F493605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1393 | 388 | 2786 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10681966|Ga0114129_106819661 |
| Length | 408 |
| Sequence | MNSGRLKRLLKLQAEEEERKCNDAAIEPTNRPLTVAAQFRNVHVRRRLPSRDHREGSAIINFFALRPVQEDPLLPELRKDPISGRWVIVATDSARRPSDFVREPVPVPAVNGVCPLCPGNEPKTRPEVLAFRQNGGGANSAGWSLRVVPNKFPVLGVEGDLRRQGEGMFDKMSGVGAHEVIVETPDHCQTLSDLSQKQIEDVLWAFRNRVLDLRQDKRLRYAVMFKNFGEAAGATLEHSHSQLIALPVIPKRVREEIEGARAYYQFKERCIYCDIVQQETQAGVRLILETDRFVVIAPYAARFPFETWILPKRHESHFEETEPATMGNLAWVLRATLRKMACVLERPAYNFVIHSAPLQEGQMPEYHWHIEIMPKLTRVAGFEWATGFHINPTPPEEAAKFLRDAGVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 274 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 386 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 387 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 388 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.65 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 97.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10681966 | 3300009147 | Bacteria | 1323 |
| 2 | JGI25406J46586_10020362 | 3300003203 | Unclassified | 2684 |
| 3 | Ga0058863_10101987 | 3300004799 | Bacteria | 4056 |
| 4 | Ga0058861_11763141 | 3300004800 | Unclassified | 1945 |
| 5 | Ga0058862_11755211 | 3300004803 | Bacteria | 1622 |
| 6 | Ga0065714_10109055 | 3300005288 | Bacteria | 1506 |
| 7 | Ga0065712_10070553 | 3300005290 | Bacteria | 5911 |
| 8 | Ga0065712_10088406 | 3300005290 | Bacteria | 2512 |
| 9 | Ga0065712_10098888 | 3300005290 | Bacteria | 2106 |
| 10 | Ga0065715_10198264 | 3300005293 | Unclassified | 1376 |
| 11 | Ga0065707_10002787 | 3300005295 | Bacteria | 4264 |
| 12 | Ga0065707_10014613 | 3300005295 | Bacteria | 2771 |
| 13 | Ga0065707_10083645 | 3300005295 | Bacteria | 8555 |
| 14 | Ga0065707_10094018 | 3300005295 | Bacteria | 3549 |
| 15 | Ga0065707_10134884 | 3300005295 | Bacteria | 1856 |
| 16 | Ga0065707_10137407 | 3300005295 | Bacteria | 1821 |
| 17 | Ga0070676_10027352 | 3300005328 | Bacteria | 3233 |
| 18 | Ga0070683_100000048 | 3300005329 | Bacteria | 93771 |
| 19 | Ga0070683_100051625 | 3300005329 | Bacteria | 3808 |
| 20 | Ga0070683_100054837 | 3300005329 | Unclassified | 3697 |
| 21 | Ga0070683_100115499 | 3300005329 | Bacteria | 2534 |
| 22 | Ga0070690_100002213 | 3300005330 | Bacteria | 10410 |
| 23 | Ga0070670_100003569 | 3300005331 | Bacteria | 12941 |
| 24 | Ga0070670_100036486 | 3300005331 | Bacteria | 4230 |
| 25 | Ga0070670_100266192 | 3300005331 | Bacteria | 1495 |
| 26 | Ga0068869_100075258 | 3300005334 | Bacteria | 2508 |
| 27 | Ga0070666_10035605 | 3300005335 | Bacteria | 3302 |
| 28 | Ga0070666_10125374 | 3300005335 | Bacteria | 1783 |
| 29 | Ga0070680_100012542 | 3300005336 | Bacteria | 6587 |
| 30 | Ga0070680_100015561 | 3300005336 | Bacteria | 5968 |
| 31 | Ga0070680_100025973 | 3300005336 | Bacteria | 4684 |
| 32 | Ga0070680_100122737 | 3300005336 | Bacteria | 2169 |
| 33 | Ga0068868_100008891 | 3300005338 | Bacteria | 7200 |
| 34 | Ga0068868_100090672 | 3300005338 | Unclassified | 2462 |
| 35 | Ga0068868_100165327 | 3300005338 | Bacteria | 1830 |
| 36 | Ga0070689_100007004 | 3300005340 | Bacteria | 7856 |
| 37 | Ga0070689_100012178 | 3300005340 | Bacteria | 6187 |
| 38 | Ga0070689_100214622 | 3300005340 | Bacteria | 1576 |
| 39 | Ga0070689_100370373 | 3300005340 | Unclassified | 1205 |
| 40 | Ga0070687_100015273 | 3300005343 | Bacteria | 3468 |
| 41 | Ga0070687_100016131 | 3300005343 | Bacteria | 3398 |
| 42 | Ga0070692_10024447 | 3300005345 | Bacteria | 2968 |
| 43 | Ga0070668_100023718 | 3300005347 | Bacteria | 4643 |
| 44 | Ga0070668_100357464 | 3300005347 | Bacteria | 1237 |
| 45 | Ga0070669_100042332 | 3300005353 | Unclassified | 3314 |
| 46 | Ga0070669_100046316 | 3300005353 | Bacteria | 3171 |
| 47 | Ga0070669_100065428 | 3300005353 | Bacteria | 2678 |
| 48 | Ga0070669_100097360 | 3300005353 | Bacteria | 2215 |
| 49 | Ga0070669_100193922 | 3300005353 | Bacteria | 1595 |
| 50 | Ga0070669_100325849 | 3300005353 | Bacteria | 1241 |
| 51 | Ga0070675_100000863 | 3300005354 | Bacteria | 21563 |
| 52 | Ga0070675_100017018 | 3300005354 | Bacteria | 5778 |
| 53 | Ga0070675_100091118 | 3300005354 | Bacteria | 2554 |
| 54 | Ga0070675_100289465 | 3300005354 | Bacteria | 1441 |
| 55 | Ga0070671_100041907 | 3300005355 | Bacteria | 3805 |
| 56 | Ga0070671_100167081 | 3300005355 | Bacteria | 1860 |
| 57 | Ga0070674_100024753 | 3300005356 | Bacteria | 3899 |
| 58 | Ga0070674_100143483 | 3300005356 | Bacteria | 1795 |
| 59 | Ga0070673_100004711 | 3300005364 | Bacteria | 8657 |
| 60 | Ga0070673_100005778 | 3300005364 | Bacteria | 7965 |
| 61 | Ga0070673_100024730 | 3300005364 | Bacteria | 4408 |
| 62 | Ga0070673_100080756 | 3300005364 | Bacteria | 2636 |
| 63 | Ga0070673_100148706 | 3300005364 | Bacteria | 1982 |
| 64 | Ga0070673_100156177 | 3300005364 | Bacteria | 1936 |
| 65 | Ga0070688_100021384 | 3300005365 | Bacteria | 3779 |
| 66 | Ga0070688_100029736 | 3300005365 | Unclassified | 3274 |
| 67 | Ga0070688_100048620 | 3300005365 | Bacteria | 2636 |
| 68 | Ga0070688_100056651 | 3300005365 | Bacteria | 2462 |
| 69 | Ga0070659_100145925 | 3300005366 | Bacteria | 1928 |
| 70 | Ga0070667_100202517 | 3300005367 | Bacteria | 1761 |
| 71 | Ga0070703_10000403 | 3300005406 | Bacteria | 18037 |
| 72 | Ga0070703_10009210 | 3300005406 | Unclassified | 2786 |
| 73 | Ga0070703_10015520 | 3300005406 | Bacteria | 2180 |
| 74 | Ga0070703_10062047 | 3300005406 | Bacteria | 1226 |
| 75 | Ga0070709_10000029 | 3300005434 | Bacteria | 119772 |
| 76 | Ga0070709_10020756 | 3300005434 | Bacteria | 3819 |
| 77 | Ga0070709_10039088 | 3300005434 | Unclassified | 2909 |
| 78 | Ga0070709_10082239 | 3300005434 | Bacteria | 2104 |
| 79 | Ga0070709_10124081 | 3300005434 | Bacteria | 1755 |
| 80 | Ga0070709_10185678 | 3300005434 | Unclassified | 1463 |
| 81 | Ga0070714_100011082 | 3300005435 | Bacteria | 7145 |
| 82 | Ga0070713_100005215 | 3300005436 | Bacteria | 8854 |
| 83 | Ga0070713_100008039 | 3300005436 | Bacteria | 7452 |
| 84 | Ga0070713_100009698 | 3300005436 | Bacteria | 6914 |
| 85 | Ga0070713_100076213 | 3300005436 | Unclassified | 2847 |
| 86 | Ga0070713_100297751 | 3300005436 | Bacteria | 1484 |
| 87 | Ga0070710_10002860 | 3300005437 | Bacteria | 8223 |
| 88 | Ga0070710_10087151 | 3300005437 | Bacteria | 1835 |
| 89 | Ga0070710_10120772 | 3300005437 | Bacteria | 1586 |
| 90 | Ga0070701_10017984 | 3300005438 | Bacteria | 3316 |
| 91 | Ga0070701_10026950 | 3300005438 | Bacteria | 2809 |
| 92 | Ga0070701_10027813 | 3300005438 | Bacteria | 2774 |
| 93 | Ga0070701_10101166 | 3300005438 | Bacteria | 1597 |
| 94 | Ga0070711_100000027 | 3300005439 | Bacteria | 108952 |
| 95 | Ga0070711_100003000 | 3300005439 | Bacteria | 9749 |
| 96 | Ga0070711_100011074 | 3300005439 | Bacteria | 5596 |
| 97 | Ga0070711_100017969 | 3300005439 | Bacteria | 4508 |
| 98 | Ga0070711_100042422 | 3300005439 | Bacteria | 3075 |
| 99 | Ga0070711_100052621 | 3300005439 | Bacteria | 2803 |
| 100 | Ga0070705_100000221 | 3300005440 | Bacteria | 33830 |
| 101 | Ga0070705_100002104 | 3300005440 | Bacteria | 10142 |
| 102 | Ga0070705_100005766 | 3300005440 | Bacteria | 6052 |
| 103 | Ga0070705_100008819 | 3300005440 | Bacteria | 4997 |
| 104 | Ga0070705_100088584 | 3300005440 | Bacteria | 1922 |
| 105 | Ga0070700_100030711 | 3300005441 | Unclassified | 3214 |
| 106 | Ga0070700_100031058 | 3300005441 | Bacteria | 3197 |
| 107 | Ga0070694_100003286 | 3300005444 | Bacteria | 9664 |
| 108 | Ga0070694_100005213 | 3300005444 | Bacteria | 7851 |
| 109 | Ga0070694_100006791 | 3300005444 | Bacteria | 6950 |
| 110 | Ga0070694_100102871 | 3300005444 | Bacteria | 2023 |
| 111 | Ga0070694_100195836 | 3300005444 | Bacteria | 1503 |
| 112 | Ga0070694_100209803 | 3300005444 | Bacteria | 1456 |
| 113 | Ga0070708_100006107 | 3300005445 | Bacteria | 9582 |
| 114 | Ga0070708_100021130 | 3300005445 | Bacteria | 5498 |
| 115 | Ga0070708_100082824 | 3300005445 | Bacteria | 2907 |
| 116 | Ga0070708_100295673 | 3300005445 | Unclassified | 1525 |
| 117 | Ga0070708_100326402 | 3300005445 | Unclassified | 1446 |
| 118 | Ga0070678_100104267 | 3300005456 | Bacteria | 2205 |
| 119 | Ga0070678_100262381 | 3300005456 | Bacteria | 1453 |
| 120 | Ga0070678_100335093 | 3300005456 | Bacteria | 1296 |
| 121 | Ga0070662_100050452 | 3300005457 | Bacteria | 3002 |
| 122 | Ga0070662_100081810 | 3300005457 | Bacteria | 2407 |
| 123 | Ga0070662_100088775 | 3300005457 | Bacteria | 2318 |
| 124 | Ga0070681_10000242 | 3300005458 | Bacteria | 43180 |
| 125 | Ga0070681_10008930 | 3300005458 | Bacteria | 9852 |
| 126 | Ga0070681_10010266 | 3300005458 | Bacteria | 9241 |
| 127 | Ga0070681_10428787 | 3300005458 | Unclassified | 1234 |
| 128 | Ga0070681_10447933 | 3300005458 | Unclassified | 1203 |
| 129 | Ga0068867_100003936 | 3300005459 | Bacteria | 10458 |
| 130 | Ga0068867_100021810 | 3300005459 | Bacteria | 4573 |
| 131 | Ga0068867_100038696 | 3300005459 | Bacteria | 3473 |
| 132 | Ga0068867_100451137 | 3300005459 | Bacteria | 1096 |
| 133 | Ga0070706_100000208 | 3300005467 | Bacteria | 72971 |
| 134 | Ga0070706_100007222 | 3300005467 | Bacteria | 10441 |
| 135 | Ga0070706_100042144 | 3300005467 | Bacteria | 4215 |
| 136 | Ga0070706_100086813 | 3300005467 | Bacteria | 2899 |
| 137 | Ga0070706_100156077 | 3300005467 | Bacteria | 2130 |
| 138 | Ga0070706_100204180 | 3300005467 | Unclassified | 1846 |
| 139 | Ga0070706_100274116 | 3300005467 | Bacteria | 1574 |
| 140 | Ga0070706_100430419 | 3300005467 | Unclassified | 1228 |
| 141 | Ga0070707_100020689 | 3300005468 | Bacteria | 6209 |
| 142 | Ga0070707_100055558 | 3300005468 | Bacteria | 3796 |
| 143 | Ga0070707_100081064 | 3300005468 | Bacteria | 3132 |
| 144 | Ga0070707_100102983 | 3300005468 | Unclassified | 2766 |
| 145 | Ga0070707_100120145 | 3300005468 | Bacteria | 2551 |
| 146 | Ga0070707_100191869 | 3300005468 | Unclassified | 1992 |
| 147 | Ga0070707_100240742 | 3300005468 | Bacteria | 1761 |
| 148 | Ga0070707_100348076 | 3300005468 | Bacteria | 1439 |
| 149 | Ga0070707_100461909 | 3300005468 | Bacteria | 1230 |
| 150 | Ga0070698_100006201 | 3300005471 | Bacteria | 13022 |
| 151 | Ga0070698_100007211 | 3300005471 | Bacteria | 12043 |
| 152 | Ga0070698_100014143 | 3300005471 | Bacteria | 8436 |
| 153 | Ga0070698_100021538 | 3300005471 | Bacteria | 6751 |
| 154 | Ga0070698_100052957 | 3300005471 | Bacteria | 4126 |
| 155 | Ga0070698_100145794 | 3300005471 | Bacteria | 2317 |
| 156 | Ga0070699_100000029 | 3300005518 | Bacteria | 151185 |
| 157 | Ga0070699_100001721 | 3300005518 | Bacteria | 19955 |
| 158 | Ga0070699_100001814 | 3300005518 | Bacteria | 19414 |
| 159 | Ga0070699_100002759 | 3300005518 | Bacteria | 15658 |
| 160 | Ga0070699_100003831 | 3300005518 | Bacteria | 13288 |
| 161 | Ga0070699_100011338 | 3300005518 | Bacteria | 7695 |
| 162 | Ga0070699_100038432 | 3300005518 | Bacteria | 4144 |
| 163 | Ga0070699_100075638 | 3300005518 | Bacteria | 2931 |
| 164 | Ga0070699_100114935 | 3300005518 | Bacteria | 2365 |
| 165 | Ga0070699_100207133 | 3300005518 | Bacteria | 1745 |
| 166 | Ga0070699_100216768 | 3300005518 | Bacteria | 1705 |
| 167 | Ga0070699_100260318 | 3300005518 | Bacteria | 1551 |
| 168 | Ga0070699_100342557 | 3300005518 | Bacteria | 1346 |
| 169 | Ga0070699_100374643 | 3300005518 | Bacteria | 1284 |
| 170 | Ga0070699_100379795 | 3300005518 | Bacteria | 1276 |
| 171 | Ga0070679_100014473 | 3300005530 | Bacteria | 7577 |
| 172 | Ga0070679_100066444 | 3300005530 | Bacteria | 3594 |
| 173 | Ga0070684_100000038 | 3300005535 | Bacteria | 94959 |
| 174 | Ga0070684_100053735 | 3300005535 | Bacteria | 3508 |
| 175 | Ga0070684_100083985 | 3300005535 | Bacteria | 2822 |
| 176 | Ga0070684_100408693 | 3300005535 | Bacteria | 1252 |
| 177 | Ga0070697_100000522 | 3300005536 | Bacteria | 28975 |
| 178 | Ga0070697_100011943 | 3300005536 | Bacteria | 6799 |
| 179 | Ga0070697_100027403 | 3300005536 | Bacteria | 4558 |
| 180 | Ga0070697_100050479 | 3300005536 | Bacteria | 3376 |
| 181 | Ga0070697_100103069 | 3300005536 | Bacteria | 2371 |
| 182 | Ga0070697_100286198 | 3300005536 | Unclassified | 1415 |
| 183 | Ga0070697_100286644 | 3300005536 | Unclassified | 1414 |
| 184 | Ga0070672_100033032 | 3300005543 | Bacteria | 3914 |
| 185 | Ga0070672_100041249 | 3300005543 | Bacteria | 3547 |
| 186 | Ga0070672_100099821 | 3300005543 | Bacteria | 2353 |
| 187 | Ga0070672_100123433 | 3300005543 | Bacteria | 2122 |
| 188 | Ga0070686_100002326 | 3300005544 | Bacteria | 10487 |
| 189 | Ga0070695_100003478 | 3300005545 | Bacteria | 9199 |
| 190 | Ga0070695_100027675 | 3300005545 | Bacteria | 3514 |
| 191 | Ga0070695_100093607 | 3300005545 | Bacteria | 2011 |
| 192 | Ga0070695_100118096 | 3300005545 | Unclassified | 1811 |
| 193 | Ga0070695_100198403 | 3300005545 | Bacteria | 1432 |
| 194 | Ga0070696_100000362 | 3300005546 | Bacteria | 27732 |
| 195 | Ga0070696_100002039 | 3300005546 | Bacteria | 13250 |
| 196 | Ga0070696_100011391 | 3300005546 | Bacteria | 5957 |
| 197 | Ga0070696_100015421 | 3300005546 | Bacteria | 5131 |
| 198 | Ga0070696_100017408 | 3300005546 | Bacteria | 4850 |
| 199 | Ga0070696_100022395 | 3300005546 | Bacteria | 4292 |
| 200 | Ga0070696_100039752 | 3300005546 | Bacteria | 3248 |
| 201 | Ga0070696_100059475 | 3300005546 | Bacteria | 2671 |
| 202 | Ga0070696_100095540 | 3300005546 | Bacteria | 2123 |
| 203 | Ga0070696_100133056 | 3300005546 | Bacteria | 1811 |
| 204 | Ga0070696_100155335 | 3300005546 | Bacteria | 1682 |
| 205 | Ga0070693_100000012 | 3300005547 | Bacteria | 71975 |
| 206 | Ga0070693_100033253 | 3300005547 | Bacteria | 2844 |
| 207 | Ga0070665_100026922 | 3300005548 | Bacteria | 5791 |
| 208 | Ga0070665_100401326 | 3300005548 | Bacteria | 1379 |
| 209 | Ga0070704_100003038 | 3300005549 | Bacteria | 9551 |
| 210 | Ga0070704_100014058 | 3300005549 | Bacteria | 4989 |
| 211 | Ga0070704_100023424 | 3300005549 | Bacteria | 4033 |
| 212 | Ga0070704_100040094 | 3300005549 | Bacteria | 3221 |
| 213 | Ga0070704_100070671 | 3300005549 | Bacteria | 2533 |
| 214 | Ga0070704_100348200 | 3300005549 | Bacteria | 1250 |
| 215 | Ga0070704_100398357 | 3300005549 | Bacteria | 1174 |
| 216 | Ga0068855_100048548 | 3300005563 | Bacteria | 5009 |
| 217 | Ga0068855_100049629 | 3300005563 | Bacteria | 4949 |
| 218 | Ga0068855_100051195 | 3300005563 | Bacteria | 4865 |
| 219 | Ga0068855_100080341 | 3300005563 | Bacteria | 3781 |
| 220 | Ga0070664_100001762 | 3300005564 | Bacteria | 17341 |
| 221 | Ga0070664_100079139 | 3300005564 | Bacteria | 2828 |
| 222 | Ga0070664_100081513 | 3300005564 | Bacteria | 2789 |
| 223 | Ga0070664_100140530 | 3300005564 | Bacteria | 2126 |
| 224 | Ga0070664_100421083 | 3300005564 | Unclassified | 1223 |
| 225 | Ga0068857_100000538 | 3300005577 | Bacteria | 27467 |
| 226 | Ga0068857_100005072 | 3300005577 | Bacteria | 11195 |
| 227 | Ga0068857_100022733 | 3300005577 | Bacteria | 5516 |
| 228 | Ga0068857_100402436 | 3300005577 | Bacteria | 1274 |
| 229 | Ga0068854_100005914 | 3300005578 | Bacteria | 7749 |
| 230 | Ga0068854_100148965 | 3300005578 | Unclassified | 1803 |
| 231 | Ga0068856_100000618 | 3300005614 | Bacteria | 38933 |
| 232 | Ga0068856_100002308 | 3300005614 | Bacteria | 19646 |
| 233 | Ga0068856_100017427 | 3300005614 | Bacteria | 6960 |
| 234 | Ga0068856_100038178 | 3300005614 | Bacteria | 4714 |
| 235 | Ga0070702_100020714 | 3300005615 | Bacteria | 3449 |
| 236 | Ga0068852_100119127 | 3300005616 | Unclassified | 2413 |
| 237 | Ga0068852_100184558 | 3300005616 | Bacteria | 1964 |
| 238 | Ga0068859_100001945 | 3300005617 | Bacteria | 21072 |
| 239 | Ga0068859_100063870 | 3300005617 | Unclassified | 3713 |
| 240 | Ga0068859_100289434 | 3300005617 | Unclassified | 1731 |
| 241 | Ga0068859_100291291 | 3300005617 | Bacteria | 1726 |
| 242 | Ga0068859_100342706 | 3300005617 | Bacteria | 1589 |
| 243 | Ga0068859_100706628 | 3300005617 | Unclassified | 1099 |
| 244 | Ga0068864_100009721 | 3300005618 | Bacteria | 7936 |
| 245 | Ga0068864_100015208 | 3300005618 | Bacteria | 6400 |
| 246 | Ga0068864_100036850 | 3300005618 | Bacteria | 4171 |
| 247 | Ga0068864_100054144 | 3300005618 | Bacteria | 3463 |
| 248 | Ga0068864_100128617 | 3300005618 | Bacteria | 2272 |
| 249 | Ga0068866_10009281 | 3300005718 | Bacteria | 4170 |
| 250 | Ga0068861_100096112 | 3300005719 | Bacteria | 2347 |
| 251 | Ga0068861_100101019 | 3300005719 | Bacteria | 2294 |
| 252 | Ga0068870_10019398 | 3300005840 | Bacteria | 3298 |
| 253 | Ga0068863_100002307 | 3300005841 | Bacteria | 18968 |
| 254 | Ga0068863_100006891 | 3300005841 | Bacteria | 11135 |
| 255 | Ga0068863_100095180 | 3300005841 | Bacteria | 2826 |
| 256 | Ga0068863_100243708 | 3300005841 | Unclassified | 1735 |
| 257 | Ga0068863_100280098 | 3300005841 | Bacteria | 1615 |
| 258 | Ga0068863_100437126 | 3300005841 | Bacteria | 1283 |
| 259 | Ga0068858_100008072 | 3300005842 | Bacteria | 10137 |
| 260 | Ga0068858_100009268 | 3300005842 | Bacteria | 9400 |
| 261 | Ga0068858_100055451 | 3300005842 | Unclassified | 3664 |
| 262 | Ga0068858_100060731 | 3300005842 | Bacteria | 3494 |
| 263 | Ga0068858_100209387 | 3300005842 | Unclassified | 1845 |
| 264 | Ga0068858_100288158 | 3300005842 | Bacteria | 1565 |
| 265 | Ga0068860_100007055 | 3300005843 | Bacteria | 11247 |
| 266 | Ga0068860_100013803 | 3300005843 | Bacteria | 7921 |
| 267 | Ga0068860_100071180 | 3300005843 | Bacteria | 3306 |
| 268 | Ga0068860_100281787 | 3300005843 | Bacteria | 1624 |
| 269 | Ga0068860_100347766 | 3300005843 | Bacteria | 1458 |
| 270 | Ga0068860_100363247 | 3300005843 | Bacteria | 1427 |
| 271 | Ga0068862_100006997 | 3300005844 | Bacteria | 9364 |
| 272 | Ga0068862_100084035 | 3300005844 | Bacteria | 2765 |
| 273 | Ga0068862_100299418 | 3300005844 | Bacteria | 1479 |
| 274 | Ga0068862_100342259 | 3300005844 | Bacteria | 1385 |
| 275 | Ga0068862_100427316 | 3300005844 | Bacteria | 1244 |
| 276 | Ga0081455_10031589 | 3300005937 | Bacteria | 4787 |
| 277 | Ga0081455_10064885 | 3300005937 | Bacteria | 3056 |
| 278 | Ga0081455_10119536 | 3300005937 | Bacteria | 2078 |
| 279 | Ga0081539_10000034 | 3300005985 | Bacteria | 307597 |
| 280 | Ga0081539_10000092 | 3300005985 | Bacteria | 208968 |
| 281 | Ga0081539_10000151 | 3300005985 | Bacteria | 160054 |
| 282 | Ga0070717_10026495 | 3300006028 | Unclassified | 4624 |
| 283 | Ga0070717_10352599 | 3300006028 | Bacteria | 1316 |
| 284 | Ga0070717_10357667 | 3300006028 | Unclassified | 1306 |
| 285 | Ga0075432_10033266 | 3300006058 | Bacteria | 1788 |
| 286 | Ga0075432_10056822 | 3300006058 | Bacteria | 1388 |
| 287 | Ga0070715_10009767 | 3300006163 | Bacteria | 3394 |
| 288 | Ga0070715_10138434 | 3300006163 | Bacteria | 1180 |
| 289 | Ga0070715_10166022 | 3300006163 | Bacteria | 1095 |
| 290 | Ga0070716_100000362 | 3300006173 | Bacteria | 18659 |
| 291 | Ga0070716_100001947 | 3300006173 | Bacteria | 9386 |
| 292 | Ga0070716_100005601 | 3300006173 | Bacteria | 6098 |
| 293 | Ga0070716_100010580 | 3300006173 | Bacteria | 4629 |
| 294 | Ga0070716_100042990 | 3300006173 | Bacteria | 2524 |
| 295 | Ga0070716_100061004 | 3300006173 | Bacteria | 2181 |
| 296 | Ga0070716_100095408 | 3300006173 | Bacteria | 1810 |
| 297 | Ga0070716_100148845 | 3300006173 | Unclassified | 1503 |
| 298 | Ga0097621_100001489 | 3300006237 | Bacteria | 16057 |
| 299 | Ga0097621_100030411 | 3300006237 | Bacteria | 4274 |
| 300 | Ga0097621_100072830 | 3300006237 | Bacteria | 2843 |
| 301 | Ga0097621_100135159 | 3300006237 | Bacteria | 2102 |
| 302 | Ga0097621_100155599 | 3300006237 | Bacteria | 1962 |
| 303 | Ga0097621_100348193 | 3300006237 | Bacteria | 1317 |
| 304 | Ga0075370_10110391 | 3300006353 | Bacteria | 1597 |
| 305 | Ga0068871_100006737 | 3300006358 | Bacteria | 8158 |
| 306 | Ga0068871_100031351 | 3300006358 | Bacteria | 4192 |
| 307 | Ga0068871_100327930 | 3300006358 | Bacteria | 1350 |
| 308 | Ga0075428_100000398 | 3300006844 | Bacteria | 43056 |
| 309 | Ga0075428_100000421 | 3300006844 | Bacteria | 42169 |
| 310 | Ga0075428_100001485 | 3300006844 | Bacteria | 25073 |
| 311 | Ga0075428_100002532 | 3300006844 | Bacteria | 19874 |
| 312 | Ga0075428_100005186 | 3300006844 | Bacteria | 14469 |
| 313 | Ga0075428_100013592 | 3300006844 | Bacteria | 9065 |
| 314 | Ga0075428_100014142 | 3300006844 | Bacteria | 8881 |
| 315 | Ga0075428_100027532 | 3300006844 | Bacteria | 6290 |
| 316 | Ga0075428_100044754 | 3300006844 | Bacteria | 4863 |
| 317 | Ga0075428_100070705 | 3300006844 | Bacteria | 3815 |
| 318 | Ga0075428_100128474 | 3300006844 | Bacteria | 2757 |
| 319 | Ga0075428_100179736 | 3300006844 | Bacteria | 2290 |
| 320 | Ga0075428_100248391 | 3300006844 | Bacteria | 1918 |
| 321 | Ga0075428_100282848 | 3300006844 | Bacteria | 1785 |
| 322 | Ga0075428_100479810 | 3300006844 | Unclassified | 1331 |
| 323 | Ga0075430_100000341 | 3300006846 | Bacteria | 33734 |
| 324 | Ga0075430_100000882 | 3300006846 | Bacteria | 23536 |
| 325 | Ga0075430_100007002 | 3300006846 | Bacteria | 9506 |
| 326 | Ga0075430_100007723 | 3300006846 | Bacteria | 9088 |
| 327 | Ga0075430_100024148 | 3300006846 | Bacteria | 5175 |
| 328 | Ga0075430_100076865 | 3300006846 | Bacteria | 2798 |
| 329 | Ga0075430_100127416 | 3300006846 | Bacteria | 2122 |
| 330 | Ga0075430_100193047 | 3300006846 | Bacteria | 1692 |
| 331 | Ga0075431_100001562 | 3300006847 | Bacteria | 21263 |
| 332 | Ga0075431_100002961 | 3300006847 | Bacteria | 16438 |
| 333 | Ga0075431_100006021 | 3300006847 | Bacteria | 12020 |
| 334 | Ga0075431_100007984 | 3300006847 | Bacteria | 10556 |
| 335 | Ga0075431_100019021 | 3300006847 | Bacteria | 6998 |
| 336 | Ga0075431_100025142 | 3300006847 | Bacteria | 6103 |
| 337 | Ga0075431_100029241 | 3300006847 | Bacteria | 5670 |
| 338 | Ga0075431_100031771 | 3300006847 | Bacteria | 5438 |
| 339 | Ga0075431_100043975 | 3300006847 | Bacteria | 4607 |
| 340 | Ga0075431_100062732 | 3300006847 | Bacteria | 3835 |
| 341 | Ga0075431_100227665 | 3300006847 | Bacteria | 1900 |
| 342 | Ga0075431_100297281 | 3300006847 | Bacteria | 1632 |
| 343 | Ga0075433_10000305 | 3300006852 | Bacteria | 29652 |
| 344 | Ga0075433_10000783 | 3300006852 | Bacteria | 21957 |
| 345 | Ga0075433_10027368 | 3300006852 | Bacteria | 4835 |
| 346 | Ga0075433_10036132 | 3300006852 | Bacteria | 4253 |
| 347 | Ga0075433_10065298 | 3300006852 | Bacteria | 3192 |
| 348 | Ga0075433_10079756 | 3300006852 | Bacteria | 2885 |
| 349 | Ga0075433_10110227 | 3300006852 | Bacteria | 2442 |
| 350 | Ga0075433_10133243 | 3300006852 | Bacteria | 2208 |
| 351 | Ga0075433_10309278 | 3300006852 | Unclassified | 1399 |
| 352 | Ga0075433_10457953 | 3300006852 | Unclassified | 1124 |
| 353 | Ga0075434_100000107 | 3300006871 | Bacteria | 47551 |
| 354 | Ga0075434_100006811 | 3300006871 | Bacteria | 10512 |
| 355 | Ga0075434_100015784 | 3300006871 | Bacteria | 7250 |
| 356 | Ga0075434_100033258 | 3300006871 | Bacteria | 5088 |
| 357 | Ga0075434_100052289 | 3300006871 | Bacteria | 4059 |
| 358 | Ga0075434_100054358 | 3300006871 | Bacteria | 3978 |
| 359 | Ga0075434_100056056 | 3300006871 | Bacteria | 3916 |
| 360 | Ga0075434_100065144 | 3300006871 | Bacteria | 3629 |
| 361 | Ga0075434_100076997 | 3300006871 | Bacteria | 3330 |
| 362 | Ga0075434_100085346 | 3300006871 | Bacteria | 3156 |
| 363 | Ga0075434_100089634 | 3300006871 | Bacteria | 3076 |
| 364 | Ga0075434_100110722 | 3300006871 | Bacteria | 2757 |
| 365 | Ga0075434_100141417 | 3300006871 | Bacteria | 2426 |
| 366 | Ga0075434_100212937 | 3300006871 | Bacteria | 1952 |
| 367 | Ga0075434_100246506 | 3300006871 | Bacteria | 1806 |
| 368 | Ga0075434_100454812 | 3300006871 | Unclassified | 1301 |
| 369 | Ga0075429_100001205 | 3300006880 | Bacteria | 20971 |
| 370 | Ga0075429_100007238 | 3300006880 | Bacteria | 9627 |
| 371 | Ga0075429_100011821 | 3300006880 | Bacteria | 7569 |
| 372 | Ga0075429_100060770 | 3300006880 | Bacteria | 3291 |
| 373 | Ga0075429_100122767 | 3300006880 | Bacteria | 2270 |
| 374 | Ga0075429_100199639 | 3300006880 | Bacteria | 1752 |
| 375 | Ga0075429_100244247 | 3300006880 | Bacteria | 1572 |
| 376 | Ga0075429_100342578 | 3300006880 | Bacteria | 1308 |
| 377 | Ga0068865_100206577 | 3300006881 | Bacteria | 1528 |
| 378 | Ga0075436_100000592 | 3300006914 | Bacteria | 23758 |
| 379 | Ga0075436_100001557 | 3300006914 | Bacteria | 15650 |
| 380 | Ga0075436_100001958 | 3300006914 | Bacteria | 14199 |
| 381 | Ga0075436_100004307 | 3300006914 | Bacteria | 9769 |
| 382 | Ga0075436_100015198 | 3300006914 | Bacteria | 5274 |
| 383 | Ga0075436_100017110 | 3300006914 | Bacteria | 4962 |
| 384 | Ga0075436_100019077 | 3300006914 | Bacteria | 4698 |
| 385 | Ga0075436_100100178 | 3300006914 | Unclassified | 2017 |
| 386 | Ga0075436_100190857 | 3300006914 | Bacteria | 1449 |
| 387 | Ga0075436_100227566 | 3300006914 | Bacteria | 1324 |
| 388 | Ga0097620_100001945 | 3300006931 | Bacteria | 21072 |
| 389 | Ga0097620_100063869 | 3300006931 | Unclassified | 3713 |
| 390 | Ga0097620_100289466 | 3300006931 | Unclassified | 1731 |
| 391 | Ga0097620_100291263 | 3300006931 | Bacteria | 1726 |
| 392 | Ga0097620_100342705 | 3300006931 | Bacteria | 1589 |
| 393 | Ga0097620_100706566 | 3300006931 | Unclassified | 1099 |
| 394 | Ga0075435_100000054 | 3300007076 | Bacteria | 58537 |
| 395 | Ga0075435_100007100 | 3300007076 | Bacteria | 7954 |
| 396 | Ga0075435_100009536 | 3300007076 | Bacteria | 7037 |
| 397 | Ga0075435_100026771 | 3300007076 | Bacteria | 4504 |
| 398 | Ga0075435_100067955 | 3300007076 | Bacteria | 2902 |
| 399 | Ga0075435_100208621 | 3300007076 | Bacteria | 1656 |
| 400 | Ga0075435_100278562 | 3300007076 | Bacteria | 1427 |
| 401 | Ga0099794_10000854 | 3300007265 | Bacteria | 10286 |
| 402 | Ga0099795_10001407 | 3300007788 | Bacteria | 5204 |
| 403 | Ga0105240_10002241 | 3300009093 | Bacteria | 31405 |
| 404 | Ga0105240_10006423 | 3300009093 | Bacteria | 17279 |
| 405 | Ga0105240_10020126 | 3300009093 | Bacteria | 8908 |
| 406 | Ga0105240_10074666 | 3300009093 | Bacteria | 4184 |
| 407 | Ga0105240_10136821 | 3300009093 | Unclassified | 2933 |
| 408 | Ga0105240_10270955 | 3300009093 | Unclassified | 1954 |
| 409 | Ga0105240_10377190 | 3300009093 | Bacteria | 1602 |
| 410 | Ga0111539_10000455 | 3300009094 | Bacteria | 51281 |
| 411 | Ga0111539_10000481 | 3300009094 | Bacteria | 50448 |
| 412 | Ga0111539_10005828 | 3300009094 | Bacteria | 15928 |
| 413 | Ga0111539_10011459 | 3300009094 | Bacteria | 11131 |
| 414 | Ga0111539_10012335 | 3300009094 | Bacteria | 10709 |
| 415 | Ga0111539_10014217 | 3300009094 | Bacteria | 9939 |
| 416 | Ga0111539_10016344 | 3300009094 | Bacteria | 9200 |
| 417 | Ga0111539_10023394 | 3300009094 | Bacteria | 7591 |
| 418 | Ga0111539_10042847 | 3300009094 | Bacteria | 5431 |
| 419 | Ga0111539_10044646 | 3300009094 | Bacteria | 5308 |
| 420 | Ga0111539_10046140 | 3300009094 | Bacteria | 5214 |
| 421 | Ga0111539_10449260 | 3300009094 | Bacteria | 1501 |
| 422 | Ga0111539_10514303 | 3300009094 | Bacteria | 1394 |
| 423 | Ga0111539_10542901 | 3300009094 | Bacteria | 1354 |
| 424 | Ga0105245_10099472 | 3300009098 | Unclassified | 2689 |
| 425 | Ga0105245_10336882 | 3300009098 | Bacteria | 1491 |
| 426 | Ga0114129_10000704 | 3300009147 | Bacteria | 42132 |
| 427 | Ga0114129_10000726 | 3300009147 | Bacteria | 41775 |
| 428 | Ga0114129_10001085 | 3300009147 | Bacteria | 35711 |
| 429 | Ga0114129_10004758 | 3300009147 | Bacteria | 19182 |
| 430 | Ga0114129_10005676 | 3300009147 | Bacteria | 17663 |
| 431 | Ga0114129_10007659 | 3300009147 | Bacteria | 15369 |
| 432 | Ga0114129_10008153 | 3300009147 | Bacteria | 14931 |
| 433 | Ga0114129_10008312 | 3300009147 | Bacteria | 14808 |
| 434 | Ga0114129_10011034 | 3300009147 | Bacteria | 12873 |
| 435 | Ga0114129_10011480 | 3300009147 | Bacteria | 12612 |
| 436 | Ga0114129_10014123 | 3300009147 | Bacteria | 11376 |
| 437 | Ga0114129_10017003 | 3300009147 | Bacteria | 10355 |
| 438 | Ga0114129_10060780 | 3300009147 | Bacteria | 5282 |
| 439 | Ga0114129_10067842 | 3300009147 | Bacteria | 4973 |
| 440 | Ga0114129_10070576 | 3300009147 | Bacteria | 4871 |
| 441 | Ga0114129_10114235 | 3300009147 | Bacteria | 3723 |
| 442 | Ga0114129_10125199 | 3300009147 | Bacteria | 3534 |
| 443 | Ga0114129_10149319 | 3300009147 | Bacteria | 3199 |
| 444 | Ga0114129_10208823 | 3300009147 | Bacteria | 2641 |
| 445 | Ga0114129_10211980 | 3300009147 | Bacteria | 2618 |
| 446 | Ga0114129_10227596 | 3300009147 | Bacteria | 2512 |
| 447 | Ga0114129_10433135 | 3300009147 | Bacteria | 1727 |
| 448 | Ga0114129_10463942 | 3300009147 | Bacteria | 1659 |
| 449 | Ga0114129_10579607 | 3300009147 | Unclassified | 1456 |
| 450 | Ga0114129_10810959 | 3300009147 | Bacteria | 1193 |
| 451 | Ga0114129_10831590 | 3300009147 | Bacteria | 1175 |
| 452 | Ga0114129_10849499 | 3300009147 | Bacteria | 1161 |
| 453 | Ga0105243_10047807 | 3300009148 | Bacteria | 3370 |
| 454 | Ga0105243_10064744 | 3300009148 | Bacteria | 2934 |
| 455 | Ga0105243_10132232 | 3300009148 | Bacteria | 2118 |
| 456 | Ga0105241_10091402 | 3300009174 | Bacteria | 2401 |
| 457 | Ga0105241_10381854 | 3300009174 | Bacteria | 1231 |
| 458 | Ga0105242_10094144 | 3300009176 | Bacteria | 2526 |
| 459 | Ga0105242_10134854 | 3300009176 | Bacteria | 2136 |
| 460 | Ga0105248_10007473 | 3300009177 | Bacteria | 11991 |
| 461 | Ga0105248_10030650 | 3300009177 | Bacteria | 6007 |
| 462 | Ga0105248_10059915 | 3300009177 | Bacteria | 4275 |
| 463 | Ga0105248_10093653 | 3300009177 | Bacteria | 3383 |
| 464 | Ga0105248_10117414 | 3300009177 | Bacteria | 3000 |
| 465 | Ga0105248_10327642 | 3300009177 | Bacteria | 1725 |
| 466 | Ga0105248_10608518 | 3300009177 | Bacteria | 1233 |
| 467 | Ga0105237_10020943 | 3300009545 | Bacteria | 6730 |
| 468 | Ga0105237_10026934 | 3300009545 | Bacteria | 5873 |
| 469 | Ga0105238_10000180 | 3300009551 | Bacteria | 68847 |
| 470 | Ga0105238_10014879 | 3300009551 | Bacteria | 7873 |
| 471 | Ga0105249_10025544 | 3300009553 | Bacteria | 5319 |
| 472 | Ga0105249_10096944 | 3300009553 | Bacteria | 2768 |
| 473 | Ga0105249_10270463 | 3300009553 | Bacteria | 1693 |
| 474 | Ga0105249_10341706 | 3300009553 | Bacteria | 1514 |
| 475 | Ga0105239_10006705 | 3300010375 | Bacteria | 13301 |
| 476 | Ga0105246_10486348 | 3300011119 | Bacteria | 1045 |
| 477 | Ga0157370_10001165 | 3300013104 | Bacteria | 32739 |
| 478 | Ga0157370_10083174 | 3300013104 | Unclassified | 3010 |
| 479 | Ga0157370_10094048 | 3300013104 | Bacteria | 2813 |
| 480 | Ga0157369_10000592 | 3300013105 | Bacteria | 47171 |
| 481 | Ga0157369_10115282 | 3300013105 | Unclassified | 2853 |
| 482 | Ga0157369_10140362 | 3300013105 | Unclassified | 2557 |
| 483 | Ga0157374_10000441 | 3300013296 | Bacteria | 37640 |
| 484 | Ga0157374_10204452 | 3300013296 | Bacteria | 1935 |
| 485 | Ga0157374_10242671 | 3300013296 | Unclassified | 1772 |
| 486 | Ga0157374_10447025 | 3300013296 | Bacteria | 1294 |
| 487 | Ga0157374_10462557 | 3300013296 | Bacteria | 1270 |
| 488 | Ga0157378_10003579 | 3300013297 | Bacteria | 13755 |
| 489 | Ga0157378_10025611 | 3300013297 | Bacteria | 5193 |
| 490 | Ga0157378_10069837 | 3300013297 | Bacteria | 3152 |
| 491 | Ga0157378_10129379 | 3300013297 | Bacteria | 2335 |
| 492 | Ga0157378_10248636 | 3300013297 | Bacteria | 1701 |
| 493 | Ga0163162_10282195 | 3300013306 | Bacteria | 1793 |
| 494 | Ga0163162_10404675 | 3300013306 | Unclassified | 1497 |
| 495 | Ga0157372_10003362 | 3300013307 | Bacteria | 17262 |
| 496 | Ga0157372_10074245 | 3300013307 | Unclassified | 3835 |
| 497 | Ga0157375_10085469 | 3300013308 | Bacteria | 3204 |
| 498 | Ga0157375_10140687 | 3300013308 | Bacteria | 2540 |
| 499 | Ga0157375_10148545 | 3300013308 | Bacteria | 2477 |
| 500 | Ga0157375_10202265 | 3300013308 | Bacteria | 2142 |
| 501 | Ga0157375_10206437 | 3300013308 | Bacteria | 2121 |
| 502 | Ga0157375_10262360 | 3300013308 | Bacteria | 1889 |
| 503 | Ga0163163_10038117 | 3300014325 | Bacteria | 4681 |
| 504 | Ga0163163_10043789 | 3300014325 | Bacteria | 4391 |
| 505 | Ga0163163_10083176 | 3300014325 | Bacteria | 3206 |
| 506 | Ga0157380_10033796 | 3300014326 | Bacteria | 3940 |
| 507 | Ga0157380_10131806 | 3300014326 | Bacteria | 2134 |
| 508 | Ga0157380_10345636 | 3300014326 | Bacteria | 1390 |
| 509 | Ga0157380_10346626 | 3300014326 | Bacteria | 1388 |
| 510 | Ga0157377_10057953 | 3300014745 | Bacteria | 2204 |
| 511 | Ga0157377_10100110 | 3300014745 | Bacteria | 1725 |
| 512 | Ga0157379_10076476 | 3300014968 | Bacteria | 2998 |
| 513 | Ga0157379_10102677 | 3300014968 | Bacteria | 2566 |
| 514 | Ga0157379_10177469 | 3300014968 | Bacteria | 1924 |
| 515 | Ga0157376_10000023 | 3300014969 | Bacteria | 223978 |
| 516 | Ga0157376_10141115 | 3300014969 | Bacteria | 2162 |
| 517 | Ga0157376_10182248 | 3300014969 | Bacteria | 1921 |
| 518 | Ga0157376_10204088 | 3300014969 | Bacteria | 1821 |
| 519 | Ga0157376_10209775 | 3300014969 | Bacteria | 1798 |
| 520 | Ga0157376_10224760 | 3300014969 | Bacteria | 1741 |
| 521 | Ga0163161_10072203 | 3300017792 | Bacteria | 2527 |
| 522 | Ga0163161_10305681 | 3300017792 | Unclassified | 1254 |
| 523 | Ga0206351_10837870 | 3300020077 | Bacteria | 1506 |
| 524 | Ga0213873_10001907 | 3300021358 | Bacteria | 3545 |
| 525 | Ga0213876_10038824 | 3300021384 | Bacteria | 2515 |
| 526 | Ga0213876_10039142 | 3300021384 | Bacteria | 2505 |
| 527 | Ga0213875_10004157 | 3300021388 | Bacteria | 8017 |
| 528 | Ga0224572_1004837 | 3300024225 | Unclassified | 2372 |
| 529 | Ga0207697_10087921 | 3300025315 | Bacteria | 1315 |
| 530 | Ga0207653_10000261 | 3300025885 | Bacteria | 32960 |
| 531 | Ga0207653_10011963 | 3300025885 | Unclassified | 2706 |
| 532 | Ga0207692_10013816 | 3300025898 | Bacteria | 3513 |
| 533 | Ga0207692_10014017 | 3300025898 | Unclassified | 3493 |
| 534 | Ga0207642_10089922 | 3300025899 | Bacteria | 1514 |
| 535 | Ga0207680_10026853 | 3300025903 | Bacteria | 3196 |
| 536 | Ga0207685_10028201 | 3300025905 | Bacteria | 1974 |
| 537 | Ga0207685_10045856 | 3300025905 | Unclassified | 1660 |
| 538 | Ga0207699_10000002 | 3300025906 | Bacteria | 662194 |
| 539 | Ga0207699_10024147 | 3300025906 | Bacteria | 3320 |
| 540 | Ga0207699_10067158 | 3300025906 | Bacteria | 2179 |
| 541 | Ga0207699_10110748 | 3300025906 | Bacteria | 1759 |
| 542 | Ga0207699_10114079 | 3300025906 | Bacteria | 1737 |
| 543 | Ga0207645_10034133 | 3300025907 | Bacteria | 3269 |
| 544 | Ga0207643_10033372 | 3300025908 | Bacteria | 2880 |
| 545 | Ga0207643_10200598 | 3300025908 | Bacteria | 1214 |
| 546 | Ga0207705_10228325 | 3300025909 | Unclassified | 1415 |
| 547 | Ga0207684_10000248 | 3300025910 | Bacteria | 80978 |
| 548 | Ga0207684_10005571 | 3300025910 | Bacteria | 11592 |
| 549 | Ga0207684_10100352 | 3300025910 | Bacteria | 2474 |
| 550 | Ga0207684_10404860 | 3300025910 | Unclassified | 1173 |
| 551 | Ga0207654_10032115 | 3300025911 | Bacteria | 2897 |
| 552 | Ga0207654_10211716 | 3300025911 | Bacteria | 1281 |
| 553 | Ga0207707_10001311 | 3300025912 | Bacteria | 23194 |
| 554 | Ga0207707_10003312 | 3300025912 | Bacteria | 14317 |
| 555 | Ga0207707_10010191 | 3300025912 | Bacteria | 8157 |
| 556 | Ga0207707_10061912 | 3300025912 | Bacteria | 3256 |
| 557 | Ga0207695_10017728 | 3300025913 | Bacteria | 8266 |
| 558 | Ga0207695_10024628 | 3300025913 | Bacteria | 6762 |
| 559 | Ga0207695_10033917 | 3300025913 | Bacteria | 5558 |
| 560 | Ga0207695_10070335 | 3300025913 | Bacteria | 3578 |
| 561 | Ga0207695_10087358 | 3300025913 | Bacteria | 3141 |
| 562 | Ga0207695_10238563 | 3300025913 | Bacteria | 1720 |
| 563 | Ga0207671_10021128 | 3300025914 | Unclassified | 4943 |
| 564 | Ga0207671_10112684 | 3300025914 | Unclassified | 2071 |
| 565 | Ga0207693_10021548 | 3300025915 | Bacteria | 5120 |
| 566 | Ga0207693_10028502 | 3300025915 | Bacteria | 4411 |
| 567 | Ga0207663_10000006 | 3300025916 | Bacteria | 253740 |
| 568 | Ga0207663_10072055 | 3300025916 | Bacteria | 2232 |
| 569 | Ga0207663_10112826 | 3300025916 | Unclassified | 1847 |
| 570 | Ga0207663_10132277 | 3300025916 | Bacteria | 1725 |
| 571 | Ga0207660_10006198 | 3300025917 | Bacteria | 7770 |
| 572 | Ga0207660_10021369 | 3300025917 | Unclassified | 4352 |
| 573 | Ga0207660_10038159 | 3300025917 | Unclassified | 3353 |
| 574 | Ga0207660_10067295 | 3300025917 | Bacteria | 2594 |
| 575 | Ga0207660_10069252 | 3300025917 | Bacteria | 2561 |
| 576 | Ga0207660_10108957 | 3300025917 | Bacteria | 2081 |
| 577 | Ga0207662_10013275 | 3300025918 | Bacteria | 4605 |
| 578 | Ga0207662_10083186 | 3300025918 | Bacteria | 1956 |
| 579 | Ga0207662_10267709 | 3300025918 | Unclassified | 1127 |
| 580 | Ga0207657_10159172 | 3300025919 | Bacteria | 1835 |
| 581 | Ga0207652_10016229 | 3300025921 | Bacteria | 6076 |
| 582 | Ga0207652_10153166 | 3300025921 | Bacteria | 2065 |
| 583 | Ga0207652_10240188 | 3300025921 | Bacteria | 1633 |
| 584 | Ga0207646_10000922 | 3300025922 | Bacteria | 37828 |
| 585 | Ga0207646_10012116 | 3300025922 | Bacteria | 8301 |
| 586 | Ga0207646_10063648 | 3300025922 | Bacteria | 3292 |
| 587 | Ga0207646_10071503 | 3300025922 | Bacteria | 3098 |
| 588 | Ga0207646_10138884 | 3300025922 | Bacteria | 2188 |
| 589 | Ga0207646_10147840 | 3300025922 | Bacteria | 2118 |
| 590 | Ga0207646_10151667 | 3300025922 | Bacteria | 2090 |
| 591 | Ga0207646_10275898 | 3300025922 | Bacteria | 1519 |
| 592 | Ga0207681_10002867 | 3300025923 | Bacteria | 10893 |
| 593 | Ga0207681_10014305 | 3300025923 | Bacteria | 4928 |
| 594 | Ga0207681_10033869 | 3300025923 | Bacteria | 3354 |
| 595 | Ga0207681_10097069 | 3300025923 | Bacteria | 2117 |
| 596 | Ga0207681_10298208 | 3300025923 | Bacteria | 1274 |
| 597 | Ga0207694_10001880 | 3300025924 | Bacteria | 17404 |
| 598 | Ga0207694_10120402 | 3300025924 | Bacteria | 2095 |
| 599 | Ga0207650_10009543 | 3300025925 | Bacteria | 6634 |
| 600 | Ga0207650_10063244 | 3300025925 | Unclassified | 2766 |
| 601 | Ga0207650_10109073 | 3300025925 | Bacteria | 2140 |
| 602 | Ga0207650_10212015 | 3300025925 | Unclassified | 1556 |
| 603 | Ga0207659_10001044 | 3300025926 | Bacteria | 16401 |
| 604 | Ga0207659_10026922 | 3300025926 | Bacteria | 3886 |
| 605 | Ga0207659_10058293 | 3300025926 | Bacteria | 2772 |
| 606 | Ga0207659_10074768 | 3300025926 | Bacteria | 2484 |
| 607 | Ga0207659_10106222 | 3300025926 | Unclassified | 2126 |
| 608 | Ga0207700_10014372 | 3300025928 | Bacteria | 5186 |
| 609 | Ga0207700_10015322 | 3300025928 | Bacteria | 5052 |
| 610 | Ga0207700_10020937 | 3300025928 | Unclassified | 4454 |
| 611 | Ga0207664_10006353 | 3300025929 | Bacteria | 8121 |
| 612 | Ga0207664_10035733 | 3300025929 | Bacteria | 3836 |
| 613 | Ga0207644_10011851 | 3300025931 | Bacteria | 5777 |
| 614 | Ga0207644_10029360 | 3300025931 | Bacteria | 3814 |
| 615 | Ga0207706_10021487 | 3300025933 | Bacteria | 5796 |
| 616 | Ga0207706_10066546 | 3300025933 | Unclassified | 3171 |
| 617 | Ga0207706_10090817 | 3300025933 | Bacteria | 2685 |
| 618 | Ga0207706_10418756 | 3300025933 | Unclassified | 1160 |
| 619 | Ga0207686_10048851 | 3300025934 | Bacteria | 2624 |
| 620 | Ga0207686_10353113 | 3300025934 | Bacteria | 1107 |
| 621 | Ga0207670_10051753 | 3300025936 | Bacteria | 2759 |
| 622 | Ga0207670_10185080 | 3300025936 | Bacteria | 1571 |
| 623 | Ga0207670_10205114 | 3300025936 | Bacteria | 1500 |
| 624 | Ga0207704_10068872 | 3300025938 | Bacteria | 2233 |
| 625 | Ga0207704_10223287 | 3300025938 | Unclassified | 1395 |
| 626 | Ga0207665_10000680 | 3300025939 | Bacteria | 22941 |
| 627 | Ga0207665_10001680 | 3300025939 | Bacteria | 14896 |
| 628 | Ga0207665_10006483 | 3300025939 | Bacteria | 7762 |
| 629 | Ga0207665_10007762 | 3300025939 | Bacteria | 7082 |
| 630 | Ga0207665_10062269 | 3300025939 | Bacteria | 2531 |
| 631 | Ga0207665_10083421 | 3300025939 | Bacteria | 2204 |
| 632 | Ga0207665_10094458 | 3300025939 | Bacteria | 2077 |
| 633 | Ga0207665_10105698 | 3300025939 | Bacteria | 1972 |
| 634 | Ga0207665_10106458 | 3300025939 | Bacteria | 1965 |
| 635 | Ga0207665_10159758 | 3300025939 | Bacteria | 1620 |
| 636 | Ga0207665_10183891 | 3300025939 | Bacteria | 1515 |
| 637 | Ga0207665_10253346 | 3300025939 | Bacteria | 1302 |
| 638 | Ga0207691_10028579 | 3300025940 | Bacteria | 5220 |
| 639 | Ga0207691_10039705 | 3300025940 | Bacteria | 4354 |
| 640 | Ga0207691_10069553 | 3300025940 | Bacteria | 3180 |
| 641 | Ga0207691_10089330 | 3300025940 | Bacteria | 2763 |
| 642 | Ga0207691_10117965 | 3300025940 | Bacteria | 2354 |
| 643 | Ga0207691_10236954 | 3300025940 | Unclassified | 1578 |
| 644 | Ga0207691_10264970 | 3300025940 | Bacteria | 1481 |
| 645 | Ga0207711_10047986 | 3300025941 | Bacteria | 3652 |
| 646 | Ga0207711_10126859 | 3300025941 | Bacteria | 2284 |
| 647 | Ga0207711_10145833 | 3300025941 | Bacteria | 2133 |
| 648 | Ga0207711_10201992 | 3300025941 | Bacteria | 1814 |
| 649 | Ga0207711_10326224 | 3300025941 | Bacteria | 1419 |
| 650 | Ga0207711_10507248 | 3300025941 | Bacteria | 1124 |
| 651 | Ga0207689_10065026 | 3300025942 | Bacteria | 3000 |
| 652 | Ga0207689_10325030 | 3300025942 | Bacteria | 1277 |
| 653 | Ga0207661_10000049 | 3300025944 | Bacteria | 93797 |
| 654 | Ga0207661_10036940 | 3300025944 | Bacteria | 3816 |
| 655 | Ga0207661_10197201 | 3300025944 | Bacteria | 1768 |
| 656 | Ga0207679_10021463 | 3300025945 | Bacteria | 4379 |
| 657 | Ga0207679_10044457 | 3300025945 | Bacteria | 3204 |
| 658 | Ga0207679_10127521 | 3300025945 | Bacteria | 2036 |
| 659 | Ga0207667_10025881 | 3300025949 | Bacteria | 6419 |
| 660 | Ga0207667_10061251 | 3300025949 | Bacteria | 3937 |
| 661 | Ga0207667_10067729 | 3300025949 | Bacteria | 3719 |
| 662 | Ga0207667_10070057 | 3300025949 | Unclassified | 3650 |
| 663 | Ga0207667_10112255 | 3300025949 | Bacteria | 2811 |
| 664 | Ga0207667_10167900 | 3300025949 | Bacteria | 2256 |
| 665 | Ga0207651_10028984 | 3300025960 | Bacteria | 3501 |
| 666 | Ga0207651_10038078 | 3300025960 | Bacteria | 3157 |
| 667 | Ga0207651_10093808 | 3300025960 | Unclassified | 2205 |
| 668 | Ga0207651_10098282 | 3300025960 | Bacteria | 2164 |
| 669 | Ga0207651_10156679 | 3300025960 | Unclassified | 1780 |
| 670 | Ga0207712_10123261 | 3300025961 | Bacteria | 1964 |
| 671 | Ga0207640_10020149 | 3300025981 | Unclassified | 3956 |
| 672 | Ga0207640_10030580 | 3300025981 | Bacteria | 3318 |
| 673 | Ga0207640_10328589 | 3300025981 | Bacteria | 1220 |
| 674 | Ga0207658_10084783 | 3300025986 | Bacteria | 2439 |
| 675 | Ga0207677_10002677 | 3300026023 | Bacteria | 9385 |
| 676 | Ga0207677_10268714 | 3300026023 | Bacteria | 1394 |
| 677 | Ga0207703_10007033 | 3300026035 | Bacteria | 8954 |
| 678 | Ga0207703_10014289 | 3300026035 | Bacteria | 6192 |
| 679 | Ga0207703_10042482 | 3300026035 | Bacteria | 3647 |
| 680 | Ga0207703_10070079 | 3300026035 | Bacteria | 2893 |
| 681 | Ga0207703_10131912 | 3300026035 | Bacteria | 2159 |
| 682 | Ga0207703_10168490 | 3300026035 | Bacteria | 1925 |
| 683 | Ga0207703_10193609 | 3300026035 | Unclassified | 1803 |
| 684 | Ga0207703_10227439 | 3300026035 | Bacteria | 1671 |
| 685 | Ga0207703_10325252 | 3300026035 | Bacteria | 1409 |
| 686 | Ga0207639_10075419 | 3300026041 | Bacteria | 2652 |
| 687 | Ga0207639_10285080 | 3300026041 | Bacteria | 1454 |
| 688 | Ga0207678_10113384 | 3300026067 | Bacteria | 2313 |
| 689 | Ga0207708_10029732 | 3300026075 | Bacteria | 4141 |
| 690 | Ga0207708_10073061 | 3300026075 | Bacteria | 2629 |
| 691 | Ga0207708_10314522 | 3300026075 | Bacteria | 1276 |
| 692 | Ga0207702_10008916 | 3300026078 | Bacteria | 8456 |
| 693 | Ga0207702_10053586 | 3300026078 | Bacteria | 3415 |
| 694 | Ga0207702_10056997 | 3300026078 | Unclassified | 3319 |
| 695 | Ga0207702_10072126 | 3300026078 | Bacteria | 2975 |
| 696 | Ga0207702_10311445 | 3300026078 | Unclassified | 1497 |
| 697 | Ga0207641_10001296 | 3300026088 | Bacteria | 24871 |
| 698 | Ga0207641_10007090 | 3300026088 | Bacteria | 9360 |
| 699 | Ga0207641_10061795 | 3300026088 | Bacteria | 3195 |
| 700 | Ga0207641_10246505 | 3300026088 | Bacteria | 1667 |
| 701 | Ga0207648_10003070 | 3300026089 | Bacteria | 17656 |
| 702 | Ga0207648_10032208 | 3300026089 | Bacteria | 4630 |
| 703 | Ga0207648_10249560 | 3300026089 | Bacteria | 1582 |
| 704 | Ga0207648_10455626 | 3300026089 | Bacteria | 1165 |
| 705 | Ga0207676_10007919 | 3300026095 | Bacteria | 7560 |
| 706 | Ga0207676_10032639 | 3300026095 | Bacteria | 3926 |
| 707 | Ga0207676_10041790 | 3300026095 | Unclassified | 3522 |
| 708 | Ga0207676_10159388 | 3300026095 | Bacteria | 1953 |
| 709 | Ga0207676_10175151 | 3300026095 | Bacteria | 1873 |
| 710 | Ga0207676_10398658 | 3300026095 | Bacteria | 1285 |
| 711 | Ga0207674_10003396 | 3300026116 | Bacteria | 19530 |
| 712 | Ga0207674_10003522 | 3300026116 | Bacteria | 19105 |
| 713 | Ga0207674_10416422 | 3300026116 | Bacteria | 1298 |
| 714 | Ga0207675_100084688 | 3300026118 | Bacteria | 2975 |
| 715 | Ga0207675_100207777 | 3300026118 | Bacteria | 1882 |
| 716 | Ga0207675_100259118 | 3300026118 | Bacteria | 1685 |
| 717 | Ga0207675_100327341 | 3300026118 | Bacteria | 1497 |
| 718 | Ga0207675_100362987 | 3300026118 | Bacteria | 1421 |
| 719 | Ga0207675_100557414 | 3300026118 | Unclassified | 1146 |
| 720 | Ga0207683_10057829 | 3300026121 | Bacteria | 3404 |
| 721 | Ga0207683_10081516 | 3300026121 | Bacteria | 2872 |
| 722 | Ga0207683_10087107 | 3300026121 | Bacteria | 2777 |
| 723 | Ga0207683_10145679 | 3300026121 | Bacteria | 2135 |
| 724 | Ga0207683_10152611 | 3300026121 | Bacteria | 2085 |
| 725 | Ga0207683_10450535 | 3300026121 | Bacteria | 1186 |
| 726 | Ga0207683_10492119 | 3300026121 | Bacteria | 1132 |
| 727 | Ga0207698_10057854 | 3300026142 | Bacteria | 3001 |
| 728 | Ga0207698_10069312 | 3300026142 | Bacteria | 2788 |
| 729 | Ga0207698_10394914 | 3300026142 | Bacteria | 1320 |
| 730 | Ga0210000_1017429 | 3300027462 | Bacteria | 1088 |
| 731 | Ga0209999_1015149 | 3300027543 | Bacteria | 1402 |
| 732 | Ga0209588_1016626 | 3300027671 | Unclassified | 2273 |
| 733 | Ga0209588_1036789 | 3300027671 | Bacteria | 1576 |
| 734 | Ga0209974_10036009 | 3300027876 | Unclassified | 1643 |
| 735 | Ga0209974_10073523 | 3300027876 | Bacteria | 1169 |
| 736 | Ga0207428_10000033 | 3300027907 | Bacteria | 232081 |
| 737 | Ga0207428_10000435 | 3300027907 | Bacteria | 51355 |
| 738 | Ga0207428_10004008 | 3300027907 | Bacteria | 14135 |
| 739 | Ga0207428_10009545 | 3300027907 | Bacteria | 8694 |
| 740 | Ga0207428_10012546 | 3300027907 | Bacteria | 7440 |
| 741 | Ga0207428_10021675 | 3300027907 | Bacteria | 5436 |
| 742 | Ga0207428_10111443 | 3300027907 | Unclassified | 2105 |
| 743 | Ga0207428_10139690 | 3300027907 | Bacteria | 1850 |
| 744 | Ga0265354_1000073 | 3300028016 | Bacteria | 16758 |
| 745 | Ga0268266_10000587 | 3300028379 | Bacteria | 50211 |
| 746 | Ga0268266_10033791 | 3300028379 | Unclassified | 4347 |
| 747 | Ga0268265_10010950 | 3300028380 | Bacteria | 6123 |
| 748 | Ga0268265_10011935 | 3300028380 | Bacteria | 5877 |
| 749 | Ga0268265_10223774 | 3300028380 | Bacteria | 1648 |
| 750 | Ga0268265_10307431 | 3300028380 | Bacteria | 1430 |
| 751 | Ga0268264_10025855 | 3300028381 | Bacteria | 4794 |
| 752 | Ga0268264_10026177 | 3300028381 | Bacteria | 4764 |
| 753 | Ga0268264_10289007 | 3300028381 | Bacteria | 1539 |
| 754 | Ga0265319_1002097 | 3300028563 | Bacteria | 11164 |
| 755 | Ga0265318_10000420 | 3300028577 | Bacteria | 32662 |
| 756 | Ga0265323_10000906 | 3300028653 | Bacteria | 15674 |
| 757 | Ga0265323_10007258 | 3300028653 | Unclassified | 4619 |
| 758 | Ga0265323_10045981 | 3300028653 | Unclassified | 1566 |
| 759 | Ga0265323_10047002 | 3300028653 | Bacteria | 1545 |
| 760 | Ga0265322_10000885 | 3300028654 | Bacteria | 10619 |
| 761 | Ga0265336_10001709 | 3300028666 | Bacteria | 9663 |
| 762 | Ga0265338_10000139 | 3300028800 | Bacteria | 135334 |
| 763 | Ga0265338_10003099 | 3300028800 | Bacteria | 23843 |
| 764 | Ga0265338_10009300 | 3300028800 | Bacteria | 11744 |
| 765 | Ga0265338_10025506 | 3300028800 | Bacteria | 5996 |
| 766 | Ga0265338_10033630 | 3300028800 | Bacteria | 4971 |
| 767 | Ga0265338_10056841 | 3300028800 | Bacteria | 3465 |
| 768 | Ga0265770_1002159 | 3300030878 | Bacteria | 2676 |
| 769 | Ga0265330_10025272 | 3300031235 | Bacteria | 2693 |
| 770 | Ga0265328_10008223 | 3300031239 | Bacteria | 4313 |
| 771 | Ga0265320_10001344 | 3300031240 | Bacteria | 17925 |
| 772 | Ga0265320_10031720 | 3300031240 | Bacteria | 2711 |
| 773 | Ga0265325_10052872 | 3300031241 | Bacteria | 2084 |
| 774 | Ga0265325_10113238 | 3300031241 | Bacteria | 1316 |
| 775 | Ga0265329_10000405 | 3300031242 | Bacteria | 22560 |
| 776 | Ga0265340_10008053 | 3300031247 | Bacteria | 5708 |
| 777 | Ga0265340_10018270 | 3300031247 | Bacteria | 3618 |
| 778 | Ga0265339_10000182 | 3300031249 | Bacteria | 53151 |
| 779 | Ga0265339_10053495 | 3300031249 | Unclassified | 2196 |
| 780 | Ga0265331_10000317 | 3300031250 | Bacteria | 52403 |
| 781 | Ga0265331_10000366 | 3300031250 | Bacteria | 47311 |
| 782 | Ga0265331_10018808 | 3300031250 | Bacteria | 3573 |
| 783 | Ga0265316_10002192 | 3300031344 | Bacteria | 20520 |
| 784 | Ga0265316_10008727 | 3300031344 | Bacteria | 9378 |
| 785 | Ga0265316_10024251 | 3300031344 | Bacteria | 5089 |
| 786 | Ga0265316_10025334 | 3300031344 | Bacteria | 4952 |
| 787 | Ga0265316_10045315 | 3300031344 | Unclassified | 3492 |
| 788 | Ga0265316_10046649 | 3300031344 | Bacteria | 3432 |
| 789 | Ga0265316_10074387 | 3300031344 | Bacteria | 2614 |
| 790 | Ga0265316_10088326 | 3300031344 | Bacteria | 2367 |
| 791 | Ga0265316_10095040 | 3300031344 | Bacteria | 2270 |
| 792 | Ga0265316_10097504 | 3300031344 | Bacteria | 2237 |
| 793 | Ga0265316_10189558 | 3300031344 | Bacteria | 1528 |
| 794 | Ga0307408_100040504 | 3300031548 | Bacteria | 3299 |
| 795 | Ga0307408_100076057 | 3300031548 | Bacteria | 2496 |
| 796 | Ga0307408_100133647 | 3300031548 | Bacteria | 1938 |
| 797 | Ga0307408_100137991 | 3300031548 | Bacteria | 1910 |
| 798 | Ga0307408_100213002 | 3300031548 | Bacteria | 1571 |
| 799 | Ga0307408_100216978 | 3300031548 | Bacteria | 1559 |
| 800 | Ga0307408_100360712 | 3300031548 | Unclassified | 1236 |
| 801 | Ga0265313_10000255 | 3300031595 | Bacteria | 58241 |
| 802 | Ga0265313_10002537 | 3300031595 | Bacteria | 15655 |
| 803 | Ga0316579_10083524 | 3300031691 | Bacteria | 1522 |
| 804 | Ga0265314_10000408 | 3300031711 | Bacteria | 58081 |
| 805 | Ga0265314_10083298 | 3300031711 | Bacteria | 2103 |
| 806 | Ga0265342_10001004 | 3300031712 | Bacteria | 27819 |
| 807 | Ga0265342_10018922 | 3300031712 | Bacteria | 4449 |
| 808 | Ga0265342_10030867 | 3300031712 | Bacteria | 3317 |
| 809 | Ga0265342_10045070 | 3300031712 | Bacteria | 2656 |
| 810 | Ga0316578_10000576 | 3300031728 | Bacteria | 12702 |
| 811 | Ga0307405_10052667 | 3300031731 | Bacteria | 2532 |
| 812 | Ga0307405_10274282 | 3300031731 | Bacteria | 1266 |
| 813 | Ga0307413_10015980 | 3300031824 | Bacteria | 3862 |
| 814 | Ga0307413_10090835 | 3300031824 | Bacteria | 1988 |
| 815 | Ga0307410_10000584 | 3300031852 | Bacteria | 14998 |
| 816 | Ga0307410_10021988 | 3300031852 | Bacteria | 3934 |
| 817 | Ga0307410_10027478 | 3300031852 | Bacteria | 3597 |
| 818 | Ga0307410_10363650 | 3300031852 | Bacteria | 1159 |
| 819 | Ga0307406_10256534 | 3300031901 | Bacteria | 1320 |
| 820 | Ga0307407_10007994 | 3300031903 | Bacteria | 4825 |
| 821 | Ga0307407_10015484 | 3300031903 | Bacteria | 3772 |
| 822 | Ga0307407_10031272 | 3300031903 | Bacteria | 2881 |
| 823 | Ga0307407_10182902 | 3300031903 | Bacteria | 1390 |
| 824 | Ga0307412_10008811 | 3300031911 | Bacteria | 5777 |
| 825 | Ga0307412_10022102 | 3300031911 | Bacteria | 3894 |
| 826 | Ga0307412_10043309 | 3300031911 | Bacteria | 2930 |
| 827 | Ga0307409_100001963 | 3300031995 | Bacteria | 10526 |
| 828 | Ga0307409_100009405 | 3300031995 | Bacteria | 6001 |
| 829 | Ga0307409_100170895 | 3300031995 | Unclassified | 1913 |
| 830 | Ga0307409_100475203 | 3300031995 | Bacteria | 1212 |
| 831 | Ga0307409_100592578 | 3300031995 | Bacteria | 1094 |
| 832 | Ga0307416_100002140 | 3300032002 | Bacteria | 11173 |
| 833 | Ga0307416_100008530 | 3300032002 | Bacteria | 6624 |
| 834 | Ga0307416_100013568 | 3300032002 | Bacteria | 5545 |
| 835 | Ga0307416_100022496 | 3300032002 | Bacteria | 4552 |
| 836 | Ga0307416_100257865 | 3300032002 | Bacteria | 1702 |
| 837 | Ga0307414_10006358 | 3300032004 | Bacteria | 6582 |
| 838 | Ga0307414_10015416 | 3300032004 | Bacteria | 4612 |
| 839 | Ga0307414_10064531 | 3300032004 | Bacteria | 2608 |
| 840 | Ga0307411_10001766 | 3300032005 | Bacteria | 9126 |
| 841 | Ga0307411_10006989 | 3300032005 | Bacteria | 5701 |
| 842 | Ga0307411_10010855 | 3300032005 | Bacteria | 4881 |
| 843 | Ga0307411_10291488 | 3300032005 | Bacteria | 1304 |
| 844 | Ga0307411_10325012 | 3300032005 | Bacteria | 1244 |
| 845 | Ga0316580_10047029 | 3300032139 | Bacteria | 1330 |
| 846 | Ga0316592_1002075 | 3300033524 | Bacteria | 3396 |
| 847 | Ga0316592_1007560 | 3300033524 | Bacteria | 2127 |
| 848 | Ga0316588_1000364 | 3300033528 | Bacteria | 5879 |
| 849 | Ga0316596_1008554 | 3300033541 | Bacteria | 2443 |
| 850 | Ga0316212_1000277 | 3300033547 | Bacteria | 6054 |
| 851 | Ga0373948_0011441 | 3300034817 | Bacteria | 1569 |
| 852 | Ga0373958_0022934 | 3300034819 | Bacteria | 1170 |
| 853 | Ga0373959_0002633 | 3300034820 | Bacteria | 2847 |
| 854 | Ga0373938_0000411 | 3300034957 | Bacteria | 6904 |
| 855 | Ga0373926_0001952 | 3300035083 | Bacteria | 6457 |
| 856 | Ga0373926_0017848 | 3300035083 | Bacteria | 2438 |
| 857 | Ga0373928_0003168 | 3300035084 | Bacteria | 3150 |
| 858 | Ga0373929_0003351 | 3300035085 | Bacteria | 2893 |
| 859 | Ga0373934_0010338 | 3300035086 | Bacteria | 3502 |
| 860 | Ga0373934_0032053 | 3300035086 | Unclassified | 2060 |
| 861 | Ga0373944_0066540 | 3300035089 | Bacteria | 1166 |
| 862 | Ga0373951_0001893 | 3300035091 | Bacteria | 5390 |
| 863 | Ga0373952_0002290 | 3300035092 | Bacteria | 3449 |
| 864 | Ga0373923_0049358 | 3300035111 | Bacteria | 1760 |
| 865 | Ga0373923_0115880 | 3300035111 | Unclassified | 1193 |
| 866 | Ga0373932_0003415 | 3300035112 | Bacteria | 3821 |
| 867 | Ga0373936_0021294 | 3300035113 | Bacteria | 2521 |
| 868 | Ga0373936_0032866 | 3300035113 | Bacteria | 2054 |
| 869 | Ga0373939_0003135 | 3300035114 | Bacteria | 3888 |
| 870 | Ga0373941_0000100 | 3300035115 | Bacteria | 14305 |
| 871 | Ga0373945_0005208 | 3300035116 | Bacteria | 4157 |
| 872 | Ga0373945_0018312 | 3300035116 | Unclassified | 2382 |
| 873 | Ga0373945_0050565 | 3300035116 | Bacteria | 1528 |
| 874 | Ga0373953_0005563 | 3300035117 | Bacteria | 4098 |
| 875 | Ga0373954_0001733 | 3300035118 | Bacteria | 8939 |
| 876 | Ga0373954_0063400 | 3300035118 | Unclassified | 1747 |
| 877 | Ga0373954_0070445 | 3300035118 | Bacteria | 1661 |
| 878 | Ga0373954_0100924 | 3300035118 | Bacteria | 1392 |
| 879 | Ga0373954_0120788 | 3300035118 | Bacteria | 1272 |
| 880 | Ga0373956_0005358 | 3300035119 | Bacteria | 5134 |
| 881 | Ga0373956_0013358 | 3300035119 | Bacteria | 3416 |
| 882 | Ga0373960_0001352 | 3300035121 | Bacteria | 5402 |
| 883 | Ga0373943_0057785 | 3300035170 | Bacteria | 1929 |
| 884 | Ga0373943_0064135 | 3300035170 | Bacteria | 1844 |
| 885 | Ga0373943_0155902 | 3300035170 | Bacteria | 1240 |
| 886 | Ga0373946_0001535 | 3300035171 | Bacteria | 8034 |
| 887 | Ga0373946_0040845 | 3300035171 | Unclassified | 1900 |
| 888 | Ga0373946_0052362 | 3300035171 | Bacteria | 1712 |
| 889 | Ga0373946_0082587 | 3300035171 | Bacteria | 1410 |
| 890 | Ga0373955_0002172 | 3300035172 | Bacteria | 8494 |
| 891 | Ga0373955_0020850 | 3300035172 | Bacteria | 3300 |
| 892 | Ga0373955_0066556 | 3300035172 | Unclassified | 2003 |
| 893 | Ga0373942_0003366 | 3300035207 | Bacteria | 3759 |
| 894 | Ga0373961_0001007 | 3300035241 | Bacteria | 9195 |
| 895 | Ga0373961_0047257 | 3300035241 | Bacteria | 1264 |
| 896 | Ga0316574_0009468 | 3300035398 | Bacteria | 5459 |
| 897 | Ga0373924_0184404 | 3300035410 | Bacteria | 919 |
| 898 | Ga0373931_0000326 | 3300035691 | Bacteria | 19957 |
| 899 | Ga0373931_0011882 | 3300035691 | Bacteria | 4212 |
| 900 | Ga0373931_0045572 | 3300035691 | Bacteria | 2316 |
| 901 | Ga0373935_0007305 | 3300035692 | Bacteria | 6606 |
| 902 | Ga0373935_0017708 | 3300035692 | Bacteria | 4327 |
| 903 | Ga0373935_0043884 | 3300035692 | Bacteria | 2816 |
| 904 | Ga0373935_0083190 | 3300035692 | Bacteria | 2083 |
| 905 | Ga0373927_0001044 | 3300035695 | Bacteria | 21078 |
| 906 | Ga0373927_0003851 | 3300035695 | Bacteria | 10652 |
| 907 | Ga0373927_0007815 | 3300035695 | Bacteria | 7237 |
| 908 | Ga0373927_0012069 | 3300035695 | Bacteria | 5747 |
| 909 | Ga0373927_0081468 | 3300035695 | Bacteria | 2098 |
| 910 | Ga0373927_0133512 | 3300035695 | Bacteria | 1622 |
| 911 | Ga0373933_0012932 | 3300035724 | Bacteria | 4617 |
| 912 | Ga0373933_0060171 | 3300035724 | Unclassified | 2290 |
| 913 | Ga0373933_0118591 | 3300035724 | Bacteria | 1656 |
| 914 | Ga0373947_0001564 | 3300035725 | Bacteria | 14018 |
| 915 | Ga0373947_0005841 | 3300035725 | Bacteria | 7170 |
| 916 | Ga0373947_0006086 | 3300035725 | Bacteria | 7029 |
| 917 | Ga0373947_0072097 | 3300035725 | Bacteria | 2120 |
| 918 | Ga0373947_0082739 | 3300035725 | Bacteria | 1990 |
| 919 | Ga0373947_0167708 | 3300035725 | Bacteria | 1423 |
| 920 | Ga0373947_0187721 | 3300035725 | Unclassified | 1348 |
| 921 | Ga0373937_0003455 | 3300036401 | Bacteria | 13272 |
| 922 | Ga0373937_0021013 | 3300036401 | Bacteria | 5856 |
| 923 | Ga0373937_0082047 | 3300036401 | Bacteria | 2983 |
| 924 | Ga0373937_0086200 | 3300036401 | Bacteria | 2906 |
| 925 | Ga0373937_0088612 | 3300036401 | Bacteria | 2865 |
| 926 | Ga0373937_0192094 | 3300036401 | Unclassified | 1918 |
| 927 | Ga0373937_0204030 | 3300036401 | Bacteria | 1859 |
| 928 | Ga0316582_0007601 | 3300036647 | Bacteria | 5778 |
| 929 | Ga0316582_0008317 | 3300036647 | Bacteria | 5570 |
| 930 | Ga0316582_0041012 | 3300036647 | Bacteria | 2892 |
| 931 | Ga0316582_0163124 | 3300036647 | Bacteria | 1510 |
| 932 | Ga0316584_0133075 | 3300036712 | Bacteria | 1857 |
| 933 | Ga0373925_0001268 | 3300037068 | Bacteria | 22290 |
| 934 | Ga0373925_0006381 | 3300037068 | Bacteria | 8681 |
| 935 | Ga0373925_0007445 | 3300037068 | Bacteria | 7988 |
| 936 | Ga0373925_0008189 | 3300037068 | Bacteria | 7607 |
| 937 | Ga0373925_0033881 | 3300037068 | Bacteria | 3763 |
| 938 | Ga0373925_0161693 | 3300037068 | Bacteria | 1764 |
| 939 | Ga0373925_0279063 | 3300037068 | Bacteria | 1345 |
| 940 | Ga0373925_0389730 | 3300037068 | Bacteria | 1135 |
| 941 | Ga0395899_0048870 | 3300037312 | Bacteria | 3146 |
| 942 | Ga0395900_0002799 | 3300037418 | Bacteria | 19058 |
| 943 | Ga0395900_0032160 | 3300037418 | Bacteria | 5394 |
| 944 | Ga0395898_0002991 | 3300037466 | Bacteria | 19191 |
| 945 | Ga0395898_0106762 | 3300037466 | Bacteria | 2686 |
| 946 | Ga0395898_0209536 | 3300037466 | Bacteria | 1859 |
| 947 | Ga0395898_0212131 | 3300037466 | Bacteria | 1847 |
| 948 | Ga0395905_0045314 | 3300037471 | Bacteria | 4125 |
| 949 | Ga0395905_0157698 | 3300037471 | Bacteria | 2134 |
| 950 | Ga0395905_0275876 | 3300037471 | Bacteria | 1567 |
| 951 | Ga0395905_0283114 | 3300037471 | Bacteria | 1544 |
| 952 | Ga0395905_0308492 | 3300037471 | Bacteria | 1471 |
| 953 | Ga0395905_0337999 | 3300037471 | Bacteria | 1397 |
| 954 | Ga0316581_0020655 | 3300037588 | Bacteria | 1929 |
| 955 | Ga0436364_0302019 | 3300037853 | Bacteria | 1278 |
| 956 | Ga0436364_0305504 | 3300037853 | Bacteria | 1155 |
| 957 | Ga0436364_1196049 | 3300037853 | Bacteria | 21068 |
| 958 | Ga0395901_0000800 | 3300038443 | Bacteria | 34936 |
| 959 | Ga0395901_0066875 | 3300038443 | Bacteria | 3743 |
| 960 | Ga0395901_0108573 | 3300038443 | Unclassified | 2913 |
| 961 | Ga0395901_0432088 | 3300038443 | Bacteria | 1349 |
| 962 | Ga0400488_08526 | 3300038741 | Bacteria | 2513 |
| 963 | Ga0400483_133231 | 3300039062 | Unclassified | 2077 |
| 964 | Ga0436365_0695601 | 3300039437 | Unclassified | 2135 |
| 965 | Ga0436365_0701791 | 3300039437 | Bacteria | 2518 |
| 966 | Ga0436365_1368230 | 3300039437 | Bacteria | 1009 |
| 967 | Ga0436365_1473988 | 3300039437 | Bacteria | 2586 |
| 968 | Ga0436365_1711751 | 3300039437 | Bacteria | 3608 |
| 969 | Ga0436360_0811333 | 3300039438 | Bacteria | 4537 |
| 970 | Ga0436360_1006139 | 3300039438 | Bacteria | 1410 |
| 971 | Ga0436361_0831143 | 3300039447 | Bacteria | 1375 |
| 972 | Ga0436363_0100449 | 3300039450 | Bacteria | 4748 |
| 973 | Ga0451577_0000102 | 3300042876 | Bacteria | 188094 |
| 974 | Ga0451577_0000118 | 3300042876 | Bacteria | 174137 |
| 975 | Ga0451577_0000158 | 3300042876 | Bacteria | 151857 |
| 976 | Ga0451577_0000342 | 3300042876 | Bacteria | 87318 |
| 977 | Ga0451577_0000442 | 3300042876 | Bacteria | 73235 |
| 978 | Ga0451577_0002894 | 3300042876 | Bacteria | 19689 |
| 979 | Ga0451577_0010768 | 3300042876 | Bacteria | 8701 |
| 980 | Ga0451577_0010818 | 3300042876 | Bacteria | 8673 |
| 981 | Ga0451577_0024537 | 3300042876 | Bacteria | 5484 |
| 982 | Ga0451577_0034248 | 3300042876 | Bacteria | 4579 |
| 983 | Ga0451577_0047223 | 3300042876 | Bacteria | 3850 |
| 984 | Ga0451577_0062738 | 3300042876 | Bacteria | 3314 |
| 985 | Ga0451577_0086879 | 3300042876 | Bacteria | 2790 |
| 986 | Ga0451577_0109542 | 3300042876 | Bacteria | 2470 |
| 987 | Ga0451577_0122691 | 3300042876 | Bacteria | 2327 |
| 988 | Ga0451577_0146091 | 3300042876 | Bacteria | 2126 |
| 989 | Ga0451577_0148304 | 3300042876 | Bacteria | 2110 |
| 990 | Ga0451577_0202057 | 3300042876 | Bacteria | 1794 |
| 991 | Ga0451577_0249939 | 3300042876 | Bacteria | 1605 |
| 992 | Ga0451577_0475607 | 3300042876 | Bacteria | 1134 |
| 993 | Ga0453683_0000001 | 3300044673 | Bacteria | 1384965 |
| 994 | Ga0453683_0000095 | 3300044673 | Bacteria | 132405 |
| 995 | Ga0453683_0000668 | 3300044673 | Bacteria | 36652 |
| 996 | Ga0453683_0014218 | 3300044673 | Bacteria | 5174 |
| 997 | Ga0453683_0015951 | 3300044673 | Bacteria | 4855 |
| 998 | Ga0453683_0061315 | 3300044673 | Unclassified | 2352 |
| 999 | Ga0453683_0095561 | 3300044673 | Bacteria | 1864 |
| 1000 | Ga0453683_0156752 | 3300044673 | Bacteria | 1440 |
| 1001 | Ga0453684_0000036 | 3300044712 | Bacteria | 711481 |
| 1002 | Ga0453684_0000089 | 3300044712 | Bacteria | 395064 |
| 1003 | Ga0453684_0000249 | 3300044712 | Bacteria | 232232 |
| 1004 | Ga0453684_0000291 | 3300044712 | Bacteria | 215046 |
| 1005 | Ga0453684_0000416 | 3300044712 | Bacteria | 174046 |
| 1006 | Ga0453684_0000931 | 3300044712 | Bacteria | 96738 |
| 1007 | Ga0453684_0001325 | 3300044712 | Bacteria | 73132 |
| 1008 | Ga0453684_0002093 | 3300044712 | Bacteria | 50497 |
| 1009 | Ga0453684_0004587 | 3300044712 | Bacteria | 28807 |
| 1010 | Ga0453684_0010523 | 3300044712 | Bacteria | 15793 |
| 1011 | Ga0453684_0012461 | 3300044712 | Bacteria | 14012 |
| 1012 | Ga0453684_0012798 | 3300044712 | Bacteria | 13756 |
| 1013 | Ga0453684_0016247 | 3300044712 | Bacteria | 11660 |
| 1014 | Ga0453684_0016452 | 3300044712 | Bacteria | 11564 |
| 1015 | Ga0453684_0065370 | 3300044712 | Bacteria | 4639 |
| 1016 | Ga0451576_0000771 | 3300045051 | Bacteria | 63052 |
| 1017 | Ga0451576_0000986 | 3300045051 | Bacteria | 52706 |
| 1018 | Ga0451576_0002308 | 3300045051 | Bacteria | 28909 |
| 1019 | Ga0451576_0004596 | 3300045051 | Bacteria | 17819 |
| 1020 | Ga0451576_0006456 | 3300045051 | Bacteria | 14377 |
| 1021 | Ga0451576_0008282 | 3300045051 | Bacteria | 12222 |
| 1022 | Ga0451576_0010231 | 3300045051 | Bacteria | 10785 |
| 1023 | Ga0451576_0017793 | 3300045051 | Bacteria | 7807 |
| 1024 | Ga0451576_0023257 | 3300045051 | Bacteria | 6712 |
| 1025 | Ga0451576_0048024 | 3300045051 | Bacteria | 4486 |
| 1026 | Ga0451576_0055948 | 3300045051 | Bacteria | 4127 |
| 1027 | Ga0451576_0070865 | 3300045051 | Bacteria | 3628 |
| 1028 | Ga0451576_0076476 | 3300045051 | Unclassified | 3484 |
| 1029 | Ga0451576_0089845 | 3300045051 | Bacteria | 3195 |
| 1030 | Ga0451576_0116955 | 3300045051 | Bacteria | 2775 |
| 1031 | Ga0451576_0132403 | 3300045051 | Bacteria | 2599 |
| 1032 | Ga0466967_0049862 | 3300045976 | Bacteria | 3664 |
| 1033 | Ga0495592_0143522 | 3300046454 | Bacteria | 1658 |
| 1034 | Ga0495603_0078049 | 3300046455 | Bacteria | 1942 |
| 1035 | Ga0495603_0173644 | 3300046455 | Bacteria | 1248 |
| 1036 | Ga0495629_0011921 | 3300046459 | Bacteria | 6305 |
| 1037 | Ga0495629_0186010 | 3300046459 | Bacteria | 1439 |
| 1038 | Ga0495651_0015055 | 3300046462 | Bacteria | 5979 |
| 1039 | Ga0495651_0018396 | 3300046462 | Bacteria | 5412 |
| 1040 | Ga0495651_0048545 | 3300046462 | Bacteria | 3278 |
| 1041 | Ga0495651_0179708 | 3300046462 | Bacteria | 1498 |
| 1042 | Ga0495580_0000698 | 3300046472 | Bacteria | 28698 |
| 1043 | Ga0495580_0000831 | 3300046472 | Bacteria | 26753 |
| 1044 | Ga0495580_0003043 | 3300046472 | Bacteria | 14356 |
| 1045 | Ga0495580_0006590 | 3300046472 | Bacteria | 9435 |
| 1046 | Ga0495580_0048725 | 3300046472 | Bacteria | 2998 |
| 1047 | Ga0495580_0049783 | 3300046472 | Bacteria | 2964 |
| 1048 | Ga0495580_0055509 | 3300046472 | Unclassified | 2791 |
| 1049 | Ga0495580_0085302 | 3300046472 | Bacteria | 2200 |
| 1050 | Ga0495580_0107202 | 3300046472 | Bacteria | 1940 |
| 1051 | Ga0495580_0108584 | 3300046472 | Unclassified | 1927 |
| 1052 | Ga0495580_0130040 | 3300046472 | Bacteria | 1747 |
| 1053 | Ga0495580_0209793 | 3300046472 | Bacteria | 1340 |
| 1054 | Ga0495582_0000811 | 3300046473 | Bacteria | 17357 |
| 1055 | Ga0495582_0038876 | 3300046473 | Bacteria | 2619 |
| 1056 | Ga0495582_0097234 | 3300046473 | Bacteria | 1646 |
| 1057 | Ga0495662_0011005 | 3300046476 | Bacteria | 4424 |
| 1058 | Ga0495664_0006501 | 3300046477 | Bacteria | 6458 |
| 1059 | Ga0495664_0046463 | 3300046477 | Bacteria | 2576 |
| 1060 | Ga0495594_0081059 | 3300046499 | Bacteria | 1812 |
| 1061 | Ga0495594_0101666 | 3300046499 | Unclassified | 1617 |
| 1062 | Ga0495608_0084278 | 3300046511 | Bacteria | 2062 |
| 1063 | Ga0495608_0194539 | 3300046511 | Bacteria | 1279 |
| 1064 | Ga0495618_0001176 | 3300046514 | Bacteria | 17746 |
| 1065 | Ga0495628_0036251 | 3300046516 | Bacteria | 3960 |
| 1066 | Ga0495628_0120163 | 3300046516 | Bacteria | 2016 |
| 1067 | Ga0495628_0166282 | 3300046516 | Bacteria | 1674 |
| 1068 | Ga0495630_0006727 | 3300046517 | Bacteria | 8192 |
| 1069 | Ga0495630_0015944 | 3300046517 | Bacteria | 5491 |
| 1070 | Ga0495643_0001268 | 3300046522 | Bacteria | 24192 |
| 1071 | Ga0495666_0065298 | 3300046526 | Unclassified | 1736 |
| 1072 | Ga0495666_0151869 | 3300046526 | Bacteria | 1077 |
| 1073 | Ga0495642_0011949 | 3300046528 | Bacteria | 3344 |
| 1074 | Ga0495642_0012097 | 3300046528 | Bacteria | 3324 |
| 1075 | Ga0495642_0071469 | 3300046528 | Bacteria | 1452 |
| 1076 | Ga0495652_0064248 | 3300046529 | Bacteria | 3087 |
| 1077 | Ga0495652_0140811 | 3300046529 | Unclassified | 1897 |
| 1078 | Ga0495652_0146033 | 3300046529 | Bacteria | 1854 |
| 1079 | Ga0495652_0155998 | 3300046529 | Unclassified | 1778 |
| 1080 | Ga0495665_0002806 | 3300046531 | Bacteria | 9403 |
| 1081 | Ga0495665_0011553 | 3300046531 | Bacteria | 4780 |
| 1082 | Ga0495665_0034126 | 3300046531 | Bacteria | 2721 |
| 1083 | Ga0495640_0036676 | 3300046533 | Bacteria | 3463 |
| 1084 | Ga0495586_0189269 | 3300046535 | Bacteria | 1165 |
| 1085 | Ga0495587_0000291 | 3300046536 | Bacteria | 35547 |
| 1086 | Ga0495587_0004247 | 3300046536 | Bacteria | 9472 |
| 1087 | Ga0495645_0002293 | 3300046543 | Bacteria | 13000 |
| 1088 | Ga0495645_0009122 | 3300046543 | Bacteria | 6929 |
| 1089 | Ga0495645_0215593 | 3300046543 | Bacteria | 1294 |
| 1090 | Ga0495667_0111047 | 3300046559 | Unclassified | 1771 |
| 1091 | Ga0495656_0107305 | 3300046615 | Unclassified | 1301 |
| 1092 | Ga0495634_0057461 | 3300046642 | Bacteria | 2597 |
| 1093 | Ga0495634_0084864 | 3300046642 | Bacteria | 2065 |
| 1094 | Ga0495634_0117270 | 3300046642 | Bacteria | 1707 |
| 1095 | Ga0495635_0049638 | 3300046663 | Bacteria | 2892 |
| 1096 | Ga0495659_0001646 | 3300046664 | Bacteria | 7503 |
| 1097 | Ga0495659_0003198 | 3300046664 | Bacteria | 5243 |
| 1098 | Ga0495659_0008101 | 3300046664 | Bacteria | 3339 |
| 1099 | Ga0495659_0055608 | 3300046664 | Bacteria | 1451 |
| 1100 | Ga0495659_0076585 | 3300046664 | Bacteria | 1262 |
| 1101 | Ga0495588_0002473 | 3300046674 | Bacteria | 7918 |
| 1102 | Ga0495657_0056537 | 3300046675 | Bacteria | 2612 |
| 1103 | Ga0495599_0265868 | 3300046678 | Bacteria | 1041 |
| 1104 | Ga0495623_0027851 | 3300046679 | Unclassified | 3637 |
| 1105 | Ga0495623_0046467 | 3300046679 | Bacteria | 2755 |
| 1106 | Ga0495658_0115923 | 3300046683 | Bacteria | 1615 |
| 1107 | Ga0495658_0187190 | 3300046683 | Bacteria | 1286 |
| 1108 | Ga0495669_0006346 | 3300046684 | Bacteria | 4941 |
| 1109 | Ga0495669_0027677 | 3300046684 | Bacteria | 2481 |
| 1110 | Ga0495669_0033700 | 3300046684 | Bacteria | 2255 |
| 1111 | Ga0495669_0107491 | 3300046684 | Bacteria | 1300 |
| 1112 | Ga0495669_0121383 | 3300046684 | Bacteria | 1225 |
| 1113 | Ga0495613_0040442 | 3300046689 | Bacteria | 3454 |
| 1114 | Ga0495613_0047111 | 3300046689 | Bacteria | 3185 |
| 1115 | Ga0495670_0087704 | 3300046691 | Bacteria | 1590 |
| 1116 | Ga0495600_0190977 | 3300046809 | Bacteria | 1317 |
| 1117 | Ga0495581_0011957 | 3300047315 | Bacteria | 5022 |
| 1118 | Ga0495581_0156534 | 3300047315 | Bacteria | 1332 |
| 1119 | Ga0495604_0000768 | 3300047317 | Bacteria | 27007 |
| 1120 | Ga0495604_0058699 | 3300047317 | Bacteria | 2954 |
| 1121 | Ga0495636_0013309 | 3300047318 | Bacteria | 3264 |
| 1122 | Ga0495636_0154209 | 3300047318 | Bacteria | 1032 |
| 1123 | Ga0495674_0015837 | 3300047319 | Bacteria | 7039 |
| 1124 | Ga0495674_0072475 | 3300047319 | Bacteria | 2971 |
| 1125 | Ga0495674_0190786 | 3300047319 | Bacteria | 1703 |
| 1126 | Ga0495674_0216134 | 3300047319 | Bacteria | 1586 |
| 1127 | Ga0495674_0299208 | 3300047319 | Bacteria | 1314 |
| 1128 | Ga0495674_0376766 | 3300047319 | Unclassified | 1149 |
| 1129 | Ga0495675_0096815 | 3300047444 | Unclassified | 1850 |
| 1130 | Ga0495675_0125611 | 3300047444 | Bacteria | 1596 |
| 1131 | Ga0495675_0175636 | 3300047444 | Unclassified | 1314 |
| 1132 | Ga0495685_026031 | 3300047447 | Unclassified | 2014 |
| 1133 | Ga0495684_0004863 | 3300047471 | Bacteria | 10480 |
| 1134 | Ga0495684_0010480 | 3300047471 | Bacteria | 7168 |
| 1135 | Ga0495684_0124545 | 3300047471 | Unclassified | 1939 |
| 1136 | Ga0495684_0176314 | 3300047471 | Bacteria | 1587 |
| 1137 | Ga0495602_0019958 | 3300048088 | Bacteria | 6635 |
| 1138 | Ga0495602_0110466 | 3300048088 | Bacteria | 2234 |
| 1139 | Ga0495602_0132025 | 3300048088 | Unclassified | 1990 |
| 1140 | Ga0496102_0049189 | 3300048905 | Bacteria | 3835 |
| 1141 | Ga0496102_0089343 | 3300048905 | Bacteria | 2850 |
| 1142 | Ga0496104_0122186 | 3300048907 | Unclassified | 2500 |
| 1143 | Ga0496106_0080674 | 3300048909 | Bacteria | 2499 |
| 1144 | Ga0496106_0374551 | 3300048909 | Unclassified | 1144 |
| 1145 | Ga0496112_0044478 | 3300048915 | Bacteria | 4351 |
| 1146 | Ga0496112_0446153 | 3300048915 | Bacteria | 1232 |
| 1147 | Ga0496115_0021365 | 3300048918 | Bacteria | 5000 |
| 1148 | Ga0496115_0358937 | 3300048918 | Bacteria | 1188 |
| 1149 | Ga0501031_0039173 | 3300049568 | Bacteria | 3092 |
| 1150 | Ga0501031_0272494 | 3300049568 | Bacteria | 1099 |
| 1151 | Ga0501032_0063690 | 3300049569 | Bacteria | 2468 |
| 1152 | Ga0501033_0061239 | 3300049570 | Bacteria | 2774 |
| 1153 | Ga0501034_0022870 | 3300049571 | Bacteria | 6368 |
| 1154 | Ga0501034_0042270 | 3300049571 | Bacteria | 4614 |
| 1155 | Ga0501036_0122531 | 3300049572 | Bacteria | 2196 |
| 1156 | Ga0501036_0221593 | 3300049572 | Bacteria | 1588 |
| 1157 | Ga0501036_0265424 | 3300049572 | Unclassified | 1438 |
| 1158 | Ga0501037_0006924 | 3300049573 | Bacteria | 8279 |
| 1159 | Ga0501038_0062519 | 3300049574 | Bacteria | 3181 |
| 1160 | Ga0501038_0152414 | 3300049574 | Bacteria | 1884 |
| 1161 | Ga0501039_0050461 | 3300049575 | Bacteria | 3219 |
| 1162 | Ga0501039_0154242 | 3300049575 | Bacteria | 1804 |
| 1163 | Ga0501040_0005078 | 3300049576 | Bacteria | 8506 |
| 1164 | Ga0501040_0016245 | 3300049576 | Bacteria | 4923 |
| 1165 | Ga0501040_0023758 | 3300049576 | Bacteria | 4111 |
| 1166 | Ga0501040_0068659 | 3300049576 | Bacteria | 2445 |
| 1167 | Ga0501040_0145822 | 3300049576 | Bacteria | 1669 |
| 1168 | Ga0501040_0176350 | 3300049576 | Bacteria | 1514 |
| 1169 | Ga0501041_0001270 | 3300049577 | Bacteria | 13870 |
| 1170 | Ga0501041_0008158 | 3300049577 | Bacteria | 6162 |
| 1171 | Ga0501041_0084472 | 3300049577 | Bacteria | 1956 |
| 1172 | Ga0501041_0183194 | 3300049577 | Bacteria | 1311 |
| 1173 | Ga0501042_0003910 | 3300049578 | Bacteria | 9429 |
| 1174 | Ga0501042_0048431 | 3300049578 | Unclassified | 3030 |
| 1175 | Ga0501042_0057710 | 3300049578 | Bacteria | 2770 |
| 1176 | Ga0501042_0067909 | 3300049578 | Unclassified | 2549 |
| 1177 | Ga0501042_0167360 | 3300049578 | Bacteria | 1586 |
| 1178 | Ga0501043_0096769 | 3300049579 | Bacteria | 2320 |
| 1179 | Ga0501046_0031516 | 3300049580 | Bacteria | 4296 |
| 1180 | Ga0501046_0131141 | 3300049580 | Bacteria | 1901 |
| 1181 | Ga0501047_0006159 | 3300049581 | Bacteria | 11281 |
| 1182 | Ga0501047_0156444 | 3300049581 | Bacteria | 2153 |
| 1183 | Ga0501048_0031747 | 3300049582 | Bacteria | 3820 |
| 1184 | Ga0501048_0037562 | 3300049582 | Bacteria | 3478 |
| 1185 | Ga0501048_0052967 | 3300049582 | Bacteria | 2887 |
| 1186 | Ga0501048_0140390 | 3300049582 | Bacteria | 1708 |
| 1187 | Ga0501048_0260464 | 3300049582 | Bacteria | 1232 |
| 1188 | Ga0501068_0093735 | 3300049584 | Bacteria | 1855 |
| 1189 | Ga0501069_0157190 | 3300049585 | Bacteria | 1308 |
| 1190 | Ga0501070_0019276 | 3300049586 | Bacteria | 5721 |
| 1191 | Ga0501071_0197027 | 3300049587 | Bacteria | 1512 |
| 1192 | Ga0501072_0007790 | 3300049588 | Bacteria | 8136 |
| 1193 | Ga0501072_0008017 | 3300049588 | Bacteria | 8016 |
| 1194 | Ga0501072_0030980 | 3300049588 | Bacteria | 4184 |
| 1195 | Ga0501072_0121920 | 3300049588 | Bacteria | 2077 |
| 1196 | Ga0501072_0222403 | 3300049588 | Bacteria | 1504 |
| 1197 | Ga0501072_0339496 | 3300049588 | Bacteria | 1193 |
| 1198 | Ga0501073_0069643 | 3300049589 | Bacteria | 2451 |
| 1199 | Ga0501074_0014004 | 3300049590 | Bacteria | 5830 |
| 1200 | Ga0501074_0238228 | 3300049590 | Bacteria | 1295 |
| 1201 | Ga0501075_0001108 | 3300049591 | Bacteria | 17348 |
| 1202 | Ga0501075_0021880 | 3300049591 | Bacteria | 4666 |
| 1203 | Ga0501075_0034963 | 3300049591 | Bacteria | 3745 |
| 1204 | Ga0501075_0045609 | 3300049591 | Bacteria | 3290 |
| 1205 | Ga0501075_0062522 | 3300049591 | Bacteria | 2806 |
| 1206 | Ga0501075_0211343 | 3300049591 | Bacteria | 1480 |
| 1207 | Ga0501076_0003486 | 3300049592 | Bacteria | 11051 |
| 1208 | Ga0501076_0006788 | 3300049592 | Bacteria | 8307 |
| 1209 | Ga0501076_0023621 | 3300049592 | Bacteria | 4743 |
| 1210 | Ga0501076_0028396 | 3300049592 | Bacteria | 4345 |
| 1211 | Ga0501076_0049874 | 3300049592 | Bacteria | 3311 |
| 1212 | Ga0501076_0061604 | 3300049592 | Bacteria | 2986 |
| 1213 | Ga0501077_0007255 | 3300049593 | Bacteria | 6835 |
| 1214 | Ga0501077_0023722 | 3300049593 | Bacteria | 3889 |
| 1215 | Ga0501221_007705 | 3300049704 | Bacteria | 1853 |
| 1216 | Ga0501079_0023210 | 3300049741 | Bacteria | 4762 |
| 1217 | Ga0501079_0028665 | 3300049741 | Bacteria | 4273 |
| 1218 | Ga0501079_0056686 | 3300049741 | Bacteria | 3023 |
| 1219 | Ga0501079_0079882 | 3300049741 | Bacteria | 2529 |
| 1220 | Ga0501079_0349400 | 3300049741 | Bacteria | 1159 |
| 1221 | Ga0501079_0350356 | 3300049741 | Bacteria | 1157 |
| 1222 | Ga0501080_0229356 | 3300049742 | Bacteria | 1698 |
| 1223 | Ga0501081_0015900 | 3300049743 | Bacteria | 4968 |
| 1224 | Ga0501081_0032131 | 3300049743 | Bacteria | 3560 |
| 1225 | Ga0501081_0102764 | 3300049743 | Bacteria | 2022 |
| 1226 | Ga0501081_0144610 | 3300049743 | Bacteria | 1705 |
| 1227 | Ga0501083_0021667 | 3300049744 | Bacteria | 4463 |
| 1228 | Ga0501083_0122590 | 3300049744 | Bacteria | 1705 |
| 1229 | Ga0501035_0003460 | 3300049822 | Bacteria | 15111 |
| 1230 | Ga0501035_0128745 | 3300049822 | Bacteria | 2208 |
| 1231 | Ga0501035_0300864 | 3300049822 | Unclassified | 1351 |
| 1232 | Ga0501044_0083960 | 3300049823 | Unclassified | 3219 |
| 1233 | Ga0501044_0152287 | 3300049823 | Bacteria | 2294 |
| 1234 | Ga0501044_0187224 | 3300049823 | Bacteria | 2034 |
| 1235 | Ga0501045_0018388 | 3300049824 | Unclassified | 4971 |
| 1236 | Ga0501045_0049374 | 3300049824 | Bacteria | 3068 |
| 1237 | Ga0501045_0061868 | 3300049824 | Unclassified | 2747 |
| 1238 | Ga0501045_0069794 | 3300049824 | Bacteria | 2584 |
| 1239 | nmdc:mga07m45_165069_c1 | 3300050496 | Bacteria | 1286 |
| 1240 | nmdc:mga05p37_109553_c1 | 3300050507 | Bacteria | 2621 |
| 1241 | nmdc:mga05p37_113948_c1 | 3300050507 | Bacteria | 3324 |
| 1242 | nmdc:mga05p37_119088_c1 | 3300050507 | Bacteria | 3244 |
| 1243 | nmdc:mga05p37_1238_c1 | 3300050507 | Bacteria | 29628 |
| 1244 | nmdc:mga05p37_137766_c1 | 3300050507 | Bacteria | 2992 |
| 1245 | nmdc:mga05p37_141558_c1 | 3300050507 | Bacteria | 2947 |
| 1246 | nmdc:mga05p37_15576_c1 | 3300050507 | Bacteria | 9138 |
| 1247 | nmdc:mga05p37_16644_c1 | 3300050507 | Bacteria | 8857 |
| 1248 | nmdc:mga05p37_170232_c1 | 3300050507 | Bacteria | 2657 |
| 1249 | nmdc:mga05p37_193544_c1 | 3300050507 | Unclassified | 2467 |
| 1250 | nmdc:mga05p37_202927_c1 | 3300050507 | Unclassified | 2400 |
| 1251 | nmdc:mga05p37_208691_c1 | 3300050507 | Bacteria | 2362 |
| 1252 | nmdc:mga05p37_214193_c1 | 3300050507 | Bacteria | 2327 |
| 1253 | nmdc:mga05p37_21975_c1 | 3300050507 | Bacteria | 7729 |
| 1254 | nmdc:mga05p37_23196_c1 | 3300050507 | Bacteria | 7529 |
| 1255 | nmdc:mga05p37_2826_c1 | 3300050507 | Bacteria | 19787 |
| 1256 | nmdc:mga05p37_30941_c1 | 3300050507 | Bacteria | 6535 |
| 1257 | nmdc:mga05p37_35271_c1 | 3300050507 | Bacteria | 6132 |
| 1258 | nmdc:mga05p37_3828_c1 | 3300050507 | Bacteria | 17597 |
| 1259 | nmdc:mga05p37_4725_c1 | 3300050507 | Bacteria | 15918 |
| 1260 | nmdc:mga05p37_507298_c1 | 3300050507 | Bacteria | 1383 |
| 1261 | nmdc:mga05p37_571_c1 | 3300050507 | Bacteria | 40489 |
| 1262 | nmdc:mga05p37_7972_c1 | 3300050507 | Bacteria | 12501 |
| 1263 | nmdc:mga05p37_830350_c1 | 3300050507 | Bacteria | 1006 |
| 1264 | nmdc:mga05p37_893_c1 | 3300050507 | Bacteria | 33632 |
| 1265 | nmdc:mga09592_1061_c1 | 3300050508 | Bacteria | 21805 |
| 1266 | nmdc:mga09592_109088_c1 | 3300050508 | Bacteria | 2374 |
| 1267 | nmdc:mga09592_124010_c1 | 3300050508 | Unclassified | 2220 |
| 1268 | nmdc:mga09592_16949_c1 | 3300050508 | Bacteria | 5962 |
| 1269 | nmdc:mga09592_1842_c1 | 3300050508 | Bacteria | 17047 |
| 1270 | nmdc:mga09592_263750_c1 | 3300050508 | Bacteria | 1494 |
| 1271 | nmdc:mga09592_31912_c1 | 3300050508 | Bacteria | 4390 |
| 1272 | nmdc:mga09592_47811_c1 | 3300050508 | Bacteria | 3606 |
| 1273 | nmdc:mga09592_9084_c1 | 3300050508 | Bacteria | 8081 |
| 1274 | nmdc:mga09592_9871_c1 | 3300050508 | Bacteria | 7763 |
| 1275 | nmdc:mga0qj67_12967_c1 | 3300050509 | Bacteria | 6290 |
| 1276 | nmdc:mga0qj67_150404_c1 | 3300050509 | Bacteria | 1889 |
| 1277 | nmdc:mga0qj67_26317_c1 | 3300050509 | Bacteria | 4504 |
| 1278 | nmdc:mga0qj67_27875_c1 | 3300050509 | Bacteria | 4380 |
| 1279 | nmdc:mga0qj67_40407_c1 | 3300050509 | Bacteria | 3666 |
| 1280 | nmdc:mga0qj67_4733_c1 | 3300050509 | Bacteria | 9887 |
| 1281 | nmdc:mga0qj67_73685_c1 | 3300050509 | Bacteria | 2727 |
| 1282 | nmdc:mga0qj67_7669_c1 | 3300050509 | Bacteria | 7975 |
| 1283 | nmdc:mga0qj67_93375_c1 | 3300050509 | Bacteria | 1722 |
| 1284 | nmdc:mga06r32_133219_c1 | 3300050510 | Bacteria | 2459 |
| 1285 | nmdc:mga06r32_16916_c1 | 3300050510 | Bacteria | 6653 |
| 1286 | nmdc:mga06r32_281346_c1 | 3300050510 | Bacteria | 1650 |
| 1287 | nmdc:mga06r32_28342_c1 | 3300050510 | Bacteria | 5239 |
| 1288 | nmdc:mga06r32_29558_c1 | 3300050510 | Bacteria | 5139 |
| 1289 | nmdc:mga06r32_42603_c1 | 3300050510 | Bacteria | 4317 |
| 1290 | nmdc:mga06r32_44660_c1 | 3300050510 | Bacteria | 4220 |
| 1291 | nmdc:mga06r32_6384_c1 | 3300050510 | Bacteria | 10594 |
| 1292 | nmdc:mga06r32_70113_c1 | 3300050510 | Unclassified | 3389 |
| 1293 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 1294 | nmdc:mga08y16_133721_c1 | 3300050511 | Bacteria | 2578 |
| 1295 | nmdc:mga08y16_19558_c1 | 3300050511 | Bacteria | 7140 |
| 1296 | nmdc:mga08y16_2054_c1 | 3300050511 | Bacteria | 20614 |
| 1297 | nmdc:mga08y16_31818_c1 | 3300050511 | Bacteria | 5548 |
| 1298 | nmdc:mga08y16_37489_c1 | 3300050511 | Bacteria | 5090 |
| 1299 | nmdc:mga08y16_379934_c1 | 3300050511 | Bacteria | 1448 |
| 1300 | nmdc:mga08y16_388882_c1 | 3300050511 | Bacteria | 1429 |
| 1301 | nmdc:mga08y16_41092_c1 | 3300050511 | Bacteria | 4845 |
| 1302 | nmdc:mga08y16_485231_c1 | 3300050511 | Bacteria | 1257 |
| 1303 | nmdc:mga08y16_486273_c1 | 3300050511 | Bacteria | 1256 |
| 1304 | nmdc:mga08y16_5112_c1 | 3300050511 | Bacteria | 13706 |
| 1305 | nmdc:mga08y16_58013_c1 | 3300050511 | Bacteria | 4045 |
| 1306 | nmdc:mga08y16_66988_c1 | 3300050511 | Bacteria | 3747 |
| 1307 | nmdc:mga0n895_118755_c1 | 3300050512 | Bacteria | 2665 |
| 1308 | nmdc:mga0n895_123259_c1 | 3300050512 | Bacteria | 2614 |
| 1309 | nmdc:mga0n895_129696_c1 | 3300050512 | Bacteria | 2546 |
| 1310 | nmdc:mga0n895_132294_c1 | 3300050512 | Bacteria | 2520 |
| 1311 | nmdc:mga0n895_172066_c1 | 3300050512 | Unclassified | 2198 |
| 1312 | nmdc:mga0n895_1792_c1 | 3300050512 | Bacteria | 16311 |
| 1313 | nmdc:mga0n895_202578_c1 | 3300050512 | Bacteria | 2015 |
| 1314 | nmdc:mga0n895_230479_c1 | 3300050512 | Bacteria | 1880 |
| 1315 | nmdc:mga0n895_26_c1 | 3300050512 | Bacteria | 89958 |
| 1316 | nmdc:mga0n895_31169_c1 | 3300050512 | Bacteria | 5102 |
| 1317 | nmdc:mga0n895_3140_c1 | 3300050512 | Bacteria | 13183 |
| 1318 | nmdc:mga0n895_38100_c1 | 3300050512 | Bacteria | 4657 |
| 1319 | nmdc:mga0n895_438309_c1 | 3300050512 | Bacteria | 1320 |
| 1320 | nmdc:mga0n895_542862_c1 | 3300050512 | Unclassified | 1169 |
| 1321 | nmdc:mga0n895_69370_c1 | 3300050512 | Bacteria | 3493 |
| 1322 | nmdc:mga0n895_75583_c1 | 3300050512 | Bacteria | 3349 |
| 1323 | nmdc:mga0n895_93994_c1 | 3300050512 | Bacteria | 3002 |
| 1324 | nmdc:mga0rr50_117604_c1 | 3300050513 | Bacteria | 2111 |
| 1325 | nmdc:mga0rr50_13268_c1 | 3300050513 | Bacteria | 5359 |
| 1326 | nmdc:mga0rr50_137614_c1 | 3300050513 | Bacteria | 1962 |
| 1327 | nmdc:mga0rr50_189_c1 | 3300050513 | Bacteria | 33360 |
| 1328 | nmdc:mga0rr50_206759_c1 | 3300050513 | Bacteria | 1616 |
| 1329 | nmdc:mga0rr50_24412_c1 | 3300050513 | Bacteria | 4186 |
| 1330 | nmdc:mga0rr50_381867_c1 | 3300050513 | Bacteria | 1188 |
| 1331 | nmdc:mga0rr50_4734_c1 | 3300050513 | Bacteria | 8025 |
| 1332 | nmdc:mga0rr50_5_c1 | 3300050513 | Bacteria | 327169 |
| 1333 | nmdc:mga0rr50_65136_c1 | 3300050513 | Bacteria | 2110 |
| 1334 | nmdc:mga0rr50_88017_c1 | 3300050513 | Bacteria | 2412 |
| 1335 | nmdc:mga0rr50_9409_c1 | 3300050513 | Bacteria | 6141 |
| 1336 | nmdc:mga0rr50_94521_c1 | 3300050513 | Bacteria | 2335 |
| 1337 | nmdc:mga08x19_18929_c1 | 3300050514 | Bacteria | 4222 |
| 1338 | nmdc:mga08x19_193_c1 | 3300050514 | Bacteria | 47757 |
| 1339 | nmdc:mga08x19_230579_c1 | 3300050514 | Bacteria | 1274 |
| 1340 | nmdc:mga08x19_28451_c1 | 3300050514 | Bacteria | 3501 |
| 1341 | nmdc:mga08x19_36038_c1 | 3300050514 | Bacteria | 3132 |
| 1342 | nmdc:mga08x19_3741_c1 | 3300050514 | Bacteria | 9061 |
| 1343 | nmdc:mga08x19_39_c1 | 3300050514 | Bacteria | 158844 |
| 1344 | nmdc:mga08x19_552_c1 | 3300050514 | Bacteria | 24509 |
| 1345 | nmdc:mga08x19_6051_c1 | 3300050514 | Bacteria | 7148 |
| 1346 | nmdc:mga08x19_64443_c1 | 3300050514 | Unclassified | 2379 |
| 1347 | nmdc:mga08x19_67122_c1 | 3300050514 | Bacteria | 2333 |
| 1348 | nmdc:mga08x19_68796_c1 | 3300050514 | Unclassified | 2305 |
| 1349 | nmdc:mga08x19_90523_c1 | 3300050514 | Bacteria | 2019 |
| 1350 | nmdc:mga08x19_935_c1 | 3300050514 | Bacteria | 18384 |
| 1351 | nmdc:mga0a205_1070_c1 | 3300050515 | Bacteria | 22744 |
| 1352 | nmdc:mga0a205_157809_c1 | 3300050515 | Bacteria | 2167 |
| 1353 | nmdc:mga0a205_166707_c1 | 3300050515 | Bacteria | 2098 |
| 1354 | nmdc:mga0a205_17003_c1 | 3300050515 | Bacteria | 6809 |
| 1355 | nmdc:mga0a205_17100_c1 | 3300050515 | Bacteria | 6790 |
| 1356 | nmdc:mga0a205_23132_c1 | 3300050515 | Bacteria | 5894 |
| 1357 | nmdc:mga0a205_25660_c1 | 3300050515 | Bacteria | 5616 |
| 1358 | nmdc:mga0a205_27475_c1 | 3300050515 | Bacteria | 5433 |
| 1359 | nmdc:mga0a205_32_c1 | 3300050515 | Bacteria | 79060 |
| 1360 | nmdc:mga0a205_334455_c1 | 3300050515 | Unclassified | 1384 |
| 1361 | nmdc:mga0a205_37839_c2 | 3300050515 | Bacteria | 1863 |
| 1362 | nmdc:mga0a205_55818_c1 | 3300050515 | Bacteria | 3814 |
| 1363 | nmdc:mga0a205_619_c1 | 3300050515 | Bacteria | 28239 |
| 1364 | nmdc:mga0a205_82749_c1 | 3300050515 | Bacteria | 3100 |
| 1365 | Ga0495612_0022097 | 3300053078 | Bacteria | 2550 |
| 1366 | Ga0495595_0081047 | 3300053084 | Bacteria | 1546 |
| 1367 | Ga0495619_0003455 | 3300053085 | Bacteria | 10194 |
| 1368 | Ga0495619_0027075 | 3300053085 | Bacteria | 3693 |
| 1369 | Ga0495619_0224215 | 3300053085 | Bacteria | 1302 |
| 1370 | Ga0501084_0004255 | 3300054114 | Bacteria | 11644 |
| 1371 | Ga0501084_0010571 | 3300054114 | Bacteria | 7636 |
| 1372 | Ga0501084_0014550 | 3300054114 | Bacteria | 6523 |
| 1373 | Ga0501084_0071702 | 3300054114 | Bacteria | 2901 |
| 1374 | Ga0501084_0182648 | 3300054114 | Bacteria | 1771 |
| 1375 | Ga0590071_000237 | 3300059421 | Bacteria | 16106 |
| 1376 | Ga0590074_000404 | 3300059423 | Bacteria | 6190 |
| 1377 | Ga0590075_000952 | 3300059424 | Bacteria | 7534 |
| 1378 | Ga0590075_005099 | 3300059424 | Bacteria | 3105 |
| 1379 | Ga0590075_025889 | 3300059424 | Unclassified | 1476 |
| 1380 | Ga0590077_000214 | 3300059426 | Bacteria | 16646 |
| 1381 | Ga0590077_000432 | 3300059426 | Bacteria | 11762 |
| 1382 | Ga0501082_0000531 | 3300060353 | Bacteria | 33934 |
| 1383 | Ga0501082_0002871 | 3300060353 | Bacteria | 15013 |
| 1384 | Ga0501082_0048346 | 3300060353 | Bacteria | 3666 |
| 1385 | Ga0501082_0404830 | 3300060353 | Bacteria | 1191 |
| 1386 | Ga0530510_0007391 | 3300061734 | Bacteria | 7647 |
| 1387 | Ga0530510_0024893 | 3300061734 | Bacteria | 4277 |
| 1388 | Ga0530510_0046708 | 3300061734 | Bacteria | 3128 |
| 1389 | Ga0530510_0090267 | 3300061734 | Bacteria | 2235 |
| 1390 | Ga0530510_0219396 | 3300061734 | Bacteria | 1413 |
| 1391 | 2687234418 | 2684623219 | Bacteria | 8442773 |
| 1392 | 2688069808 | 2687453257 | Bacteria | 6784659 |
| 1393 | 2920109424 | 2920107658 | Bacteria | 10042636 |
| 1394 | Ga0114129_10681966 | |||
| 1395 | JGI25406J46586_10020362 | |||
| 1396 | Ga0058863_10101987 | |||
| 1397 | Ga0058861_11763141 | |||
| 1398 | Ga0058862_11755211 | |||
| 1399 | Ga0065714_10109055 | |||
| 1400 | Ga0065712_10070553 | |||
| 1401 | Ga0065712_10088406 | |||
| 1402 | Ga0065712_10098888 | |||
| 1403 | Ga0065715_10198264 | |||
| 1404 | Ga0065707_10002787 | |||
| 1405 | Ga0065707_10014613 | |||
| 1406 | Ga0065707_10083645 | |||
| 1407 | Ga0065707_10094018 | |||
| 1408 | Ga0065707_10134884 | |||
| 1409 | Ga0065707_10137407 | |||
| 1410 | Ga0070676_10027352 | |||
| 1411 | Ga0070683_100000048 | |||
| 1412 | Ga0070683_100051625 | |||
| 1413 | Ga0070683_100054837 | |||
| 1414 | Ga0070683_100115499 | |||
| 1415 | Ga0070690_100002213 | |||
| 1416 | Ga0070670_100003569 | |||
| 1417 | Ga0070670_100036486 | |||
| 1418 | Ga0070670_100266192 | |||
| 1419 | Ga0068869_100075258 | |||
| 1420 | Ga0070666_10035605 | |||
| 1421 | Ga0070666_10125374 | |||
| 1422 | Ga0070680_100012542 | |||
| 1423 | Ga0070680_100015561 | |||
| 1424 | Ga0070680_100025973 | |||
| 1425 | Ga0070680_100122737 | |||
| 1426 | Ga0068868_100008891 | |||
| 1427 | Ga0068868_100090672 | |||
| 1428 | Ga0068868_100165327 | |||
| 1429 | Ga0070689_100007004 | |||
| 1430 | Ga0070689_100012178 | |||
| 1431 | Ga0070689_100214622 | |||
| 1432 | Ga0070689_100370373 | |||
| 1433 | Ga0070687_100015273 | |||
| 1434 | Ga0070687_100016131 | |||
| 1435 | Ga0070692_10024447 | |||
| 1436 | Ga0070668_100023718 | |||
| 1437 | Ga0070668_100357464 | |||
| 1438 | Ga0070669_100042332 | |||
| 1439 | Ga0070669_100046316 | |||
| 1440 | Ga0070669_100065428 | |||
| 1441 | Ga0070669_100097360 | |||
| 1442 | Ga0070669_100193922 | |||
| 1443 | Ga0070669_100325849 | |||
| 1444 | Ga0070675_100000863 | |||
| 1445 | Ga0070675_100017018 | |||
| 1446 | Ga0070675_100091118 | |||
| 1447 | Ga0070675_100289465 | |||
| 1448 | Ga0070671_100041907 | |||
| 1449 | Ga0070671_100167081 | |||
| 1450 | Ga0070674_100024753 | |||
| 1451 | Ga0070674_100143483 | |||
| 1452 | Ga0070673_100004711 | |||
| 1453 | Ga0070673_100005778 | |||
| 1454 | Ga0070673_100024730 | |||
| 1455 | Ga0070673_100080756 | |||
| 1456 | Ga0070673_100148706 | |||
| 1457 | Ga0070673_100156177 | |||
| 1458 | Ga0070688_100021384 | |||
| 1459 | Ga0070688_100029736 | |||
| 1460 | Ga0070688_100048620 | |||
| 1461 | Ga0070688_100056651 | |||
| 1462 | Ga0070659_100145925 | |||
| 1463 | Ga0070667_100202517 | |||
| 1464 | Ga0070703_10000403 | |||
| 1465 | Ga0070703_10009210 | |||
| 1466 | Ga0070703_10015520 | |||
| 1467 | Ga0070703_10062047 | |||
| 1468 | Ga0070709_10000029 | |||
| 1469 | Ga0070709_10020756 | |||
| 1470 | Ga0070709_10039088 | |||
| 1471 | Ga0070709_10082239 | |||
| 1472 | Ga0070709_10124081 | |||
| 1473 | Ga0070709_10185678 | |||
| 1474 | Ga0070714_100011082 | |||
| 1475 | Ga0070713_100005215 | |||
| 1476 | Ga0070713_100008039 | |||
| 1477 | Ga0070713_100009698 | |||
| 1478 | Ga0070713_100076213 | |||
| 1479 | Ga0070713_100297751 | |||
| 1480 | Ga0070710_10002860 | |||
| 1481 | Ga0070710_10087151 | |||
| 1482 | Ga0070710_10120772 | |||
| 1483 | Ga0070701_10017984 | |||
| 1484 | Ga0070701_10026950 | |||
| 1485 | Ga0070701_10027813 | |||
| 1486 | Ga0070701_10101166 | |||
| 1487 | Ga0070711_100000027 | |||
| 1488 | Ga0070711_100003000 | |||
| 1489 | Ga0070711_100011074 | |||
| 1490 | Ga0070711_100017969 | |||
| 1491 | Ga0070711_100042422 | |||
| 1492 | Ga0070711_100052621 | |||
| 1493 | Ga0070705_100000221 | |||
| 1494 | Ga0070705_100002104 | |||
| 1495 | Ga0070705_100005766 | |||
| 1496 | Ga0070705_100008819 | |||
| 1497 | Ga0070705_100088584 | |||
| 1498 | Ga0070700_100030711 | |||
| 1499 | Ga0070700_100031058 | |||
| 1500 | Ga0070694_100003286 | |||
| 1501 | Ga0070694_100005213 | |||
| 1502 | Ga0070694_100006791 | |||
| 1503 | Ga0070694_100102871 | |||
| 1504 | Ga0070694_100195836 | |||
| 1505 | Ga0070694_100209803 | |||
| 1506 | Ga0070708_100006107 | |||
| 1507 | Ga0070708_100021130 | |||
| 1508 | Ga0070708_100082824 | |||
| 1509 | Ga0070708_100295673 | |||
| 1510 | Ga0070708_100326402 | |||
| 1511 | Ga0070678_100104267 | |||
| 1512 | Ga0070678_100262381 | |||
| 1513 | Ga0070678_100335093 | |||
| 1514 | Ga0070662_100050452 | |||
| 1515 | Ga0070662_100081810 | |||
| 1516 | Ga0070662_100088775 | |||
| 1517 | Ga0070681_10000242 | |||
| 1518 | Ga0070681_10008930 | |||
| 1519 | Ga0070681_10010266 | |||
| 1520 | Ga0070681_10428787 | |||
| 1521 | Ga0070681_10447933 | |||
| 1522 | Ga0068867_100003936 | |||
| 1523 | Ga0068867_100021810 | |||
| 1524 | Ga0068867_100038696 | |||
| 1525 | Ga0068867_100451137 | |||
| 1526 | Ga0070706_100000208 | |||
| 1527 | Ga0070706_100007222 | |||
| 1528 | Ga0070706_100042144 | |||
| 1529 | Ga0070706_100086813 | |||
| 1530 | Ga0070706_100156077 | |||
| 1531 | Ga0070706_100204180 | |||
| 1532 | Ga0070706_100274116 | |||
| 1533 | Ga0070706_100430419 | |||
| 1534 | Ga0070707_100020689 | |||
| 1535 | Ga0070707_100055558 | |||
| 1536 | Ga0070707_100081064 | |||
| 1537 | Ga0070707_100102983 | |||
| 1538 | Ga0070707_100120145 | |||
| 1539 | Ga0070707_100191869 | |||
| 1540 | Ga0070707_100240742 | |||
| 1541 | Ga0070707_100348076 | |||
| 1542 | Ga0070707_100461909 | |||
| 1543 | Ga0070698_100006201 | |||
| 1544 | Ga0070698_100007211 | |||
| 1545 | Ga0070698_100014143 | |||
| 1546 | Ga0070698_100021538 | |||
| 1547 | Ga0070698_100052957 | |||
| 1548 | Ga0070698_100145794 | |||
| 1549 | Ga0070699_100000029 | |||
| 1550 | Ga0070699_100001721 | |||
| 1551 | Ga0070699_100001814 | |||
| 1552 | Ga0070699_100002759 | |||
| 1553 | Ga0070699_100003831 | |||
| 1554 | Ga0070699_100011338 | |||
| 1555 | Ga0070699_100038432 | |||
| 1556 | Ga0070699_100075638 | |||
| 1557 | Ga0070699_100114935 | |||
| 1558 | Ga0070699_100207133 | |||
| 1559 | Ga0070699_100216768 | |||
| 1560 | Ga0070699_100260318 | |||
| 1561 | Ga0070699_100342557 | |||
| 1562 | Ga0070699_100374643 | |||
| 1563 | Ga0070699_100379795 | |||
| 1564 | Ga0070679_100014473 | |||
| 1565 | Ga0070679_100066444 | |||
| 1566 | Ga0070684_100000038 | |||
| 1567 | Ga0070684_100053735 | |||
| 1568 | Ga0070684_100083985 | |||
| 1569 | Ga0070684_100408693 | |||
| 1570 | Ga0070697_100000522 | |||
| 1571 | Ga0070697_100011943 | |||
| 1572 | Ga0070697_100027403 | |||
| 1573 | Ga0070697_100050479 | |||
| 1574 | Ga0070697_100103069 | |||
| 1575 | Ga0070697_100286198 | |||
| 1576 | Ga0070697_100286644 | |||
| 1577 | Ga0070672_100033032 | |||
| 1578 | Ga0070672_100041249 | |||
| 1579 | Ga0070672_100099821 | |||
| 1580 | Ga0070672_100123433 | |||
| 1581 | Ga0070686_100002326 | |||
| 1582 | Ga0070695_100003478 | |||
| 1583 | Ga0070695_100027675 | |||
| 1584 | Ga0070695_100093607 | |||
| 1585 | Ga0070695_100118096 | |||
| 1586 | Ga0070695_100198403 | |||
| 1587 | Ga0070696_100000362 | |||
| 1588 | Ga0070696_100002039 | |||
| 1589 | Ga0070696_100011391 | |||
| 1590 | Ga0070696_100015421 | |||
| 1591 | Ga0070696_100017408 | |||
| 1592 | Ga0070696_100022395 | |||
| 1593 | Ga0070696_100039752 | |||
| 1594 | Ga0070696_100059475 | |||
| 1595 | Ga0070696_100095540 | |||
| 1596 | Ga0070696_100133056 | |||
| 1597 | Ga0070696_100155335 | |||
| 1598 | Ga0070693_100000012 | |||
| 1599 | Ga0070693_100033253 | |||
| 1600 | Ga0070665_100026922 | |||
| 1601 | Ga0070665_100401326 | |||
| 1602 | Ga0070704_100003038 | |||
| 1603 | Ga0070704_100014058 | |||
| 1604 | Ga0070704_100023424 | |||
| 1605 | Ga0070704_100040094 | |||
| 1606 | Ga0070704_100070671 | |||
| 1607 | Ga0070704_100348200 | |||
| 1608 | Ga0070704_100398357 | |||
| 1609 | Ga0068855_100048548 | |||
| 1610 | Ga0068855_100049629 | |||
| 1611 | Ga0068855_100051195 | |||
| 1612 | Ga0068855_100080341 | |||
| 1613 | Ga0070664_100001762 | |||
| 1614 | Ga0070664_100079139 | |||
| 1615 | Ga0070664_100081513 | |||
| 1616 | Ga0070664_100140530 | |||
| 1617 | Ga0070664_100421083 | |||
| 1618 | Ga0068857_100000538 | |||
| 1619 | Ga0068857_100005072 | |||
| 1620 | Ga0068857_100022733 | |||
| 1621 | Ga0068857_100402436 | |||
| 1622 | Ga0068854_100005914 | |||
| 1623 | Ga0068854_100148965 | |||
| 1624 | Ga0068856_100000618 | |||
| 1625 | Ga0068856_100002308 | |||
| 1626 | Ga0068856_100017427 | |||
| 1627 | Ga0068856_100038178 | |||
| 1628 | Ga0070702_100020714 | |||
| 1629 | Ga0068852_100119127 | |||
| 1630 | Ga0068852_100184558 | |||
| 1631 | Ga0068859_100001945 | |||
| 1632 | Ga0068859_100063870 | |||
| 1633 | Ga0068859_100289434 | |||
| 1634 | Ga0068859_100291291 | |||
| 1635 | Ga0068859_100342706 | |||
| 1636 | Ga0068859_100706628 | |||
| 1637 | Ga0068864_100009721 | |||
| 1638 | Ga0068864_100015208 | |||
| 1639 | Ga0068864_100036850 | |||
| 1640 | Ga0068864_100054144 | |||
| 1641 | Ga0068864_100128617 | |||
| 1642 | Ga0068866_10009281 | |||
| 1643 | Ga0068861_100096112 | |||
| 1644 | Ga0068861_100101019 | |||
| 1645 | Ga0068870_10019398 | |||
| 1646 | Ga0068863_100002307 | |||
| 1647 | Ga0068863_100006891 | |||
| 1648 | Ga0068863_100095180 | |||
| 1649 | Ga0068863_100243708 | |||
| 1650 | Ga0068863_100280098 | |||
| 1651 | Ga0068863_100437126 | |||
| 1652 | Ga0068858_100008072 | |||
| 1653 | Ga0068858_100009268 | |||
| 1654 | Ga0068858_100055451 | |||
| 1655 | Ga0068858_100060731 | |||
| 1656 | Ga0068858_100209387 | |||
| 1657 | Ga0068858_100288158 | |||
| 1658 | Ga0068860_100007055 | |||
| 1659 | Ga0068860_100013803 | |||
| 1660 | Ga0068860_100071180 | |||
| 1661 | Ga0068860_100281787 | |||
| 1662 | Ga0068860_100347766 | |||
| 1663 | Ga0068860_100363247 | |||
| 1664 | Ga0068862_100006997 | |||
| 1665 | Ga0068862_100084035 | |||
| 1666 | Ga0068862_100299418 | |||
| 1667 | Ga0068862_100342259 | |||
| 1668 | Ga0068862_100427316 | |||
| 1669 | Ga0081455_10031589 | |||
| 1670 | Ga0081455_10064885 | |||
| 1671 | Ga0081455_10119536 | |||
| 1672 | Ga0081539_10000034 | |||
| 1673 | Ga0081539_10000092 | |||
| 1674 | Ga0081539_10000151 | |||
| 1675 | Ga0070717_10026495 | |||
| 1676 | Ga0070717_10352599 | |||
| 1677 | Ga0070717_10357667 | |||
| 1678 | Ga0075432_10033266 | |||
| 1679 | Ga0075432_10056822 | |||
| 1680 | Ga0070715_10009767 | |||
| 1681 | Ga0070715_10138434 | |||
| 1682 | Ga0070715_10166022 | |||
| 1683 | Ga0070716_100000362 | |||
| 1684 | Ga0070716_100001947 | |||
| 1685 | Ga0070716_100005601 | |||
| 1686 | Ga0070716_100010580 | |||
| 1687 | Ga0070716_100042990 | |||
| 1688 | Ga0070716_100061004 | |||
| 1689 | Ga0070716_100095408 | |||
| 1690 | Ga0070716_100148845 | |||
| 1691 | Ga0097621_100001489 | |||
| 1692 | Ga0097621_100030411 | |||
| 1693 | Ga0097621_100072830 | |||
| 1694 | Ga0097621_100135159 | |||
| 1695 | Ga0097621_100155599 | |||
| 1696 | Ga0097621_100348193 | |||
| 1697 | Ga0075370_10110391 | |||
| 1698 | Ga0068871_100006737 | |||
| 1699 | Ga0068871_100031351 | |||
| 1700 | Ga0068871_100327930 | |||
| 1701 | Ga0075428_100000398 | |||
| 1702 | Ga0075428_100000421 | |||
| 1703 | Ga0075428_100001485 | |||
| 1704 | Ga0075428_100002532 | |||
| 1705 | Ga0075428_100005186 | |||
| 1706 | Ga0075428_100013592 | |||
| 1707 | Ga0075428_100014142 | |||
| 1708 | Ga0075428_100027532 | |||
| 1709 | Ga0075428_100044754 | |||
| 1710 | Ga0075428_100070705 | |||
| 1711 | Ga0075428_100128474 | |||
| 1712 | Ga0075428_100179736 | |||
| 1713 | Ga0075428_100248391 | |||
| 1714 | Ga0075428_100282848 | |||
| 1715 | Ga0075428_100479810 | |||
| 1716 | Ga0075430_100000341 | |||
| 1717 | Ga0075430_100000882 | |||
| 1718 | Ga0075430_100007002 | |||
| 1719 | Ga0075430_100007723 | |||
| 1720 | Ga0075430_100024148 | |||
| 1721 | Ga0075430_100076865 | |||
| 1722 | Ga0075430_100127416 | |||
| 1723 | Ga0075430_100193047 | |||
| 1724 | Ga0075431_100001562 | |||
| 1725 | Ga0075431_100002961 | |||
| 1726 | Ga0075431_100006021 | |||
| 1727 | Ga0075431_100007984 | |||
| 1728 | Ga0075431_100019021 | |||
| 1729 | Ga0075431_100025142 | |||
| 1730 | Ga0075431_100029241 | |||
| 1731 | Ga0075431_100031771 | |||
| 1732 | Ga0075431_100043975 | |||
| 1733 | Ga0075431_100062732 | |||
| 1734 | Ga0075431_100227665 | |||
| 1735 | Ga0075431_100297281 | |||
| 1736 | Ga0075433_10000305 | |||
| 1737 | Ga0075433_10000783 | |||
| 1738 | Ga0075433_10027368 | |||
| 1739 | Ga0075433_10036132 | |||
| 1740 | Ga0075433_10065298 | |||
| 1741 | Ga0075433_10079756 | |||
| 1742 | Ga0075433_10110227 | |||
| 1743 | Ga0075433_10133243 | |||
| 1744 | Ga0075433_10309278 | |||
| 1745 | Ga0075433_10457953 | |||
| 1746 | Ga0075434_100000107 | |||
| 1747 | Ga0075434_100006811 | |||
| 1748 | Ga0075434_100015784 | |||
| 1749 | Ga0075434_100033258 | |||
| 1750 | Ga0075434_100052289 | |||
| 1751 | Ga0075434_100054358 | |||
| 1752 | Ga0075434_100056056 | |||
| 1753 | Ga0075434_100065144 | |||
| 1754 | Ga0075434_100076997 | |||
| 1755 | Ga0075434_100085346 | |||
| 1756 | Ga0075434_100089634 | |||
| 1757 | Ga0075434_100110722 | |||
| 1758 | Ga0075434_100141417 | |||
| 1759 | Ga0075434_100212937 | |||
| 1760 | Ga0075434_100246506 | |||
| 1761 | Ga0075434_100454812 | |||
| 1762 | Ga0075429_100001205 | |||
| 1763 | Ga0075429_100007238 | |||
| 1764 | Ga0075429_100011821 | |||
| 1765 | Ga0075429_100060770 | |||
| 1766 | Ga0075429_100122767 | |||
| 1767 | Ga0075429_100199639 | |||
| 1768 | Ga0075429_100244247 | |||
| 1769 | Ga0075429_100342578 | |||
| 1770 | Ga0068865_100206577 | |||
| 1771 | Ga0075436_100000592 | |||
| 1772 | Ga0075436_100001557 | |||
| 1773 | Ga0075436_100001958 | |||
| 1774 | Ga0075436_100004307 | |||
| 1775 | Ga0075436_100015198 | |||
| 1776 | Ga0075436_100017110 | |||
| 1777 | Ga0075436_100019077 | |||
| 1778 | Ga0075436_100100178 | |||
| 1779 | Ga0075436_100190857 | |||
| 1780 | Ga0075436_100227566 | |||
| 1781 | Ga0097620_100001945 | |||
| 1782 | Ga0097620_100063869 | |||
| 1783 | Ga0097620_100289466 | |||
| 1784 | Ga0097620_100291263 | |||
| 1785 | Ga0097620_100342705 | |||
| 1786 | Ga0097620_100706566 | |||
| 1787 | Ga0075435_100000054 | |||
| 1788 | Ga0075435_100007100 | |||
| 1789 | Ga0075435_100009536 | |||
| 1790 | Ga0075435_100026771 | |||
| 1791 | Ga0075435_100067955 | |||
| 1792 | Ga0075435_100208621 | |||
| 1793 | Ga0075435_100278562 | |||
| 1794 | Ga0099794_10000854 | |||
| 1795 | Ga0099795_10001407 | |||
| 1796 | Ga0105240_10002241 | |||
| 1797 | Ga0105240_10006423 | |||
| 1798 | Ga0105240_10020126 | |||
| 1799 | Ga0105240_10074666 | |||
| 1800 | Ga0105240_10136821 | |||
| 1801 | Ga0105240_10270955 | |||
| 1802 | Ga0105240_10377190 | |||
| 1803 | Ga0111539_10000455 | |||
| 1804 | Ga0111539_10000481 | |||
| 1805 | Ga0111539_10005828 | |||
| 1806 | Ga0111539_10011459 | |||
| 1807 | Ga0111539_10012335 | |||
| 1808 | Ga0111539_10014217 | |||
| 1809 | Ga0111539_10016344 | |||
| 1810 | Ga0111539_10023394 | |||
| 1811 | Ga0111539_10042847 | |||
| 1812 | Ga0111539_10044646 | |||
| 1813 | Ga0111539_10046140 | |||
| 1814 | Ga0111539_10449260 | |||
| 1815 | Ga0111539_10514303 | |||
| 1816 | Ga0111539_10542901 | |||
| 1817 | Ga0105245_10099472 | |||
| 1818 | Ga0105245_10336882 | |||
| 1819 | Ga0114129_10000704 | |||
| 1820 | Ga0114129_10000726 | |||
| 1821 | Ga0114129_10001085 | |||
| 1822 | Ga0114129_10004758 | |||
| 1823 | Ga0114129_10005676 | |||
| 1824 | Ga0114129_10007659 | |||
| 1825 | Ga0114129_10008153 | |||
| 1826 | Ga0114129_10008312 | |||
| 1827 | Ga0114129_10011034 | |||
| 1828 | Ga0114129_10011480 | |||
| 1829 | Ga0114129_10014123 | |||
| 1830 | Ga0114129_10017003 | |||
| 1831 | Ga0114129_10060780 | |||
| 1832 | Ga0114129_10067842 | |||
| 1833 | Ga0114129_10070576 | |||
| 1834 | Ga0114129_10114235 | |||
| 1835 | Ga0114129_10125199 | |||
| 1836 | Ga0114129_10149319 | |||
| 1837 | Ga0114129_10208823 | |||
| 1838 | Ga0114129_10211980 | |||
| 1839 | Ga0114129_10227596 | |||
| 1840 | Ga0114129_10433135 | |||
| 1841 | Ga0114129_10463942 | |||
| 1842 | Ga0114129_10579607 | |||
| 1843 | Ga0114129_10810959 | |||
| 1844 | Ga0114129_10831590 | |||
| 1845 | Ga0114129_10849499 | |||
| 1846 | Ga0105243_10047807 | |||
| 1847 | Ga0105243_10064744 | |||
| 1848 | Ga0105243_10132232 | |||
| 1849 | Ga0105241_10091402 | |||
| 1850 | Ga0105241_10381854 | |||
| 1851 | Ga0105242_10094144 | |||
| 1852 | Ga0105242_10134854 | |||
| 1853 | Ga0105248_10007473 | |||
| 1854 | Ga0105248_10030650 | |||
| 1855 | Ga0105248_10059915 | |||
| 1856 | Ga0105248_10093653 | |||
| 1857 | Ga0105248_10117414 | |||
| 1858 | Ga0105248_10327642 | |||
| 1859 | Ga0105248_10608518 | |||
| 1860 | Ga0105237_10020943 | |||
| 1861 | Ga0105237_10026934 | |||
| 1862 | Ga0105238_10000180 | |||
| 1863 | Ga0105238_10014879 | |||
| 1864 | Ga0105249_10025544 | |||
| 1865 | Ga0105249_10096944 | |||
| 1866 | Ga0105249_10270463 | |||
| 1867 | Ga0105249_10341706 | |||
| 1868 | Ga0105239_10006705 | |||
| 1869 | Ga0105246_10486348 | |||
| 1870 | Ga0157370_10001165 | |||
| 1871 | Ga0157370_10083174 | |||
| 1872 | Ga0157370_10094048 | |||
| 1873 | Ga0157369_10000592 | |||
| 1874 | Ga0157369_10115282 | |||
| 1875 | Ga0157369_10140362 | |||
| 1876 | Ga0157374_10000441 | |||
| 1877 | Ga0157374_10204452 | |||
| 1878 | Ga0157374_10242671 | |||
| 1879 | Ga0157374_10447025 | |||
| 1880 | Ga0157374_10462557 | |||
| 1881 | Ga0157378_10003579 | |||
| 1882 | Ga0157378_10025611 | |||
| 1883 | Ga0157378_10069837 | |||
| 1884 | Ga0157378_10129379 | |||
| 1885 | Ga0157378_10248636 | |||
| 1886 | Ga0163162_10282195 | |||
| 1887 | Ga0163162_10404675 | |||
| 1888 | Ga0157372_10003362 | |||
| 1889 | Ga0157372_10074245 | |||
| 1890 | Ga0157375_10085469 | |||
| 1891 | Ga0157375_10140687 | |||
| 1892 | Ga0157375_10148545 | |||
| 1893 | Ga0157375_10202265 | |||
| 1894 | Ga0157375_10206437 | |||
| 1895 | Ga0157375_10262360 | |||
| 1896 | Ga0163163_10038117 | |||
| 1897 | Ga0163163_10043789 | |||
| 1898 | Ga0163163_10083176 | |||
| 1899 | Ga0157380_10033796 | |||
| 1900 | Ga0157380_10131806 | |||
| 1901 | Ga0157380_10345636 | |||
| 1902 | Ga0157380_10346626 | |||
| 1903 | Ga0157377_10057953 | |||
| 1904 | Ga0157377_10100110 | |||
| 1905 | Ga0157379_10076476 | |||
| 1906 | Ga0157379_10102677 | |||
| 1907 | Ga0157379_10177469 | |||
| 1908 | Ga0157376_10000023 | |||
| 1909 | Ga0157376_10141115 | |||
| 1910 | Ga0157376_10182248 | |||
| 1911 | Ga0157376_10204088 | |||
| 1912 | Ga0157376_10209775 | |||
| 1913 | Ga0157376_10224760 | |||
| 1914 | Ga0163161_10072203 | |||
| 1915 | Ga0163161_10305681 | |||
| 1916 | Ga0206351_10837870 | |||
| 1917 | Ga0213873_10001907 | |||
| 1918 | Ga0213876_10038824 | |||
| 1919 | Ga0213876_10039142 | |||
| 1920 | Ga0213875_10004157 | |||
| 1921 | Ga0224572_1004837 | |||
| 1922 | Ga0207697_10087921 | |||
| 1923 | Ga0207653_10000261 | |||
| 1924 | Ga0207653_10011963 | |||
| 1925 | Ga0207692_10013816 | |||
| 1926 | Ga0207692_10014017 | |||
| 1927 | Ga0207642_10089922 | |||
| 1928 | Ga0207680_10026853 | |||
| 1929 | Ga0207685_10028201 | |||
| 1930 | Ga0207685_10045856 | |||
| 1931 | Ga0207699_10000002 | |||
| 1932 | Ga0207699_10024147 | |||
| 1933 | Ga0207699_10067158 | |||
| 1934 | Ga0207699_10110748 | |||
| 1935 | Ga0207699_10114079 | |||
| 1936 | Ga0207645_10034133 | |||
| 1937 | Ga0207643_10033372 | |||
| 1938 | Ga0207643_10200598 | |||
| 1939 | Ga0207705_10228325 | |||
| 1940 | Ga0207684_10000248 | |||
| 1941 | Ga0207684_10005571 | |||
| 1942 | Ga0207684_10100352 | |||
| 1943 | Ga0207684_10404860 | |||
| 1944 | Ga0207654_10032115 | |||
| 1945 | Ga0207654_10211716 | |||
| 1946 | Ga0207707_10001311 | |||
| 1947 | Ga0207707_10003312 | |||
| 1948 | Ga0207707_10010191 | |||
| 1949 | Ga0207707_10061912 | |||
| 1950 | Ga0207695_10017728 | |||
| 1951 | Ga0207695_10024628 | |||
| 1952 | Ga0207695_10033917 | |||
| 1953 | Ga0207695_10070335 | |||
| 1954 | Ga0207695_10087358 | |||
| 1955 | Ga0207695_10238563 | |||
| 1956 | Ga0207671_10021128 | |||
| 1957 | Ga0207671_10112684 | |||
| 1958 | Ga0207693_10021548 | |||
| 1959 | Ga0207693_10028502 | |||
| 1960 | Ga0207663_10000006 | |||
| 1961 | Ga0207663_10072055 | |||
| 1962 | Ga0207663_10112826 | |||
| 1963 | Ga0207663_10132277 | |||
| 1964 | Ga0207660_10006198 | |||
| 1965 | Ga0207660_10021369 | |||
| 1966 | Ga0207660_10038159 | |||
| 1967 | Ga0207660_10067295 | |||
| 1968 | Ga0207660_10069252 | |||
| 1969 | Ga0207660_10108957 | |||
| 1970 | Ga0207662_10013275 | |||
| 1971 | Ga0207662_10083186 | |||
| 1972 | Ga0207662_10267709 | |||
| 1973 | Ga0207657_10159172 | |||
| 1974 | Ga0207652_10016229 | |||
| 1975 | Ga0207652_10153166 | |||
| 1976 | Ga0207652_10240188 | |||
| 1977 | Ga0207646_10000922 | |||
| 1978 | Ga0207646_10012116 | |||
| 1979 | Ga0207646_10063648 | |||
| 1980 | Ga0207646_10071503 | |||
| 1981 | Ga0207646_10138884 | |||
| 1982 | Ga0207646_10147840 | |||
| 1983 | Ga0207646_10151667 | |||
| 1984 | Ga0207646_10275898 | |||
| 1985 | Ga0207681_10002867 | |||
| 1986 | Ga0207681_10014305 | |||
| 1987 | Ga0207681_10033869 | |||
| 1988 | Ga0207681_10097069 | |||
| 1989 | Ga0207681_10298208 | |||
| 1990 | Ga0207694_10001880 | |||
| 1991 | Ga0207694_10120402 | |||
| 1992 | Ga0207650_10009543 | |||
| 1993 | Ga0207650_10063244 | |||
| 1994 | Ga0207650_10109073 | |||
| 1995 | Ga0207650_10212015 | |||
| 1996 | Ga0207659_10001044 | |||
| 1997 | Ga0207659_10026922 | |||
| 1998 | Ga0207659_10058293 | |||
| 1999 | Ga0207659_10074768 | |||
| 2000 | Ga0207659_10106222 | |||
| 2001 | Ga0207700_10014372 | |||
| 2002 | Ga0207700_10015322 | |||
| 2003 | Ga0207700_10020937 | |||
| 2004 | Ga0207664_10006353 | |||
| 2005 | Ga0207664_10035733 | |||
| 2006 | Ga0207644_10011851 | |||
| 2007 | Ga0207644_10029360 | |||
| 2008 | Ga0207706_10021487 | |||
| 2009 | Ga0207706_10066546 | |||
| 2010 | Ga0207706_10090817 | |||
| 2011 | Ga0207706_10418756 | |||
| 2012 | Ga0207686_10048851 | |||
| 2013 | Ga0207686_10353113 | |||
| 2014 | Ga0207670_10051753 | |||
| 2015 | Ga0207670_10185080 | |||
| 2016 | Ga0207670_10205114 | |||
| 2017 | Ga0207704_10068872 | |||
| 2018 | Ga0207704_10223287 | |||
| 2019 | Ga0207665_10000680 | |||
| 2020 | Ga0207665_10001680 | |||
| 2021 | Ga0207665_10006483 | |||
| 2022 | Ga0207665_10007762 | |||
| 2023 | Ga0207665_10062269 | |||
| 2024 | Ga0207665_10083421 | |||
| 2025 | Ga0207665_10094458 | |||
| 2026 | Ga0207665_10105698 | |||
| 2027 | Ga0207665_10106458 | |||
| 2028 | Ga0207665_10159758 | |||
| 2029 | Ga0207665_10183891 | |||
| 2030 | Ga0207665_10253346 | |||
| 2031 | Ga0207691_10028579 | |||
| 2032 | Ga0207691_10039705 | |||
| 2033 | Ga0207691_10069553 | |||
| 2034 | Ga0207691_10089330 | |||
| 2035 | Ga0207691_10117965 | |||
| 2036 | Ga0207691_10236954 | |||
| 2037 | Ga0207691_10264970 | |||
| 2038 | Ga0207711_10047986 | |||
| 2039 | Ga0207711_10126859 | |||
| 2040 | Ga0207711_10145833 | |||
| 2041 | Ga0207711_10201992 | |||
| 2042 | Ga0207711_10326224 | |||
| 2043 | Ga0207711_10507248 | |||
| 2044 | Ga0207689_10065026 | |||
| 2045 | Ga0207689_10325030 | |||
| 2046 | Ga0207661_10000049 | |||
| 2047 | Ga0207661_10036940 | |||
| 2048 | Ga0207661_10197201 | |||
| 2049 | Ga0207679_10021463 | |||
| 2050 | Ga0207679_10044457 | |||
| 2051 | Ga0207679_10127521 | |||
| 2052 | Ga0207667_10025881 | |||
| 2053 | Ga0207667_10061251 | |||
| 2054 | Ga0207667_10067729 | |||
| 2055 | Ga0207667_10070057 | |||
| 2056 | Ga0207667_10112255 | |||
| 2057 | Ga0207667_10167900 | |||
| 2058 | Ga0207651_10028984 | |||
| 2059 | Ga0207651_10038078 | |||
| 2060 | Ga0207651_10093808 | |||
| 2061 | Ga0207651_10098282 | |||
| 2062 | Ga0207651_10156679 | |||
| 2063 | Ga0207712_10123261 | |||
| 2064 | Ga0207640_10020149 | |||
| 2065 | Ga0207640_10030580 | |||
| 2066 | Ga0207640_10328589 | |||
| 2067 | Ga0207658_10084783 | |||
| 2068 | Ga0207677_10002677 | |||
| 2069 | Ga0207677_10268714 | |||
| 2070 | Ga0207703_10007033 | |||
| 2071 | Ga0207703_10014289 | |||
| 2072 | Ga0207703_10042482 | |||
| 2073 | Ga0207703_10070079 | |||
| 2074 | Ga0207703_10131912 | |||
| 2075 | Ga0207703_10168490 | |||
| 2076 | Ga0207703_10193609 | |||
| 2077 | Ga0207703_10227439 | |||
| 2078 | Ga0207703_10325252 | |||
| 2079 | Ga0207639_10075419 | |||
| 2080 | Ga0207639_10285080 | |||
| 2081 | Ga0207678_10113384 | |||
| 2082 | Ga0207708_10029732 | |||
| 2083 | Ga0207708_10073061 | |||
| 2084 | Ga0207708_10314522 | |||
| 2085 | Ga0207702_10008916 | |||
| 2086 | Ga0207702_10053586 | |||
| 2087 | Ga0207702_10056997 | |||
| 2088 | Ga0207702_10072126 | |||
| 2089 | Ga0207702_10311445 | |||
| 2090 | Ga0207641_10001296 | |||
| 2091 | Ga0207641_10007090 | |||
| 2092 | Ga0207641_10061795 | |||
| 2093 | Ga0207641_10246505 | |||
| 2094 | Ga0207648_10003070 | |||
| 2095 | Ga0207648_10032208 | |||
| 2096 | Ga0207648_10249560 | |||
| 2097 | Ga0207648_10455626 | |||
| 2098 | Ga0207676_10007919 | |||
| 2099 | Ga0207676_10032639 | |||
| 2100 | Ga0207676_10041790 | |||
| 2101 | Ga0207676_10159388 | |||
| 2102 | Ga0207676_10175151 | |||
| 2103 | Ga0207676_10398658 | |||
| 2104 | Ga0207674_10003396 | |||
| 2105 | Ga0207674_10003522 | |||
| 2106 | Ga0207674_10416422 | |||
| 2107 | Ga0207675_100084688 | |||
| 2108 | Ga0207675_100207777 | |||
| 2109 | Ga0207675_100259118 | |||
| 2110 | Ga0207675_100327341 | |||
| 2111 | Ga0207675_100362987 | |||
| 2112 | Ga0207675_100557414 | |||
| 2113 | Ga0207683_10057829 | |||
| 2114 | Ga0207683_10081516 | |||
| 2115 | Ga0207683_10087107 | |||
| 2116 | Ga0207683_10145679 | |||
| 2117 | Ga0207683_10152611 | |||
| 2118 | Ga0207683_10450535 | |||
| 2119 | Ga0207683_10492119 | |||
| 2120 | Ga0207698_10057854 | |||
| 2121 | Ga0207698_10069312 | |||
| 2122 | Ga0207698_10394914 | |||
| 2123 | Ga0210000_1017429 | |||
| 2124 | Ga0209999_1015149 | |||
| 2125 | Ga0209588_1016626 | |||
| 2126 | Ga0209588_1036789 | |||
| 2127 | Ga0209974_10036009 | |||
| 2128 | Ga0209974_10073523 | |||
| 2129 | Ga0207428_10000033 | |||
| 2130 | Ga0207428_10000435 | |||
| 2131 | Ga0207428_10004008 | |||
| 2132 | Ga0207428_10009545 | |||
| 2133 | Ga0207428_10012546 | |||
| 2134 | Ga0207428_10021675 | |||
| 2135 | Ga0207428_10111443 | |||
| 2136 | Ga0207428_10139690 | |||
| 2137 | Ga0265354_1000073 | |||
| 2138 | Ga0268266_10000587 | |||
| 2139 | Ga0268266_10033791 | |||
| 2140 | Ga0268265_10010950 | |||
| 2141 | Ga0268265_10011935 | |||
| 2142 | Ga0268265_10223774 | |||
| 2143 | Ga0268265_10307431 | |||
| 2144 | Ga0268264_10025855 | |||
| 2145 | Ga0268264_10026177 | |||
| 2146 | Ga0268264_10289007 | |||
| 2147 | Ga0265319_1002097 | |||
| 2148 | Ga0265318_10000420 | |||
| 2149 | Ga0265323_10000906 | |||
| 2150 | Ga0265323_10007258 | |||
| 2151 | Ga0265323_10045981 | |||
| 2152 | Ga0265323_10047002 | |||
| 2153 | Ga0265322_10000885 | |||
| 2154 | Ga0265336_10001709 | |||
| 2155 | Ga0265338_10000139 | |||
| 2156 | Ga0265338_10003099 | |||
| 2157 | Ga0265338_10009300 | |||
| 2158 | Ga0265338_10025506 | |||
| 2159 | Ga0265338_10033630 | |||
| 2160 | Ga0265338_10056841 | |||
| 2161 | Ga0265770_1002159 | |||
| 2162 | Ga0265330_10025272 | |||
| 2163 | Ga0265328_10008223 | |||
| 2164 | Ga0265320_10001344 | |||
| 2165 | Ga0265320_10031720 | |||
| 2166 | Ga0265325_10052872 | |||
| 2167 | Ga0265325_10113238 | |||
| 2168 | Ga0265329_10000405 | |||
| 2169 | Ga0265340_10008053 | |||
| 2170 | Ga0265340_10018270 | |||
| 2171 | Ga0265339_10000182 | |||
| 2172 | Ga0265339_10053495 | |||
| 2173 | Ga0265331_10000317 | |||
| 2174 | Ga0265331_10000366 | |||
| 2175 | Ga0265331_10018808 | |||
| 2176 | Ga0265316_10002192 | |||
| 2177 | Ga0265316_10008727 | |||
| 2178 | Ga0265316_10024251 | |||
| 2179 | Ga0265316_10025334 | |||
| 2180 | Ga0265316_10045315 | |||
| 2181 | Ga0265316_10046649 | |||
| 2182 | Ga0265316_10074387 | |||
| 2183 | Ga0265316_10088326 | |||
| 2184 | Ga0265316_10095040 | |||
| 2185 | Ga0265316_10097504 | |||
| 2186 | Ga0265316_10189558 | |||
| 2187 | Ga0307408_100040504 | |||
| 2188 | Ga0307408_100076057 | |||
| 2189 | Ga0307408_100133647 | |||
| 2190 | Ga0307408_100137991 | |||
| 2191 | Ga0307408_100213002 | |||
| 2192 | Ga0307408_100216978 | |||
| 2193 | Ga0307408_100360712 | |||
| 2194 | Ga0265313_10000255 | |||
| 2195 | Ga0265313_10002537 | |||
| 2196 | Ga0316579_10083524 | |||
| 2197 | Ga0265314_10000408 | |||
| 2198 | Ga0265314_10083298 | |||
| 2199 | Ga0265342_10001004 | |||
| 2200 | Ga0265342_10018922 | |||
| 2201 | Ga0265342_10030867 | |||
| 2202 | Ga0265342_10045070 | |||
| 2203 | Ga0316578_10000576 | |||
| 2204 | Ga0307405_10052667 | |||
| 2205 | Ga0307405_10274282 | |||
| 2206 | Ga0307413_10015980 | |||
| 2207 | Ga0307413_10090835 | |||
| 2208 | Ga0307410_10000584 | |||
| 2209 | Ga0307410_10021988 | |||
| 2210 | Ga0307410_10027478 | |||
| 2211 | Ga0307410_10363650 | |||
| 2212 | Ga0307406_10256534 | |||
| 2213 | Ga0307407_10007994 | |||
| 2214 | Ga0307407_10015484 | |||
| 2215 | Ga0307407_10031272 | |||
| 2216 | Ga0307407_10182902 | |||
| 2217 | Ga0307412_10008811 | |||
| 2218 | Ga0307412_10022102 | |||
| 2219 | Ga0307412_10043309 | |||
| 2220 | Ga0307409_100001963 | |||
| 2221 | Ga0307409_100009405 | |||
| 2222 | Ga0307409_100170895 | |||
| 2223 | Ga0307409_100475203 | |||
| 2224 | Ga0307409_100592578 | |||
| 2225 | Ga0307416_100002140 | |||
| 2226 | Ga0307416_100008530 | |||
| 2227 | Ga0307416_100013568 | |||
| 2228 | Ga0307416_100022496 | |||
| 2229 | Ga0307416_100257865 | |||
| 2230 | Ga0307414_10006358 | |||
| 2231 | Ga0307414_10015416 | |||
| 2232 | Ga0307414_10064531 | |||
| 2233 | Ga0307411_10001766 | |||
| 2234 | Ga0307411_10006989 | |||
| 2235 | Ga0307411_10010855 | |||
| 2236 | Ga0307411_10291488 | |||
| 2237 | Ga0307411_10325012 | |||
| 2238 | Ga0316580_10047029 | |||
| 2239 | Ga0316592_1002075 | |||
| 2240 | Ga0316592_1007560 | |||
| 2241 | Ga0316588_1000364 | |||
| 2242 | Ga0316596_1008554 | |||
| 2243 | Ga0316212_1000277 | |||
| 2244 | Ga0373948_0011441 | |||
| 2245 | Ga0373958_0022934 | |||
| 2246 | Ga0373959_0002633 | |||
| 2247 | Ga0373938_0000411 | |||
| 2248 | Ga0373926_0001952 | |||
| 2249 | Ga0373926_0017848 | |||
| 2250 | Ga0373928_0003168 | |||
| 2251 | Ga0373929_0003351 | |||
| 2252 | Ga0373934_0010338 | |||
| 2253 | Ga0373934_0032053 | |||
| 2254 | Ga0373944_0066540 | |||
| 2255 | Ga0373951_0001893 | |||
| 2256 | Ga0373952_0002290 | |||
| 2257 | Ga0373923_0049358 | |||
| 2258 | Ga0373923_0115880 | |||
| 2259 | Ga0373932_0003415 | |||
| 2260 | Ga0373936_0021294 | |||
| 2261 | Ga0373936_0032866 | |||
| 2262 | Ga0373939_0003135 | |||
| 2263 | Ga0373941_0000100 | |||
| 2264 | Ga0373945_0005208 | |||
| 2265 | Ga0373945_0018312 | |||
| 2266 | Ga0373945_0050565 | |||
| 2267 | Ga0373953_0005563 | |||
| 2268 | Ga0373954_0001733 | |||
| 2269 | Ga0373954_0063400 | |||
| 2270 | Ga0373954_0070445 | |||
| 2271 | Ga0373954_0100924 | |||
| 2272 | Ga0373954_0120788 | |||
| 2273 | Ga0373956_0005358 | |||
| 2274 | Ga0373956_0013358 | |||
| 2275 | Ga0373960_0001352 | |||
| 2276 | Ga0373943_0057785 | |||
| 2277 | Ga0373943_0064135 | |||
| 2278 | Ga0373943_0155902 | |||
| 2279 | Ga0373946_0001535 | |||
| 2280 | Ga0373946_0040845 | |||
| 2281 | Ga0373946_0052362 | |||
| 2282 | Ga0373946_0082587 | |||
| 2283 | Ga0373955_0002172 | |||
| 2284 | Ga0373955_0020850 | |||
| 2285 | Ga0373955_0066556 | |||
| 2286 | Ga0373942_0003366 | |||
| 2287 | Ga0373961_0001007 | |||
| 2288 | Ga0373961_0047257 | |||
| 2289 | Ga0316574_0009468 | |||
| 2290 | Ga0373924_0184404 | |||
| 2291 | Ga0373931_0000326 | |||
| 2292 | Ga0373931_0011882 | |||
| 2293 | Ga0373931_0045572 | |||
| 2294 | Ga0373935_0007305 | |||
| 2295 | Ga0373935_0017708 | |||
| 2296 | Ga0373935_0043884 | |||
| 2297 | Ga0373935_0083190 | |||
| 2298 | Ga0373927_0001044 | |||
| 2299 | Ga0373927_0003851 | |||
| 2300 | Ga0373927_0007815 | |||
| 2301 | Ga0373927_0012069 | |||
| 2302 | Ga0373927_0081468 | |||
| 2303 | Ga0373927_0133512 | |||
| 2304 | Ga0373933_0012932 | |||
| 2305 | Ga0373933_0060171 | |||
| 2306 | Ga0373933_0118591 | |||
| 2307 | Ga0373947_0001564 | |||
| 2308 | Ga0373947_0005841 | |||
| 2309 | Ga0373947_0006086 | |||
| 2310 | Ga0373947_0072097 | |||
| 2311 | Ga0373947_0082739 | |||
| 2312 | Ga0373947_0167708 | |||
| 2313 | Ga0373947_0187721 | |||
| 2314 | Ga0373937_0003455 | |||
| 2315 | Ga0373937_0021013 | |||
| 2316 | Ga0373937_0082047 | |||
| 2317 | Ga0373937_0086200 | |||
| 2318 | Ga0373937_0088612 | |||
| 2319 | Ga0373937_0192094 | |||
| 2320 | Ga0373937_0204030 | |||
| 2321 | Ga0316582_0007601 | |||
| 2322 | Ga0316582_0008317 | |||
| 2323 | Ga0316582_0041012 | |||
| 2324 | Ga0316582_0163124 | |||
| 2325 | Ga0316584_0133075 | |||
| 2326 | Ga0373925_0001268 | |||
| 2327 | Ga0373925_0006381 | |||
| 2328 | Ga0373925_0007445 | |||
| 2329 | Ga0373925_0008189 | |||
| 2330 | Ga0373925_0033881 | |||
| 2331 | Ga0373925_0161693 | |||
| 2332 | Ga0373925_0279063 | |||
| 2333 | Ga0373925_0389730 | |||
| 2334 | Ga0395899_0048870 | |||
| 2335 | Ga0395900_0002799 | |||
| 2336 | Ga0395900_0032160 | |||
| 2337 | Ga0395898_0002991 | |||
| 2338 | Ga0395898_0106762 | |||
| 2339 | Ga0395898_0209536 | |||
| 2340 | Ga0395898_0212131 | |||
| 2341 | Ga0395905_0045314 | |||
| 2342 | Ga0395905_0157698 | |||
| 2343 | Ga0395905_0275876 | |||
| 2344 | Ga0395905_0283114 | |||
| 2345 | Ga0395905_0308492 | |||
| 2346 | Ga0395905_0337999 | |||
| 2347 | Ga0316581_0020655 | |||
| 2348 | Ga0436364_0302019 | |||
| 2349 | Ga0436364_0305504 | |||
| 2350 | Ga0436364_1196049 | |||
| 2351 | Ga0395901_0000800 | |||
| 2352 | Ga0395901_0066875 | |||
| 2353 | Ga0395901_0108573 | |||
| 2354 | Ga0395901_0432088 | |||
| 2355 | Ga0400488_08526 | |||
| 2356 | Ga0400483_133231 | |||
| 2357 | Ga0436365_0695601 | |||
| 2358 | Ga0436365_0701791 | |||
| 2359 | Ga0436365_1368230 | |||
| 2360 | Ga0436365_1473988 | |||
| 2361 | Ga0436365_1711751 | |||
| 2362 | Ga0436360_0811333 | |||
| 2363 | Ga0436360_1006139 | |||
| 2364 | Ga0436361_0831143 | |||
| 2365 | Ga0436363_0100449 | |||
| 2366 | Ga0451577_0000102 | |||
| 2367 | Ga0451577_0000118 | |||
| 2368 | Ga0451577_0000158 | |||
| 2369 | Ga0451577_0000342 | |||
| 2370 | Ga0451577_0000442 | |||
| 2371 | Ga0451577_0002894 | |||
| 2372 | Ga0451577_0010768 | |||
| 2373 | Ga0451577_0010818 | |||
| 2374 | Ga0451577_0024537 | |||
| 2375 | Ga0451577_0034248 | |||
| 2376 | Ga0451577_0047223 | |||
| 2377 | Ga0451577_0062738 | |||
| 2378 | Ga0451577_0086879 | |||
| 2379 | Ga0451577_0109542 | |||
| 2380 | Ga0451577_0122691 | |||
| 2381 | Ga0451577_0146091 | |||
| 2382 | Ga0451577_0148304 | |||
| 2383 | Ga0451577_0202057 | |||
| 2384 | Ga0451577_0249939 | |||
| 2385 | Ga0451577_0475607 | |||
| 2386 | Ga0453683_0000001 | |||
| 2387 | Ga0453683_0000095 | |||
| 2388 | Ga0453683_0000668 | |||
| 2389 | Ga0453683_0014218 | |||
| 2390 | Ga0453683_0015951 | |||
| 2391 | Ga0453683_0061315 | |||
| 2392 | Ga0453683_0095561 | |||
| 2393 | Ga0453683_0156752 | |||
| 2394 | Ga0453684_0000036 | |||
| 2395 | Ga0453684_0000089 | |||
| 2396 | Ga0453684_0000249 | |||
| 2397 | Ga0453684_0000291 | |||
| 2398 | Ga0453684_0000416 | |||
| 2399 | Ga0453684_0000931 | |||
| 2400 | Ga0453684_0001325 | |||
| 2401 | Ga0453684_0002093 | |||
| 2402 | Ga0453684_0004587 | |||
| 2403 | Ga0453684_0010523 | |||
| 2404 | Ga0453684_0012461 | |||
| 2405 | Ga0453684_0012798 | |||
| 2406 | Ga0453684_0016247 | |||
| 2407 | Ga0453684_0016452 | |||
| 2408 | Ga0453684_0065370 | |||
| 2409 | Ga0451576_0000771 | |||
| 2410 | Ga0451576_0000986 | |||
| 2411 | Ga0451576_0002308 | |||
| 2412 | Ga0451576_0004596 | |||
| 2413 | Ga0451576_0006456 | |||
| 2414 | Ga0451576_0008282 | |||
| 2415 | Ga0451576_0010231 | |||
| 2416 | Ga0451576_0017793 | |||
| 2417 | Ga0451576_0023257 | |||
| 2418 | Ga0451576_0048024 | |||
| 2419 | Ga0451576_0055948 | |||
| 2420 | Ga0451576_0070865 | |||
| 2421 | Ga0451576_0076476 | |||
| 2422 | Ga0451576_0089845 | |||
| 2423 | Ga0451576_0116955 | |||
| 2424 | Ga0451576_0132403 | |||
| 2425 | Ga0466967_0049862 | |||
| 2426 | Ga0495592_0143522 | |||
| 2427 | Ga0495603_0078049 | |||
| 2428 | Ga0495603_0173644 | |||
| 2429 | Ga0495629_0011921 | |||
| 2430 | Ga0495629_0186010 | |||
| 2431 | Ga0495651_0015055 | |||
| 2432 | Ga0495651_0018396 | |||
| 2433 | Ga0495651_0048545 | |||
| 2434 | Ga0495651_0179708 | |||
| 2435 | Ga0495580_0000698 | |||
| 2436 | Ga0495580_0000831 | |||
| 2437 | Ga0495580_0003043 | |||
| 2438 | Ga0495580_0006590 | |||
| 2439 | Ga0495580_0048725 | |||
| 2440 | Ga0495580_0049783 | |||
| 2441 | Ga0495580_0055509 | |||
| 2442 | Ga0495580_0085302 | |||
| 2443 | Ga0495580_0107202 | |||
| 2444 | Ga0495580_0108584 | |||
| 2445 | Ga0495580_0130040 | |||
| 2446 | Ga0495580_0209793 | |||
| 2447 | Ga0495582_0000811 | |||
| 2448 | Ga0495582_0038876 | |||
| 2449 | Ga0495582_0097234 | |||
| 2450 | Ga0495662_0011005 | |||
| 2451 | Ga0495664_0006501 | |||
| 2452 | Ga0495664_0046463 | |||
| 2453 | Ga0495594_0081059 | |||
| 2454 | Ga0495594_0101666 | |||
| 2455 | Ga0495608_0084278 | |||
| 2456 | Ga0495608_0194539 | |||
| 2457 | Ga0495618_0001176 | |||
| 2458 | Ga0495628_0036251 | |||
| 2459 | Ga0495628_0120163 | |||
| 2460 | Ga0495628_0166282 | |||
| 2461 | Ga0495630_0006727 | |||
| 2462 | Ga0495630_0015944 | |||
| 2463 | Ga0495643_0001268 | |||
| 2464 | Ga0495666_0065298 | |||
| 2465 | Ga0495666_0151869 | |||
| 2466 | Ga0495642_0011949 | |||
| 2467 | Ga0495642_0012097 | |||
| 2468 | Ga0495642_0071469 | |||
| 2469 | Ga0495652_0064248 | |||
| 2470 | Ga0495652_0140811 | |||
| 2471 | Ga0495652_0146033 | |||
| 2472 | Ga0495652_0155998 | |||
| 2473 | Ga0495665_0002806 | |||
| 2474 | Ga0495665_0011553 | |||
| 2475 | Ga0495665_0034126 | |||
| 2476 | Ga0495640_0036676 | |||
| 2477 | Ga0495586_0189269 | |||
| 2478 | Ga0495587_0000291 | |||
| 2479 | Ga0495587_0004247 | |||
| 2480 | Ga0495645_0002293 | |||
| 2481 | Ga0495645_0009122 | |||
| 2482 | Ga0495645_0215593 | |||
| 2483 | Ga0495667_0111047 | |||
| 2484 | Ga0495656_0107305 | |||
| 2485 | Ga0495634_0057461 | |||
| 2486 | Ga0495634_0084864 | |||
| 2487 | Ga0495634_0117270 | |||
| 2488 | Ga0495635_0049638 | |||
| 2489 | Ga0495659_0001646 | |||
| 2490 | Ga0495659_0003198 | |||
| 2491 | Ga0495659_0008101 | |||
| 2492 | Ga0495659_0055608 | |||
| 2493 | Ga0495659_0076585 | |||
| 2494 | Ga0495588_0002473 | |||
| 2495 | Ga0495657_0056537 | |||
| 2496 | Ga0495599_0265868 | |||
| 2497 | Ga0495623_0027851 | |||
| 2498 | Ga0495623_0046467 | |||
| 2499 | Ga0495658_0115923 | |||
| 2500 | Ga0495658_0187190 | |||
| 2501 | Ga0495669_0006346 | |||
| 2502 | Ga0495669_0027677 | |||
| 2503 | Ga0495669_0033700 | |||
| 2504 | Ga0495669_0107491 | |||
| 2505 | Ga0495669_0121383 | |||
| 2506 | Ga0495613_0040442 | |||
| 2507 | Ga0495613_0047111 | |||
| 2508 | Ga0495670_0087704 | |||
| 2509 | Ga0495600_0190977 | |||
| 2510 | Ga0495581_0011957 | |||
| 2511 | Ga0495581_0156534 | |||
| 2512 | Ga0495604_0000768 | |||
| 2513 | Ga0495604_0058699 | |||
| 2514 | Ga0495636_0013309 | |||
| 2515 | Ga0495636_0154209 | |||
| 2516 | Ga0495674_0015837 | |||
| 2517 | Ga0495674_0072475 | |||
| 2518 | Ga0495674_0190786 | |||
| 2519 | Ga0495674_0216134 | |||
| 2520 | Ga0495674_0299208 | |||
| 2521 | Ga0495674_0376766 | |||
| 2522 | Ga0495675_0096815 | |||
| 2523 | Ga0495675_0125611 | |||
| 2524 | Ga0495675_0175636 | |||
| 2525 | Ga0495685_026031 | |||
| 2526 | Ga0495684_0004863 | |||
| 2527 | Ga0495684_0010480 | |||
| 2528 | Ga0495684_0124545 | |||
| 2529 | Ga0495684_0176314 | |||
| 2530 | Ga0495602_0019958 | |||
| 2531 | Ga0495602_0110466 | |||
| 2532 | Ga0495602_0132025 | |||
| 2533 | Ga0496102_0049189 | |||
| 2534 | Ga0496102_0089343 | |||
| 2535 | Ga0496104_0122186 | |||
| 2536 | Ga0496106_0080674 | |||
| 2537 | Ga0496106_0374551 | |||
| 2538 | Ga0496112_0044478 | |||
| 2539 | Ga0496112_0446153 | |||
| 2540 | Ga0496115_0021365 | |||
| 2541 | Ga0496115_0358937 | |||
| 2542 | Ga0501031_0039173 | |||
| 2543 | Ga0501031_0272494 | |||
| 2544 | Ga0501032_0063690 | |||
| 2545 | Ga0501033_0061239 | |||
| 2546 | Ga0501034_0022870 | |||
| 2547 | Ga0501034_0042270 | |||
| 2548 | Ga0501036_0122531 | |||
| 2549 | Ga0501036_0221593 | |||
| 2550 | Ga0501036_0265424 | |||
| 2551 | Ga0501037_0006924 | |||
| 2552 | Ga0501038_0062519 | |||
| 2553 | Ga0501038_0152414 | |||
| 2554 | Ga0501039_0050461 | |||
| 2555 | Ga0501039_0154242 | |||
| 2556 | Ga0501040_0005078 | |||
| 2557 | Ga0501040_0016245 | |||
| 2558 | Ga0501040_0023758 | |||
| 2559 | Ga0501040_0068659 | |||
| 2560 | Ga0501040_0145822 | |||
| 2561 | Ga0501040_0176350 | |||
| 2562 | Ga0501041_0001270 | |||
| 2563 | Ga0501041_0008158 | |||
| 2564 | Ga0501041_0084472 | |||
| 2565 | Ga0501041_0183194 | |||
| 2566 | Ga0501042_0003910 | |||
| 2567 | Ga0501042_0048431 | |||
| 2568 | Ga0501042_0057710 | |||
| 2569 | Ga0501042_0067909 | |||
| 2570 | Ga0501042_0167360 | |||
| 2571 | Ga0501043_0096769 | |||
| 2572 | Ga0501046_0031516 | |||
| 2573 | Ga0501046_0131141 | |||
| 2574 | Ga0501047_0006159 | |||
| 2575 | Ga0501047_0156444 | |||
| 2576 | Ga0501048_0031747 | |||
| 2577 | Ga0501048_0037562 | |||
| 2578 | Ga0501048_0052967 | |||
| 2579 | Ga0501048_0140390 | |||
| 2580 | Ga0501048_0260464 | |||
| 2581 | Ga0501068_0093735 | |||
| 2582 | Ga0501069_0157190 | |||
| 2583 | Ga0501070_0019276 | |||
| 2584 | Ga0501071_0197027 | |||
| 2585 | Ga0501072_0007790 | |||
| 2586 | Ga0501072_0008017 | |||
| 2587 | Ga0501072_0030980 | |||
| 2588 | Ga0501072_0121920 | |||
| 2589 | Ga0501072_0222403 | |||
| 2590 | Ga0501072_0339496 | |||
| 2591 | Ga0501073_0069643 | |||
| 2592 | Ga0501074_0014004 | |||
| 2593 | Ga0501074_0238228 | |||
| 2594 | Ga0501075_0001108 | |||
| 2595 | Ga0501075_0021880 | |||
| 2596 | Ga0501075_0034963 | |||
| 2597 | Ga0501075_0045609 | |||
| 2598 | Ga0501075_0062522 | |||
| 2599 | Ga0501075_0211343 | |||
| 2600 | Ga0501076_0003486 | |||
| 2601 | Ga0501076_0006788 | |||
| 2602 | Ga0501076_0023621 | |||
| 2603 | Ga0501076_0028396 | |||
| 2604 | Ga0501076_0049874 | |||
| 2605 | Ga0501076_0061604 | |||
| 2606 | Ga0501077_0007255 | |||
| 2607 | Ga0501077_0023722 | |||
| 2608 | Ga0501221_007705 | |||
| 2609 | Ga0501079_0023210 | |||
| 2610 | Ga0501079_0028665 | |||
| 2611 | Ga0501079_0056686 | |||
| 2612 | Ga0501079_0079882 | |||
| 2613 | Ga0501079_0349400 | |||
| 2614 | Ga0501079_0350356 | |||
| 2615 | Ga0501080_0229356 | |||
| 2616 | Ga0501081_0015900 | |||
| 2617 | Ga0501081_0032131 | |||
| 2618 | Ga0501081_0102764 | |||
| 2619 | Ga0501081_0144610 | |||
| 2620 | Ga0501083_0021667 | |||
| 2621 | Ga0501083_0122590 | |||
| 2622 | Ga0501035_0003460 | |||
| 2623 | Ga0501035_0128745 | |||
| 2624 | Ga0501035_0300864 | |||
| 2625 | Ga0501044_0083960 | |||
| 2626 | Ga0501044_0152287 | |||
| 2627 | Ga0501044_0187224 | |||
| 2628 | Ga0501045_0018388 | |||
| 2629 | Ga0501045_0049374 | |||
| 2630 | Ga0501045_0061868 | |||
| 2631 | Ga0501045_0069794 | |||
| 2632 | nmdc:mga07m45_165069_c1 | |||
| 2633 | nmdc:mga05p37_109553_c1 | |||
| 2634 | nmdc:mga05p37_113948_c1 | |||
| 2635 | nmdc:mga05p37_119088_c1 | |||
| 2636 | nmdc:mga05p37_1238_c1 | |||
| 2637 | nmdc:mga05p37_137766_c1 | |||
| 2638 | nmdc:mga05p37_141558_c1 | |||
| 2639 | nmdc:mga05p37_15576_c1 | |||
| 2640 | nmdc:mga05p37_16644_c1 | |||
| 2641 | nmdc:mga05p37_170232_c1 | |||
| 2642 | nmdc:mga05p37_193544_c1 | |||
| 2643 | nmdc:mga05p37_202927_c1 | |||
| 2644 | nmdc:mga05p37_208691_c1 | |||
| 2645 | nmdc:mga05p37_214193_c1 | |||
| 2646 | nmdc:mga05p37_21975_c1 | |||
| 2647 | nmdc:mga05p37_23196_c1 | |||
| 2648 | nmdc:mga05p37_2826_c1 | |||
| 2649 | nmdc:mga05p37_30941_c1 | |||
| 2650 | nmdc:mga05p37_35271_c1 | |||
| 2651 | nmdc:mga05p37_3828_c1 | |||
| 2652 | nmdc:mga05p37_4725_c1 | |||
| 2653 | nmdc:mga05p37_507298_c1 | |||
| 2654 | nmdc:mga05p37_571_c1 | |||
| 2655 | nmdc:mga05p37_7972_c1 | |||
| 2656 | nmdc:mga05p37_830350_c1 | |||
| 2657 | nmdc:mga05p37_893_c1 | |||
| 2658 | nmdc:mga09592_1061_c1 | |||
| 2659 | nmdc:mga09592_109088_c1 | |||
| 2660 | nmdc:mga09592_124010_c1 | |||
| 2661 | nmdc:mga09592_16949_c1 | |||
| 2662 | nmdc:mga09592_1842_c1 | |||
| 2663 | nmdc:mga09592_263750_c1 | |||
| 2664 | nmdc:mga09592_31912_c1 | |||
| 2665 | nmdc:mga09592_47811_c1 | |||
| 2666 | nmdc:mga09592_9084_c1 | |||
| 2667 | nmdc:mga09592_9871_c1 | |||
| 2668 | nmdc:mga0qj67_12967_c1 | |||
| 2669 | nmdc:mga0qj67_150404_c1 | |||
| 2670 | nmdc:mga0qj67_26317_c1 | |||
| 2671 | nmdc:mga0qj67_27875_c1 | |||
| 2672 | nmdc:mga0qj67_40407_c1 | |||
| 2673 | nmdc:mga0qj67_4733_c1 | |||
| 2674 | nmdc:mga0qj67_73685_c1 | |||
| 2675 | nmdc:mga0qj67_7669_c1 | |||
| 2676 | nmdc:mga0qj67_93375_c1 | |||
| 2677 | nmdc:mga06r32_133219_c1 | |||
| 2678 | nmdc:mga06r32_16916_c1 | |||
| 2679 | nmdc:mga06r32_281346_c1 | |||
| 2680 | nmdc:mga06r32_28342_c1 | |||
| 2681 | nmdc:mga06r32_29558_c1 | |||
| 2682 | nmdc:mga06r32_42603_c1 | |||
| 2683 | nmdc:mga06r32_44660_c1 | |||
| 2684 | nmdc:mga06r32_6384_c1 | |||
| 2685 | nmdc:mga06r32_70113_c1 | |||
| 2686 | nmdc:mga08y16_12_c1 | |||
| 2687 | nmdc:mga08y16_133721_c1 | |||
| 2688 | nmdc:mga08y16_19558_c1 | |||
| 2689 | nmdc:mga08y16_2054_c1 | |||
| 2690 | nmdc:mga08y16_31818_c1 | |||
| 2691 | nmdc:mga08y16_37489_c1 | |||
| 2692 | nmdc:mga08y16_379934_c1 | |||
| 2693 | nmdc:mga08y16_388882_c1 | |||
| 2694 | nmdc:mga08y16_41092_c1 | |||
| 2695 | nmdc:mga08y16_485231_c1 | |||
| 2696 | nmdc:mga08y16_486273_c1 | |||
| 2697 | nmdc:mga08y16_5112_c1 | |||
| 2698 | nmdc:mga08y16_58013_c1 | |||
| 2699 | nmdc:mga08y16_66988_c1 | |||
| 2700 | nmdc:mga0n895_118755_c1 | |||
| 2701 | nmdc:mga0n895_123259_c1 | |||
| 2702 | nmdc:mga0n895_129696_c1 | |||
| 2703 | nmdc:mga0n895_132294_c1 | |||
| 2704 | nmdc:mga0n895_172066_c1 | |||
| 2705 | nmdc:mga0n895_1792_c1 | |||
| 2706 | nmdc:mga0n895_202578_c1 | |||
| 2707 | nmdc:mga0n895_230479_c1 | |||
| 2708 | nmdc:mga0n895_26_c1 | |||
| 2709 | nmdc:mga0n895_31169_c1 | |||
| 2710 | nmdc:mga0n895_3140_c1 | |||
| 2711 | nmdc:mga0n895_38100_c1 | |||
| 2712 | nmdc:mga0n895_438309_c1 | |||
| 2713 | nmdc:mga0n895_542862_c1 | |||
| 2714 | nmdc:mga0n895_69370_c1 | |||
| 2715 | nmdc:mga0n895_75583_c1 | |||
| 2716 | nmdc:mga0n895_93994_c1 | |||
| 2717 | nmdc:mga0rr50_117604_c1 | |||
| 2718 | nmdc:mga0rr50_13268_c1 | |||
| 2719 | nmdc:mga0rr50_137614_c1 | |||
| 2720 | nmdc:mga0rr50_189_c1 | |||
| 2721 | nmdc:mga0rr50_206759_c1 | |||
| 2722 | nmdc:mga0rr50_24412_c1 | |||
| 2723 | nmdc:mga0rr50_381867_c1 | |||
| 2724 | nmdc:mga0rr50_4734_c1 | |||
| 2725 | nmdc:mga0rr50_5_c1 | |||
| 2726 | nmdc:mga0rr50_65136_c1 | |||
| 2727 | nmdc:mga0rr50_88017_c1 | |||
| 2728 | nmdc:mga0rr50_9409_c1 | |||
| 2729 | nmdc:mga0rr50_94521_c1 | |||
| 2730 | nmdc:mga08x19_18929_c1 | |||
| 2731 | nmdc:mga08x19_193_c1 | |||
| 2732 | nmdc:mga08x19_230579_c1 | |||
| 2733 | nmdc:mga08x19_28451_c1 | |||
| 2734 | nmdc:mga08x19_36038_c1 | |||
| 2735 | nmdc:mga08x19_3741_c1 | |||
| 2736 | nmdc:mga08x19_39_c1 | |||
| 2737 | nmdc:mga08x19_552_c1 | |||
| 2738 | nmdc:mga08x19_6051_c1 | |||
| 2739 | nmdc:mga08x19_64443_c1 | |||
| 2740 | nmdc:mga08x19_67122_c1 | |||
| 2741 | nmdc:mga08x19_68796_c1 | |||
| 2742 | nmdc:mga08x19_90523_c1 | |||
| 2743 | nmdc:mga08x19_935_c1 | |||
| 2744 | nmdc:mga0a205_1070_c1 | |||
| 2745 | nmdc:mga0a205_157809_c1 | |||
| 2746 | nmdc:mga0a205_166707_c1 | |||
| 2747 | nmdc:mga0a205_17003_c1 | |||
| 2748 | nmdc:mga0a205_17100_c1 | |||
| 2749 | nmdc:mga0a205_23132_c1 | |||
| 2750 | nmdc:mga0a205_25660_c1 | |||
| 2751 | nmdc:mga0a205_27475_c1 | |||
| 2752 | nmdc:mga0a205_32_c1 | |||
| 2753 | nmdc:mga0a205_334455_c1 | |||
| 2754 | nmdc:mga0a205_37839_c2 | |||
| 2755 | nmdc:mga0a205_55818_c1 | |||
| 2756 | nmdc:mga0a205_619_c1 | |||
| 2757 | nmdc:mga0a205_82749_c1 | |||
| 2758 | Ga0495612_0022097 | |||
| 2759 | Ga0495595_0081047 | |||
| 2760 | Ga0495619_0003455 | |||
| 2761 | Ga0495619_0027075 | |||
| 2762 | Ga0495619_0224215 | |||
| 2763 | Ga0501084_0004255 | |||
| 2764 | Ga0501084_0010571 | |||
| 2765 | Ga0501084_0014550 | |||
| 2766 | Ga0501084_0071702 | |||
| 2767 | Ga0501084_0182648 | |||
| 2768 | Ga0590071_000237 | |||
| 2769 | Ga0590074_000404 | |||
| 2770 | Ga0590075_000952 | |||
| 2771 | Ga0590075_005099 | |||
| 2772 | Ga0590075_025889 | |||
| 2773 | Ga0590077_000214 | |||
| 2774 | Ga0590077_000432 | |||
| 2775 | Ga0501082_0000531 | |||
| 2776 | Ga0501082_0002871 | |||
| 2777 | Ga0501082_0048346 | |||
| 2778 | Ga0501082_0404830 | |||
| 2779 | Ga0530510_0007391 | |||
| 2780 | Ga0530510_0024893 | |||
| 2781 | Ga0530510_0046708 | |||
| 2782 | Ga0530510_0090267 | |||
| 2783 | Ga0530510_0219396 | |||
| 2784 | 2687234418 | |||
| 2785 | 2688069808 | |||
| 2786 | 2920109424 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zwj-assembly1.cif.gz_A | x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 | 0.9224 | 8 | 336 |
| 2h39-assembly1.cif.gz_A | crystal structure of an adp-glucose phosphorylase from arabidopsis thaliana with bound adp-glucose | 0.9175 | 7 | 336 |
| 1z84-assembly1.cif.gz_B | x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 | 0.9149 | 6 | 336 |
| 1zwj-assembly1.cif.gz_B | x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 | 0.9098 | 6 | 336 |
| 1zwj-assembly1.cif.gz_A | x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 | 0.9076 | 8 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MNU2_183_339_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9618 | 182 | 339 | 3.30.428.10 |
| af_I1MNU2_183_339_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9439 | 182 | 339 | 3.30.428.10 |
| af_Q79FY3_3_179_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9364 | 177 | 336 | 3.30.428.10 |
| 1gupA01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9307 | 182 | 335 | 3.30.428.10 |
| 1hxpB01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9138 | 178 | 335 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4DIP9-F1-model_v4 | Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) | 0.9922 | 127 | 336 |
GO:0006012
GO:0008108 GO:0008270 |
| AF-A0A7C3XUM2-F1-model_v4 | Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) | 0.9918 | 46 | 336 |
GO:0006012
GO:0008108 GO:0008270 |
| AF-A0A849Y824-F1-model_v4 | DUF4931 domain-containing protein | 0.9889 | 44 | 339 |
GO:0006012
GO:0008108 GO:0008270 |
| AF-A0A0F9IPU9-F1-model_v4 | HIT domain-containing protein | 0.9884 | 80 | 336 |
GO:0006012
GO:0008108 GO:0008270 |
| AF-A0A7X1ZLL9-F1-model_v4 | Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) | 0.9878 | 80 | 314 |
GO:0006012
GO:0008108 GO:0008270 |