 | 140 |
| 258 | 3300046462 | Ga0495651_0027081 | Ga0495651_0027081_492_914 | 140 |
| 259 | 3300046477 | Ga0495664_0007504 | Ga0495664_0007504_386_808 | 140 |
| 260 | 3300046477 | Ga0495664_0416668 | Ga0495664_0416668_299_721 | 140 |
| 261 | 3300046491 | Ga0495584_0217539 | Ga0495584_0217539_448_870 | 140 |
| 262 | 3300046500 | Ga0495596_0266892 | Ga0495596_0266892_201_623 | 140 |
| 263 | 3300046506 | Ga0495583_0126717 | Ga0495583_0126717_84_506 | 140 |
| 264 | 3300046507 | Ga0495606_0512640 | Ga0495606_0512640_16_438 | 140 |
| 265 | 3300046507 | Ga0495606_0518053 | Ga0495606_0518053_53_481 | 140 |
| 266 | 3300046513 | Ga0495616_0322104 | Ga0495616_0322104_82_504 | 140 |
| 267 | 3300046514 | Ga0495618_0397787 | Ga0495618_0397787_176_598 | 140 |
| 268 | 3300046515 | Ga0495620_0033852 | Ga0495620_0033852_1105_1527 | 140 |
| 269 | 3300046517 | Ga0495630_0107347 | Ga0495630_0107347_1083_1505 | 140 |
| 270 | 3300046518 | Ga0495631_0417531 | Ga0495631_0417531_41_463 | 140 |
| 271 | 3300046522 | Ga0495643_0008653 | Ga0495643_0008653_341_763 | 140 |
| 272 | 3300046522 | Ga0495643_0443470 | Ga0495643_0443470_24_446 | 140 |
| 273 | 3300046524 | Ga0495648_0039173 | Ga0495648_0039173_965_1387 | 140 |
| 274 | 3300046529 | Ga0495652_0120252 | Ga0495652_0120252_119_541 | 140 |
| 275 | 3300046536 | Ga0495587_0004094 | Ga0495587_0004094_6226_6648 | 140 |
| 276 | 3300046543 | Ga0495645_0541658 | Ga0495645_0541658_121_543 | 140 |
| 277 | 3300046557 | Ga0495622_0124130 | Ga0495622_0124130_427_849 | 140 |
| 278 | 3300046559 | Ga0495667_0131901 | Ga0495667_0131901_828_1250 | 140 |
| 279 | 3300046616 | Ga0495668_0144734 | Ga0495668_0144734_268_690 | 140 |
| 280 | 3300046642 | Ga0495634_0019165 | Ga0495634_0019165_2175_2597 | 140 |
| 281 | 3300046642 | Ga0495634_0116016 | Ga0495634_0116016_818_1240 | 140 |
| 282 | 3300046648 | Ga0495611_0085823 | Ga0495611_0085823_232_654 | 140 |
| 283 | 3300046660 | Ga0495625_0029775 | Ga0495625_0029775_469_891 | 140 |
| 284 | 3300046663 | Ga0495635_0002199 | Ga0495635_0002199_6217_6639 | 140 |
| 285 | 3300046665 | Ga0495661_0133148 | Ga0495661_0133148_672_1094 | 140 |
| 286 | 3300046665 | Ga0495661_0220214 | Ga0495661_0220214_491_913 | 140 |
| 287 | 3300046675 | Ga0495657_0011029 | Ga0495657_0011029_2095_2517 | 140 |
| 288 | 3300046675 | Ga0495657_0014422 | Ga0495657_0014422_844_1266 | 140 |
| 289 | 3300046678 | Ga0495599_0095311 | Ga0495599_0095311_977_1399 | 140 |
| 290 | 3300046679 | Ga0495623_0043429 | Ga0495623_0043429_1934_2356 | 140 |
| 291 | 3300046680 | Ga0495646_0076971 | Ga0495646_0076971_1349_1771 | 140 |
| 292 | 3300046689 | Ga0495613_0060313 | Ga0495613_0060313_1978_2400 | 140 |
| 293 | 3300046690 | Ga0495624_0323741 | Ga0495624_0323741_159_581 | 140 |
| 294 | 3300046690 | Ga0495624_0371965 | Ga0495624_0371965_257_679 | 140 |
| 295 | 3300046692 | Ga0495671_0052466 | Ga0495671_0052466_80_502 | 140 |
| 296 | 3300046692 | Ga0495671_0246860 | Ga0495671_0246860_203_625 | 140 |
| 297 | 3300046809 | Ga0495600_0012798 | Ga0495600_0012798_548_970 | 140 |
| 298 | 3300047317 | Ga0495604_0002274 | Ga0495604_0002274_11998_12420 | 140 |
| 299 | 3300047317 | Ga0495604_0079461 | Ga0495604_0079461_1914_2336 | 140 |
| 300 | 3300047317 | Ga0495604_0111985 | Ga0495604_0111985_1442_1864 | 140 |
| 301 | 3300047319 | Ga0495674_0140758 | Ga0495674_0140758_1255_1677 | 140 |
| 302 | 3300047322 | Ga0495680_0001595 | Ga0495680_0001595_14931_15353 | 140 |
| 303 | 3300047443 | Ga0495687_056061 | Ga0495687_056061_341_763 | 140 |
| 304 | 3300047444 | Ga0495675_0017231 | Ga0495675_0017231_3601_4023 | 140 |
| 305 | 3300047471 | Ga0495684_0065648 | Ga0495684_0065648_500_922 | 140 |
| 306 | 3300047472 | Ga0495686_0310224 | Ga0495686_0310224_249_671 | 140 |
| 307 | 3300047673 | Ga0495593_0094177 | Ga0495593_0094177_246_668 | 140 |
| 308 | 3300048088 | Ga0495602_0023337 | Ga0495602_0023337_4814_5236 | 140 |
| 309 | 3300048903 | Ga0496100_0301952 | Ga0496100_0301952_238_663 | 140 |
| 310 | 3300048903 | Ga0496100_0324962 | Ga0496100_0324962_677_1099 | 140 |
| 311 | 3300048903 | Ga0496100_0384937 | Ga0496100_0384937_586_1008 | 140 |
| 312 | 3300048904 | Ga0496101_0033122 | Ga0496101_0033122_625_1047 | 140 |
| 313 | 3300048904 | Ga0496101_0126230 | Ga0496101_0126230_1085_1507 | 140 |
| 314 | 3300048904 | Ga0496101_0208392 | Ga0496101_0208392_950_1375 | 140 |
| 315 | 3300048904 | Ga0496101_1182723 | Ga0496101_1182723_24_446 | 140 |
| 316 | 3300048905 | Ga0496102_0012642 | Ga0496102_0012642_6797_7219 | 140 |
| 317 | 3300048905 | Ga0496102_0061059 | Ga0496102_0061059_407_829 | 140 |
| 318 | 3300048905 | Ga0496102_0219217 | Ga0496102_0219217_272_694 | 140 |
| 319 | 3300048906 | Ga0496103_0038684 | Ga0496103_0038684_1974_2396 | 140 |
| 320 | 3300048906 | Ga0496103_0301794 | Ga0496103_0301794_397_822 | 140 |
| 321 | 3300048907 | Ga0496104_0020012 | Ga0496104_0020012_2537_2959 | 140 |
| 322 | 3300048907 | Ga0496104_0263653 | Ga0496104_0263653_136_558 | 140 |
| 323 | 3300048907 | Ga0496104_0819283 | Ga0496104_0819283_92_514 | 140 |
| 324 | 3300048908 | Ga0496105_0027000 | Ga0496105_0027000_3831_4253 | 140 |
| 325 | 3300048908 | Ga0496105_0031039 | Ga0496105_0031039_1279_1701 | 140 |
| 326 | 3300048908 | Ga0496105_0056915 | Ga0496105_0056915_2546_2968 | 140 |
| 327 | 3300048908 | Ga0496105_0154296 | Ga0496105_0154296_1369_1791 | 140 |
| 328 | 3300048909 | Ga0496106_0000501 | Ga0496106_0000501_12757_13182 | 140 |
| 329 | 3300048909 | Ga0496106_0130575 | Ga0496106_0130575_279_701 | 140 |
| 330 | 3300048909 | Ga0496106_0237543 | Ga0496106_0237543_433_855 | 140 |
| 331 | 3300048910 | Ga0496107_0006040 | Ga0496107_0006040_5574_5999 | 140 |
| 332 | 3300048910 | Ga0496107_0175743 | Ga0496107_0175743_1004_1426 | 140 |
| 333 | 3300048911 | Ga0496108_0024615 | Ga0496108_0024615_3528_3953 | 140 |
| 334 | 3300048912 | Ga0496109_0000607 | Ga0496109_0000607_12316_12741 | 140 |
| 335 | 3300048912 | Ga0496109_0095832 | Ga0496109_0095832_1194_1616 | 140 |
| 336 | 3300048913 | Ga0496110_0372904 | Ga0496110_0372904_799_1221 | 140 |
| 337 | 3300048913 | Ga0496110_0451001 | Ga0496110_0451001_732_1154 | 140 |
| 338 | 3300048914 | Ga0496111_0092813 | Ga0496111_0092813_432_854 | 140 |
| 339 | 3300048914 | Ga0496111_0117826 | Ga0496111_0117826_1209_1631 | 140 |
| 340 | 3300048914 | Ga0496111_0423681 | Ga0496111_0423681_493_918 | 140 |
| 341 | 3300048915 | Ga0496112_0025348 | Ga0496112_0025348_1307_1729 | 140 |
| 342 | 3300048915 | Ga0496112_0065599 | Ga0496112_0065599_1979_2404 | 140 |
| 343 | 3300048916 | Ga0496113_0117397 | Ga0496113_0117397_448_870 | 140 |
| 344 | 3300048916 | Ga0496113_1170086 | Ga0496113_1170086_57_479 | 140 |
| 345 | 3300048917 | Ga0496114_0279763 | Ga0496114_0279763_1002_1424 | 140 |
| 346 | 3300048918 | Ga0496115_0038929 | Ga0496115_0038929_2923_3345 | 140 |
| 347 | 3300048918 | Ga0496115_0091716 | Ga0496115_0091716_740_1162 | 140 |
| 348 | 3300048918 | Ga0496115_0501600 | Ga0496115_0501600_402_827 | 140 |
| 349 | 3300048919 | Ga0496116_0036964 | Ga0496116_0036964_560_982 | 140 |
| 350 | 3300048921 | Ga0496118_0012116 | Ga0496118_0012116_5701_6126 | 140 |
| 351 | 3300048921 | Ga0496118_0266811 | Ga0496118_0266811_82_504 | 140 |
| 352 | 3300048921 | Ga0496118_0364382 | Ga0496118_0364382_253_675 | 140 |
| 353 | 3300048922 | Ga0496119_0026902 | Ga0496119_0026902_1719_2141 | 140 |
| 354 | 3300048922 | Ga0496119_0074232 | Ga0496119_0074232_854_1276 | 140 |
| 355 | 3300048922 | Ga0496119_0092035 | Ga0496119_0092035_1237_1662 | 140 |
| 356 | 3300048923 | Ga0496120_0104950 | Ga0496120_0104950_450_872 | 140 |
| 357 | 3300048924 | Ga0496121_0029660 | Ga0496121_0029660_268_693 | 140 |
| 358 | 3300048924 | Ga0496121_0056308 | Ga0496121_0056308_315_737 | 140 |
| 359 | 3300048924 | Ga0496121_0087766 | Ga0496121_0087766_840_1262 | 140 |
| 360 | 3300048924 | Ga0496121_0480251 | Ga0496121_0480251_361_783 | 140 |
| 361 | 3300048924 | Ga0496121_0494450 | Ga0496121_0494450_56_478 | 140 |
| 362 | 3300048925 | Ga0496122_0011608 | Ga0496122_0011608_3887_4309 | 140 |
| 363 | 3300048926 | Ga0496123_0315587 | Ga0496123_0315587_238_660 | 140 |
| 364 | 3300048927 | Ga0496124_0762197 | Ga0496124_0762197_66_488 | 140 |
| 365 | 3300048928 | Ga0496125_0056729 | Ga0496125_0056729_206_628 | 140 |
| 366 | 3300048928 | Ga0496125_0171121 | Ga0496125_0171121_529_951 | 140 |
| 367 | 3300048928 | Ga0496125_0178860 | Ga0496125_0178860_535_960 | 140 |
| 368 | 3300048928 | Ga0496125_0464075 | Ga0496125_0464075_191_613 | 140 |
| 369 | 3300048929 | Ga0496126_0003590 | Ga0496126_0003590_9815_10237 | 140 |
| 370 | 3300048929 | Ga0496126_0040306 | Ga0496126_0040306_514_936 | 140 |
| 371 | 3300048929 | Ga0496126_0114342 | Ga0496126_0114342_1833_2255 | 140 |
| 372 | 3300048929 | Ga0496126_0551668 | Ga0496126_0551668_419_841 | 140 |
| 373 | 3300048929 | Ga0496126_0581783 | Ga0496126_0581783_46_468 | 140 |
| 374 | 3300048929 | Ga0496126_0728904 | Ga0496126_0728904_324_746 | 140 |
| 375 | 3300048929 | Ga0496126_0743122 | Ga0496126_0743122_194_616 | 140 |
| 376 | 3300049579 | Ga0501043_0361846 | Ga0501043_0361846_641_1081 | 140 |
| 377 | 3300050491 | nmdc:mga00v17_149961_c1 | nmdc:mga00v17_149961_c1_389_811 | 140 |
| 378 | 3300050492 | nmdc:mga0yw44_106002_c1 | nmdc:mga0yw44_106002_c1_1206_1628 | 140 |
| 379 | 3300050492 | nmdc:mga0yw44_106378_c1 | nmdc:mga0yw44_106378_c1_138_560 | 140 |
| 380 | 3300050492 | nmdc:mga0yw44_16105_c1 | nmdc:mga0yw44_16105_c1_3272_3694 | 140 |
| 381 | 3300050494 | nmdc:mga06z11_373427_c1 | nmdc:mga06z11_373427_c1_182_604 | 140 |
| 382 | 3300050512 | nmdc:mga0n895_484023_c1 | nmdc:mga0n895_484023_c1_231_656 | 140 |
| 383 | 3300050516 | nmdc:mga0sz30_77783_c1 | nmdc:mga0sz30_77783_c1_759_1181 | 140 |
| 384 | 3300053077 | Ga0495601_0637574 | Ga0495601_0637574_127_549 | 140 |
| 385 | 3300053079 | Ga0500610_0287722 | Ga0500610_0287722_176_598 | 140 |
| 386 | 3300053083 | Ga0495655_0160756 | Ga0495655_0160756_113_535 | 140 |
| 387 | 3300053084 | Ga0495595_0554364 | Ga0495595_0554364_125_547 | 140 |
| 388 | 3300053086 | Ga0500578_0227955 | Ga0500578_0227955_181_603 | 140 |
| 389 | 3300053087 | Ga0500643_000040 | Ga0500643_000040_164904_165326 | 140 |
| 390 | 3300053092 | Ga0500583_0202187 | Ga0500583_0202187_378_800 | 140 |
| 391 | 3300053094 | Ga0500566_0000230 | Ga0500566_0000230_9916_10338 | 140 |
| 392 | 3300053094 | Ga0500566_0179997 | Ga0500566_0179997_339_761 | 140 |
| 393 | 3300053096 | Ga0500641_0021384 | Ga0500641_0021384_452_874 | 140 |
| 394 | 3300053097 | Ga0500648_093476 | Ga0500648_093476_535_957 | 140 |
| 395 | 3300053102 | Ga0500554_264146 | Ga0500554_264146_44_466 | 140 |
| 396 | 3300053103 | Ga0500555_002003 | Ga0500555_002003_5062_5484 | 140 |
| 397 | 3300053109 | Ga0500569_040307 | Ga0500569_040307_468_890 | 140 |
| 398 | 3300053111 | Ga0500572_028490 | Ga0500572_028490_155_577 | 140 |
| 399 | 3300053116 | Ga0500592_004040 | Ga0500592_004040_14_436 | 140 |
| 400 | 3300053118 | Ga0500594_0119064 | Ga0500594_0119064_123_545 | 140 |
| 401 | 3300053119 | Ga0500595_085970 | Ga0500595_085970_262_684 | 140 |
| 402 | 3300053123 | Ga0500614_123950 | Ga0500614_123950_266_688 | 140 |
| 403 | 3300053125 | Ga0500618_031139 | Ga0500618_031139_801_1223 | 140 |
| 404 | 3300053133 | Ga0500655_020750 | Ga0500655_020750_766_1188 | 140 |
| 405 | 3300053136 | Ga0500559_0042935 | Ga0500559_0042935_1304_1726 | 140 |
| 406 | 3300053138 | Ga0500564_007088 | Ga0500564_007088_1902_2324 | 140 |
| 407 | 3300053139 | Ga0500568_0005161 | Ga0500568_0005161_5938_6360 | 140 |
| 408 | 3300053142 | Ga0500577_0023967 | Ga0500577_0023967_1179_1601 | 140 |
| 409 | 3300053146 | Ga0500588_0249205 | Ga0500588_0249205_232_654 | 140 |
| 410 | 3300053148 | Ga0500590_120403 | Ga0500590_120403_640_1062 | 140 |
| 411 | 3300053150 | Ga0500603_043302 | Ga0500603_043302_289_711 | 140 |
| 412 | 3300053153 | Ga0500616_0016770 | Ga0500616_0016770_3010_3432 | 140 |
| 413 | 3300053154 | Ga0500619_055454 | Ga0500619_055454_63_485 | 140 |
| 414 | 3300053155 | Ga0500620_010151 | Ga0500620_010151_1892_2314 | 140 |
| 415 | 3300053158 | Ga0500627_0477836 | Ga0500627_0477836_84_506 | 140 |
| 416 | 3300053162 | Ga0500638_122474 | Ga0500638_122474_589_1011 | 140 |
| 417 | 3300053177 | Ga0500636_0000120 | Ga0500636_0000120_22609_23031 | 140 |
| 418 | 3300053177 | Ga0500636_0095073 | Ga0500636_0095073_817_1239 | 140 |
| 419 | 3300053177 | Ga0500636_0321081 | Ga0500636_0321081_131_553 | 140 |
| 420 | 3300053178 | Ga0500637_0268001 | Ga0500637_0268001_285_707 | 140 |
| 421 | 3300053722 | Ga0500649_059072 | Ga0500649_059072_13_435 | 140 |
| 422 | 3300053731 | Ga0500609_000334 | Ga0500609_000334_1706_2128 | 140 |
| 423 | 3300053737 | Ga0500601_000586 | Ga0500601_000586_4753_5175 | 140 |
| 424 | 3300053737 | Ga0500601_038210 | Ga0500601_038210_60_482 | 140 |
| 425 | 3300005329 | Ga0070683_100037619 | Ga0070683_1000376193 | 141 |
| 426 | 3300005336 | Ga0070680_100004631 | Ga0070680_1000046318 | 141 |
| 427 | 3300005336 | Ga0070680_100640087 | Ga0070680_1006400872 | 141 |
| 428 | 3300005337 | Ga0070682_100199702 | Ga0070682_1001997022 | 141 |
| 429 | 3300005434 | Ga0070709_10001049 | Ga0070709_1000104911 | 141 |
| 430 | 3300005437 | Ga0070710_10040600 | Ga0070710_100406002 | 141 |
| 431 | 3300005439 | Ga0070711_100003503 | Ga0070711_1000035038 | 141 |
| 432 | 3300005439 | Ga0070711_101384808 | Ga0070711_1013848081 | 141 |
| 433 | 3300005455 | Ga0070663_100538085 | Ga0070663_1005380852 | 141 |
| 434 | 3300005458 | Ga0070681_10047129 | Ga0070681_100471292 | 141 |
| 435 | 3300005458 | Ga0070681_10720642 | Ga0070681_107206422 | 141 |
| 436 | 3300005530 | Ga0070679_100051310 | Ga0070679_1000513107 | 141 |
| 437 | 3300005530 | Ga0070679_100215689 | Ga0070679_1002156892 | 141 |
| 438 | 3300005530 | Ga0070679_100229794 | Ga0070679_1002297942 | 141 |
| 439 | 3300005530 | Ga0070679_100502166 | Ga0070679_1005021662 | 141 |
| 440 | 3300005530 | Ga0070679_100750247 | Ga0070679_1007502472 | 141 |
| 441 | 3300005535 | Ga0070684_100011514 | Ga0070684_1000115144 | 141 |
| 442 | 3300005548 | Ga0070665_100601414 | Ga0070665_1006014142 | 141 |
| 443 | 3300005563 | Ga0068855_100275794 | Ga0068855_1002757942 | 141 |
| 444 | 3300005563 | Ga0068855_100838891 | Ga0068855_1008388912 | 141 |
| 445 | 3300005563 | Ga0068855_101797924 | Ga0068855_1017979241 | 141 |
| 446 | 3300005577 | Ga0068857_100395122 | Ga0068857_1003951222 | 141 |
| 447 | 3300005614 | Ga0068856_100000535 | Ga0068856_10000053529 | 141 |
| 448 | 3300005616 | Ga0068852_102639092 | Ga0068852_1026390921 | 141 |
| 449 | 3300005981 | Ga0081538_10031309 | Ga0081538_100313093 | 141 |
| 450 | 3300005983 | Ga0081540_1116975 | Ga0081540_11169752 | 141 |
| 451 | 3300006028 | Ga0070717_10144342 | Ga0070717_101443422 | 141 |
| 452 | 3300006038 | Ga0075365_10686225 | Ga0075365_106862252 | 141 |
| 453 | 3300006175 | Ga0070712_100290120 | Ga0070712_1002901202 | 141 |
| 454 | 3300006195 | Ga0075366_10694709 | Ga0075366_106947091 | 141 |
| 455 | 3300006358 | Ga0068871_100625788 | Ga0068871_1006257882 | 141 |
| 456 | 3300009093 | Ga0105240_10012039 | Ga0105240_100120394 | 141 |
| 457 | 3300009093 | Ga0105240_10514575 | Ga0105240_105145752 | 141 |
| 458 | 3300009148 | Ga0105243_11566714 | Ga0105243_115667141 | 141 |
| 459 | 3300009545 | Ga0105237_10027416 | Ga0105237_100274168 | 141 |
| 460 | 3300009545 | Ga0105237_10068125 | Ga0105237_100681252 | 141 |
| 461 | 3300009545 | Ga0105237_10373604 | Ga0105237_103736042 | 141 |
| 462 | 3300009551 | Ga0105238_10021123 | Ga0105238_100211237 | 141 |
| 463 | 3300009551 | Ga0105238_10182278 | Ga0105238_101822782 | 141 |
| 464 | 3300009551 | Ga0105238_10311513 | Ga0105238_103115132 | 141 |
| 465 | 3300009551 | Ga0105238_10376017 | Ga0105238_103760172 | 141 |
| 466 | 3300009551 | Ga0105238_11254211 | Ga0105238_112542112 | 141 |
| 467 | 3300010375 | Ga0105239_10203365 | Ga0105239_102033652 | 141 |
| 468 | 3300013104 | Ga0157370_11895656 | Ga0157370_118956561 | 141 |
| 469 | 3300013105 | Ga0157369_10009894 | Ga0157369_100098948 | 141 |
| 470 | 3300013105 | Ga0157369_10103369 | Ga0157369_101033694 | 141 |
| 471 | 3300013105 | Ga0157369_11695679 | Ga0157369_116956791 | 141 |
| 472 | 3300013296 | Ga0157374_10517789 | Ga0157374_105177892 | 141 |
| 473 | 3300013307 | Ga0157372_10189034 | Ga0157372_101890343 | 141 |
| 474 | 3300013307 | Ga0157372_10284026 | Ga0157372_102840262 | 141 |
| 475 | 3300013307 | Ga0157372_11504618 | Ga0157372_115046182 | 141 |
| 476 | 3300014745 | Ga0157377_10842548 | Ga0157377_108425482 | 141 |
| 477 | 3300020069 | Ga0197907_11372531 | Ga0197907_113725312 | 141 |
| 478 | 3300021384 | Ga0213876_10217404 | Ga0213876_102174042 | 141 |
| 479 | 3300022467 | Ga0224712_10274410 | Ga0224712_102744101 | 141 |
| 480 | 3300025906 | Ga0207699_10204874 | Ga0207699_102048741 | 141 |
| 481 | 3300025912 | Ga0207707_10009378 | Ga0207707_1000937810 | 141 |
| 482 | 3300025912 | Ga0207707_10025231 | Ga0207707_100252316 | 141 |
| 483 | 3300025912 | Ga0207707_10207609 | Ga0207707_102076091 | 141 |
| 484 | 3300025912 | Ga0207707_10733281 | Ga0207707_107332811 | 141 |
| 485 | 3300025913 | Ga0207695_10035634 | Ga0207695_100356345 | 141 |
| 486 | 3300025913 | Ga0207695_11324059 | Ga0207695_113240591 | 141 |
| 487 | 3300025914 | Ga0207671_10285934 | Ga0207671_102859342 | 141 |
| 488 | 3300025914 | Ga0207671_10376283 | Ga0207671_103762832 | 141 |
| 489 | 3300025915 | Ga0207693_10021981 | Ga0207693_100219815 | 141 |
| 490 | 3300025917 | Ga0207660_10031077 | Ga0207660_100310776 | 141 |
| 491 | 3300025921 | Ga0207652_10009472 | Ga0207652_100094728 | 141 |
| 492 | 3300025921 | Ga0207652_10041605 | Ga0207652_100416052 | 141 |
| 493 | 3300025921 | Ga0207652_10451505 | Ga0207652_104515051 | 141 |
| 494 | 3300025924 | Ga0207694_10017732 | Ga0207694_100177321 | 141 |
| 495 | 3300025924 | Ga0207694_10545562 | Ga0207694_105455622 | 141 |
| 496 | 3300025928 | Ga0207700_10173713 | Ga0207700_101737131 | 141 |
| 497 | 3300025929 | Ga0207664_10629235 | Ga0207664_106292351 | 141 |
| 498 | 3300025929 | Ga0207664_11248387 | Ga0207664_112483872 | 141 |
| 499 | 3300025944 | Ga0207661_10003040 | Ga0207661_100030403 | 141 |
| 500 | 3300025944 | Ga0207661_10331914 | Ga0207661_103319142 | 141 |
| 501 | 3300025949 | Ga0207667_10328127 | Ga0207667_103281272 | 141 |
| 502 | 3300025949 | Ga0207667_10377288 | Ga0207667_103772882 | 141 |
| 503 | 3300026041 | Ga0207639_11692278 | Ga0207639_116922781 | 141 |
| 504 | 3300026067 | Ga0207678_10167906 | Ga0207678_101679062 | 141 |
| 505 | 3300026078 | Ga0207702_10000081 | Ga0207702_1000008139 | 141 |
| 506 | 3300026078 | Ga0207702_10056499 | Ga0207702_100564993 | 141 |
| 507 | 3300026116 | Ga0207674_10370937 | Ga0207674_103709372 | 141 |
| 508 | 3300026121 | Ga0207683_10097580 | Ga0207683_100975802 | 141 |
| 509 | 3300026142 | Ga0207698_10779031 | Ga0207698_107790312 | 141 |
| 510 | 3300026142 | Ga0207698_10835067 | Ga0207698_108350671 | 141 |
| 511 | 3300032126 | Ga0307415_100358307 | Ga0307415_1003583072 | 141 |
| 512 | 3300035089 | Ga0373944_0125234 | Ga0373944_0125234_157_582 | 141 |
| 513 | 3300035111 | Ga0373923_0051523 | Ga0373923_0051523_59_484 | 141 |
| 514 | 3300035116 | Ga0373945_0021136 | Ga0373945_0021136_1311_1736 | 141 |
| 515 | 3300035117 | Ga0373953_0069543 | Ga0373953_0069543_389_814 | 141 |
| 516 | 3300035118 | Ga0373954_0045183 | Ga0373954_0045183_1604_2029 | 141 |
| 517 | 3300035172 | Ga0373955_0028493 | Ga0373955_0028493_177_602 | 141 |
| 518 | 3300035410 | Ga0373924_0006349 | Ga0373924_0006349_1706_2131 | 141 |
| 519 | 3300035692 | Ga0373935_0042994 | Ga0373935_0042994_158_583 | 141 |
| 520 | 3300035695 | Ga0373927_0084944 | Ga0373927_0084944_758_1183 | 141 |
| 521 | 3300035695 | Ga0373927_0128333 | Ga0373927_0128333_284_709 | 141 |
| 522 | 3300035724 | Ga0373933_0031995 | Ga0373933_0031995_313_777 | 141 |
| 523 | 3300035725 | Ga0373947_0639787 | Ga0373947_0639787_165_590 | 141 |
| 524 | 3300036401 | Ga0373937_0036239 | Ga0373937_0036239_2898_3362 | 141 |
| 525 | 3300037068 | Ga0373925_0043776 | Ga0373925_0043776_763_1188 | 141 |
| 526 | 3300037068 | Ga0373925_0573898 | Ga0373925_0573898_263_688 | 141 |
| 527 | 3300037068 | Ga0373925_0671226 | Ga0373925_0671226_82_507 | 141 |
| 528 | 3300037418 | Ga0395900_1659015 | Ga0395900_1659015_27_455 | 141 |
| 529 | 3300037466 | Ga0395898_0117507 | Ga0395898_0117507_279_704 | 141 |
| 530 | 3300037853 | Ga0436364_0326406 | Ga0436364_0326406_1043_1468 | 141 |
| 531 | 3300039437 | Ga0436365_0712770 | Ga0436365_0712770_1485_1910 | 141 |
| 532 | 3300039437 | Ga0436365_1587325 | Ga0436365_1587325_96_521 | 141 |
| 533 | 3300041451 | Ga0451791_0535527 | Ga0451791_0535527_160_585 | 141 |
| 534 | 3300041456 | Ga0451795_1432725 | Ga0451795_1432725_13_438 | 141 |
| 535 | 3300044694 | Ga0466963_0037426 | Ga0466963_0037426_2653_3078 | 141 |
| 536 | 3300044706 | Ga0466964_0404466 | Ga0466964_0404466_120_545 | 141 |
| 537 | 3300045976 | Ga0466967_0168058 | Ga0466967_0168058_124_549 | 141 |
| 538 | 3300045976 | Ga0466967_0803791 | Ga0466967_0803791_255_680 | 141 |
| 539 | 3300046455 | Ga0495603_0486554 | Ga0495603_0486554_189_614 | 141 |
| 540 | 3300046459 | Ga0495629_0129488 | Ga0495629_0129488_818_1243 | 141 |
| 541 | 3300046462 | Ga0495651_0465031 | Ga0495651_0465031_248_673 | 141 |
| 542 | 3300046472 | Ga0495580_0021678 | Ga0495580_0021678_379_804 | 141 |
| 543 | 3300046473 | Ga0495582_0157122 | Ga0495582_0157122_196_621 | 141 |
| 544 | 3300046477 | Ga0495664_0010508 | Ga0495664_0010508_2656_3120 | 141 |
| 545 | 3300046499 | Ga0495594_0246695 | Ga0495594_0246695_54_479 | 141 |
| 546 | 3300046516 | Ga0495628_0238409 | Ga0495628_0238409_94_519 | 141 |
| 547 | 3300046524 | Ga0495648_0004572 | Ga0495648_0004572_9907_10332 | 141 |
| 548 | 3300046526 | Ga0495666_0076926 | Ga0495666_0076926_915_1340 | 141 |
| 549 | 3300046531 | Ga0495665_0007540 | Ga0495665_0007540_2204_2629 | 141 |
| 550 | 3300046535 | Ga0495586_0100571 | Ga0495586_0100571_285_710 | 141 |
| 551 | 3300046536 | Ga0495587_0292503 | Ga0495587_0292503_169_594 | 141 |
| 552 | 3300046642 | Ga0495634_0030090 | Ga0495634_0030090_166_591 | 141 |
| 553 | 3300046675 | Ga0495657_0853520 | Ga0495657_0853520_66_491 | 141 |
| 554 | 3300046678 | Ga0495599_0257471 | Ga0495599_0257471_87_551 | 141 |
| 555 | 3300046681 | Ga0495647_0114158 | Ga0495647_0114158_436_900 | 141 |
| 556 | 3300046683 | Ga0495658_0038455 | Ga0495658_0038455_1637_2062 | 141 |
| 557 | 3300046683 | Ga0495658_0759005 | Ga0495658_0759005_61_486 | 141 |
| 558 | 3300046690 | Ga0495624_0038211 | Ga0495624_0038211_2155_2580 | 141 |
| 559 | 3300047315 | Ga0495581_0030696 | Ga0495581_0030696_348_773 | 141 |
| 560 | 3300047319 | Ga0495674_0091722 | Ga0495674_0091722_1161_1586 | 141 |
| 561 | 3300047471 | Ga0495684_0015313 | Ga0495684_0015313_2114_2539 | 141 |
| 562 | 3300047673 | Ga0495593_0038125 | Ga0495593_0038125_2006_2431 | 141 |
| 563 | 3300048924 | Ga0496121_0026502 | Ga0496121_0026502_2382_2807 | 141 |
| 564 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_71394_71912 | 141 |
| 565 | 3300048929 | Ga0496126_0479065 | Ga0496126_0479065_126_551 | 141 |
| 566 | 3300049581 | Ga0501047_0188735 | Ga0501047_0188735_33_461 | 141 |
| 567 | 3300049744 | Ga0501083_0801602 | Ga0501083_0801602_99_527 | 141 |
| 568 | 3300050492 | nmdc:mga0yw44_638244_c1 | nmdc:mga0yw44_638244_c1_201_626 | 141 |
| 569 | 3300001979 | JGI24740J21852_10026584 | JGI24740J21852_100265842 | 142 |
| 570 | 3300001979 | JGI24740J21852_10101045 | JGI24740J21852_101010451 | 142 |
| 571 | 3300002075 | JGI24738J21930_10101359 | JGI24738J21930_101013592 | 142 |
| 572 | 3300003215 | JGI25153J46596_10004677 | JGI25153J46596_100046777 | 142 |
| 573 | 3300003659 | JGI25404J52841_10009065 | JGI25404J52841_100090653 | 142 |
| 574 | 3300003659 | JGI25404J52841_10024640 | JGI25404J52841_100246401 | 142 |
| 575 | 3300005293 | Ga0065715_10271731 | Ga0065715_102717312 | 142 |
| 576 | 3300005327 | Ga0070658_10144495 | Ga0070658_101444952 | 142 |
| 577 | 3300005329 | Ga0070683_100007695 | Ga0070683_1000076957 | 142 |
| 578 | 3300005334 | Ga0068869_100017200 | Ga0068869_1000172002 | 142 |
| 579 | 3300005334 | Ga0068869_100139057 | Ga0068869_1001390573 | 142 |
| 580 | 3300005334 | Ga0068869_100838093 | Ga0068869_1008380932 | 142 |
| 581 | 3300005335 | Ga0070666_10912799 | Ga0070666_109127992 | 142 |
| 582 | 3300005336 | Ga0070680_100018149 | Ga0070680_1000181494 | 142 |
| 583 | 3300005337 | Ga0070682_100046870 | Ga0070682_1000468703 | 142 |
| 584 | 3300005337 | Ga0070682_100249988 | Ga0070682_1002499881 | 142 |
| 585 | 3300005338 | Ga0068868_100161311 | Ga0068868_1001613112 | 142 |
| 586 | 3300005338 | Ga0068868_100227730 | Ga0068868_1002277302 | 142 |
| 587 | 3300005339 | Ga0070660_100007944 | Ga0070660_1000079446 | 142 |
| 588 | 3300005339 | Ga0070660_100609937 | Ga0070660_1006099371 | 142 |
| 589 | 3300005339 | Ga0070660_100932119 | Ga0070660_1009321191 | 142 |
| 590 | 3300005341 | Ga0070691_10035653 | Ga0070691_100356532 | 142 |
| 591 | 3300005344 | Ga0070661_100116253 | Ga0070661_1001162532 | 142 |
| 592 | 3300005344 | Ga0070661_100220441 | Ga0070661_1002204413 | 142 |
| 593 | 3300005344 | Ga0070661_100318800 | Ga0070661_1003188002 | 142 |
| 594 | 3300005347 | Ga0070668_100101845 | Ga0070668_1001018452 | 142 |
| 595 | 3300005347 | Ga0070668_100175219 | Ga0070668_1001752192 | 142 |
| 596 | 3300005347 | Ga0070668_100309786 | Ga0070668_1003097861 | 142 |
| 597 | 3300005353 | Ga0070669_100528292 | Ga0070669_1005282921 | 142 |
| 598 | 3300005355 | Ga0070671_100191403 | Ga0070671_1001914032 | 142 |
| 599 | 3300005355 | Ga0070671_100383341 | Ga0070671_1003833411 | 142 |
| 600 | 3300005356 | Ga0070674_100477836 | Ga0070674_1004778362 | 142 |
| 601 | 3300005366 | Ga0070659_100569554 | Ga0070659_1005695541 | 142 |
| 602 | 3300005367 | Ga0070667_100176034 | Ga0070667_1001760342 | 142 |
| 603 | 3300005434 | Ga0070709_10054092 | Ga0070709_100540923 | 142 |
| 604 | 3300005435 | Ga0070714_100001503 | Ga0070714_10000150312 | 142 |
| 605 | 3300005435 | Ga0070714_100438034 | Ga0070714_1004380342 | 142 |
| 606 | 3300005435 | Ga0070714_100531195 | Ga0070714_1005311952 | 142 |
| 607 | 3300005436 | Ga0070713_100009241 | Ga0070713_1000092416 | 142 |
| 608 | 3300005437 | Ga0070710_10004766 | Ga0070710_100047668 | 142 |
| 609 | 3300005439 | Ga0070711_100062200 | Ga0070711_1000622001 | 142 |
| 610 | 3300005439 | Ga0070711_100502680 | Ga0070711_1005026801 | 142 |
| 611 | 3300005441 | Ga0070700_100070735 | Ga0070700_1000707353 | 142 |
| 612 | 3300005455 | Ga0070663_100020052 | Ga0070663_1000200526 | 142 |
| 613 | 3300005455 | Ga0070663_100056176 | Ga0070663_1000561762 | 142 |
| 614 | 3300005455 | Ga0070663_100106058 | Ga0070663_1001060582 | 142 |
| 615 | 3300005455 | Ga0070663_100129247 | Ga0070663_1001292471 | 142 |
| 616 | 3300005455 | Ga0070663_100436681 | Ga0070663_1004366811 | 142 |
| 617 | 3300005456 | Ga0070678_100003659 | Ga0070678_1000036596 | 142 |
| 618 | 3300005456 | Ga0070678_100118900 | Ga0070678_1001189002 | 142 |
| 619 | 3300005457 | Ga0070662_100035529 | Ga0070662_1000355295 | 142 |
| 620 | 3300005457 | Ga0070662_100081802 | Ga0070662_1000818022 | 142 |
| 621 | 3300005457 | Ga0070662_100265020 | Ga0070662_1002650201 | 142 |
| 622 | 3300005458 | Ga0070681_10035146 | Ga0070681_100351466 | 142 |
| 623 | 3300005459 | Ga0068867_100783578 | Ga0068867_1007835782 | 142 |
| 624 | 3300005467 | Ga0070706_100263515 | Ga0070706_1002635152 | 142 |
| 625 | 3300005471 | Ga0070698_100040993 | Ga0070698_1000409932 | 142 |
| 626 | 3300005518 | Ga0070699_101286957 | Ga0070699_1012869571 | 142 |
| 627 | 3300005530 | Ga0070679_100021982 | Ga0070679_1000219824 | 142 |
| 628 | 3300005530 | Ga0070679_100077530 | Ga0070679_1000775302 | 142 |
| 629 | 3300005530 | Ga0070679_100397219 | Ga0070679_1003972191 | 142 |
| 630 | 3300005535 | Ga0070684_100076765 | Ga0070684_1000767653 | 142 |
| 631 | 3300005536 | Ga0070697_101063056 | Ga0070697_1010630561 | 142 |
| 632 | 3300005539 | Ga0068853_100005334 | Ga0068853_1000053348 | 142 |
| 633 | 3300005539 | Ga0068853_100040711 | Ga0068853_1000407114 | 142 |
| 634 | 3300005539 | Ga0068853_100062602 | Ga0068853_1000626022 | 142 |
| 635 | 3300005544 | Ga0070686_100502978 | Ga0070686_1005029781 | 142 |
| 636 | 3300005545 | Ga0070695_100399860 | Ga0070695_1003998602 | 142 |
| 637 | 3300005545 | Ga0070695_100538480 | Ga0070695_1005384802 | 142 |
| 638 | 3300005546 | Ga0070696_100391104 | Ga0070696_1003911042 | 142 |
| 639 | 3300005547 | Ga0070693_100067081 | Ga0070693_1000670813 | 142 |
| 640 | 3300005548 | Ga0070665_100018669 | Ga0070665_1000186693 | 142 |
| 641 | 3300005548 | Ga0070665_100044315 | Ga0070665_1000443156 | 142 |
| 642 | 3300005548 | Ga0070665_100110097 | Ga0070665_1001100972 | 142 |
| 643 | 3300005548 | Ga0070665_100140384 | Ga0070665_1001403842 | 142 |
| 644 | 3300005548 | Ga0070665_100900290 | Ga0070665_1009002902 | 142 |
| 645 | 3300005548 | Ga0070665_101273400 | Ga0070665_1012734002 | 142 |
| 646 | 3300005563 | Ga0068855_100038159 | Ga0068855_1000381592 | 142 |
| 647 | 3300005563 | Ga0068855_100052372 | Ga0068855_1000523722 | 142 |
| 648 | 3300005563 | Ga0068855_100218469 | Ga0068855_1002184692 | 142 |
| 649 | 3300005563 | Ga0068855_100344202 | Ga0068855_1003442022 | 142 |
| 650 | 3300005563 | Ga0068855_101721918 | Ga0068855_1017219181 | 142 |
| 651 | 3300005564 | Ga0070664_100227468 | Ga0070664_1002274682 | 142 |
| 652 | 3300005577 | Ga0068857_100078149 | Ga0068857_1000781491 | 142 |
| 653 | 3300005577 | Ga0068857_100265457 | Ga0068857_1002654572 | 142 |
| 654 | 3300005578 | Ga0068854_100076313 | Ga0068854_1000763133 | 142 |
| 655 | 3300005578 | Ga0068854_100126538 | Ga0068854_1001265383 | 142 |
| 656 | 3300005578 | Ga0068854_100287511 | Ga0068854_1002875112 | 142 |
| 657 | 3300005578 | Ga0068854_100546618 | Ga0068854_1005466182 | 142 |
| 658 | 3300005614 | Ga0068856_100036723 | Ga0068856_1000367232 | 142 |
| 659 | 3300005614 | Ga0068856_100068097 | Ga0068856_1000680973 | 142 |
| 660 | 3300005614 | Ga0068856_100071781 | Ga0068856_1000717812 | 142 |
| 661 | 3300005614 | Ga0068856_100404857 | Ga0068856_1004048572 | 142 |
| 662 | 3300005615 | Ga0070702_100274298 | Ga0070702_1002742982 | 142 |
| 663 | 3300005615 | Ga0070702_100364868 | Ga0070702_1003648682 | 142 |
| 664 | 3300005615 | Ga0070702_100800800 | Ga0070702_1008008001 | 142 |
| 665 | 3300005616 | Ga0068852_100004762 | Ga0068852_1000047623 | 142 |
| 666 | 3300005616 | Ga0068852_100127746 | Ga0068852_1001277463 | 142 |
| 667 | 3300005617 | Ga0068859_100195058 | Ga0068859_1001950582 | 142 |
| 668 | 3300005617 | Ga0068859_100233047 | Ga0068859_1002330471 | 142 |
| 669 | 3300005618 | Ga0068864_102264950 | Ga0068864_1022649501 | 142 |
| 670 | 3300005718 | Ga0068866_10041298 | Ga0068866_100412983 | 142 |
| 671 | 3300005718 | Ga0068866_10785214 | Ga0068866_107852141 | 142 |
| 672 | 3300005718 | Ga0068866_10885531 | Ga0068866_108855311 | 142 |
| 673 | 3300005718 | Ga0068866_10960974 | Ga0068866_109609741 | 142 |
| 674 | 3300005719 | Ga0068861_100250689 | Ga0068861_1002506892 | 142 |
| 675 | 3300005719 | Ga0068861_100528020 | Ga0068861_1005280202 | 142 |
| 676 | 3300005719 | Ga0068861_100627970 | Ga0068861_1006279702 | 142 |
| 677 | 3300005719 | Ga0068861_101286184 | Ga0068861_1012861841 | 142 |
| 678 | 3300005719 | Ga0068861_101539450 | Ga0068861_1015394501 | 142 |
| 679 | 3300005834 | Ga0068851_10000835 | Ga0068851_100008359 | 142 |
| 680 | 3300005834 | Ga0068851_10006013 | Ga0068851_100060133 | 142 |
| 681 | 3300005834 | Ga0068851_10142660 | Ga0068851_101426602 | 142 |
| 682 | 3300005834 | Ga0068851_10158191 | Ga0068851_101581912 | 142 |
| 683 | 3300005834 | Ga0068851_10243997 | Ga0068851_102439972 | 142 |
| 684 | 3300005840 | Ga0068870_10103942 | Ga0068870_101039422 | 142 |
| 685 | 3300005841 | Ga0068863_100188289 | Ga0068863_1001882892 | 142 |
| 686 | 3300005841 | Ga0068863_100731594 | Ga0068863_1007315942 | 142 |
| 687 | 3300005842 | Ga0068858_100408049 | Ga0068858_1004080492 | 142 |
| 688 | 3300005842 | Ga0068858_100604751 | Ga0068858_1006047512 | 142 |
| 689 | 3300005842 | Ga0068858_101185446 | Ga0068858_1011854461 | 142 |
| 690 | 3300005843 | Ga0068860_100200283 | Ga0068860_1002002833 | 142 |
| 691 | 3300005843 | Ga0068860_100359876 | Ga0068860_1003598762 | 142 |
| 692 | 3300005843 | Ga0068860_101377247 | Ga0068860_1013772472 | 142 |
| 693 | 3300005844 | Ga0068862_100141665 | Ga0068862_1001416653 | 142 |
| 694 | 3300005844 | Ga0068862_100215223 | Ga0068862_1002152232 | 142 |
| 695 | 3300005844 | Ga0068862_100867533 | Ga0068862_1008675332 | 142 |
| 696 | 3300005937 | Ga0081455_10013697 | Ga0081455_100136977 | 142 |
| 697 | 3300005983 | Ga0081540_1003440 | Ga0081540_100344012 | 142 |
| 698 | 3300005983 | Ga0081540_1011448 | Ga0081540_10114482 | 142 |
| 699 | 3300005983 | Ga0081540_1031530 | Ga0081540_10315303 | 142 |
| 700 | 3300005983 | Ga0081540_1143122 | Ga0081540_11431222 | 142 |
| 701 | 3300005983 | Ga0081540_1179174 | Ga0081540_11791741 | 142 |
| 702 | 3300006028 | Ga0070717_10002312 | Ga0070717_100023123 | 142 |
| 703 | 3300006028 | Ga0070717_10658516 | Ga0070717_106585162 | 142 |
| 704 | 3300006038 | Ga0075365_10125646 | Ga0075365_101256462 | 142 |
| 705 | 3300006038 | Ga0075365_10178904 | Ga0075365_101789042 | 142 |
| 706 | 3300006042 | Ga0075368_10135596 | Ga0075368_101355962 | 142 |
| 707 | 3300006042 | Ga0075368_10184296 | Ga0075368_101842962 | 142 |
| 708 | 3300006042 | Ga0075368_10534277 | Ga0075368_105342771 | 142 |
| 709 | 3300006048 | Ga0075363_100257702 | Ga0075363_1002577022 | 142 |
| 710 | 3300006048 | Ga0075363_100277714 | Ga0075363_1002777142 | 142 |
| 711 | 3300006163 | Ga0070715_10000192 | Ga0070715_100001923 | 142 |
| 712 | 3300006163 | Ga0070715_10174292 | Ga0070715_101742922 | 142 |
| 713 | 3300006163 | Ga0070715_10346336 | Ga0070715_103463362 | 142 |
| 714 | 3300006173 | Ga0070716_100063087 | Ga0070716_1000630871 | 142 |
| 715 | 3300006175 | Ga0070712_100004044 | Ga0070712_1000040447 | 142 |
| 716 | 3300006175 | Ga0070712_100008540 | Ga0070712_1000085401 | 142 |
| 717 | 3300006177 | Ga0075362_10276076 | Ga0075362_102760762 | 142 |
| 718 | 3300006178 | Ga0075367_10210784 | Ga0075367_102107842 | 142 |
| 719 | 3300006178 | Ga0075367_10264219 | Ga0075367_102642192 | 142 |
| 720 | 3300006178 | Ga0075367_10401998 | Ga0075367_104019982 | 142 |
| 721 | 3300006186 | Ga0075369_10155208 | Ga0075369_101552082 | 142 |
| 722 | 3300006186 | Ga0075369_10404673 | Ga0075369_104046732 | 142 |
| 723 | 3300006195 | Ga0075366_10310403 | Ga0075366_103104031 | 142 |
| 724 | 3300006195 | Ga0075366_10443540 | Ga0075366_104435402 | 142 |
| 725 | 3300006237 | Ga0097621_100045438 | Ga0097621_1000454381 | 142 |
| 726 | 3300006237 | Ga0097621_100336554 | Ga0097621_1003365542 | 142 |
| 727 | 3300006353 | Ga0075370_10591939 | Ga0075370_105919391 | 142 |
| 728 | 3300006358 | Ga0068871_100278163 | Ga0068871_1002781632 | 142 |
| 729 | 3300006358 | Ga0068871_100372732 | Ga0068871_1003727322 | 142 |
| 730 | 3300006852 | Ga0075433_10937407 | Ga0075433_109374071 | 142 |
| 731 | 3300006881 | Ga0068865_100116722 | Ga0068865_1001167222 | 142 |
| 732 | 3300006881 | Ga0068865_100212981 | Ga0068865_1002129812 | 142 |
| 733 | 3300006931 | Ga0097620_100195051 | Ga0097620_1001950512 | 142 |
| 734 | 3300006931 | Ga0097620_100233036 | Ga0097620_1002330361 | 142 |
| 735 | 3300006942 | Ga0099824_1004186 | Ga0099824_100418616 | 142 |
| 736 | 3300006943 | Ga0099822_1006118 | Ga0099822_100611814 | 142 |
| 737 | 3300007265 | Ga0099794_10342109 | Ga0099794_103421092 | 142 |
| 738 | 3300007788 | Ga0099795_10001203 | Ga0099795_100012038 | 142 |
| 739 | 3300007788 | Ga0099795_10031793 | Ga0099795_100317932 | 142 |
| 740 | 3300007788 | Ga0099795_10052099 | Ga0099795_100520992 | 142 |
| 741 | 3300007788 | Ga0099795_10411000 | Ga0099795_104110001 | 142 |
| 742 | 3300009092 | Ga0105250_10077524 | Ga0105250_100775242 | 142 |
| 743 | 3300009093 | Ga0105240_10044376 | Ga0105240_100443762 | 142 |
| 744 | 3300009093 | Ga0105240_10065642 | Ga0105240_100656425 | 142 |
| 745 | 3300009093 | Ga0105240_10078471 | Ga0105240_100784715 | 142 |
| 746 | 3300009093 | Ga0105240_10348106 | Ga0105240_103481061 | 142 |
| 747 | 3300009093 | Ga0105240_10874452 | Ga0105240_108744522 | 142 |
| 748 | 3300009098 | Ga0105245_10026228 | Ga0105245_100262283 | 142 |
| 749 | 3300009098 | Ga0105245_10027787 | Ga0105245_100277876 | 142 |
| 750 | 3300009098 | Ga0105245_10968357 | Ga0105245_109683572 | 142 |
| 751 | 3300009098 | Ga0105245_11474897 | Ga0105245_114748971 | 142 |
| 752 | 3300009101 | Ga0105247_10168177 | Ga0105247_101681772 | 142 |
| 753 | 3300009174 | Ga0105241_10073753 | Ga0105241_100737532 | 142 |
| 754 | 3300009174 | Ga0105241_10768650 | Ga0105241_107686501 | 142 |
| 755 | 3300009176 | Ga0105242_10088880 | Ga0105242_100888803 | 142 |
| 756 | 3300009176 | Ga0105242_10396170 | Ga0105242_103961702 | 142 |
| 757 | 3300009177 | Ga0105248_10135116 | Ga0105248_101351163 | 142 |
| 758 | 3300009177 | Ga0105248_10666508 | Ga0105248_106665082 | 142 |
| 759 | 3300009177 | Ga0105248_11025023 | Ga0105248_110250232 | 142 |
| 760 | 3300009545 | Ga0105237_10007135 | Ga0105237_100071353 | 142 |
| 761 | 3300009545 | Ga0105237_10042680 | Ga0105237_100426805 | 142 |
| 762 | 3300009545 | Ga0105237_10150862 | Ga0105237_101508624 | 142 |
| 763 | 3300009545 | Ga0105237_10191711 | Ga0105237_101917112 | 142 |
| 764 | 3300009545 | Ga0105237_10310707 | Ga0105237_103107071 | 142 |
| 765 | 3300009551 | Ga0105238_10008586 | Ga0105238_1000858611 | 142 |
| 766 | 3300009551 | Ga0105238_10021503 | Ga0105238_100215034 | 142 |
| 767 | 3300009551 | Ga0105238_10025858 | Ga0105238_100258582 | 142 |
| 768 | 3300009551 | Ga0105238_10173743 | Ga0105238_101737433 | 142 |
| 769 | 3300009551 | Ga0105238_10516787 | Ga0105238_105167872 | 142 |
| 770 | 3300009553 | Ga0105249_10295127 | Ga0105249_102951273 | 142 |
| 771 | 3300010159 | Ga0099796_10021942 | Ga0099796_100219422 | 142 |
| 772 | 3300010159 | Ga0099796_10022456 | Ga0099796_100224561 | 142 |
| 773 | 3300010375 | Ga0105239_10008381 | Ga0105239_1000838111 | 142 |
| 774 | 3300010375 | Ga0105239_10040184 | Ga0105239_100401842 | 142 |
| 775 | 3300010375 | Ga0105239_10085316 | Ga0105239_100853162 | 142 |
| 776 | 3300010375 | Ga0105239_10124685 | Ga0105239_101246853 | 142 |
| 777 | 3300010375 | Ga0105239_10617559 | Ga0105239_106175592 | 142 |
| 778 | 3300010375 | Ga0105239_10758819 | Ga0105239_107588192 | 142 |
| 779 | 3300013104 | Ga0157370_10034059 | Ga0157370_100340592 | 142 |
| 780 | 3300013105 | Ga0157369_10069789 | Ga0157369_100697892 | 142 |
| 781 | 3300013105 | Ga0157369_10387188 | Ga0157369_103871881 | 142 |
| 782 | 3300013105 | Ga0157369_11551367 | Ga0157369_115513671 | 142 |
| 783 | 3300013296 | Ga0157374_10003326 | Ga0157374_100033267 | 142 |
| 784 | 3300013296 | Ga0157374_10989339 | Ga0157374_109893392 | 142 |
| 785 | 3300013297 | Ga0157378_10178253 | Ga0157378_101782532 | 142 |
| 786 | 3300013306 | Ga0163162_10026850 | Ga0163162_100268504 | 142 |
| 787 | 3300013306 | Ga0163162_10367028 | Ga0163162_103670282 | 142 |
| 788 | 3300013306 | Ga0163162_10410342 | Ga0163162_104103422 | 142 |
| 789 | 3300013306 | Ga0163162_10670628 | Ga0163162_106706282 | 142 |
| 790 | 3300013307 | Ga0157372_10329977 | Ga0157372_103299773 | 142 |
| 791 | 3300013308 | Ga0157375_10298571 | Ga0157375_102985712 | 142 |
| 792 | 3300013308 | Ga0157375_10789035 | Ga0157375_107890352 | 142 |
| 793 | 3300014325 | Ga0163163_10007553 | Ga0163163_100075537 | 142 |
| 794 | 3300014325 | Ga0163163_10399369 | Ga0163163_103993693 | 142 |
| 795 | 3300014325 | Ga0163163_10424397 | Ga0163163_104243972 | 142 |
| 796 | 3300014325 | Ga0163163_10693921 | Ga0163163_106939212 | 142 |
| 797 | 3300014326 | Ga0157380_10475671 | Ga0157380_104756712 | 142 |
| 798 | 3300014968 | Ga0157379_10245584 | Ga0157379_102455843 | 142 |
| 799 | 3300014968 | Ga0157379_11818768 | Ga0157379_118187681 | 142 |
| 800 | 3300014969 | Ga0157376_10017469 | Ga0157376_100174696 | 142 |
| 801 | 3300014969 | Ga0157376_10591912 | Ga0157376_105919122 | 142 |
| 802 | 3300014969 | Ga0157376_11412126 | Ga0157376_114121262 | 142 |
| 803 | 3300017792 | Ga0163161_10369875 | Ga0163161_103698752 | 142 |
| 804 | 3300017792 | Ga0163161_11204541 | Ga0163161_112045411 | 142 |
| 805 | 3300019183 | Ga0184601_109990 | Ga0184601_1099901 | 142 |
| 806 | 3300020070 | Ga0206356_10091318 | Ga0206356_100913182 | 142 |
| 807 | 3300020081 | Ga0206354_10938124 | Ga0206354_109381242 | 142 |
| 808 | 3300020082 | Ga0206353_12039802 | Ga0206353_120398022 | 142 |
| 809 | 3300021361 | Ga0213872_10120974 | Ga0213872_101209742 | 142 |
| 810 | 3300021377 | Ga0213874_10106109 | Ga0213874_101061091 | 142 |
| 811 | 3300025297 | Ga0209758_1003142 | Ga0209758_100314211 | 142 |
| 812 | 3300025315 | Ga0207697_10065228 | Ga0207697_100652282 | 142 |
| 813 | 3300025321 | Ga0207656_10001089 | Ga0207656_100010899 | 142 |
| 814 | 3300025321 | Ga0207656_10006242 | Ga0207656_100062423 | 142 |
| 815 | 3300025321 | Ga0207656_10286944 | Ga0207656_102869441 | 142 |
| 816 | 3300025898 | Ga0207692_10000798 | Ga0207692_100007987 | 142 |
| 817 | 3300025898 | Ga0207692_10001866 | Ga0207692_100018664 | 142 |
| 818 | 3300025899 | Ga0207642_10031389 | Ga0207642_100313892 | 142 |
| 819 | 3300025899 | Ga0207642_10057482 | Ga0207642_100574822 | 142 |
| 820 | 3300025901 | Ga0207688_10030058 | Ga0207688_100300585 | 142 |
| 821 | 3300025904 | Ga0207647_10003452 | Ga0207647_1000345212 | 142 |
| 822 | 3300025905 | Ga0207685_10017711 | Ga0207685_100177114 | 142 |
| 823 | 3300025905 | Ga0207685_10365411 | Ga0207685_103654112 | 142 |
| 824 | 3300025906 | Ga0207699_10001678 | Ga0207699_100016782 | 142 |
| 825 | 3300025906 | Ga0207699_10028617 | Ga0207699_100286172 | 142 |
| 826 | 3300025907 | Ga0207645_10415238 | Ga0207645_104152382 | 142 |
| 827 | 3300025908 | Ga0207643_10113617 | Ga0207643_101136172 | 142 |
| 828 | 3300025910 | Ga0207684_10441852 | Ga0207684_104418522 | 142 |
| 829 | 3300025910 | Ga0207684_10553006 | Ga0207684_105530062 | 142 |
| 830 | 3300025911 | Ga0207654_10001074 | Ga0207654_1000107410 | 142 |
| 831 | 3300025911 | Ga0207654_10462097 | Ga0207654_104620971 | 142 |
| 832 | 3300025912 | Ga0207707_10002655 | Ga0207707_100026557 | 142 |
| 833 | 3300025913 | Ga0207695_10135688 | Ga0207695_101356882 | 142 |
| 834 | 3300025914 | Ga0207671_10177765 | Ga0207671_101777652 | 142 |
| 835 | 3300025914 | Ga0207671_10372967 | Ga0207671_103729672 | 142 |
| 836 | 3300025914 | Ga0207671_10524648 | Ga0207671_105246481 | 142 |
| 837 | 3300025914 | Ga0207671_11182731 | Ga0207671_111827311 | 142 |
| 838 | 3300025915 | Ga0207693_10001679 | Ga0207693_1000167913 | 142 |
| 839 | 3300025915 | Ga0207693_10105122 | Ga0207693_101051223 | 142 |
| 840 | 3300025916 | Ga0207663_10000672 | Ga0207663_100006728 | 142 |
| 841 | 3300025916 | Ga0207663_10590031 | Ga0207663_105900312 | 142 |
| 842 | 3300025916 | Ga0207663_10602854 | Ga0207663_106028542 | 142 |
| 843 | 3300025917 | Ga0207660_10028715 | Ga0207660_100287154 | 142 |
| 844 | 3300025917 | Ga0207660_10041034 | Ga0207660_100410344 | 142 |
| 845 | 3300025917 | Ga0207660_10130755 | Ga0207660_101307552 | 142 |
| 846 | 3300025919 | Ga0207657_10004801 | Ga0207657_100048019 | 142 |
| 847 | 3300025919 | Ga0207657_10967270 | Ga0207657_109672701 | 142 |
| 848 | 3300025920 | Ga0207649_10129301 | Ga0207649_101293012 | 142 |
| 849 | 3300025920 | Ga0207649_10400411 | Ga0207649_104004111 | 142 |
| 850 | 3300025921 | Ga0207652_10002660 | Ga0207652_100026609 | 142 |
| 851 | 3300025924 | Ga0207694_10000271 | Ga0207694_100002711 | 142 |
| 852 | 3300025924 | Ga0207694_10021788 | Ga0207694_100217887 | 142 |
| 853 | 3300025924 | Ga0207694_10126639 | Ga0207694_101266392 | 142 |
| 854 | 3300025927 | Ga0207687_10023036 | Ga0207687_100230363 | 142 |
| 855 | 3300025927 | Ga0207687_10852633 | Ga0207687_108526332 | 142 |
| 856 | 3300025927 | Ga0207687_11691001 | Ga0207687_116910011 | 142 |
| 857 | 3300025928 | Ga0207700_10005119 | Ga0207700_100051197 | 142 |
| 858 | 3300025929 | Ga0207664_10012380 | Ga0207664_100123806 | 142 |
| 859 | 3300025929 | Ga0207664_10815116 | Ga0207664_108151161 | 142 |
| 860 | 3300025931 | Ga0207644_10464988 | Ga0207644_104649881 | 142 |
| 861 | 3300025931 | Ga0207644_10473889 | Ga0207644_104738892 | 142 |
| 862 | 3300025932 | Ga0207690_10179248 | Ga0207690_101792482 | 142 |
| 863 | 3300025932 | Ga0207690_10199483 | Ga0207690_101994832 | 142 |
| 864 | 3300025932 | Ga0207690_11369522 | Ga0207690_113695221 | 142 |
| 865 | 3300025933 | Ga0207706_10055641 | Ga0207706_100556413 | 142 |
| 866 | 3300025933 | Ga0207706_10093304 | Ga0207706_100933042 | 142 |
| 867 | 3300025933 | Ga0207706_10576871 | Ga0207706_105768712 | 142 |
| 868 | 3300025933 | Ga0207706_10727540 | Ga0207706_107275401 | 142 |
| 869 | 3300025934 | Ga0207686_10041734 | Ga0207686_100417342 | 142 |
| 870 | 3300025934 | Ga0207686_10299322 | Ga0207686_102993222 | 142 |
| 871 | 3300025935 | Ga0207709_10453503 | Ga0207709_104535031 | 142 |
| 872 | 3300025935 | Ga0207709_10942025 | Ga0207709_109420252 | 142 |
| 873 | 3300025937 | Ga0207669_10312440 | Ga0207669_103124402 | 142 |
| 874 | 3300025937 | Ga0207669_10353849 | Ga0207669_103538492 | 142 |
| 875 | 3300025938 | Ga0207704_10162045 | Ga0207704_101620452 | 142 |
| 876 | 3300025939 | Ga0207665_10000700 | Ga0207665_1000070025 | 142 |
| 877 | 3300025939 | Ga0207665_10078292 | Ga0207665_100782921 | 142 |
| 878 | 3300025939 | Ga0207665_10119560 | Ga0207665_101195602 | 142 |
| 879 | 3300025941 | Ga0207711_10780215 | Ga0207711_107802152 | 142 |
| 880 | 3300025942 | Ga0207689_10080252 | Ga0207689_100802523 | 142 |
| 881 | 3300025942 | Ga0207689_10190000 | Ga0207689_101900003 | 142 |
| 882 | 3300025942 | Ga0207689_10284579 | Ga0207689_102845792 | 142 |
| 883 | 3300025942 | Ga0207689_10483259 | Ga0207689_104832592 | 142 |
| 884 | 3300025944 | Ga0207661_10481903 | Ga0207661_104819032 | 142 |
| 885 | 3300025945 | Ga0207679_10797422 | Ga0207679_107974222 | 142 |
| 886 | 3300025949 | Ga0207667_10003903 | Ga0207667_1000390311 | 142 |
| 887 | 3300025949 | Ga0207667_10005344 | Ga0207667_100053446 | 142 |
| 888 | 3300025949 | Ga0207667_10047821 | Ga0207667_100478216 | 142 |
| 889 | 3300025949 | Ga0207667_10348616 | Ga0207667_103486161 | 142 |
| 890 | 3300025972 | Ga0207668_10249957 | Ga0207668_102499572 | 142 |
| 891 | 3300025972 | Ga0207668_10484392 | Ga0207668_104843922 | 142 |
| 892 | 3300025972 | Ga0207668_10560910 | Ga0207668_105609102 | 142 |
| 893 | 3300025981 | Ga0207640_10007468 | Ga0207640_100074685 | 142 |
| 894 | 3300025981 | Ga0207640_10105171 | Ga0207640_101051712 | 142 |
| 895 | 3300025981 | Ga0207640_10289366 | Ga0207640_102893662 | 142 |
| 896 | 3300025986 | Ga0207658_10311950 | Ga0207658_103119502 | 142 |
| 897 | 3300025986 | Ga0207658_10484966 | Ga0207658_104849662 | 142 |
| 898 | 3300026023 | Ga0207677_10011044 | Ga0207677_100110446 | 142 |
| 899 | 3300026023 | Ga0207677_10420316 | Ga0207677_104203162 | 142 |
| 900 | 3300026035 | Ga0207703_10075453 | Ga0207703_100754531 | 142 |
| 901 | 3300026035 | Ga0207703_10683214 | Ga0207703_106832142 | 142 |
| 902 | 3300026041 | Ga0207639_10172869 | Ga0207639_101728693 | 142 |
| 903 | 3300026041 | Ga0207639_10275687 | Ga0207639_102756872 | 142 |
| 904 | 3300026041 | Ga0207639_10295835 | Ga0207639_102958352 | 142 |
| 905 | 3300026041 | Ga0207639_11217495 | Ga0207639_112174952 | 142 |
| 906 | 3300026067 | Ga0207678_10010552 | Ga0207678_100105526 | 142 |
| 907 | 3300026067 | Ga0207678_10073165 | Ga0207678_100731652 | 142 |
| 908 | 3300026067 | Ga0207678_10089069 | Ga0207678_100890693 | 142 |
| 909 | 3300026067 | Ga0207678_10234738 | Ga0207678_102347382 | 142 |
| 910 | 3300026067 | Ga0207678_11296226 | Ga0207678_112962261 | 142 |
| 911 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005253 | 142 |
| 912 | 3300026078 | Ga0207702_10239096 | Ga0207702_102390962 | 142 |
| 913 | 3300026078 | Ga0207702_10249513 | Ga0207702_102495132 | 142 |
| 914 | 3300026088 | Ga0207641_10176651 | Ga0207641_101766512 | 142 |
| 915 | 3300026088 | Ga0207641_10848347 | Ga0207641_108483472 | 142 |
| 916 | 3300026088 | Ga0207641_11796530 | Ga0207641_117965301 | 142 |
| 917 | 3300026089 | Ga0207648_10884066 | Ga0207648_108840662 | 142 |
| 918 | 3300026095 | Ga0207676_10604521 | Ga0207676_106045211 | 142 |
| 919 | 3300026116 | Ga0207674_10007442 | Ga0207674_100074425 | 142 |
| 920 | 3300026116 | Ga0207674_10024446 | Ga0207674_100244463 | 142 |
| 921 | 3300026118 | Ga0207675_100628200 | Ga0207675_1006282002 | 142 |
| 922 | 3300026118 | Ga0207675_100632621 | Ga0207675_1006326212 | 142 |
| 923 | 3300026118 | Ga0207675_101396566 | Ga0207675_1013965661 | 142 |
| 924 | 3300026118 | Ga0207675_101426250 | Ga0207675_1014262501 | 142 |
| 925 | 3300026121 | Ga0207683_10027486 | Ga0207683_100274862 | 142 |
| 926 | 3300026121 | Ga0207683_10032383 | Ga0207683_100323832 | 142 |
| 927 | 3300026121 | Ga0207683_11210045 | Ga0207683_112100452 | 142 |
| 928 | 3300026142 | Ga0207698_10065686 | Ga0207698_100656863 | 142 |
| 929 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009156 | 142 |
| 930 | 3300027361 | Ga0209489_100010 | Ga0209489_100010114 | 142 |
| 931 | 3300027363 | Ga0209700_100017 | Ga0209700_100017114 | 142 |
| 932 | 3300028379 | Ga0268266_10016992 | Ga0268266_100169922 | 142 |
| 933 | 3300028379 | Ga0268266_10019219 | Ga0268266_100192192 | 142 |
| 934 | 3300028379 | Ga0268266_10093175 | Ga0268266_100931753 | 142 |
| 935 | 3300028379 | Ga0268266_10335405 | Ga0268266_103354052 | 142 |
| 936 | 3300028379 | Ga0268266_10353387 | Ga0268266_103533872 | 142 |
| 937 | 3300028379 | Ga0268266_10416169 | Ga0268266_104161692 | 142 |
| 938 | 3300028379 | Ga0268266_10907006 | Ga0268266_109070062 | 142 |
| 939 | 3300028379 | Ga0268266_11258179 | Ga0268266_112581792 | 142 |
| 940 | 3300028379 | Ga0268266_12108609 | Ga0268266_121086091 | 142 |
| 941 | 3300028380 | Ga0268265_10080305 | Ga0268265_100803053 | 142 |
| 942 | 3300028380 | Ga0268265_10240729 | Ga0268265_102407292 | 142 |
| 943 | 3300028380 | Ga0268265_10368469 | Ga0268265_103684692 | 142 |
| 944 | 3300028380 | Ga0268265_11718478 | Ga0268265_117184781 | 142 |
| 945 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035277 | 142 |
| 946 | 3300028381 | Ga0268264_10211912 | Ga0268264_102119122 | 142 |
| 947 | 3300028381 | Ga0268264_10346086 | Ga0268264_103460862 | 142 |
| 948 | 3300028381 | Ga0268264_11024525 | Ga0268264_110245251 | 142 |
| 949 | 3300028381 | Ga0268264_12374707 | Ga0268264_123747072 | 142 |
| 950 | 3300028794 | Ga0307515_10141133 | Ga0307515_101411332 | 142 |
| 951 | 3300028794 | Ga0307515_10855676 | Ga0307515_108556761 | 142 |
| 952 | 3300030522 | Ga0307512_10296696 | Ga0307512_102966962 | 142 |
| 953 | 3300031235 | Ga0265330_10115115 | Ga0265330_101151152 | 142 |
| 954 | 3300031238 | Ga0265332_10012628 | Ga0265332_100126283 | 142 |
| 955 | 3300031238 | Ga0265332_10029389 | Ga0265332_100293892 | 142 |
| 956 | 3300031239 | Ga0265328_10136833 | Ga0265328_101368332 | 142 |
| 957 | 3300031241 | Ga0265325_10001459 | Ga0265325_1000145916 | 142 |
| 958 | 3300031249 | Ga0265339_10116551 | Ga0265339_101165512 | 142 |
| 959 | 3300031249 | Ga0265339_10125533 | Ga0265339_101255331 | 142 |
| 960 | 3300031250 | Ga0265331_10012884 | Ga0265331_100128844 | 142 |
| 961 | 3300031250 | Ga0265331_10067340 | Ga0265331_100673402 | 142 |
| 962 | 3300031344 | Ga0265316_10024414 | Ga0265316_100244147 | 142 |
| 963 | 3300031344 | Ga0265316_10116509 | Ga0265316_101165092 | 142 |
| 964 | 3300031344 | Ga0265316_10513478 | Ga0265316_105134782 | 142 |
| 965 | 3300031456 | Ga0307513_10710277 | Ga0307513_107102771 | 142 |
| 966 | 3300031507 | Ga0307509_10043479 | Ga0307509_100434794 | 142 |
| 967 | 3300031507 | Ga0307509_10111569 | Ga0307509_101115693 | 142 |
| 968 | 3300031548 | Ga0307408_100297283 | Ga0307408_1002972832 | 142 |
| 969 | 3300031548 | Ga0307408_100478711 | Ga0307408_1004787112 | 142 |
| 970 | 3300031595 | Ga0265313_10053430 | Ga0265313_100534303 | 142 |
| 971 | 3300031616 | Ga0307508_10433683 | Ga0307508_104336832 | 142 |
| 972 | 3300031616 | Ga0307508_10470827 | Ga0307508_104708272 | 142 |
| 973 | 3300031616 | Ga0307508_10474521 | Ga0307508_104745212 | 142 |
| 974 | 3300031711 | Ga0265314_10002371 | Ga0265314_1000237111 | 142 |
| 975 | 3300031712 | Ga0265342_10046188 | Ga0265342_100461881 | 142 |
| 976 | 3300031712 | Ga0265342_10255286 | Ga0265342_102552861 | 142 |
| 977 | 3300031730 | Ga0307516_10009732 | Ga0307516_1000973210 | 142 |
| 978 | 3300031730 | Ga0307516_10149556 | Ga0307516_101495563 | 142 |
| 979 | 3300031730 | Ga0307516_10244301 | Ga0307516_102443012 | 142 |
| 980 | 3300031903 | Ga0307407_10272742 | Ga0307407_102727422 | 142 |
| 981 | 3300031911 | Ga0307412_10245600 | Ga0307412_102456002 | 142 |
| 982 | 3300031995 | Ga0307409_100422445 | Ga0307409_1004224452 | 142 |
| 983 | 3300033179 | Ga0307507_10086856 | Ga0307507_100868563 | 142 |
| 984 | 3300033180 | Ga0307510_10009746 | Ga0307510_1000974612 | 142 |
| 985 | 3300033180 | Ga0307510_10048002 | Ga0307510_100480025 | 142 |
| 986 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009288 | 142 |
| 987 | 3300033544 | Ga0316215_1006418 | Ga0316215_10064182 | 142 |
| 988 | 3300034816 | Ga0373930_0069732 | Ga0373930_0069732_152_580 | 142 |
| 989 | 3300035084 | Ga0373928_0222476 | Ga0373928_0222476_17_469 | 142 |
| 990 | 3300035086 | Ga0373934_0015478 | Ga0373934_0015478_1327_1770 | 142 |
| 991 | 3300035086 | Ga0373934_0160854 | Ga0373934_0160854_45_473 | 142 |
| 992 | 3300035088 | Ga0373940_0012311 | Ga0373940_0012311_561_989 | 142 |
| 993 | 3300035090 | Ga0373949_0091805 | Ga0373949_0091805_18_446 | 142 |
| 994 | 3300035092 | Ga0373952_0008165 | Ga0373952_0008165_1270_1698 | 142 |
| 995 | 3300035092 | Ga0373952_0073418 | Ga0373952_0073418_204_632 | 142 |
| 996 | 3300035111 | Ga0373923_0051235 | Ga0373923_0051235_645_1088 | 142 |
| 997 | 3300035113 | Ga0373936_0089725 | Ga0373936_0089725_407_835 | 142 |
| 998 | 3300035117 | Ga0373953_0002753 | Ga0373953_0002753_2612_3055 | 142 |
| 999 | 3300035117 | Ga0373953_0366716 | Ga0373953_0366716_21_449 | 142 |
| 1000 | 3300035118 | Ga0373954_0046329 | Ga0373954_0046329_484_927 | 142 |
| 1001 | 3300035118 | Ga0373954_0089602 | Ga0373954_0089602_821_1249 | 142 |
| 1002 | 3300035119 | Ga0373956_0001884 | Ga0373956_0001884_5558_6001 | 142 |
| 1003 | 3300035120 | Ga0373957_0000200 | Ga0373957_0000200_594_1037 | 142 |
| 1004 | 3300035120 | Ga0373957_0529496 | Ga0373957_0529496_11_439 | 142 |
| 1005 | 3300035170 | Ga0373943_0150435 | Ga0373943_0150435_444_872 | 142 |
| 1006 | 3300035170 | Ga0373943_0513366 | Ga0373943_0513366_43_471 | 142 |
| 1007 | 3300035171 | Ga0373946_0124782 | Ga0373946_0124782_566_994 | 142 |
| 1008 | 3300035172 | Ga0373955_0005004 | Ga0373955_0005004_2866_3309 | 142 |
| 1009 | 3300035207 | Ga0373942_0033816 | Ga0373942_0033816_196_624 | 142 |
| 1010 | 3300035242 | Ga0373962_0178067 | Ga0373962_0178067_220_648 | 142 |
| 1011 | 3300035691 | Ga0373931_0004494 | Ga0373931_0004494_4156_4584 | 142 |
| 1012 | 3300035691 | Ga0373931_0216727 | Ga0373931_0216727_59_511 | 142 |
| 1013 | 3300035692 | Ga0373935_0082494 | Ga0373935_0082494_440_868 | 142 |
| 1014 | 3300035692 | Ga0373935_0109527 | Ga0373935_0109527_876_1304 | 142 |
| 1015 | 3300035695 | Ga0373927_0026102 | Ga0373927_0026102_361_789 | 142 |
| 1016 | 3300035695 | Ga0373927_0180331 | Ga0373927_0180331_896_1324 | 142 |
| 1017 | 3300035724 | Ga0373933_0022657 | Ga0373933_0022657_912_1355 | 142 |
| 1018 | 3300035724 | Ga0373933_0773427 | Ga0373933_0773427_28_456 | 142 |
| 1019 | 3300035725 | Ga0373947_0017146 | Ga0373947_0017146_2521_2949 | 142 |
| 1020 | 3300035725 | Ga0373947_0168552 | Ga0373947_0168552_270_698 | 142 |
| 1021 | 3300035725 | Ga0373947_0253866 | Ga0373947_0253866_29_457 | 142 |
| 1022 | 3300035725 | Ga0373947_0464391 | Ga0373947_0464391_285_713 | 142 |
| 1023 | 3300036242 | Ga0310104_03485 | Ga0310104_03485_835_1263 | 142 |
| 1024 | 3300036401 | Ga0373937_0014785 | Ga0373937_0014785_3431_3874 | 142 |
| 1025 | 3300036401 | Ga0373937_0054734 | Ga0373937_0054734_441_869 | 142 |
| 1026 | 3300036401 | Ga0373937_0767649 | Ga0373937_0767649_255_683 | 142 |
| 1027 | 3300036459 | Ga0372808_005034 | Ga0372808_005034_300_728 | 142 |
| 1028 | 3300037068 | Ga0373925_0204767 | Ga0373925_0204767_1030_1458 | 142 |
| 1029 | 3300037068 | Ga0373925_0257427 | Ga0373925_0257427_180_608 | 142 |
| 1030 | 3300037068 | Ga0373925_0328933 | Ga0373925_0328933_269_697 | 142 |
| 1031 | 3300037418 | Ga0395900_0428366 | Ga0395900_0428366_710_1138 | 142 |
| 1032 | 3300037471 | Ga0395905_0053544 | Ga0395905_0053544_2497_2925 | 142 |
| 1033 | 3300038443 | Ga0395901_0116181 | Ga0395901_0116181_1938_2366 | 142 |
| 1034 | 3300039438 | Ga0436360_0062375 | Ga0436360_0062375_390_818 | 142 |
| 1035 | 3300039438 | Ga0436360_0288357 | Ga0436360_0288357_1771_2199 | 142 |
| 1036 | 3300039447 | Ga0436361_1160317 | Ga0436361_1160317_1116_1565 | 142 |
| 1037 | 3300039450 | Ga0436363_0674671 | Ga0436363_0674671_685_1113 | 142 |
| 1038 | 3300039450 | Ga0436363_0928946 | Ga0436363_0928946_174_605 | 142 |
| 1039 | 3300041452 | Ga0451793_0481979 | Ga0451793_0481979_181_609 | 142 |
| 1040 | 3300041452 | Ga0451793_1831426 | Ga0451793_1831426_849_1277 | 142 |
| 1041 | 3300041453 | Ga0451797_0276797 | Ga0451797_0276797_110_538 | 142 |
| 1042 | 3300041456 | Ga0451795_1072685 | Ga0451795_1072685_94_522 | 142 |
| 1043 | 3300041486 | Ga0451807_0740528 | Ga0451807_0740528_131_559 | 142 |
| 1044 | 3300041486 | Ga0451807_2768343 | Ga0451807_2768343_30_458 | 142 |
| 1045 | 3300041492 | Ga0451835_0414532 | Ga0451835_0414532_330_758 | 142 |
| 1046 | 3300041494 | Ga0451837_1123549 | Ga0451837_1123549_750_1178 | 142 |
| 1047 | 3300041503 | Ga0451847_0288977 | Ga0451847_0288977_33_461 | 142 |
| 1048 | 3300041505 | Ga0451849_1171485 | Ga0451849_1171485_38_466 | 142 |
| 1049 | 3300041509 | Ga0451843_0960431 | Ga0451843_0960431_274_702 | 142 |
| 1050 | 3300041512 | Ga0451853_0403605 | Ga0451853_0403605_48_476 | 142 |
| 1051 | 3300042438 | Ga0439459_0022833 | Ga0439459_0022833_504_932 | 142 |
| 1052 | 3300044656 | Ga0466969_0138052 | Ga0466969_0138052_325_756 | 142 |
| 1053 | 3300044684 | Ga0466966_0182565 | Ga0466966_0182565_555_986 | 142 |
| 1054 | 3300044735 | Ga0466968_0236576 | Ga0466968_0236576_255_686 | 142 |
| 1055 | 3300045049 | Ga0466959_0155138 | Ga0466959_0155138_661_1092 | 142 |
| 1056 | 3300046452 | Ga0495617_213296 | Ga0495617_213296_55_483 | 142 |
| 1057 | 3300046454 | Ga0495592_0002897 | Ga0495592_0002897_10230_10673 | 142 |
| 1058 | 3300046454 | Ga0495592_0150404 | Ga0495592_0150404_1037_1465 | 142 |
| 1059 | 3300046455 | Ga0495603_0016547 | Ga0495603_0016547_960_1388 | 142 |
| 1060 | 3300046455 | Ga0495603_0031419 | Ga0495603_0031419_2529_2957 | 142 |
| 1061 | 3300046455 | Ga0495603_0101068 | Ga0495603_0101068_1118_1549 | 142 |
| 1062 | 3300046455 | Ga0495603_0388618 | Ga0495603_0388618_135_563 | 142 |
| 1063 | 3300046459 | Ga0495629_0064923 | Ga0495629_0064923_195_638 | 142 |
| 1064 | 3300046459 | Ga0495629_0219080 | Ga0495629_0219080_242_670 | 142 |
| 1065 | 3300046460 | Ga0495638_0018849 | Ga0495638_0018849_3110_3550 | 142 |
| 1066 | 3300046460 | Ga0495638_0074041 | Ga0495638_0074041_611_1051 | 142 |
| 1067 | 3300046460 | Ga0495638_0221135 | Ga0495638_0221135_194_622 | 142 |
| 1068 | 3300046462 | Ga0495651_0193645 | Ga0495651_0193645_669_1097 | 142 |
| 1069 | 3300046463 | Ga0495653_0066003 | Ga0495653_0066003_828_1271 | 142 |
| 1070 | 3300046473 | Ga0495582_0173382 | Ga0495582_0173382_690_1118 | 142 |
| 1071 | 3300046475 | Ga0495639_0283323 | Ga0495639_0283323_207_635 | 142 |
| 1072 | 3300046475 | Ga0495639_0744274 | Ga0495639_0744274_55_483 | 142 |
| 1073 | 3300046476 | Ga0495662_0410640 | Ga0495662_0410640_47_475 | 142 |
| 1074 | 3300046477 | Ga0495664_0061043 | Ga0495664_0061043_1568_1996 | 142 |
| 1075 | 3300046491 | Ga0495584_0087161 | Ga0495584_0087161_73_501 | 142 |
| 1076 | 3300046491 | Ga0495584_0095500 | Ga0495584_0095500_91_525 | 142 |
| 1077 | 3300046491 | Ga0495584_0100078 | Ga0495584_0100078_12_440 | 142 |
| 1078 | 3300046491 | Ga0495584_0350908 | Ga0495584_0350908_218_646 | 142 |
| 1079 | 3300046507 | Ga0495606_0141205 | Ga0495606_0141205_65_505 | 142 |
| 1080 | 3300046507 | Ga0495606_0366619 | Ga0495606_0366619_249_677 | 142 |
| 1081 | 3300046507 | Ga0495606_0586742 | Ga0495606_0586742_80_508 | 142 |
| 1082 | 3300046511 | Ga0495608_0017985 | Ga0495608_0017985_1761_2204 | 142 |
| 1083 | 3300046512 | Ga0495610_0061518 | Ga0495610_0061518_476_916 | 142 |
| 1084 | 3300046513 | Ga0495616_0271533 | Ga0495616_0271533_148_576 | 142 |
| 1085 | 3300046515 | Ga0495620_0027074 | Ga0495620_0027074_1898_2338 | 142 |
| 1086 | 3300046517 | Ga0495630_0849392 | Ga0495630_0849392_65_493 | 142 |
| 1087 | 3300046518 | Ga0495631_0083502 | Ga0495631_0083502_195_635 | 142 |
| 1088 | 3300046518 | Ga0495631_0184737 | Ga0495631_0184737_80_508 | 142 |
| 1089 | 3300046519 | Ga0495632_0116801 | Ga0495632_0116801_282_710 | 142 |
| 1090 | 3300046522 | Ga0495643_0058784 | Ga0495643_0058784_85_525 | 142 |
| 1091 | 3300046524 | Ga0495648_0190190 | Ga0495648_0190190_73_513 | 142 |
| 1092 | 3300046529 | Ga0495652_0023007 | Ga0495652_0023007_1580_2023 | 142 |
| 1093 | 3300046529 | Ga0495652_0196823 | Ga0495652_0196823_586_1014 | 142 |
| 1094 | 3300046529 | Ga0495652_0560670 | Ga0495652_0560670_65_493 | 142 |
| 1095 | 3300046530 | Ga0495654_0025118 | Ga0495654_0025118_775_1215 | 142 |
| 1096 | 3300046531 | Ga0495665_0477316 | Ga0495665_0477316_62_490 | 142 |
| 1097 | 3300046533 | Ga0495640_0005616 | Ga0495640_0005616_5627_6070 | 142 |
| 1098 | 3300046533 | Ga0495640_0192589 | Ga0495640_0192589_712_1140 | 142 |
| 1099 | 3300046533 | Ga0495640_0364683 | Ga0495640_0364683_136_576 | 142 |
| 1100 | 3300046536 | Ga0495587_0025519 | Ga0495587_0025519_2922_3365 | 142 |
| 1101 | 3300046538 | Ga0495609_0434335 | Ga0495609_0434335_68_496 | 142 |
| 1102 | 3300046539 | Ga0495621_0369815 | Ga0495621_0369815_15_443 | 142 |
| 1103 | 3300046542 | Ga0495597_0048627 | Ga0495597_0048627_365_793 | 142 |
| 1104 | 3300046543 | Ga0495645_0013424 | Ga0495645_0013424_835_1278 | 142 |
| 1105 | 3300046543 | Ga0495645_0060122 | Ga0495645_0060122_902_1330 | 142 |
| 1106 | 3300046543 | Ga0495645_0128923 | Ga0495645_0128923_426_869 | 142 |
| 1107 | 3300046557 | Ga0495622_0008839 | Ga0495622_0008839_4176_4616 | 142 |
| 1108 | 3300046558 | Ga0495633_0500550 | Ga0495633_0500550_83_523 | 142 |
| 1109 | 3300046559 | Ga0495667_0009980 | Ga0495667_0009980_955_1398 | 142 |
| 1110 | 3300046616 | Ga0495668_0153470 | Ga0495668_0153470_470_898 | 142 |
| 1111 | 3300046616 | Ga0495668_0370538 | Ga0495668_0370538_95_535 | 142 |
| 1112 | 3300046616 | Ga0495668_0410025 | Ga0495668_0410025_46_474 | 142 |
| 1113 | 3300046616 | Ga0495668_0556326 | Ga0495668_0556326_111_539 | 142 |
| 1114 | 3300046616 | Ga0495668_0804889 | Ga0495668_0804889_42_470 | 142 |
| 1115 | 3300046642 | Ga0495634_0034579 | Ga0495634_0034579_246_689 | 142 |
| 1116 | 3300046642 | Ga0495634_0174787 | Ga0495634_0174787_866_1294 | 142 |
| 1117 | 3300046660 | Ga0495625_0178398 | Ga0495625_0178398_143_583 | 142 |
| 1118 | 3300046660 | Ga0495625_0400645 | Ga0495625_0400645_59_487 | 142 |
| 1119 | 3300046660 | Ga0495625_0613134 | Ga0495625_0613134_78_506 | 142 |
| 1120 | 3300046663 | Ga0495635_0001058 | Ga0495635_0001058_2197_2640 | 142 |
| 1121 | 3300046675 | Ga0495657_0011523 | Ga0495657_0011523_2198_2641 | 142 |
| 1122 | 3300046675 | Ga0495657_0439712 | Ga0495657_0439712_255_683 | 142 |
| 1123 | 3300046678 | Ga0495599_0082999 | Ga0495599_0082999_742_1185 | 142 |
| 1124 | 3300046678 | Ga0495599_0441992 | Ga0495599_0441992_48_491 | 142 |
| 1125 | 3300046679 | Ga0495623_0018971 | Ga0495623_0018971_2418_2861 | 142 |
| 1126 | 3300046679 | Ga0495623_0142637 | Ga0495623_0142637_191_619 | 142 |
| 1127 | 3300046679 | Ga0495623_0153410 | Ga0495623_0153410_90_533 | 142 |
| 1128 | 3300046680 | Ga0495646_0000934 | Ga0495646_0000934_163_606 | 142 |
| 1129 | 3300046680 | Ga0495646_0242207 | Ga0495646_0242207_223_651 | 142 |
| 1130 | 3300046683 | Ga0495658_0101562 | Ga0495658_0101562_285_713 | 142 |
| 1131 | 3300046689 | Ga0495613_0044384 | Ga0495613_0044384_1214_1657 | 142 |
| 1132 | 3300046691 | Ga0495670_0379468 | Ga0495670_0379468_264_692 | 142 |
| 1133 | 3300046692 | Ga0495671_0041406 | Ga0495671_0041406_1343_1783 | 142 |
| 1134 | 3300046694 | Ga0495649_0332373 | Ga0495649_0332373_109_537 | 142 |
| 1135 | 3300046794 | Ga0495589_0561386 | Ga0495589_0561386_70_498 | 142 |
| 1136 | 3300046809 | Ga0495600_0007371 | Ga0495600_0007371_4832_5275 | 142 |
| 1137 | 3300047315 | Ga0495581_0155785 | Ga0495581_0155785_97_525 | 142 |
| 1138 | 3300047317 | Ga0495604_0075423 | Ga0495604_0075423_1089_1517 | 142 |
| 1139 | 3300047317 | Ga0495604_0119190 | Ga0495604_0119190_848_1291 | 142 |
| 1140 | 3300047317 | Ga0495604_0155781 | Ga0495604_0155781_1009_1452 | 142 |
| 1141 | 3300047317 | Ga0495604_0874925 | Ga0495604_0874925_100_528 | 142 |
| 1142 | 3300047319 | Ga0495674_0087619 | Ga0495674_0087619_1792_2235 | 142 |
| 1143 | 3300047319 | Ga0495674_1192249 | Ga0495674_1192249_107_535 | 142 |
| 1144 | 3300047320 | Ga0495672_0025437 | Ga0495672_0025437_1382_1810 | 142 |
| 1145 | 3300047320 | Ga0495672_0326863 | Ga0495672_0326863_44_472 | 142 |
| 1146 | 3300047321 | Ga0495676_0457552 | Ga0495676_0457552_191_619 | 142 |
| 1147 | 3300047321 | Ga0495676_0738591 | Ga0495676_0738591_15_455 | 142 |
| 1148 | 3300047322 | Ga0495680_0020992 | Ga0495680_0020992_1452_1895 | 142 |
| 1149 | 3300047322 | Ga0495680_0280875 | Ga0495680_0280875_679_1107 | 142 |
| 1150 | 3300047444 | Ga0495675_0004307 | Ga0495675_0004307_5640_6083 | 142 |
| 1151 | 3300047444 | Ga0495675_0521181 | Ga0495675_0521181_137_565 | 142 |
| 1152 | 3300047469 | Ga0495673_0179709 | Ga0495673_0179709_169_597 | 142 |
| 1153 | 3300047471 | Ga0495684_0016173 | Ga0495684_0016173_2855_3298 | 142 |
| 1154 | 3300047471 | Ga0495684_0046854 | Ga0495684_0046854_1733_2161 | 142 |
| 1155 | 3300047472 | Ga0495686_0545627 | Ga0495686_0545627_142_570 | 142 |
| 1156 | 3300047673 | Ga0495593_0007370 | Ga0495593_0007370_4186_4629 | 142 |
| 1157 | 3300048088 | Ga0495602_0115407 | Ga0495602_0115407_247_675 | 142 |
| 1158 | 3300048088 | Ga0495602_0123311 | Ga0495602_0123311_1106_1549 | 142 |
| 1159 | 3300048088 | Ga0495602_0734926 | Ga0495602_0734926_129_557 | 142 |
| 1160 | 3300048903 | Ga0496100_0013579 | Ga0496100_0013579_3588_4016 | 142 |
| 1161 | 3300048904 | Ga0496101_0004886 | Ga0496101_0004886_332_760 | 142 |
| 1162 | 3300048904 | Ga0496101_0220684 | Ga0496101_0220684_659_1087 | 142 |
| 1163 | 3300048904 | Ga0496101_1448243 | Ga0496101_1448243_79_507 | 142 |
| 1164 | 3300048905 | Ga0496102_0180783 | Ga0496102_0180783_207_635 | 142 |
| 1165 | 3300048905 | Ga0496102_0703514 | Ga0496102_0703514_495_923 | 142 |
| 1166 | 3300048905 | Ga0496102_1418411 | Ga0496102_1418411_99_545 | 142 |
| 1167 | 3300048906 | Ga0496103_0348816 | Ga0496103_0348816_115_549 | 142 |
| 1168 | 3300048907 | Ga0496104_0022766 | Ga0496104_0022766_295_723 | 142 |
| 1169 | 3300048907 | Ga0496104_0074007 | Ga0496104_0074007_207_635 | 142 |
| 1170 | 3300048908 | Ga0496105_0024293 | Ga0496105_0024293_3137_3565 | 142 |
| 1171 | 3300048908 | Ga0496105_0364340 | Ga0496105_0364340_106_534 | 142 |
| 1172 | 3300048908 | Ga0496105_0484394 | Ga0496105_0484394_208_636 | 142 |
| 1173 | 3300048909 | Ga0496106_0003078 | Ga0496106_0003078_1461_1889 | 142 |
| 1174 | 3300048909 | Ga0496106_0014048 | Ga0496106_0014048_4485_4913 | 142 |
| 1175 | 3300048909 | Ga0496106_0151061 | Ga0496106_0151061_176_616 | 142 |
| 1176 | 3300048909 | Ga0496106_0260976 | Ga0496106_0260976_834_1262 | 142 |
| 1177 | 3300048909 | Ga0496106_0575394 | Ga0496106_0575394_222_650 | 142 |
| 1178 | 3300048909 | Ga0496106_1432746 | Ga0496106_1432746_62_490 | 142 |
| 1179 | 3300048910 | Ga0496107_0075070 | Ga0496107_0075070_952_1380 | 142 |
| 1180 | 3300048910 | Ga0496107_0700981 | Ga0496107_0700981_129_557 | 142 |
| 1181 | 3300048911 | Ga0496108_1168535 | Ga0496108_1168535_107_553 | 142 |
| 1182 | 3300048911 | Ga0496108_1566029 | Ga0496108_1566029_22_456 | 142 |
| 1183 | 3300048912 | Ga0496109_0033152 | Ga0496109_0033152_832_1260 | 142 |
| 1184 | 3300048912 | Ga0496109_1139874 | Ga0496109_1139874_107_535 | 142 |
| 1185 | 3300048913 | Ga0496110_0024161 | Ga0496110_0024161_970_1398 | 142 |
| 1186 | 3300048913 | Ga0496110_0174904 | Ga0496110_0174904_1483_1911 | 142 |
| 1187 | 3300048914 | Ga0496111_0018238 | Ga0496111_0018238_1049_1477 | 142 |
| 1188 | 3300048914 | Ga0496111_0609522 | Ga0496111_0609522_344_778 | 142 |
| 1189 | 3300048914 | Ga0496111_0737202 | Ga0496111_0737202_119_565 | 142 |
| 1190 | 3300048915 | Ga0496112_0042417 | Ga0496112_0042417_2771_3199 | 142 |
| 1191 | 3300048915 | Ga0496112_0075320 | Ga0496112_0075320_1576_2004 | 142 |
| 1192 | 3300048915 | Ga0496112_0154960 | Ga0496112_0154960_147_581 | 142 |
| 1193 | 3300048916 | Ga0496113_0062718 | Ga0496113_0062718_1338_1766 | 142 |
| 1194 | 3300048916 | Ga0496113_0079460 | Ga0496113_0079460_404_832 | 142 |
| 1195 | 3300048916 | Ga0496113_0486911 | Ga0496113_0486911_347_775 | 142 |
| 1196 | 3300048917 | Ga0496114_0010129 | Ga0496114_0010129_4740_5168 | 142 |
| 1197 | 3300048917 | Ga0496114_1580797 | Ga0496114_1580797_13_441 | 142 |
| 1198 | 3300048918 | Ga0496115_0009019 | Ga0496115_0009019_4657_5085 | 142 |
| 1199 | 3300048918 | Ga0496115_0049091 | Ga0496115_0049091_2907_3335 | 142 |
| 1200 | 3300048918 | Ga0496115_0129663 | Ga0496115_0129663_468_896 | 142 |
| 1201 | 3300048919 | Ga0496116_0168176 | Ga0496116_0168176_252_686 | 142 |
| 1202 | 3300048920 | Ga0496117_0037664 | Ga0496117_0037664_1083_1511 | 142 |
| 1203 | 3300048920 | Ga0496117_0055971 | Ga0496117_0055971_1840_2280 | 142 |
| 1204 | 3300048920 | Ga0496117_0182726 | Ga0496117_0182726_125_565 | 142 |
| 1205 | 3300048920 | Ga0496117_0191195 | Ga0496117_0191195_114_542 | 142 |
| 1206 | 3300048921 | Ga0496118_0005152 | Ga0496118_0005152_2967_3395 | 142 |
| 1207 | 3300048921 | Ga0496118_0166614 | Ga0496118_0166614_467_907 | 142 |
| 1208 | 3300048921 | Ga0496118_0402311 | Ga0496118_0402311_134_562 | 142 |
| 1209 | 3300048922 | Ga0496119_0199268 | Ga0496119_0199268_503_943 | 142 |
| 1210 | 3300048923 | Ga0496120_0038951 | Ga0496120_0038951_1676_2116 | 142 |
| 1211 | 3300048923 | Ga0496120_0417887 | Ga0496120_0417887_64_492 | 142 |
| 1212 | 3300048924 | Ga0496121_0001291 | Ga0496121_0001291_27993_28421 | 142 |
| 1213 | 3300048924 | Ga0496121_0054618 | Ga0496121_0054618_2077_2517 | 142 |
| 1214 | 3300048924 | Ga0496121_0106571 | Ga0496121_0106571_886_1314 | 142 |
| 1215 | 3300048924 | Ga0496121_0123204 | Ga0496121_0123204_880_1308 | 142 |
| 1216 | 3300048924 | Ga0496121_0143570 | Ga0496121_0143570_1117_1545 | 142 |
| 1217 | 3300048924 | Ga0496121_0331337 | Ga0496121_0331337_394_822 | 142 |
| 1218 | 3300048924 | Ga0496121_0333018 | Ga0496121_0333018_442_876 | 142 |
| 1219 | 3300048924 | Ga0496121_0695438 | Ga0496121_0695438_67_495 | 142 |
| 1220 | 3300048924 | Ga0496121_0728812 | Ga0496121_0728812_145_573 | 142 |
| 1221 | 3300048925 | Ga0496122_0203625 | Ga0496122_0203625_200_640 | 142 |
| 1222 | 3300048925 | Ga0496122_0293427 | Ga0496122_0293427_356_796 | 142 |
| 1223 | 3300048926 | Ga0496123_0154688 | Ga0496123_0154688_62_502 | 142 |
| 1224 | 3300048927 | Ga0496124_0001238 | Ga0496124_0001238_10770_11198 | 142 |
| 1225 | 3300048927 | Ga0496124_0096808 | Ga0496124_0096808_1234_1674 | 142 |
| 1226 | 3300048927 | Ga0496124_0149863 | Ga0496124_0149863_126_554 | 142 |
| 1227 | 3300048927 | Ga0496124_0150343 | Ga0496124_0150343_1242_1676 | 142 |
| 1228 | 3300048928 | Ga0496125_0036783 | Ga0496125_0036783_2126_2554 | 142 |
| 1229 | 3300048928 | Ga0496125_0049975 | Ga0496125_0049975_832_1272 | 142 |
| 1230 | 3300048928 | Ga0496125_0128520 | Ga0496125_0128520_367_807 | 142 |
| 1231 | 3300048928 | Ga0496125_0253283 | Ga0496125_0253283_626_1054 | 142 |
| 1232 | 3300048928 | Ga0496125_0636384 | Ga0496125_0636384_87_521 | 142 |
| 1233 | 3300048929 | Ga0496126_0004961 | Ga0496126_0004961_4486_4914 | 142 |
| 1234 | 3300048929 | Ga0496126_0011777 | Ga0496126_0011777_3876_4304 | 142 |
| 1235 | 3300048929 | Ga0496126_0026581 | Ga0496126_0026581_1623_2051 | 142 |
| 1236 | 3300048929 | Ga0496126_0049105 | Ga0496126_0049105_3105_3533 | 142 |
| 1237 | 3300048929 | Ga0496126_0178987 | Ga0496126_0178987_994_1434 | 142 |
| 1238 | 3300048929 | Ga0496126_0226489 | Ga0496126_0226489_933_1361 | 142 |
| 1239 | 3300048929 | Ga0496126_0299710 | Ga0496126_0299710_576_1004 | 142 |
| 1240 | 3300048929 | Ga0496126_0319546 | Ga0496126_0319546_208_636 | 142 |
| 1241 | 3300048929 | Ga0496126_0342477 | Ga0496126_0342477_444_872 | 142 |
| 1242 | 3300048929 | Ga0496126_0392003 | Ga0496126_0392003_155_583 | 142 |
| 1243 | 3300048929 | Ga0496126_0535824 | Ga0496126_0535824_357_785 | 142 |
| 1244 | 3300048929 | Ga0496126_0537433 | Ga0496126_0537433_431_859 | 142 |
| 1245 | 3300048929 | Ga0496126_0875188 | Ga0496126_0875188_207_635 | 142 |
| 1246 | 3300048929 | Ga0496126_1057997 | Ga0496126_1057997_63_491 | 142 |
| 1247 | 3300049568 | Ga0501031_0249901 | Ga0501031_0249901_665_1105 | 142 |
| 1248 | 3300049570 | Ga0501033_0720908 | Ga0501033_0720908_176_667 | 142 |
| 1249 | 3300049571 | Ga0501034_0036800 | Ga0501034_0036800_1430_1921 | 142 |
| 1250 | 3300049571 | Ga0501034_0063299 | Ga0501034_0063299_419_859 | 142 |
| 1251 | 3300049571 | Ga0501034_0820870 | Ga0501034_0820870_371_811 | 142 |
| 1252 | 3300049572 | Ga0501036_0070788 | Ga0501036_0070788_1964_2455 | 142 |
| 1253 | 3300049572 | Ga0501036_0872669 | Ga0501036_0872669_77_514 | 142 |
| 1254 | 3300049573 | Ga0501037_0100474 | Ga0501037_0100474_581_1021 | 142 |
| 1255 | 3300049573 | Ga0501037_0176199 | Ga0501037_0176199_963_1454 | 142 |
| 1256 | 3300049574 | Ga0501038_0004223 | Ga0501038_0004223_4269_4709 | 142 |
| 1257 | 3300049574 | Ga0501038_0051879 | Ga0501038_0051879_11_502 | 142 |
| 1258 | 3300049575 | Ga0501039_0163739 | Ga0501039_0163739_937_1428 | 142 |
| 1259 | 3300049575 | Ga0501039_0503905 | Ga0501039_0503905_229_669 | 142 |
| 1260 | 3300049575 | Ga0501039_0534060 | Ga0501039_0534060_103_540 | 142 |
| 1261 | 3300049576 | Ga0501040_0075435 | Ga0501040_0075435_1217_1708 | 142 |
| 1262 | 3300049576 | Ga0501040_0410826 | Ga0501040_0410826_530_958 | 142 |
| 1263 | 3300049577 | Ga0501041_0114700 | Ga0501041_0114700_41_478 | 142 |
| 1264 | 3300049578 | Ga0501042_0008276 | Ga0501042_0008276_3328_3819 | 142 |
| 1265 | 3300049579 | Ga0501043_0008239 | Ga0501043_0008239_3278_3718 | 142 |
| 1266 | 3300049580 | Ga0501046_0213472 | Ga0501046_0213472_793_1284 | 142 |
| 1267 | 3300049581 | Ga0501047_0041815 | Ga0501047_0041815_638_1078 | 142 |
| 1268 | 3300049581 | Ga0501047_1342315 | Ga0501047_1342315_11_502 | 142 |
| 1269 | 3300049582 | Ga0501048_0008490 | Ga0501048_0008490_148_639 | 142 |
| 1270 | 3300049582 | Ga0501048_0379263 | Ga0501048_0379263_17_454 | 142 |
| 1271 | 3300049583 | Ga0501067_0002243 | Ga0501067_0002243_2344_2835 | 142 |
| 1272 | 3300049584 | Ga0501068_0149491 | Ga0501068_0149491_568_1059 | 142 |
| 1273 | 3300049585 | Ga0501069_0016220 | Ga0501069_0016220_2353_2844 | 142 |
| 1274 | 3300049586 | Ga0501070_0011932 | Ga0501070_0011932_5866_6357 | 142 |
| 1275 | 3300049587 | Ga0501071_0414579 | Ga0501071_0414579_501_992 | 142 |
| 1276 | 3300049588 | Ga0501072_0057071 | Ga0501072_0057071_761_1252 | 142 |
| 1277 | 3300049589 | Ga0501073_0094006 | Ga0501073_0094006_1015_1506 | 142 |
| 1278 | 3300049589 | Ga0501073_0134132 | Ga0501073_0134132_820_1260 | 142 |
| 1279 | 3300049590 | Ga0501074_0000802 | Ga0501074_0000802_10379_10870 | 142 |
| 1280 | 3300049741 | Ga0501079_0010508 | Ga0501079_0010508_6531_7022 | 142 |
| 1281 | 3300049742 | Ga0501080_0017322 | Ga0501080_0017322_6172_6612 | 142 |
| 1282 | 3300049744 | Ga0501083_0005973 | Ga0501083_0005973_439_930 | 142 |
| 1283 | 3300049822 | Ga0501035_0039707 | Ga0501035_0039707_3622_4062 | 142 |
| 1284 | 3300049822 | Ga0501035_0135271 | Ga0501035_0135271_1645_2136 | 142 |
| 1285 | 3300049823 | Ga0501044_0018546 | Ga0501044_0018546_5527_5967 | 142 |
| 1286 | 3300049824 | Ga0501045_0013471 | Ga0501045_0013471_2799_3290 | 142 |
| 1287 | 3300050489 | nmdc:mga03683_130126_c1 | nmdc:mga03683_130126_c1_547_975 | 142 |
| 1288 | 3300050489 | nmdc:mga03683_214788_c1 | nmdc:mga03683_214788_c1_212_640 | 142 |
| 1289 | 3300050489 | nmdc:mga03683_64702_c1 | nmdc:mga03683_64702_c1_892_1320 | 142 |
| 1290 | 3300050490 | nmdc:mga03n38_14754_c1 | nmdc:mga03n38_14754_c1_201_629 | 142 |
| 1291 | 3300050490 | nmdc:mga03n38_225418_c1 | nmdc:mga03n38_225418_c1_178_606 | 142 |
| 1292 | 3300050492 | nmdc:mga0yw44_120383_c1 | nmdc:mga0yw44_120383_c1_396_824 | 142 |
| 1293 | 3300050492 | nmdc:mga0yw44_268363_c1 | nmdc:mga0yw44_268363_c1_293_733 | 142 |
| 1294 | 3300050492 | nmdc:mga0yw44_401629_c1 | nmdc:mga0yw44_401629_c1_476_904 | 142 |
| 1295 | 3300050493 | nmdc:mga0k408_174161_c1 | nmdc:mga0k408_174161_c1_222_650 | 142 |
| 1296 | 3300050493 | nmdc:mga0k408_232637_c1 | nmdc:mga0k408_232637_c1_29_514 | 142 |
| 1297 | 3300050493 | nmdc:mga0k408_327599_c1 | nmdc:mga0k408_327599_c1_23_457 | 142 |
| 1298 | 3300050493 | nmdc:mga0k408_54832_c1 | nmdc:mga0k408_54832_c1_245_673 | 142 |
| 1299 | 3300050494 | nmdc:mga06z11_167677_c1 | nmdc:mga06z11_167677_c1_503_931 | 142 |
| 1300 | 3300050494 | nmdc:mga06z11_312782_c1 | nmdc:mga06z11_312782_c1_404_832 | 142 |
| 1301 | 3300050494 | nmdc:mga06z11_5269_c1 | nmdc:mga06z11_5269_c1_209_637 | 142 |
| 1302 | 3300050496 | nmdc:mga07m45_367100_c1 | nmdc:mga07m45_367100_c1_352_780 | 142 |
| 1303 | 3300050496 | nmdc:mga07m45_4525_c1 | nmdc:mga07m45_4525_c1_241_669 | 142 |
| 1304 | 3300050514 | nmdc:mga08x19_488778_c1 | nmdc:mga08x19_488778_c1_189_617 | 142 |
| 1305 | 3300050516 | nmdc:mga0sz30_100711_c1 | nmdc:mga0sz30_100711_c1_39_467 | 142 |
| 1306 | 3300050516 | nmdc:mga0sz30_413337_c1 | nmdc:mga0sz30_413337_c1_76_504 | 142 |
| 1307 | 3300050516 | nmdc:mga0sz30_57216_c1 | nmdc:mga0sz30_57216_c1_78_512 | 142 |
| 1308 | 3300053077 | Ga0495601_0015406 | Ga0495601_0015406_2377_2805 | 142 |
| 1309 | 3300053077 | Ga0495601_0016288 | Ga0495601_0016288_1024_1467 | 142 |
| 1310 | 3300053077 | Ga0495601_0526080 | Ga0495601_0526080_279_707 | 142 |
| 1311 | 3300053080 | Ga0500635_0068970 | Ga0500635_0068970_319_747 | 142 |
| 1312 | 3300053083 | Ga0495655_0019265 | Ga0495655_0019265_771_1199 | 142 |
| 1313 | 3300053083 | Ga0495655_0303053 | Ga0495655_0303053_30_458 | 142 |
| 1314 | 3300053084 | Ga0495595_0000335 | Ga0495595_0000335_15392_15835 | 142 |
| 1315 | 3300053084 | Ga0495595_0026690 | Ga0495595_0026690_1471_1899 | 142 |
| 1316 | 3300053084 | Ga0495595_0232091 | Ga0495595_0232091_369_797 | 142 |
| 1317 | 3300053085 | Ga0495619_0001292 | Ga0495619_0001292_1639_2082 | 142 |
| 1318 | 3300053085 | Ga0495619_0127621 | Ga0495619_0127621_122_550 | 142 |
| 1319 | 3300053087 | Ga0500643_014119 | Ga0500643_014119_1263_1691 | 142 |
| 1320 | 3300053088 | Ga0500644_0031257 | Ga0500644_0031257_759_1199 | 142 |
| 1321 | 3300053089 | Ga0500581_258586 | Ga0500581_258586_251_691 | 142 |
| 1322 | 3300053091 | Ga0500647_0315650 | Ga0500647_0315650_106_534 | 142 |
| 1323 | 3300053092 | Ga0500583_0141757 | Ga0500583_0141757_622_1050 | 142 |
| 1324 | 3300053092 | Ga0500583_0482640 | Ga0500583_0482640_145_573 | 142 |
| 1325 | 3300053093 | Ga0500651_0003108 | Ga0500651_0003108_7834_8274 | 142 |
| 1326 | 3300053093 | Ga0500651_0316810 | Ga0500651_0316810_49_477 | 142 |
| 1327 | 3300053093 | Ga0500651_0465797 | Ga0500651_0465797_230_658 | 142 |
| 1328 | 3300053094 | Ga0500566_0000332 | Ga0500566_0000332_21126_21566 | 142 |
| 1329 | 3300053094 | Ga0500566_0011427 | Ga0500566_0011427_4474_4902 | 142 |
| 1330 | 3300053096 | Ga0500641_0113778 | Ga0500641_0113778_484_912 | 142 |
| 1331 | 3300053097 | Ga0500648_157151 | Ga0500648_157151_456_884 | 142 |
| 1332 | 3300053098 | Ga0500650_0028010 | Ga0500650_0028010_1189_1629 | 142 |
| 1333 | 3300053098 | Ga0500650_0113415 | Ga0500650_0113415_678_1106 | 142 |
| 1334 | 3300053103 | Ga0500555_125450 | Ga0500555_125450_69_497 | 142 |
| 1335 | 3300053109 | Ga0500569_029160 | Ga0500569_029160_455_883 | 142 |
| 1336 | 3300053116 | Ga0500592_000477 | Ga0500592_000477_5691_6131 | 142 |
| 1337 | 3300053117 | Ga0500593_159797 | Ga0500593_159797_189_629 | 142 |
| 1338 | 3300053118 | Ga0500594_0031132 | Ga0500594_0031132_488_928 | 142 |
| 1339 | 3300053119 | Ga0500595_000468 | Ga0500595_000468_8355_8783 | 142 |
| 1340 | 3300053119 | Ga0500595_018935 | Ga0500595_018935_1139_1567 | 142 |
| 1341 | 3300053119 | Ga0500595_100614 | Ga0500595_100614_48_476 | 142 |
| 1342 | 3300053121 | Ga0500607_228713 | Ga0500607_228713_275_715 | 142 |
| 1343 | 3300053122 | Ga0500608_000395 | Ga0500608_000395_4580_5020 | 142 |
| 1344 | 3300053122 | Ga0500608_326497 | Ga0500608_326497_49_492 | 142 |
| 1345 | 3300053125 | Ga0500618_004648 | Ga0500618_004648_3860_4300 | 142 |
| 1346 | 3300053127 | Ga0500623_249849 | Ga0500623_249849_59_499 | 142 |
| 1347 | 3300053130 | Ga0500642_0000128 | Ga0500642_0000128_10587_11027 | 142 |
| 1348 | 3300053130 | Ga0500642_0160360 | Ga0500642_0160360_306_734 | 142 |
| 1349 | 3300053130 | Ga0500642_0255061 | Ga0500642_0255061_189_617 | 142 |
| 1350 | 3300053131 | Ga0500652_000285 | Ga0500652_000285_11741_12181 | 142 |
| 1351 | 3300053134 | Ga0500658_0005983 | Ga0500658_0005983_2197_2637 | 142 |
| 1352 | 3300053134 | Ga0500658_0036152 | Ga0500658_0036152_617_1045 | 142 |
| 1353 | 3300053134 | Ga0500658_0058503 | Ga0500658_0058503_836_1264 | 142 |
| 1354 | 3300053134 | Ga0500658_0391449 | Ga0500658_0391449_39_479 | 142 |
| 1355 | 3300053136 | Ga0500559_0000959 | Ga0500559_0000959_1740_2180 | 142 |
| 1356 | 3300053136 | Ga0500559_0009065 | Ga0500559_0009065_1157_1585 | 142 |
| 1357 | 3300053137 | Ga0500561_0024124 | Ga0500561_0024124_914_1342 | 142 |
| 1358 | 3300053139 | Ga0500568_0000741 | Ga0500568_0000741_16412_16852 | 142 |
| 1359 | 3300053139 | Ga0500568_0078915 | Ga0500568_0078915_753_1181 | 142 |
| 1360 | 3300053140 | Ga0500573_0035584 | Ga0500573_0035584_1636_2064 | 142 |
| 1361 | 3300053145 | Ga0500586_002976 | Ga0500586_002976_626_1066 | 142 |
| 1362 | 3300053147 | Ga0500589_067269 | Ga0500589_067269_83_511 | 142 |
| 1363 | 3300053147 | Ga0500589_097143 | Ga0500589_097143_412_840 | 142 |
| 1364 | 3300053148 | Ga0500590_119784 | Ga0500590_119784_423_851 | 142 |
| 1365 | 3300053150 | Ga0500603_001419 | Ga0500603_001419_4834_5265 | 142 |
| 1366 | 3300053150 | Ga0500603_182116 | Ga0500603_182116_197_625 | 142 |
| 1367 | 3300053151 | Ga0500604_0007792 | Ga0500604_0007792_24_464 | 142 |
| 1368 | 3300053151 | Ga0500604_0212605 | Ga0500604_0212605_205_633 | 142 |
| 1369 | 3300053153 | Ga0500616_0000122 | Ga0500616_0000122_10349_10789 | 142 |
| 1370 | 3300053154 | Ga0500619_157433 | Ga0500619_157433_247_675 | 142 |
| 1371 | 3300053158 | Ga0500627_0005565 | Ga0500627_0005565_1055_1495 | 142 |
| 1372 | 3300053158 | Ga0500627_0126064 | Ga0500627_0126064_392_820 | 142 |
| 1373 | 3300053161 | Ga0500634_0044424 | Ga0500634_0044424_1613_2041 | 142 |
| 1374 | 3300053162 | Ga0500638_002107 | Ga0500638_002107_519_947 | 142 |
| 1375 | 3300053162 | Ga0500638_045751 | Ga0500638_045751_613_1041 | 142 |
| 1376 | 3300053162 | Ga0500638_171331 | Ga0500638_171331_22_450 | 142 |
| 1377 | 3300053177 | Ga0500636_0006139 | Ga0500636_0006139_4732_5172 | 142 |
| 1378 | 3300053177 | Ga0500636_0116220 | Ga0500636_0116220_149_577 | 142 |
| 1379 | 3300053177 | Ga0500636_0183939 | Ga0500636_0183939_148_576 | 142 |
| 1380 | 3300053178 | Ga0500637_0011077 | Ga0500637_0011077_2387_2815 | 142 |
| 1381 | 3300053178 | Ga0500637_0248512 | Ga0500637_0248512_541_981 | 142 |
| 1382 | 3300053178 | Ga0500637_0284938 | Ga0500637_0284938_163_591 | 142 |
| 1383 | 3300053178 | Ga0500637_0362362 | Ga0500637_0362362_173_601 | 142 |
| 1384 | 3300053727 | Ga0500611_056842 | Ga0500611_056842_450_890 | 142 |
| 1385 | 3300053727 | Ga0500611_199304 | Ga0500611_199304_24_452 | 142 |
| 1386 | 3300053728 | Ga0500657_035869 | Ga0500657_035869_776_1204 | 142 |
| 1387 | 3300053730 | Ga0500645_013421 | Ga0500645_013421_1707_2147 | 142 |
| 1388 | 3300053730 | Ga0500645_025920 | Ga0500645_025920_461_889 | 142 |
| 1389 | 3300053735 | Ga0500596_007063 | Ga0500596_007063_324_752 | 142 |
| 1390 | 3300054114 | Ga0501084_0248968 | Ga0501084_0248968_1014_1454 | 142 |
| 1391 | 3300055283 | Ga0500661_001956 | Ga0500661_001956_134_562 | 142 |
| 1392 | 3300060353 | Ga0501082_0169383 | Ga0501082_0169383_1376_1867 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bgn-assembly2.cif.gz_D | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9703 | 18 | 116 |
| 7bgn-assembly1.cif.gz_A | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9703 | 18 | 113 |
| 7bgn-assembly1.cif.gz_B | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9614 | 18 | 116 |
| 6j22-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.9353 | 23 | 112 |
| 6j2l-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.8989 | 20 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9768 | 18 | 104 | 3.10.20.810 |
| af_P9WMM7_1_97_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9729 | 17 | 104 | 3.10.20.810 |
| af_Q2FUU3_250_343_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9392 | 19 | 104 | 3.10.20.810 |
| 1zpsA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.8948 | 14 | 104 | 3.10.20.810 |
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.887 | 18 | 104 | 3.10.20.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2X420-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9884 | 7 | 102 |
GO:0000105
GO:0004635 |
| AF-A0A846BZT2-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9838 | 7 | 102 |
GO:0000105
GO:0004635 |
| AF-A0A1I2QMN9-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9822 | 18 | 112 |
GO:0000105
GO:0004635 |
| AF-A0A6J6EZC2-F1-model_v4 | Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) | 0.9811 | 18 | 112 |
GO:0000105
GO:0004635 GO:0005737 |
| AF-A0A2H1HXQ3-F1-model_v4 | Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) | 0.9807 | 18 | 112 |
GO:0000105
GO:0000287 GO:0004635 GO:0005737 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar