F493605

General Info

Members Datasets Scaffolds Average Seq Length
1393 388 2786 334

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10681966|Ga0114129_106819661
Length 408
Sequence MNSGRLKRLLKLQAEEEERKCNDAAIEPTNRPLTVAAQFRNVHVRRRLPSRDHREGSAIINFFALRPVQEDPLLPELRKDPISGRWVIVATDSARRPSDFVREPVPVPAVNGVCPLCPGNEPKTRPEVLAFRQNGGGANSAGWSLRVVPNKFPVLGVEGDLRRQGEGMFDKMSGVGAHEVIVETPDHCQTLSDLSQKQIEDVLWAFRNRVLDLRQDKRLRYAVMFKNFGEAAGATLEHSHSQLIALPVIPKRVREEIEGARAYYQFKERCIYCDIVQQETQAGVRLILETDRFVVIAPYAARFPFETWILPKRHESHFEETEPATMGNLAWVLRATLRKMACVLERPAYNFVIHSAPLQEGQMPEYHWHIEIMPKLTRVAGFEWATGFHINPTPPEEAAKFLRDAGVV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
264 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
274 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
387 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
388 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.65
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.65
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10681966 3300009147 Bacteria 1323
2 JGI25406J46586_10020362 3300003203 Unclassified 2684
3 Ga0058863_10101987 3300004799 Bacteria 4056
4 Ga0058861_11763141 3300004800 Unclassified 1945
5 Ga0058862_11755211 3300004803 Bacteria 1622
6 Ga0065714_10109055 3300005288 Bacteria 1506
7 Ga0065712_10070553 3300005290 Bacteria 5911
8 Ga0065712_10088406 3300005290 Bacteria 2512
9 Ga0065712_10098888 3300005290 Bacteria 2106
10 Ga0065715_10198264 3300005293 Unclassified 1376
11 Ga0065707_10002787 3300005295 Bacteria 4264
12 Ga0065707_10014613 3300005295 Bacteria 2771
13 Ga0065707_10083645 3300005295 Bacteria 8555
14 Ga0065707_10094018 3300005295 Bacteria 3549
15 Ga0065707_10134884 3300005295 Bacteria 1856
16 Ga0065707_10137407 3300005295 Bacteria 1821
17 Ga0070676_10027352 3300005328 Bacteria 3233
18 Ga0070683_100000048 3300005329 Bacteria 93771
19 Ga0070683_100051625 3300005329 Bacteria 3808
20 Ga0070683_100054837 3300005329 Unclassified 3697
21 Ga0070683_100115499 3300005329 Bacteria 2534
22 Ga0070690_100002213 3300005330 Bacteria 10410
23 Ga0070670_100003569 3300005331 Bacteria 12941
24 Ga0070670_100036486 3300005331 Bacteria 4230
25 Ga0070670_100266192 3300005331 Bacteria 1495
26 Ga0068869_100075258 3300005334 Bacteria 2508
27 Ga0070666_10035605 3300005335 Bacteria 3302
28 Ga0070666_10125374 3300005335 Bacteria 1783
29 Ga0070680_100012542 3300005336 Bacteria 6587
30 Ga0070680_100015561 3300005336 Bacteria 5968
31 Ga0070680_100025973 3300005336 Bacteria 4684
32 Ga0070680_100122737 3300005336 Bacteria 2169
33 Ga0068868_100008891 3300005338 Bacteria 7200
34 Ga0068868_100090672 3300005338 Unclassified 2462
35 Ga0068868_100165327 3300005338 Bacteria 1830
36 Ga0070689_100007004 3300005340 Bacteria 7856
37 Ga0070689_100012178 3300005340 Bacteria 6187
38 Ga0070689_100214622 3300005340 Bacteria 1576
39 Ga0070689_100370373 3300005340 Unclassified 1205
40 Ga0070687_100015273 3300005343 Bacteria 3468
41 Ga0070687_100016131 3300005343 Bacteria 3398
42 Ga0070692_10024447 3300005345 Bacteria 2968
43 Ga0070668_100023718 3300005347 Bacteria 4643
44 Ga0070668_100357464 3300005347 Bacteria 1237
45 Ga0070669_100042332 3300005353 Unclassified 3314
46 Ga0070669_100046316 3300005353 Bacteria 3171
47 Ga0070669_100065428 3300005353 Bacteria 2678
48 Ga0070669_100097360 3300005353 Bacteria 2215
49 Ga0070669_100193922 3300005353 Bacteria 1595
50 Ga0070669_100325849 3300005353 Bacteria 1241
51 Ga0070675_100000863 3300005354 Bacteria 21563
52 Ga0070675_100017018 3300005354 Bacteria 5778
53 Ga0070675_100091118 3300005354 Bacteria 2554
54 Ga0070675_100289465 3300005354 Bacteria 1441
55 Ga0070671_100041907 3300005355 Bacteria 3805
56 Ga0070671_100167081 3300005355 Bacteria 1860
57 Ga0070674_100024753 3300005356 Bacteria 3899
58 Ga0070674_100143483 3300005356 Bacteria 1795
59 Ga0070673_100004711 3300005364 Bacteria 8657
60 Ga0070673_100005778 3300005364 Bacteria 7965
61 Ga0070673_100024730 3300005364 Bacteria 4408
62 Ga0070673_100080756 3300005364 Bacteria 2636
63 Ga0070673_100148706 3300005364 Bacteria 1982
64 Ga0070673_100156177 3300005364 Bacteria 1936
65 Ga0070688_100021384 3300005365 Bacteria 3779
66 Ga0070688_100029736 3300005365 Unclassified 3274
67 Ga0070688_100048620 3300005365 Bacteria 2636
68 Ga0070688_100056651 3300005365 Bacteria 2462
69 Ga0070659_100145925 3300005366 Bacteria 1928
70 Ga0070667_100202517 3300005367 Bacteria 1761
71 Ga0070703_10000403 3300005406 Bacteria 18037
72 Ga0070703_10009210 3300005406 Unclassified 2786
73 Ga0070703_10015520 3300005406 Bacteria 2180
74 Ga0070703_10062047 3300005406 Bacteria 1226
75 Ga0070709_10000029 3300005434 Bacteria 119772
76 Ga0070709_10020756 3300005434 Bacteria 3819
77 Ga0070709_10039088 3300005434 Unclassified 2909
78 Ga0070709_10082239 3300005434 Bacteria 2104
79 Ga0070709_10124081 3300005434 Bacteria 1755
80 Ga0070709_10185678 3300005434 Unclassified 1463
81 Ga0070714_100011082 3300005435 Bacteria 7145
82 Ga0070713_100005215 3300005436 Bacteria 8854
83 Ga0070713_100008039 3300005436 Bacteria 7452
84 Ga0070713_100009698 3300005436 Bacteria 6914
85 Ga0070713_100076213 3300005436 Unclassified 2847
86 Ga0070713_100297751 3300005436 Bacteria 1484
87 Ga0070710_10002860 3300005437 Bacteria 8223
88 Ga0070710_10087151 3300005437 Bacteria 1835
89 Ga0070710_10120772 3300005437 Bacteria 1586
90 Ga0070701_10017984 3300005438 Bacteria 3316
91 Ga0070701_10026950 3300005438 Bacteria 2809
92 Ga0070701_10027813 3300005438 Bacteria 2774
93 Ga0070701_10101166 3300005438 Bacteria 1597
94 Ga0070711_100000027 3300005439 Bacteria 108952
95 Ga0070711_100003000 3300005439 Bacteria 9749
96 Ga0070711_100011074 3300005439 Bacteria 5596
97 Ga0070711_100017969 3300005439 Bacteria 4508
98 Ga0070711_100042422 3300005439 Bacteria 3075
99 Ga0070711_100052621 3300005439 Bacteria 2803
100 Ga0070705_100000221 3300005440 Bacteria 33830
101 Ga0070705_100002104 3300005440 Bacteria 10142
102 Ga0070705_100005766 3300005440 Bacteria 6052
103 Ga0070705_100008819 3300005440 Bacteria 4997
104 Ga0070705_100088584 3300005440 Bacteria 1922
105 Ga0070700_100030711 3300005441 Unclassified 3214
106 Ga0070700_100031058 3300005441 Bacteria 3197
107 Ga0070694_100003286 3300005444 Bacteria 9664
108 Ga0070694_100005213 3300005444 Bacteria 7851
109 Ga0070694_100006791 3300005444 Bacteria 6950
110 Ga0070694_100102871 3300005444 Bacteria 2023
111 Ga0070694_100195836 3300005444 Bacteria 1503
112 Ga0070694_100209803 3300005444 Bacteria 1456
113 Ga0070708_100006107 3300005445 Bacteria 9582
114 Ga0070708_100021130 3300005445 Bacteria 5498
115 Ga0070708_100082824 3300005445 Bacteria 2907
116 Ga0070708_100295673 3300005445 Unclassified 1525
117 Ga0070708_100326402 3300005445 Unclassified 1446
118 Ga0070678_100104267 3300005456 Bacteria 2205
119 Ga0070678_100262381 3300005456 Bacteria 1453
120 Ga0070678_100335093 3300005456 Bacteria 1296
121 Ga0070662_100050452 3300005457 Bacteria 3002
122 Ga0070662_100081810 3300005457 Bacteria 2407
123 Ga0070662_100088775 3300005457 Bacteria 2318
124 Ga0070681_10000242 3300005458 Bacteria 43180
125 Ga0070681_10008930 3300005458 Bacteria 9852
126 Ga0070681_10010266 3300005458 Bacteria 9241
127 Ga0070681_10428787 3300005458 Unclassified 1234
128 Ga0070681_10447933 3300005458 Unclassified 1203
129 Ga0068867_100003936 3300005459 Bacteria 10458
130 Ga0068867_100021810 3300005459 Bacteria 4573
131 Ga0068867_100038696 3300005459 Bacteria 3473
132 Ga0068867_100451137 3300005459 Bacteria 1096
133 Ga0070706_100000208 3300005467 Bacteria 72971
134 Ga0070706_100007222 3300005467 Bacteria 10441
135 Ga0070706_100042144 3300005467 Bacteria 4215
136 Ga0070706_100086813 3300005467 Bacteria 2899
137 Ga0070706_100156077 3300005467 Bacteria 2130
138 Ga0070706_100204180 3300005467 Unclassified 1846
139 Ga0070706_100274116 3300005467 Bacteria 1574
140 Ga0070706_100430419 3300005467 Unclassified 1228
141 Ga0070707_100020689 3300005468 Bacteria 6209
142 Ga0070707_100055558 3300005468 Bacteria 3796
143 Ga0070707_100081064 3300005468 Bacteria 3132
144 Ga0070707_100102983 3300005468 Unclassified 2766
145 Ga0070707_100120145 3300005468 Bacteria 2551
146 Ga0070707_100191869 3300005468 Unclassified 1992
147 Ga0070707_100240742 3300005468 Bacteria 1761
148 Ga0070707_100348076 3300005468 Bacteria 1439
149 Ga0070707_100461909 3300005468 Bacteria 1230
150 Ga0070698_100006201 3300005471 Bacteria 13022
151 Ga0070698_100007211 3300005471 Bacteria 12043
152 Ga0070698_100014143 3300005471 Bacteria 8436
153 Ga0070698_100021538 3300005471 Bacteria 6751
154 Ga0070698_100052957 3300005471 Bacteria 4126
155 Ga0070698_100145794 3300005471 Bacteria 2317
156 Ga0070699_100000029 3300005518 Bacteria 151185
157 Ga0070699_100001721 3300005518 Bacteria 19955
158 Ga0070699_100001814 3300005518 Bacteria 19414
159 Ga0070699_100002759 3300005518 Bacteria 15658
160 Ga0070699_100003831 3300005518 Bacteria 13288
161 Ga0070699_100011338 3300005518 Bacteria 7695
162 Ga0070699_100038432 3300005518 Bacteria 4144
163 Ga0070699_100075638 3300005518 Bacteria 2931
164 Ga0070699_100114935 3300005518 Bacteria 2365
165 Ga0070699_100207133 3300005518 Bacteria 1745
166 Ga0070699_100216768 3300005518 Bacteria 1705
167 Ga0070699_100260318 3300005518 Bacteria 1551
168 Ga0070699_100342557 3300005518 Bacteria 1346
169 Ga0070699_100374643 3300005518 Bacteria 1284
170 Ga0070699_100379795 3300005518 Bacteria 1276
171 Ga0070679_100014473 3300005530 Bacteria 7577
172 Ga0070679_100066444 3300005530 Bacteria 3594
173 Ga0070684_100000038 3300005535 Bacteria 94959
174 Ga0070684_100053735 3300005535 Bacteria 3508
175 Ga0070684_100083985 3300005535 Bacteria 2822
176 Ga0070684_100408693 3300005535 Bacteria 1252
177 Ga0070697_100000522 3300005536 Bacteria 28975
178 Ga0070697_100011943 3300005536 Bacteria 6799
179 Ga0070697_100027403 3300005536 Bacteria 4558
180 Ga0070697_100050479 3300005536 Bacteria 3376
181 Ga0070697_100103069 3300005536 Bacteria 2371
182 Ga0070697_100286198 3300005536 Unclassified 1415
183 Ga0070697_100286644 3300005536 Unclassified 1414
184 Ga0070672_100033032 3300005543 Bacteria 3914
185 Ga0070672_100041249 3300005543 Bacteria 3547
186 Ga0070672_100099821 3300005543 Bacteria 2353
187 Ga0070672_100123433 3300005543 Bacteria 2122
188 Ga0070686_100002326 3300005544 Bacteria 10487
189 Ga0070695_100003478 3300005545 Bacteria 9199
190 Ga0070695_100027675 3300005545 Bacteria 3514
191 Ga0070695_100093607 3300005545 Bacteria 2011
192 Ga0070695_100118096 3300005545 Unclassified 1811
193 Ga0070695_100198403 3300005545 Bacteria 1432
194 Ga0070696_100000362 3300005546 Bacteria 27732
195 Ga0070696_100002039 3300005546 Bacteria 13250
196 Ga0070696_100011391 3300005546 Bacteria 5957
197 Ga0070696_100015421 3300005546 Bacteria 5131
198 Ga0070696_100017408 3300005546 Bacteria 4850
199 Ga0070696_100022395 3300005546 Bacteria 4292
200 Ga0070696_100039752 3300005546 Bacteria 3248
201 Ga0070696_100059475 3300005546 Bacteria 2671
202 Ga0070696_100095540 3300005546 Bacteria 2123
203 Ga0070696_100133056 3300005546 Bacteria 1811
204 Ga0070696_100155335 3300005546 Bacteria 1682
205 Ga0070693_100000012 3300005547 Bacteria 71975
206 Ga0070693_100033253 3300005547 Bacteria 2844
207 Ga0070665_100026922 3300005548 Bacteria 5791
208 Ga0070665_100401326 3300005548 Bacteria 1379
209 Ga0070704_100003038 3300005549 Bacteria 9551
210 Ga0070704_100014058 3300005549 Bacteria 4989
211 Ga0070704_100023424 3300005549 Bacteria 4033
212 Ga0070704_100040094 3300005549 Bacteria 3221
213 Ga0070704_100070671 3300005549 Bacteria 2533
214 Ga0070704_100348200 3300005549 Bacteria 1250
215 Ga0070704_100398357 3300005549 Bacteria 1174
216 Ga0068855_100048548 3300005563 Bacteria 5009
217 Ga0068855_100049629 3300005563 Bacteria 4949
218 Ga0068855_100051195 3300005563 Bacteria 4865
219 Ga0068855_100080341 3300005563 Bacteria 3781
220 Ga0070664_100001762 3300005564 Bacteria 17341
221 Ga0070664_100079139 3300005564 Bacteria 2828
222 Ga0070664_100081513 3300005564 Bacteria 2789
223 Ga0070664_100140530 3300005564 Bacteria 2126
224 Ga0070664_100421083 3300005564 Unclassified 1223
225 Ga0068857_100000538 3300005577 Bacteria 27467
226 Ga0068857_100005072 3300005577 Bacteria 11195
227 Ga0068857_100022733 3300005577 Bacteria 5516
228 Ga0068857_100402436 3300005577 Bacteria 1274
229 Ga0068854_100005914 3300005578 Bacteria 7749
230 Ga0068854_100148965 3300005578 Unclassified 1803
231 Ga0068856_100000618 3300005614 Bacteria 38933
232 Ga0068856_100002308 3300005614 Bacteria 19646
233 Ga0068856_100017427 3300005614 Bacteria 6960
234 Ga0068856_100038178 3300005614 Bacteria 4714
235 Ga0070702_100020714 3300005615 Bacteria 3449
236 Ga0068852_100119127 3300005616 Unclassified 2413
237 Ga0068852_100184558 3300005616 Bacteria 1964
238 Ga0068859_100001945 3300005617 Bacteria 21072
239 Ga0068859_100063870 3300005617 Unclassified 3713
240 Ga0068859_100289434 3300005617 Unclassified 1731
241 Ga0068859_100291291 3300005617 Bacteria 1726
242 Ga0068859_100342706 3300005617 Bacteria 1589
243 Ga0068859_100706628 3300005617 Unclassified 1099
244 Ga0068864_100009721 3300005618 Bacteria 7936
245 Ga0068864_100015208 3300005618 Bacteria 6400
246 Ga0068864_100036850 3300005618 Bacteria 4171
247 Ga0068864_100054144 3300005618 Bacteria 3463
248 Ga0068864_100128617 3300005618 Bacteria 2272
249 Ga0068866_10009281 3300005718 Bacteria 4170
250 Ga0068861_100096112 3300005719 Bacteria 2347
251 Ga0068861_100101019 3300005719 Bacteria 2294
252 Ga0068870_10019398 3300005840 Bacteria 3298
253 Ga0068863_100002307 3300005841 Bacteria 18968
254 Ga0068863_100006891 3300005841 Bacteria 11135
255 Ga0068863_100095180 3300005841 Bacteria 2826
256 Ga0068863_100243708 3300005841 Unclassified 1735
257 Ga0068863_100280098 3300005841 Bacteria 1615
258 Ga0068863_100437126 3300005841 Bacteria 1283
259 Ga0068858_100008072 3300005842 Bacteria 10137
260 Ga0068858_100009268 3300005842 Bacteria 9400
261 Ga0068858_100055451 3300005842 Unclassified 3664
262 Ga0068858_100060731 3300005842 Bacteria 3494
263 Ga0068858_100209387 3300005842 Unclassified 1845
264 Ga0068858_100288158 3300005842 Bacteria 1565
265 Ga0068860_100007055 3300005843 Bacteria 11247
266 Ga0068860_100013803 3300005843 Bacteria 7921
267 Ga0068860_100071180 3300005843 Bacteria 3306
268 Ga0068860_100281787 3300005843 Bacteria 1624
269 Ga0068860_100347766 3300005843 Bacteria 1458
270 Ga0068860_100363247 3300005843 Bacteria 1427
271 Ga0068862_100006997 3300005844 Bacteria 9364
272 Ga0068862_100084035 3300005844 Bacteria 2765
273 Ga0068862_100299418 3300005844 Bacteria 1479
274 Ga0068862_100342259 3300005844 Bacteria 1385
275 Ga0068862_100427316 3300005844 Bacteria 1244
276 Ga0081455_10031589 3300005937 Bacteria 4787
277 Ga0081455_10064885 3300005937 Bacteria 3056
278 Ga0081455_10119536 3300005937 Bacteria 2078
279 Ga0081539_10000034 3300005985 Bacteria 307597
280 Ga0081539_10000092 3300005985 Bacteria 208968
281 Ga0081539_10000151 3300005985 Bacteria 160054
282 Ga0070717_10026495 3300006028 Unclassified 4624
283 Ga0070717_10352599 3300006028 Bacteria 1316
284 Ga0070717_10357667 3300006028 Unclassified 1306
285 Ga0075432_10033266 3300006058 Bacteria 1788
286 Ga0075432_10056822 3300006058 Bacteria 1388
287 Ga0070715_10009767 3300006163 Bacteria 3394
288 Ga0070715_10138434 3300006163 Bacteria 1180
289 Ga0070715_10166022 3300006163 Bacteria 1095
290 Ga0070716_100000362 3300006173 Bacteria 18659
291 Ga0070716_100001947 3300006173 Bacteria 9386
292 Ga0070716_100005601 3300006173 Bacteria 6098
293 Ga0070716_100010580 3300006173 Bacteria 4629
294 Ga0070716_100042990 3300006173 Bacteria 2524
295 Ga0070716_100061004 3300006173 Bacteria 2181
296 Ga0070716_100095408 3300006173 Bacteria 1810
297 Ga0070716_100148845 3300006173 Unclassified 1503
298 Ga0097621_100001489 3300006237 Bacteria 16057
299 Ga0097621_100030411 3300006237 Bacteria 4274
300 Ga0097621_100072830 3300006237 Bacteria 2843
301 Ga0097621_100135159 3300006237 Bacteria 2102
302 Ga0097621_100155599 3300006237 Bacteria 1962
303 Ga0097621_100348193 3300006237 Bacteria 1317
304 Ga0075370_10110391 3300006353 Bacteria 1597
305 Ga0068871_100006737 3300006358 Bacteria 8158
306 Ga0068871_100031351 3300006358 Bacteria 4192
307 Ga0068871_100327930 3300006358 Bacteria 1350
308 Ga0075428_100000398 3300006844 Bacteria 43056
309 Ga0075428_100000421 3300006844 Bacteria 42169
310 Ga0075428_100001485 3300006844 Bacteria 25073
311 Ga0075428_100002532 3300006844 Bacteria 19874
312 Ga0075428_100005186 3300006844 Bacteria 14469
313 Ga0075428_100013592 3300006844 Bacteria 9065
314 Ga0075428_100014142 3300006844 Bacteria 8881
315 Ga0075428_100027532 3300006844 Bacteria 6290
316 Ga0075428_100044754 3300006844 Bacteria 4863
317 Ga0075428_100070705 3300006844 Bacteria 3815
318 Ga0075428_100128474 3300006844 Bacteria 2757
319 Ga0075428_100179736 3300006844 Bacteria 2290
320 Ga0075428_100248391 3300006844 Bacteria 1918
321 Ga0075428_100282848 3300006844 Bacteria 1785
322 Ga0075428_100479810 3300006844 Unclassified 1331
323 Ga0075430_100000341 3300006846 Bacteria 33734
324 Ga0075430_100000882 3300006846 Bacteria 23536
325 Ga0075430_100007002 3300006846 Bacteria 9506
326 Ga0075430_100007723 3300006846 Bacteria 9088
327 Ga0075430_100024148 3300006846 Bacteria 5175
328 Ga0075430_100076865 3300006846 Bacteria 2798
329 Ga0075430_100127416 3300006846 Bacteria 2122
330 Ga0075430_100193047 3300006846 Bacteria 1692
331 Ga0075431_100001562 3300006847 Bacteria 21263
332 Ga0075431_100002961 3300006847 Bacteria 16438
333 Ga0075431_100006021 3300006847 Bacteria 12020
334 Ga0075431_100007984 3300006847 Bacteria 10556
335 Ga0075431_100019021 3300006847 Bacteria 6998
336 Ga0075431_100025142 3300006847 Bacteria 6103
337 Ga0075431_100029241 3300006847 Bacteria 5670
338 Ga0075431_100031771 3300006847 Bacteria 5438
339 Ga0075431_100043975 3300006847 Bacteria 4607
340 Ga0075431_100062732 3300006847 Bacteria 3835
341 Ga0075431_100227665 3300006847 Bacteria 1900
342 Ga0075431_100297281 3300006847 Bacteria 1632
343 Ga0075433_10000305 3300006852 Bacteria 29652
344 Ga0075433_10000783 3300006852 Bacteria 21957
345 Ga0075433_10027368 3300006852 Bacteria 4835
346 Ga0075433_10036132 3300006852 Bacteria 4253
347 Ga0075433_10065298 3300006852 Bacteria 3192
348 Ga0075433_10079756 3300006852 Bacteria 2885
349 Ga0075433_10110227 3300006852 Bacteria 2442
350 Ga0075433_10133243 3300006852 Bacteria 2208
351 Ga0075433_10309278 3300006852 Unclassified 1399
352 Ga0075433_10457953 3300006852 Unclassified 1124
353 Ga0075434_100000107 3300006871 Bacteria 47551
354 Ga0075434_100006811 3300006871 Bacteria 10512
355 Ga0075434_100015784 3300006871 Bacteria 7250
356 Ga0075434_100033258 3300006871 Bacteria 5088
357 Ga0075434_100052289 3300006871 Bacteria 4059
358 Ga0075434_100054358 3300006871 Bacteria 3978
359 Ga0075434_100056056 3300006871 Bacteria 3916
360 Ga0075434_100065144 3300006871 Bacteria 3629
361 Ga0075434_100076997 3300006871 Bacteria 3330
362 Ga0075434_100085346 3300006871 Bacteria 3156
363 Ga0075434_100089634 3300006871 Bacteria 3076
364 Ga0075434_100110722 3300006871 Bacteria 2757
365 Ga0075434_100141417 3300006871 Bacteria 2426
366 Ga0075434_100212937 3300006871 Bacteria 1952
367 Ga0075434_100246506 3300006871 Bacteria 1806
368 Ga0075434_100454812 3300006871 Unclassified 1301
369 Ga0075429_100001205 3300006880 Bacteria 20971
370 Ga0075429_100007238 3300006880 Bacteria 9627
371 Ga0075429_100011821 3300006880 Bacteria 7569
372 Ga0075429_100060770 3300006880 Bacteria 3291
373 Ga0075429_100122767 3300006880 Bacteria 2270
374 Ga0075429_100199639 3300006880 Bacteria 1752
375 Ga0075429_100244247 3300006880 Bacteria 1572
376 Ga0075429_100342578 3300006880 Bacteria 1308
377 Ga0068865_100206577 3300006881 Bacteria 1528
378 Ga0075436_100000592 3300006914 Bacteria 23758
379 Ga0075436_100001557 3300006914 Bacteria 15650
380 Ga0075436_100001958 3300006914 Bacteria 14199
381 Ga0075436_100004307 3300006914 Bacteria 9769
382 Ga0075436_100015198 3300006914 Bacteria 5274
383 Ga0075436_100017110 3300006914 Bacteria 4962
384 Ga0075436_100019077 3300006914 Bacteria 4698
385 Ga0075436_100100178 3300006914 Unclassified 2017
386 Ga0075436_100190857 3300006914 Bacteria 1449
387 Ga0075436_100227566 3300006914 Bacteria 1324
388 Ga0097620_100001945 3300006931 Bacteria 21072
389 Ga0097620_100063869 3300006931 Unclassified 3713
390 Ga0097620_100289466 3300006931 Unclassified 1731
391 Ga0097620_100291263 3300006931 Bacteria 1726
392 Ga0097620_100342705 3300006931 Bacteria 1589
393 Ga0097620_100706566 3300006931 Unclassified 1099
394 Ga0075435_100000054 3300007076 Bacteria 58537
395 Ga0075435_100007100 3300007076 Bacteria 7954
396 Ga0075435_100009536 3300007076 Bacteria 7037
397 Ga0075435_100026771 3300007076 Bacteria 4504
398 Ga0075435_100067955 3300007076 Bacteria 2902
399 Ga0075435_100208621 3300007076 Bacteria 1656
400 Ga0075435_100278562 3300007076 Bacteria 1427
401 Ga0099794_10000854 3300007265 Bacteria 10286
402 Ga0099795_10001407 3300007788 Bacteria 5204
403 Ga0105240_10002241 3300009093 Bacteria 31405
404 Ga0105240_10006423 3300009093 Bacteria 17279
405 Ga0105240_10020126 3300009093 Bacteria 8908
406 Ga0105240_10074666 3300009093 Bacteria 4184
407 Ga0105240_10136821 3300009093 Unclassified 2933
408 Ga0105240_10270955 3300009093 Unclassified 1954
409 Ga0105240_10377190 3300009093 Bacteria 1602
410 Ga0111539_10000455 3300009094 Bacteria 51281
411 Ga0111539_10000481 3300009094 Bacteria 50448
412 Ga0111539_10005828 3300009094 Bacteria 15928
413 Ga0111539_10011459 3300009094 Bacteria 11131
414 Ga0111539_10012335 3300009094 Bacteria 10709
415 Ga0111539_10014217 3300009094 Bacteria 9939
416 Ga0111539_10016344 3300009094 Bacteria 9200
417 Ga0111539_10023394 3300009094 Bacteria 7591
418 Ga0111539_10042847 3300009094 Bacteria 5431
419 Ga0111539_10044646 3300009094 Bacteria 5308
420 Ga0111539_10046140 3300009094 Bacteria 5214
421 Ga0111539_10449260 3300009094 Bacteria 1501
422 Ga0111539_10514303 3300009094 Bacteria 1394
423 Ga0111539_10542901 3300009094 Bacteria 1354
424 Ga0105245_10099472 3300009098 Unclassified 2689
425 Ga0105245_10336882 3300009098 Bacteria 1491
426 Ga0114129_10000704 3300009147 Bacteria 42132
427 Ga0114129_10000726 3300009147 Bacteria 41775
428 Ga0114129_10001085 3300009147 Bacteria 35711
429 Ga0114129_10004758 3300009147 Bacteria 19182
430 Ga0114129_10005676 3300009147 Bacteria 17663
431 Ga0114129_10007659 3300009147 Bacteria 15369
432 Ga0114129_10008153 3300009147 Bacteria 14931
433 Ga0114129_10008312 3300009147 Bacteria 14808
434 Ga0114129_10011034 3300009147 Bacteria 12873
435 Ga0114129_10011480 3300009147 Bacteria 12612
436 Ga0114129_10014123 3300009147 Bacteria 11376
437 Ga0114129_10017003 3300009147 Bacteria 10355
438 Ga0114129_10060780 3300009147 Bacteria 5282
439 Ga0114129_10067842 3300009147 Bacteria 4973
440 Ga0114129_10070576 3300009147 Bacteria 4871
441 Ga0114129_10114235 3300009147 Bacteria 3723
442 Ga0114129_10125199 3300009147 Bacteria 3534
443 Ga0114129_10149319 3300009147 Bacteria 3199
444 Ga0114129_10208823 3300009147 Bacteria 2641
445 Ga0114129_10211980 3300009147 Bacteria 2618
446 Ga0114129_10227596 3300009147 Bacteria 2512
447 Ga0114129_10433135 3300009147 Bacteria 1727
448 Ga0114129_10463942 3300009147 Bacteria 1659
449 Ga0114129_10579607 3300009147 Unclassified 1456
450 Ga0114129_10810959 3300009147 Bacteria 1193
451 Ga0114129_10831590 3300009147 Bacteria 1175
452 Ga0114129_10849499 3300009147 Bacteria 1161
453 Ga0105243_10047807 3300009148 Bacteria 3370
454 Ga0105243_10064744 3300009148 Bacteria 2934
455 Ga0105243_10132232 3300009148 Bacteria 2118
456 Ga0105241_10091402 3300009174 Bacteria 2401
457 Ga0105241_10381854 3300009174 Bacteria 1231
458 Ga0105242_10094144 3300009176 Bacteria 2526
459 Ga0105242_10134854 3300009176 Bacteria 2136
460 Ga0105248_10007473 3300009177 Bacteria 11991
461 Ga0105248_10030650 3300009177 Bacteria 6007
462 Ga0105248_10059915 3300009177 Bacteria 4275
463 Ga0105248_10093653 3300009177 Bacteria 3383
464 Ga0105248_10117414 3300009177 Bacteria 3000
465 Ga0105248_10327642 3300009177 Bacteria 1725
466 Ga0105248_10608518 3300009177 Bacteria 1233
467 Ga0105237_10020943 3300009545 Bacteria 6730
468 Ga0105237_10026934 3300009545 Bacteria 5873
469 Ga0105238_10000180 3300009551 Bacteria 68847
470 Ga0105238_10014879 3300009551 Bacteria 7873
471 Ga0105249_10025544 3300009553 Bacteria 5319
472 Ga0105249_10096944 3300009553 Bacteria 2768
473 Ga0105249_10270463 3300009553 Bacteria 1693
474 Ga0105249_10341706 3300009553 Bacteria 1514
475 Ga0105239_10006705 3300010375 Bacteria 13301
476 Ga0105246_10486348 3300011119 Bacteria 1045
477 Ga0157370_10001165 3300013104 Bacteria 32739
478 Ga0157370_10083174 3300013104 Unclassified 3010
479 Ga0157370_10094048 3300013104 Bacteria 2813
480 Ga0157369_10000592 3300013105 Bacteria 47171
481 Ga0157369_10115282 3300013105 Unclassified 2853
482 Ga0157369_10140362 3300013105 Unclassified 2557
483 Ga0157374_10000441 3300013296 Bacteria 37640
484 Ga0157374_10204452 3300013296 Bacteria 1935
485 Ga0157374_10242671 3300013296 Unclassified 1772
486 Ga0157374_10447025 3300013296 Bacteria 1294
487 Ga0157374_10462557 3300013296 Bacteria 1270
488 Ga0157378_10003579 3300013297 Bacteria 13755
489 Ga0157378_10025611 3300013297 Bacteria 5193
490 Ga0157378_10069837 3300013297 Bacteria 3152
491 Ga0157378_10129379 3300013297 Bacteria 2335
492 Ga0157378_10248636 3300013297 Bacteria 1701
493 Ga0163162_10282195 3300013306 Bacteria 1793
494 Ga0163162_10404675 3300013306 Unclassified 1497
495 Ga0157372_10003362 3300013307 Bacteria 17262
496 Ga0157372_10074245 3300013307 Unclassified 3835
497 Ga0157375_10085469 3300013308 Bacteria 3204
498 Ga0157375_10140687 3300013308 Bacteria 2540
499 Ga0157375_10148545 3300013308 Bacteria 2477
500 Ga0157375_10202265 3300013308 Bacteria 2142
501 Ga0157375_10206437 3300013308 Bacteria 2121
502 Ga0157375_10262360 3300013308 Bacteria 1889
503 Ga0163163_10038117 3300014325 Bacteria 4681
504 Ga0163163_10043789 3300014325 Bacteria 4391
505 Ga0163163_10083176 3300014325 Bacteria 3206
506 Ga0157380_10033796 3300014326 Bacteria 3940
507 Ga0157380_10131806 3300014326 Bacteria 2134
508 Ga0157380_10345636 3300014326 Bacteria 1390
509 Ga0157380_10346626 3300014326 Bacteria 1388
510 Ga0157377_10057953 3300014745 Bacteria 2204
511 Ga0157377_10100110 3300014745 Bacteria 1725
512 Ga0157379_10076476 3300014968 Bacteria 2998
513 Ga0157379_10102677 3300014968 Bacteria 2566
514 Ga0157379_10177469 3300014968 Bacteria 1924
515 Ga0157376_10000023 3300014969 Bacteria 223978
516 Ga0157376_10141115 3300014969 Bacteria 2162
517 Ga0157376_10182248 3300014969 Bacteria 1921
518 Ga0157376_10204088 3300014969 Bacteria 1821
519 Ga0157376_10209775 3300014969 Bacteria 1798
520 Ga0157376_10224760 3300014969 Bacteria 1741
521 Ga0163161_10072203 3300017792 Bacteria 2527
522 Ga0163161_10305681 3300017792 Unclassified 1254
523 Ga0206351_10837870 3300020077 Bacteria 1506
524 Ga0213873_10001907 3300021358 Bacteria 3545
525 Ga0213876_10038824 3300021384 Bacteria 2515
526 Ga0213876_10039142 3300021384 Bacteria 2505
527 Ga0213875_10004157 3300021388 Bacteria 8017
528 Ga0224572_1004837 3300024225 Unclassified 2372
529 Ga0207697_10087921 3300025315 Bacteria 1315
530 Ga0207653_10000261 3300025885 Bacteria 32960
531 Ga0207653_10011963 3300025885 Unclassified 2706
532 Ga0207692_10013816 3300025898 Bacteria 3513
533 Ga0207692_10014017 3300025898 Unclassified 3493
534 Ga0207642_10089922 3300025899 Bacteria 1514
535 Ga0207680_10026853 3300025903 Bacteria 3196
536 Ga0207685_10028201 3300025905 Bacteria 1974
537 Ga0207685_10045856 3300025905 Unclassified 1660
538 Ga0207699_10000002 3300025906 Bacteria 662194
539 Ga0207699_10024147 3300025906 Bacteria 3320
540 Ga0207699_10067158 3300025906 Bacteria 2179
541 Ga0207699_10110748 3300025906 Bacteria 1759
542 Ga0207699_10114079 3300025906 Bacteria 1737
543 Ga0207645_10034133 3300025907 Bacteria 3269
544 Ga0207643_10033372 3300025908 Bacteria 2880
545 Ga0207643_10200598 3300025908 Bacteria 1214
546 Ga0207705_10228325 3300025909 Unclassified 1415
547 Ga0207684_10000248 3300025910 Bacteria 80978
548 Ga0207684_10005571 3300025910 Bacteria 11592
549 Ga0207684_10100352 3300025910 Bacteria 2474
550 Ga0207684_10404860 3300025910 Unclassified 1173
551 Ga0207654_10032115 3300025911 Bacteria 2897
552 Ga0207654_10211716 3300025911 Bacteria 1281
553 Ga0207707_10001311 3300025912 Bacteria 23194
554 Ga0207707_10003312 3300025912 Bacteria 14317
555 Ga0207707_10010191 3300025912 Bacteria 8157
556 Ga0207707_10061912 3300025912 Bacteria 3256
557 Ga0207695_10017728 3300025913 Bacteria 8266
558 Ga0207695_10024628 3300025913 Bacteria 6762
559 Ga0207695_10033917 3300025913 Bacteria 5558
560 Ga0207695_10070335 3300025913 Bacteria 3578
561 Ga0207695_10087358 3300025913 Bacteria 3141
562 Ga0207695_10238563 3300025913 Bacteria 1720
563 Ga0207671_10021128 3300025914 Unclassified 4943
564 Ga0207671_10112684 3300025914 Unclassified 2071
565 Ga0207693_10021548 3300025915 Bacteria 5120
566 Ga0207693_10028502 3300025915 Bacteria 4411
567 Ga0207663_10000006 3300025916 Bacteria 253740
568 Ga0207663_10072055 3300025916 Bacteria 2232
569 Ga0207663_10112826 3300025916 Unclassified 1847
570 Ga0207663_10132277 3300025916 Bacteria 1725
571 Ga0207660_10006198 3300025917 Bacteria 7770
572 Ga0207660_10021369 3300025917 Unclassified 4352
573 Ga0207660_10038159 3300025917 Unclassified 3353
574 Ga0207660_10067295 3300025917 Bacteria 2594
575 Ga0207660_10069252 3300025917 Bacteria 2561
576 Ga0207660_10108957 3300025917 Bacteria 2081
577 Ga0207662_10013275 3300025918 Bacteria 4605
578 Ga0207662_10083186 3300025918 Bacteria 1956
579 Ga0207662_10267709 3300025918 Unclassified 1127
580 Ga0207657_10159172 3300025919 Bacteria 1835
581 Ga0207652_10016229 3300025921 Bacteria 6076
582 Ga0207652_10153166 3300025921 Bacteria 2065
583 Ga0207652_10240188 3300025921 Bacteria 1633
584 Ga0207646_10000922 3300025922 Bacteria 37828
585 Ga0207646_10012116 3300025922 Bacteria 8301
586 Ga0207646_10063648 3300025922 Bacteria 3292
587 Ga0207646_10071503 3300025922 Bacteria 3098
588 Ga0207646_10138884 3300025922 Bacteria 2188
589 Ga0207646_10147840 3300025922 Bacteria 2118
590 Ga0207646_10151667 3300025922 Bacteria 2090
591 Ga0207646_10275898 3300025922 Bacteria 1519
592 Ga0207681_10002867 3300025923 Bacteria 10893
593 Ga0207681_10014305 3300025923 Bacteria 4928
594 Ga0207681_10033869 3300025923 Bacteria 3354
595 Ga0207681_10097069 3300025923 Bacteria 2117
596 Ga0207681_10298208 3300025923 Bacteria 1274
597 Ga0207694_10001880 3300025924 Bacteria 17404
598 Ga0207694_10120402 3300025924 Bacteria 2095
599 Ga0207650_10009543 3300025925 Bacteria 6634
600 Ga0207650_10063244 3300025925 Unclassified 2766
601 Ga0207650_10109073 3300025925 Bacteria 2140
602 Ga0207650_10212015 3300025925 Unclassified 1556
603 Ga0207659_10001044 3300025926 Bacteria 16401
604 Ga0207659_10026922 3300025926 Bacteria 3886
605 Ga0207659_10058293 3300025926 Bacteria 2772
606 Ga0207659_10074768 3300025926 Bacteria 2484
607 Ga0207659_10106222 3300025926 Unclassified 2126
608 Ga0207700_10014372 3300025928 Bacteria 5186
609 Ga0207700_10015322 3300025928 Bacteria 5052
610 Ga0207700_10020937 3300025928 Unclassified 4454
611 Ga0207664_10006353 3300025929 Bacteria 8121
612 Ga0207664_10035733 3300025929 Bacteria 3836
613 Ga0207644_10011851 3300025931 Bacteria 5777
614 Ga0207644_10029360 3300025931 Bacteria 3814
615 Ga0207706_10021487 3300025933 Bacteria 5796
616 Ga0207706_10066546 3300025933 Unclassified 3171
617 Ga0207706_10090817 3300025933 Bacteria 2685
618 Ga0207706_10418756 3300025933 Unclassified 1160
619 Ga0207686_10048851 3300025934 Bacteria 2624
620 Ga0207686_10353113 3300025934 Bacteria 1107
621 Ga0207670_10051753 3300025936 Bacteria 2759
622 Ga0207670_10185080 3300025936 Bacteria 1571
623 Ga0207670_10205114 3300025936 Bacteria 1500
624 Ga0207704_10068872 3300025938 Bacteria 2233
625 Ga0207704_10223287 3300025938 Unclassified 1395
626 Ga0207665_10000680 3300025939 Bacteria 22941
627 Ga0207665_10001680 3300025939 Bacteria 14896
628 Ga0207665_10006483 3300025939 Bacteria 7762
629 Ga0207665_10007762 3300025939 Bacteria 7082
630 Ga0207665_10062269 3300025939 Bacteria 2531
631 Ga0207665_10083421 3300025939 Bacteria 2204
632 Ga0207665_10094458 3300025939 Bacteria 2077
633 Ga0207665_10105698 3300025939 Bacteria 1972
634 Ga0207665_10106458 3300025939 Bacteria 1965
635 Ga0207665_10159758 3300025939 Bacteria 1620
636 Ga0207665_10183891 3300025939 Bacteria 1515
637 Ga0207665_10253346 3300025939 Bacteria 1302
638 Ga0207691_10028579 3300025940 Bacteria 5220
639 Ga0207691_10039705 3300025940 Bacteria 4354
640 Ga0207691_10069553 3300025940 Bacteria 3180
641 Ga0207691_10089330 3300025940 Bacteria 2763
642 Ga0207691_10117965 3300025940 Bacteria 2354
643 Ga0207691_10236954 3300025940 Unclassified 1578
644 Ga0207691_10264970 3300025940 Bacteria 1481
645 Ga0207711_10047986 3300025941 Bacteria 3652
646 Ga0207711_10126859 3300025941 Bacteria 2284
647 Ga0207711_10145833 3300025941 Bacteria 2133
648 Ga0207711_10201992 3300025941 Bacteria 1814
649 Ga0207711_10326224 3300025941 Bacteria 1419
650 Ga0207711_10507248 3300025941 Bacteria 1124
651 Ga0207689_10065026 3300025942 Bacteria 3000
652 Ga0207689_10325030 3300025942 Bacteria 1277
653 Ga0207661_10000049 3300025944 Bacteria 93797
654 Ga0207661_10036940 3300025944 Bacteria 3816
655 Ga0207661_10197201 3300025944 Bacteria 1768
656 Ga0207679_10021463 3300025945 Bacteria 4379
657 Ga0207679_10044457 3300025945 Bacteria 3204
658 Ga0207679_10127521 3300025945 Bacteria 2036
659 Ga0207667_10025881 3300025949 Bacteria 6419
660 Ga0207667_10061251 3300025949 Bacteria 3937
661 Ga0207667_10067729 3300025949 Bacteria 3719
662 Ga0207667_10070057 3300025949 Unclassified 3650
663 Ga0207667_10112255 3300025949 Bacteria 2811
664 Ga0207667_10167900 3300025949 Bacteria 2256
665 Ga0207651_10028984 3300025960 Bacteria 3501
666 Ga0207651_10038078 3300025960 Bacteria 3157
667 Ga0207651_10093808 3300025960 Unclassified 2205
668 Ga0207651_10098282 3300025960 Bacteria 2164
669 Ga0207651_10156679 3300025960 Unclassified 1780
670 Ga0207712_10123261 3300025961 Bacteria 1964
671 Ga0207640_10020149 3300025981 Unclassified 3956
672 Ga0207640_10030580 3300025981 Bacteria 3318
673 Ga0207640_10328589 3300025981 Bacteria 1220
674 Ga0207658_10084783 3300025986 Bacteria 2439
675 Ga0207677_10002677 3300026023 Bacteria 9385
676 Ga0207677_10268714 3300026023 Bacteria 1394
677 Ga0207703_10007033 3300026035 Bacteria 8954
678 Ga0207703_10014289 3300026035 Bacteria 6192
679 Ga0207703_10042482 3300026035 Bacteria 3647
680 Ga0207703_10070079 3300026035 Bacteria 2893
681 Ga0207703_10131912 3300026035 Bacteria 2159
682 Ga0207703_10168490 3300026035 Bacteria 1925
683 Ga0207703_10193609 3300026035 Unclassified 1803
684 Ga0207703_10227439 3300026035 Bacteria 1671
685 Ga0207703_10325252 3300026035 Bacteria 1409
686 Ga0207639_10075419 3300026041 Bacteria 2652
687 Ga0207639_10285080 3300026041 Bacteria 1454
688 Ga0207678_10113384 3300026067 Bacteria 2313
689 Ga0207708_10029732 3300026075 Bacteria 4141
690 Ga0207708_10073061 3300026075 Bacteria 2629
691 Ga0207708_10314522 3300026075 Bacteria 1276
692 Ga0207702_10008916 3300026078 Bacteria 8456
693 Ga0207702_10053586 3300026078 Bacteria 3415
694 Ga0207702_10056997 3300026078 Unclassified 3319
695 Ga0207702_10072126 3300026078 Bacteria 2975
696 Ga0207702_10311445 3300026078 Unclassified 1497
697 Ga0207641_10001296 3300026088 Bacteria 24871
698 Ga0207641_10007090 3300026088 Bacteria 9360
699 Ga0207641_10061795 3300026088 Bacteria 3195
700 Ga0207641_10246505 3300026088 Bacteria 1667
701 Ga0207648_10003070 3300026089 Bacteria 17656
702 Ga0207648_10032208 3300026089 Bacteria 4630
703 Ga0207648_10249560 3300026089 Bacteria 1582
704 Ga0207648_10455626 3300026089 Bacteria 1165
705 Ga0207676_10007919 3300026095 Bacteria 7560
706 Ga0207676_10032639 3300026095 Bacteria 3926
707 Ga0207676_10041790 3300026095 Unclassified 3522
708 Ga0207676_10159388 3300026095 Bacteria 1953
709 Ga0207676_10175151 3300026095 Bacteria 1873
710 Ga0207676_10398658 3300026095 Bacteria 1285
711 Ga0207674_10003396 3300026116 Bacteria 19530
712 Ga0207674_10003522 3300026116 Bacteria 19105
713 Ga0207674_10416422 3300026116 Bacteria 1298
714 Ga0207675_100084688 3300026118 Bacteria 2975
715 Ga0207675_100207777 3300026118 Bacteria 1882
716 Ga0207675_100259118 3300026118 Bacteria 1685
717 Ga0207675_100327341 3300026118 Bacteria 1497
718 Ga0207675_100362987 3300026118 Bacteria 1421
719 Ga0207675_100557414 3300026118 Unclassified 1146
720 Ga0207683_10057829 3300026121 Bacteria 3404
721 Ga0207683_10081516 3300026121 Bacteria 2872
722 Ga0207683_10087107 3300026121 Bacteria 2777
723 Ga0207683_10145679 3300026121 Bacteria 2135
724 Ga0207683_10152611 3300026121 Bacteria 2085
725 Ga0207683_10450535 3300026121 Bacteria 1186
726 Ga0207683_10492119 3300026121 Bacteria 1132
727 Ga0207698_10057854 3300026142 Bacteria 3001
728 Ga0207698_10069312 3300026142 Bacteria 2788
729 Ga0207698_10394914 3300026142 Bacteria 1320
730 Ga0210000_1017429 3300027462 Bacteria 1088
731 Ga0209999_1015149 3300027543 Bacteria 1402
732 Ga0209588_1016626 3300027671 Unclassified 2273
733 Ga0209588_1036789 3300027671 Bacteria 1576
734 Ga0209974_10036009 3300027876 Unclassified 1643
735 Ga0209974_10073523 3300027876 Bacteria 1169
736 Ga0207428_10000033 3300027907 Bacteria 232081
737 Ga0207428_10000435 3300027907 Bacteria 51355
738 Ga0207428_10004008 3300027907 Bacteria 14135
739 Ga0207428_10009545 3300027907 Bacteria 8694
740 Ga0207428_10012546 3300027907 Bacteria 7440
741 Ga0207428_10021675 3300027907 Bacteria 5436
742 Ga0207428_10111443 3300027907 Unclassified 2105
743 Ga0207428_10139690 3300027907 Bacteria 1850
744 Ga0265354_1000073 3300028016 Bacteria 16758
745 Ga0268266_10000587 3300028379 Bacteria 50211
746 Ga0268266_10033791 3300028379 Unclassified 4347
747 Ga0268265_10010950 3300028380 Bacteria 6123
748 Ga0268265_10011935 3300028380 Bacteria 5877
749 Ga0268265_10223774 3300028380 Bacteria 1648
750 Ga0268265_10307431 3300028380 Bacteria 1430
751 Ga0268264_10025855 3300028381 Bacteria 4794
752 Ga0268264_10026177 3300028381 Bacteria 4764
753 Ga0268264_10289007 3300028381 Bacteria 1539
754 Ga0265319_1002097 3300028563 Bacteria 11164
755 Ga0265318_10000420 3300028577 Bacteria 32662
756 Ga0265323_10000906 3300028653 Bacteria 15674
757 Ga0265323_10007258 3300028653 Unclassified 4619
758 Ga0265323_10045981 3300028653 Unclassified 1566
759 Ga0265323_10047002 3300028653 Bacteria 1545
760 Ga0265322_10000885 3300028654 Bacteria 10619
761 Ga0265336_10001709 3300028666 Bacteria 9663
762 Ga0265338_10000139 3300028800 Bacteria 135334
763 Ga0265338_10003099 3300028800 Bacteria 23843
764 Ga0265338_10009300 3300028800 Bacteria 11744
765 Ga0265338_10025506 3300028800 Bacteria 5996
766 Ga0265338_10033630 3300028800 Bacteria 4971
767 Ga0265338_10056841 3300028800 Bacteria 3465
768 Ga0265770_1002159 3300030878 Bacteria 2676
769 Ga0265330_10025272 3300031235 Bacteria 2693
770 Ga0265328_10008223 3300031239 Bacteria 4313
771 Ga0265320_10001344 3300031240 Bacteria 17925
772 Ga0265320_10031720 3300031240 Bacteria 2711
773 Ga0265325_10052872 3300031241 Bacteria 2084
774 Ga0265325_10113238 3300031241 Bacteria 1316
775 Ga0265329_10000405 3300031242 Bacteria 22560
776 Ga0265340_10008053 3300031247 Bacteria 5708
777 Ga0265340_10018270 3300031247 Bacteria 3618
778 Ga0265339_10000182 3300031249 Bacteria 53151
779 Ga0265339_10053495 3300031249 Unclassified 2196
780 Ga0265331_10000317 3300031250 Bacteria 52403
781 Ga0265331_10000366 3300031250 Bacteria 47311
782 Ga0265331_10018808 3300031250 Bacteria 3573
783 Ga0265316_10002192 3300031344 Bacteria 20520
784 Ga0265316_10008727 3300031344 Bacteria 9378
785 Ga0265316_10024251 3300031344 Bacteria 5089
786 Ga0265316_10025334 3300031344 Bacteria 4952
787 Ga0265316_10045315 3300031344 Unclassified 3492
788 Ga0265316_10046649 3300031344 Bacteria 3432
789 Ga0265316_10074387 3300031344 Bacteria 2614
790 Ga0265316_10088326 3300031344 Bacteria 2367
791 Ga0265316_10095040 3300031344 Bacteria 2270
792 Ga0265316_10097504 3300031344 Bacteria 2237
793 Ga0265316_10189558 3300031344 Bacteria 1528
794 Ga0307408_100040504 3300031548 Bacteria 3299
795 Ga0307408_100076057 3300031548 Bacteria 2496
796 Ga0307408_100133647 3300031548 Bacteria 1938
797 Ga0307408_100137991 3300031548 Bacteria 1910
798 Ga0307408_100213002 3300031548 Bacteria 1571
799 Ga0307408_100216978 3300031548 Bacteria 1559
800 Ga0307408_100360712 3300031548 Unclassified 1236
801 Ga0265313_10000255 3300031595 Bacteria 58241
802 Ga0265313_10002537 3300031595 Bacteria 15655
803 Ga0316579_10083524 3300031691 Bacteria 1522
804 Ga0265314_10000408 3300031711 Bacteria 58081
805 Ga0265314_10083298 3300031711 Bacteria 2103
806 Ga0265342_10001004 3300031712 Bacteria 27819
807 Ga0265342_10018922 3300031712 Bacteria 4449
808 Ga0265342_10030867 3300031712 Bacteria 3317
809 Ga0265342_10045070 3300031712 Bacteria 2656
810 Ga0316578_10000576 3300031728 Bacteria 12702
811 Ga0307405_10052667 3300031731 Bacteria 2532
812 Ga0307405_10274282 3300031731 Bacteria 1266
813 Ga0307413_10015980 3300031824 Bacteria 3862
814 Ga0307413_10090835 3300031824 Bacteria 1988
815 Ga0307410_10000584 3300031852 Bacteria 14998
816 Ga0307410_10021988 3300031852 Bacteria 3934
817 Ga0307410_10027478 3300031852 Bacteria 3597
818 Ga0307410_10363650 3300031852 Bacteria 1159
819 Ga0307406_10256534 3300031901 Bacteria 1320
820 Ga0307407_10007994 3300031903 Bacteria 4825
821 Ga0307407_10015484 3300031903 Bacteria 3772
822 Ga0307407_10031272 3300031903 Bacteria 2881
823 Ga0307407_10182902 3300031903 Bacteria 1390
824 Ga0307412_10008811 3300031911 Bacteria 5777
825 Ga0307412_10022102 3300031911 Bacteria 3894
826 Ga0307412_10043309 3300031911 Bacteria 2930
827 Ga0307409_100001963 3300031995 Bacteria 10526
828 Ga0307409_100009405 3300031995 Bacteria 6001
829 Ga0307409_100170895 3300031995 Unclassified 1913
830 Ga0307409_100475203 3300031995 Bacteria 1212
831 Ga0307409_100592578 3300031995 Bacteria 1094
832 Ga0307416_100002140 3300032002 Bacteria 11173
833 Ga0307416_100008530 3300032002 Bacteria 6624
834 Ga0307416_100013568 3300032002 Bacteria 5545
835 Ga0307416_100022496 3300032002 Bacteria 4552
836 Ga0307416_100257865 3300032002 Bacteria 1702
837 Ga0307414_10006358 3300032004 Bacteria 6582
838 Ga0307414_10015416 3300032004 Bacteria 4612
839 Ga0307414_10064531 3300032004 Bacteria 2608
840 Ga0307411_10001766 3300032005 Bacteria 9126
841 Ga0307411_10006989 3300032005 Bacteria 5701
842 Ga0307411_10010855 3300032005 Bacteria 4881
843 Ga0307411_10291488 3300032005 Bacteria 1304
844 Ga0307411_10325012 3300032005 Bacteria 1244
845 Ga0316580_10047029 3300032139 Bacteria 1330
846 Ga0316592_1002075 3300033524 Bacteria 3396
847 Ga0316592_1007560 3300033524 Bacteria 2127
848 Ga0316588_1000364 3300033528 Bacteria 5879
849 Ga0316596_1008554 3300033541 Bacteria 2443
850 Ga0316212_1000277 3300033547 Bacteria 6054
851 Ga0373948_0011441 3300034817 Bacteria 1569
852 Ga0373958_0022934 3300034819 Bacteria 1170
853 Ga0373959_0002633 3300034820 Bacteria 2847
854 Ga0373938_0000411 3300034957 Bacteria 6904
855 Ga0373926_0001952 3300035083 Bacteria 6457
856 Ga0373926_0017848 3300035083 Bacteria 2438
857 Ga0373928_0003168 3300035084 Bacteria 3150
858 Ga0373929_0003351 3300035085 Bacteria 2893
859 Ga0373934_0010338 3300035086 Bacteria 3502
860 Ga0373934_0032053 3300035086 Unclassified 2060
861 Ga0373944_0066540 3300035089 Bacteria 1166
862 Ga0373951_0001893 3300035091 Bacteria 5390
863 Ga0373952_0002290 3300035092 Bacteria 3449
864 Ga0373923_0049358 3300035111 Bacteria 1760
865 Ga0373923_0115880 3300035111 Unclassified 1193
866 Ga0373932_0003415 3300035112 Bacteria 3821
867 Ga0373936_0021294 3300035113 Bacteria 2521
868 Ga0373936_0032866 3300035113 Bacteria 2054
869 Ga0373939_0003135 3300035114 Bacteria 3888
870 Ga0373941_0000100 3300035115 Bacteria 14305
871 Ga0373945_0005208 3300035116 Bacteria 4157
872 Ga0373945_0018312 3300035116 Unclassified 2382
873 Ga0373945_0050565 3300035116 Bacteria 1528
874 Ga0373953_0005563 3300035117 Bacteria 4098
875 Ga0373954_0001733 3300035118 Bacteria 8939
876 Ga0373954_0063400 3300035118 Unclassified 1747
877 Ga0373954_0070445 3300035118 Bacteria 1661
878 Ga0373954_0100924 3300035118 Bacteria 1392
879 Ga0373954_0120788 3300035118 Bacteria 1272
880 Ga0373956_0005358 3300035119 Bacteria 5134
881 Ga0373956_0013358 3300035119 Bacteria 3416
882 Ga0373960_0001352 3300035121 Bacteria 5402
883 Ga0373943_0057785 3300035170 Bacteria 1929
884 Ga0373943_0064135 3300035170 Bacteria 1844
885 Ga0373943_0155902 3300035170 Bacteria 1240
886 Ga0373946_0001535 3300035171 Bacteria 8034
887 Ga0373946_0040845 3300035171 Unclassified 1900
888 Ga0373946_0052362 3300035171 Bacteria 1712
889 Ga0373946_0082587 3300035171 Bacteria 1410
890 Ga0373955_0002172 3300035172 Bacteria 8494
891 Ga0373955_0020850 3300035172 Bacteria 3300
892 Ga0373955_0066556 3300035172 Unclassified 2003
893 Ga0373942_0003366 3300035207 Bacteria 3759
894 Ga0373961_0001007 3300035241 Bacteria 9195
895 Ga0373961_0047257 3300035241 Bacteria 1264
896 Ga0316574_0009468 3300035398 Bacteria 5459
897 Ga0373924_0184404 3300035410 Bacteria 919
898 Ga0373931_0000326 3300035691 Bacteria 19957
899 Ga0373931_0011882 3300035691 Bacteria 4212
900 Ga0373931_0045572 3300035691 Bacteria 2316
901 Ga0373935_0007305 3300035692 Bacteria 6606
902 Ga0373935_0017708 3300035692 Bacteria 4327
903 Ga0373935_0043884 3300035692 Bacteria 2816
904 Ga0373935_0083190 3300035692 Bacteria 2083
905 Ga0373927_0001044 3300035695 Bacteria 21078
906 Ga0373927_0003851 3300035695 Bacteria 10652
907 Ga0373927_0007815 3300035695 Bacteria 7237
908 Ga0373927_0012069 3300035695 Bacteria 5747
909 Ga0373927_0081468 3300035695 Bacteria 2098
910 Ga0373927_0133512 3300035695 Bacteria 1622
911 Ga0373933_0012932 3300035724 Bacteria 4617
912 Ga0373933_0060171 3300035724 Unclassified 2290
913 Ga0373933_0118591 3300035724 Bacteria 1656
914 Ga0373947_0001564 3300035725 Bacteria 14018
915 Ga0373947_0005841 3300035725 Bacteria 7170
916 Ga0373947_0006086 3300035725 Bacteria 7029
917 Ga0373947_0072097 3300035725 Bacteria 2120
918 Ga0373947_0082739 3300035725 Bacteria 1990
919 Ga0373947_0167708 3300035725 Bacteria 1423
920 Ga0373947_0187721 3300035725 Unclassified 1348
921 Ga0373937_0003455 3300036401 Bacteria 13272
922 Ga0373937_0021013 3300036401 Bacteria 5856
923 Ga0373937_0082047 3300036401 Bacteria 2983
924 Ga0373937_0086200 3300036401 Bacteria 2906
925 Ga0373937_0088612 3300036401 Bacteria 2865
926 Ga0373937_0192094 3300036401 Unclassified 1918
927 Ga0373937_0204030 3300036401 Bacteria 1859
928 Ga0316582_0007601 3300036647 Bacteria 5778
929 Ga0316582_0008317 3300036647 Bacteria 5570
930 Ga0316582_0041012 3300036647 Bacteria 2892
931 Ga0316582_0163124 3300036647 Bacteria 1510
932 Ga0316584_0133075 3300036712 Bacteria 1857
933 Ga0373925_0001268 3300037068 Bacteria 22290
934 Ga0373925_0006381 3300037068 Bacteria 8681
935 Ga0373925_0007445 3300037068 Bacteria 7988
936 Ga0373925_0008189 3300037068 Bacteria 7607
937 Ga0373925_0033881 3300037068 Bacteria 3763
938 Ga0373925_0161693 3300037068 Bacteria 1764
939 Ga0373925_0279063 3300037068 Bacteria 1345
940 Ga0373925_0389730 3300037068 Bacteria 1135
941 Ga0395899_0048870 3300037312 Bacteria 3146
942 Ga0395900_0002799 3300037418 Bacteria 19058
943 Ga0395900_0032160 3300037418 Bacteria 5394
944 Ga0395898_0002991 3300037466 Bacteria 19191
945 Ga0395898_0106762 3300037466 Bacteria 2686
946 Ga0395898_0209536 3300037466 Bacteria 1859
947 Ga0395898_0212131 3300037466 Bacteria 1847
948 Ga0395905_0045314 3300037471 Bacteria 4125
949 Ga0395905_0157698 3300037471 Bacteria 2134
950 Ga0395905_0275876 3300037471 Bacteria 1567
951 Ga0395905_0283114 3300037471 Bacteria 1544
952 Ga0395905_0308492 3300037471 Bacteria 1471
953 Ga0395905_0337999 3300037471 Bacteria 1397
954 Ga0316581_0020655 3300037588 Bacteria 1929
955 Ga0436364_0302019 3300037853 Bacteria 1278
956 Ga0436364_0305504 3300037853 Bacteria 1155
957 Ga0436364_1196049 3300037853 Bacteria 21068
958 Ga0395901_0000800 3300038443 Bacteria 34936
959 Ga0395901_0066875 3300038443 Bacteria 3743
960 Ga0395901_0108573 3300038443 Unclassified 2913
961 Ga0395901_0432088 3300038443 Bacteria 1349
962 Ga0400488_08526 3300038741 Bacteria 2513
963 Ga0400483_133231 3300039062 Unclassified 2077
964 Ga0436365_0695601 3300039437 Unclassified 2135
965 Ga0436365_0701791 3300039437 Bacteria 2518
966 Ga0436365_1368230 3300039437 Bacteria 1009
967 Ga0436365_1473988 3300039437 Bacteria 2586
968 Ga0436365_1711751 3300039437 Bacteria 3608
969 Ga0436360_0811333 3300039438 Bacteria 4537
970 Ga0436360_1006139 3300039438 Bacteria 1410
971 Ga0436361_0831143 3300039447 Bacteria 1375
972 Ga0436363_0100449 3300039450 Bacteria 4748
973 Ga0451577_0000102 3300042876 Bacteria 188094
974 Ga0451577_0000118 3300042876 Bacteria 174137
975 Ga0451577_0000158 3300042876 Bacteria 151857
976 Ga0451577_0000342 3300042876 Bacteria 87318
977 Ga0451577_0000442 3300042876 Bacteria 73235
978 Ga0451577_0002894 3300042876 Bacteria 19689
979 Ga0451577_0010768 3300042876 Bacteria 8701
980 Ga0451577_0010818 3300042876 Bacteria 8673
981 Ga0451577_0024537 3300042876 Bacteria 5484
982 Ga0451577_0034248 3300042876 Bacteria 4579
983 Ga0451577_0047223 3300042876 Bacteria 3850
984 Ga0451577_0062738 3300042876 Bacteria 3314
985 Ga0451577_0086879 3300042876 Bacteria 2790
986 Ga0451577_0109542 3300042876 Bacteria 2470
987 Ga0451577_0122691 3300042876 Bacteria 2327
988 Ga0451577_0146091 3300042876 Bacteria 2126
989 Ga0451577_0148304 3300042876 Bacteria 2110
990 Ga0451577_0202057 3300042876 Bacteria 1794
991 Ga0451577_0249939 3300042876 Bacteria 1605
992 Ga0451577_0475607 3300042876 Bacteria 1134
993 Ga0453683_0000001 3300044673 Bacteria 1384965
994 Ga0453683_0000095 3300044673 Bacteria 132405
995 Ga0453683_0000668 3300044673 Bacteria 36652
996 Ga0453683_0014218 3300044673 Bacteria 5174
997 Ga0453683_0015951 3300044673 Bacteria 4855
998 Ga0453683_0061315 3300044673 Unclassified 2352
999 Ga0453683_0095561 3300044673 Bacteria 1864
1000 Ga0453683_0156752 3300044673 Bacteria 1440
1001 Ga0453684_0000036 3300044712 Bacteria 711481
1002 Ga0453684_0000089 3300044712 Bacteria 395064
1003 Ga0453684_0000249 3300044712 Bacteria 232232
1004 Ga0453684_0000291 3300044712 Bacteria 215046
1005 Ga0453684_0000416 3300044712 Bacteria 174046
1006 Ga0453684_0000931 3300044712 Bacteria 96738
1007 Ga0453684_0001325 3300044712 Bacteria 73132
1008 Ga0453684_0002093 3300044712 Bacteria 50497
1009 Ga0453684_0004587 3300044712 Bacteria 28807
1010 Ga0453684_0010523 3300044712 Bacteria 15793
1011 Ga0453684_0012461 3300044712 Bacteria 14012
1012 Ga0453684_0012798 3300044712 Bacteria 13756
1013 Ga0453684_0016247 3300044712 Bacteria 11660
1014 Ga0453684_0016452 3300044712 Bacteria 11564
1015 Ga0453684_0065370 3300044712 Bacteria 4639
1016 Ga0451576_0000771 3300045051 Bacteria 63052
1017 Ga0451576_0000986 3300045051 Bacteria 52706
1018 Ga0451576_0002308 3300045051 Bacteria 28909
1019 Ga0451576_0004596 3300045051 Bacteria 17819
1020 Ga0451576_0006456 3300045051 Bacteria 14377
1021 Ga0451576_0008282 3300045051 Bacteria 12222
1022 Ga0451576_0010231 3300045051 Bacteria 10785
1023 Ga0451576_0017793 3300045051 Bacteria 7807
1024 Ga0451576_0023257 3300045051 Bacteria 6712
1025 Ga0451576_0048024 3300045051 Bacteria 4486
1026 Ga0451576_0055948 3300045051 Bacteria 4127
1027 Ga0451576_0070865 3300045051 Bacteria 3628
1028 Ga0451576_0076476 3300045051 Unclassified 3484
1029 Ga0451576_0089845 3300045051 Bacteria 3195
1030 Ga0451576_0116955 3300045051 Bacteria 2775
1031 Ga0451576_0132403 3300045051 Bacteria 2599
1032 Ga0466967_0049862 3300045976 Bacteria 3664
1033 Ga0495592_0143522 3300046454 Bacteria 1658
1034 Ga0495603_0078049 3300046455 Bacteria 1942
1035 Ga0495603_0173644 3300046455 Bacteria 1248
1036 Ga0495629_0011921 3300046459 Bacteria 6305
1037 Ga0495629_0186010 3300046459 Bacteria 1439
1038 Ga0495651_0015055 3300046462 Bacteria 5979
1039 Ga0495651_0018396 3300046462 Bacteria 5412
1040 Ga0495651_0048545 3300046462 Bacteria 3278
1041 Ga0495651_0179708 3300046462 Bacteria 1498
1042 Ga0495580_0000698 3300046472 Bacteria 28698
1043 Ga0495580_0000831 3300046472 Bacteria 26753
1044 Ga0495580_0003043 3300046472 Bacteria 14356
1045 Ga0495580_0006590 3300046472 Bacteria 9435
1046 Ga0495580_0048725 3300046472 Bacteria 2998
1047 Ga0495580_0049783 3300046472 Bacteria 2964
1048 Ga0495580_0055509 3300046472 Unclassified 2791
1049 Ga0495580_0085302 3300046472 Bacteria 2200
1050 Ga0495580_0107202 3300046472 Bacteria 1940
1051 Ga0495580_0108584 3300046472 Unclassified 1927
1052 Ga0495580_0130040 3300046472 Bacteria 1747
1053 Ga0495580_0209793 3300046472 Bacteria 1340
1054 Ga0495582_0000811 3300046473 Bacteria 17357
1055 Ga0495582_0038876 3300046473 Bacteria 2619
1056 Ga0495582_0097234 3300046473 Bacteria 1646
1057 Ga0495662_0011005 3300046476 Bacteria 4424
1058 Ga0495664_0006501 3300046477 Bacteria 6458
1059 Ga0495664_0046463 3300046477 Bacteria 2576
1060 Ga0495594_0081059 3300046499 Bacteria 1812
1061 Ga0495594_0101666 3300046499 Unclassified 1617
1062 Ga0495608_0084278 3300046511 Bacteria 2062
1063 Ga0495608_0194539 3300046511 Bacteria 1279
1064 Ga0495618_0001176 3300046514 Bacteria 17746
1065 Ga0495628_0036251 3300046516 Bacteria 3960
1066 Ga0495628_0120163 3300046516 Bacteria 2016
1067 Ga0495628_0166282 3300046516 Bacteria 1674
1068 Ga0495630_0006727 3300046517 Bacteria 8192
1069 Ga0495630_0015944 3300046517 Bacteria 5491
1070 Ga0495643_0001268 3300046522 Bacteria 24192
1071 Ga0495666_0065298 3300046526 Unclassified 1736
1072 Ga0495666_0151869 3300046526 Bacteria 1077
1073 Ga0495642_0011949 3300046528 Bacteria 3344
1074 Ga0495642_0012097 3300046528 Bacteria 3324
1075 Ga0495642_0071469 3300046528 Bacteria 1452
1076 Ga0495652_0064248 3300046529 Bacteria 3087
1077 Ga0495652_0140811 3300046529 Unclassified 1897
1078 Ga0495652_0146033 3300046529 Bacteria 1854
1079 Ga0495652_0155998 3300046529 Unclassified 1778
1080 Ga0495665_0002806 3300046531 Bacteria 9403
1081 Ga0495665_0011553 3300046531 Bacteria 4780
1082 Ga0495665_0034126 3300046531 Bacteria 2721
1083 Ga0495640_0036676 3300046533 Bacteria 3463
1084 Ga0495586_0189269 3300046535 Bacteria 1165
1085 Ga0495587_0000291 3300046536 Bacteria 35547
1086 Ga0495587_0004247 3300046536 Bacteria 9472
1087 Ga0495645_0002293 3300046543 Bacteria 13000
1088 Ga0495645_0009122 3300046543 Bacteria 6929
1089 Ga0495645_0215593 3300046543 Bacteria 1294
1090 Ga0495667_0111047 3300046559 Unclassified 1771
1091 Ga0495656_0107305 3300046615 Unclassified 1301
1092 Ga0495634_0057461 3300046642 Bacteria 2597
1093 Ga0495634_0084864 3300046642 Bacteria 2065
1094 Ga0495634_0117270 3300046642 Bacteria 1707
1095 Ga0495635_0049638 3300046663 Bacteria 2892
1096 Ga0495659_0001646 3300046664 Bacteria 7503
1097 Ga0495659_0003198 3300046664 Bacteria 5243
1098 Ga0495659_0008101 3300046664 Bacteria 3339
1099 Ga0495659_0055608 3300046664 Bacteria 1451
1100 Ga0495659_0076585 3300046664 Bacteria 1262
1101 Ga0495588_0002473 3300046674 Bacteria 7918
1102 Ga0495657_0056537 3300046675 Bacteria 2612
1103 Ga0495599_0265868 3300046678 Bacteria 1041
1104 Ga0495623_0027851 3300046679 Unclassified 3637
1105 Ga0495623_0046467 3300046679 Bacteria 2755
1106 Ga0495658_0115923 3300046683 Bacteria 1615
1107 Ga0495658_0187190 3300046683 Bacteria 1286
1108 Ga0495669_0006346 3300046684 Bacteria 4941
1109 Ga0495669_0027677 3300046684 Bacteria 2481
1110 Ga0495669_0033700 3300046684 Bacteria 2255
1111 Ga0495669_0107491 3300046684 Bacteria 1300
1112 Ga0495669_0121383 3300046684 Bacteria 1225
1113 Ga0495613_0040442 3300046689 Bacteria 3454
1114 Ga0495613_0047111 3300046689 Bacteria 3185
1115 Ga0495670_0087704 3300046691 Bacteria 1590
1116 Ga0495600_0190977 3300046809 Bacteria 1317
1117 Ga0495581_0011957 3300047315 Bacteria 5022
1118 Ga0495581_0156534 3300047315 Bacteria 1332
1119 Ga0495604_0000768 3300047317 Bacteria 27007
1120 Ga0495604_0058699 3300047317 Bacteria 2954
1121 Ga0495636_0013309 3300047318 Bacteria 3264
1122 Ga0495636_0154209 3300047318 Bacteria 1032
1123 Ga0495674_0015837 3300047319 Bacteria 7039
1124 Ga0495674_0072475 3300047319 Bacteria 2971
1125 Ga0495674_0190786 3300047319 Bacteria 1703
1126 Ga0495674_0216134 3300047319 Bacteria 1586
1127 Ga0495674_0299208 3300047319 Bacteria 1314
1128 Ga0495674_0376766 3300047319 Unclassified 1149
1129 Ga0495675_0096815 3300047444 Unclassified 1850
1130 Ga0495675_0125611 3300047444 Bacteria 1596
1131 Ga0495675_0175636 3300047444 Unclassified 1314
1132 Ga0495685_026031 3300047447 Unclassified 2014
1133 Ga0495684_0004863 3300047471 Bacteria 10480
1134 Ga0495684_0010480 3300047471 Bacteria 7168
1135 Ga0495684_0124545 3300047471 Unclassified 1939
1136 Ga0495684_0176314 3300047471 Bacteria 1587
1137 Ga0495602_0019958 3300048088 Bacteria 6635
1138 Ga0495602_0110466 3300048088 Bacteria 2234
1139 Ga0495602_0132025 3300048088 Unclassified 1990
1140 Ga0496102_0049189 3300048905 Bacteria 3835
1141 Ga0496102_0089343 3300048905 Bacteria 2850
1142 Ga0496104_0122186 3300048907 Unclassified 2500
1143 Ga0496106_0080674 3300048909 Bacteria 2499
1144 Ga0496106_0374551 3300048909 Unclassified 1144
1145 Ga0496112_0044478 3300048915 Bacteria 4351
1146 Ga0496112_0446153 3300048915 Bacteria 1232
1147 Ga0496115_0021365 3300048918 Bacteria 5000
1148 Ga0496115_0358937 3300048918 Bacteria 1188
1149 Ga0501031_0039173 3300049568 Bacteria 3092
1150 Ga0501031_0272494 3300049568 Bacteria 1099
1151 Ga0501032_0063690 3300049569 Bacteria 2468
1152 Ga0501033_0061239 3300049570 Bacteria 2774
1153 Ga0501034_0022870 3300049571 Bacteria 6368
1154 Ga0501034_0042270 3300049571 Bacteria 4614
1155 Ga0501036_0122531 3300049572 Bacteria 2196
1156 Ga0501036_0221593 3300049572 Bacteria 1588
1157 Ga0501036_0265424 3300049572 Unclassified 1438
1158 Ga0501037_0006924 3300049573 Bacteria 8279
1159 Ga0501038_0062519 3300049574 Bacteria 3181
1160 Ga0501038_0152414 3300049574 Bacteria 1884
1161 Ga0501039_0050461 3300049575 Bacteria 3219
1162 Ga0501039_0154242 3300049575 Bacteria 1804
1163 Ga0501040_0005078 3300049576 Bacteria 8506
1164 Ga0501040_0016245 3300049576 Bacteria 4923
1165 Ga0501040_0023758 3300049576 Bacteria 4111
1166 Ga0501040_0068659 3300049576 Bacteria 2445
1167 Ga0501040_0145822 3300049576 Bacteria 1669
1168 Ga0501040_0176350 3300049576 Bacteria 1514
1169 Ga0501041_0001270 3300049577 Bacteria 13870
1170 Ga0501041_0008158 3300049577 Bacteria 6162
1171 Ga0501041_0084472 3300049577 Bacteria 1956
1172 Ga0501041_0183194 3300049577 Bacteria 1311
1173 Ga0501042_0003910 3300049578 Bacteria 9429
1174 Ga0501042_0048431 3300049578 Unclassified 3030
1175 Ga0501042_0057710 3300049578 Bacteria 2770
1176 Ga0501042_0067909 3300049578 Unclassified 2549
1177 Ga0501042_0167360 3300049578 Bacteria 1586
1178 Ga0501043_0096769 3300049579 Bacteria 2320
1179 Ga0501046_0031516 3300049580 Bacteria 4296
1180 Ga0501046_0131141 3300049580 Bacteria 1901
1181 Ga0501047_0006159 3300049581 Bacteria 11281
1182 Ga0501047_0156444 3300049581 Bacteria 2153
1183 Ga0501048_0031747 3300049582 Bacteria 3820
1184 Ga0501048_0037562 3300049582 Bacteria 3478
1185 Ga0501048_0052967 3300049582 Bacteria 2887
1186 Ga0501048_0140390 3300049582 Bacteria 1708
1187 Ga0501048_0260464 3300049582 Bacteria 1232
1188 Ga0501068_0093735 3300049584 Bacteria 1855
1189 Ga0501069_0157190 3300049585 Bacteria 1308
1190 Ga0501070_0019276 3300049586 Bacteria 5721
1191 Ga0501071_0197027 3300049587 Bacteria 1512
1192 Ga0501072_0007790 3300049588 Bacteria 8136
1193 Ga0501072_0008017 3300049588 Bacteria 8016
1194 Ga0501072_0030980 3300049588 Bacteria 4184
1195 Ga0501072_0121920 3300049588 Bacteria 2077
1196 Ga0501072_0222403 3300049588 Bacteria 1504
1197 Ga0501072_0339496 3300049588 Bacteria 1193
1198 Ga0501073_0069643 3300049589 Bacteria 2451
1199 Ga0501074_0014004 3300049590 Bacteria 5830
1200 Ga0501074_0238228 3300049590 Bacteria 1295
1201 Ga0501075_0001108 3300049591 Bacteria 17348
1202 Ga0501075_0021880 3300049591 Bacteria 4666
1203 Ga0501075_0034963 3300049591 Bacteria 3745
1204 Ga0501075_0045609 3300049591 Bacteria 3290
1205 Ga0501075_0062522 3300049591 Bacteria 2806
1206 Ga0501075_0211343 3300049591 Bacteria 1480
1207 Ga0501076_0003486 3300049592 Bacteria 11051
1208 Ga0501076_0006788 3300049592 Bacteria 8307
1209 Ga0501076_0023621 3300049592 Bacteria 4743
1210 Ga0501076_0028396 3300049592 Bacteria 4345
1211 Ga0501076_0049874 3300049592 Bacteria 3311
1212 Ga0501076_0061604 3300049592 Bacteria 2986
1213 Ga0501077_0007255 3300049593 Bacteria 6835
1214 Ga0501077_0023722 3300049593 Bacteria 3889
1215 Ga0501221_007705 3300049704 Bacteria 1853
1216 Ga0501079_0023210 3300049741 Bacteria 4762
1217 Ga0501079_0028665 3300049741 Bacteria 4273
1218 Ga0501079_0056686 3300049741 Bacteria 3023
1219 Ga0501079_0079882 3300049741 Bacteria 2529
1220 Ga0501079_0349400 3300049741 Bacteria 1159
1221 Ga0501079_0350356 3300049741 Bacteria 1157
1222 Ga0501080_0229356 3300049742 Bacteria 1698
1223 Ga0501081_0015900 3300049743 Bacteria 4968
1224 Ga0501081_0032131 3300049743 Bacteria 3560
1225 Ga0501081_0102764 3300049743 Bacteria 2022
1226 Ga0501081_0144610 3300049743 Bacteria 1705
1227 Ga0501083_0021667 3300049744 Bacteria 4463
1228 Ga0501083_0122590 3300049744 Bacteria 1705
1229 Ga0501035_0003460 3300049822 Bacteria 15111
1230 Ga0501035_0128745 3300049822 Bacteria 2208
1231 Ga0501035_0300864 3300049822 Unclassified 1351
1232 Ga0501044_0083960 3300049823 Unclassified 3219
1233 Ga0501044_0152287 3300049823 Bacteria 2294
1234 Ga0501044_0187224 3300049823 Bacteria 2034
1235 Ga0501045_0018388 3300049824 Unclassified 4971
1236 Ga0501045_0049374 3300049824 Bacteria 3068
1237 Ga0501045_0061868 3300049824 Unclassified 2747
1238 Ga0501045_0069794 3300049824 Bacteria 2584
1239 nmdc:mga07m45_165069_c1 3300050496 Bacteria 1286
1240 nmdc:mga05p37_109553_c1 3300050507 Bacteria 2621
1241 nmdc:mga05p37_113948_c1 3300050507 Bacteria 3324
1242 nmdc:mga05p37_119088_c1 3300050507 Bacteria 3244
1243 nmdc:mga05p37_1238_c1 3300050507 Bacteria 29628
1244 nmdc:mga05p37_137766_c1 3300050507 Bacteria 2992
1245 nmdc:mga05p37_141558_c1 3300050507 Bacteria 2947
1246 nmdc:mga05p37_15576_c1 3300050507 Bacteria 9138
1247 nmdc:mga05p37_16644_c1 3300050507 Bacteria 8857
1248 nmdc:mga05p37_170232_c1 3300050507 Bacteria 2657
1249 nmdc:mga05p37_193544_c1 3300050507 Unclassified 2467
1250 nmdc:mga05p37_202927_c1 3300050507 Unclassified 2400
1251 nmdc:mga05p37_208691_c1 3300050507 Bacteria 2362
1252 nmdc:mga05p37_214193_c1 3300050507 Bacteria 2327
1253 nmdc:mga05p37_21975_c1 3300050507 Bacteria 7729
1254 nmdc:mga05p37_23196_c1 3300050507 Bacteria 7529
1255 nmdc:mga05p37_2826_c1 3300050507 Bacteria 19787
1256 nmdc:mga05p37_30941_c1 3300050507 Bacteria 6535
1257 nmdc:mga05p37_35271_c1 3300050507 Bacteria 6132
1258 nmdc:mga05p37_3828_c1 3300050507 Bacteria 17597
1259 nmdc:mga05p37_4725_c1 3300050507 Bacteria 15918
1260 nmdc:mga05p37_507298_c1 3300050507 Bacteria 1383
1261 nmdc:mga05p37_571_c1 3300050507 Bacteria 40489
1262 nmdc:mga05p37_7972_c1 3300050507 Bacteria 12501
1263 nmdc:mga05p37_830350_c1 3300050507 Bacteria 1006
1264 nmdc:mga05p37_893_c1 3300050507 Bacteria 33632
1265 nmdc:mga09592_1061_c1 3300050508 Bacteria 21805
1266 nmdc:mga09592_109088_c1 3300050508 Bacteria 2374
1267 nmdc:mga09592_124010_c1 3300050508 Unclassified 2220
1268 nmdc:mga09592_16949_c1 3300050508 Bacteria 5962
1269 nmdc:mga09592_1842_c1 3300050508 Bacteria 17047
1270 nmdc:mga09592_263750_c1 3300050508 Bacteria 1494
1271 nmdc:mga09592_31912_c1 3300050508 Bacteria 4390
1272 nmdc:mga09592_47811_c1 3300050508 Bacteria 3606
1273 nmdc:mga09592_9084_c1 3300050508 Bacteria 8081
1274 nmdc:mga09592_9871_c1 3300050508 Bacteria 7763
1275 nmdc:mga0qj67_12967_c1 3300050509 Bacteria 6290
1276 nmdc:mga0qj67_150404_c1 3300050509 Bacteria 1889
1277 nmdc:mga0qj67_26317_c1 3300050509 Bacteria 4504
1278 nmdc:mga0qj67_27875_c1 3300050509 Bacteria 4380
1279 nmdc:mga0qj67_40407_c1 3300050509 Bacteria 3666
1280 nmdc:mga0qj67_4733_c1 3300050509 Bacteria 9887
1281 nmdc:mga0qj67_73685_c1 3300050509 Bacteria 2727
1282 nmdc:mga0qj67_7669_c1 3300050509 Bacteria 7975
1283 nmdc:mga0qj67_93375_c1 3300050509 Bacteria 1722
1284 nmdc:mga06r32_133219_c1 3300050510 Bacteria 2459
1285 nmdc:mga06r32_16916_c1 3300050510 Bacteria 6653
1286 nmdc:mga06r32_281346_c1 3300050510 Bacteria 1650
1287 nmdc:mga06r32_28342_c1 3300050510 Bacteria 5239
1288 nmdc:mga06r32_29558_c1 3300050510 Bacteria 5139
1289 nmdc:mga06r32_42603_c1 3300050510 Bacteria 4317
1290 nmdc:mga06r32_44660_c1 3300050510 Bacteria 4220
1291 nmdc:mga06r32_6384_c1 3300050510 Bacteria 10594
1292 nmdc:mga06r32_70113_c1 3300050510 Unclassified 3389
1293 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
1294 nmdc:mga08y16_133721_c1 3300050511 Bacteria 2578
1295 nmdc:mga08y16_19558_c1 3300050511 Bacteria 7140
1296 nmdc:mga08y16_2054_c1 3300050511 Bacteria 20614
1297 nmdc:mga08y16_31818_c1 3300050511 Bacteria 5548
1298 nmdc:mga08y16_37489_c1 3300050511 Bacteria 5090
1299 nmdc:mga08y16_379934_c1 3300050511 Bacteria 1448
1300 nmdc:mga08y16_388882_c1 3300050511 Bacteria 1429
1301 nmdc:mga08y16_41092_c1 3300050511 Bacteria 4845
1302 nmdc:mga08y16_485231_c1 3300050511 Bacteria 1257
1303 nmdc:mga08y16_486273_c1 3300050511 Bacteria 1256
1304 nmdc:mga08y16_5112_c1 3300050511 Bacteria 13706
1305 nmdc:mga08y16_58013_c1 3300050511 Bacteria 4045
1306 nmdc:mga08y16_66988_c1 3300050511 Bacteria 3747
1307 nmdc:mga0n895_118755_c1 3300050512 Bacteria 2665
1308 nmdc:mga0n895_123259_c1 3300050512 Bacteria 2614
1309 nmdc:mga0n895_129696_c1 3300050512 Bacteria 2546
1310 nmdc:mga0n895_132294_c1 3300050512 Bacteria 2520
1311 nmdc:mga0n895_172066_c1 3300050512 Unclassified 2198
1312 nmdc:mga0n895_1792_c1 3300050512 Bacteria 16311
1313 nmdc:mga0n895_202578_c1 3300050512 Bacteria 2015
1314 nmdc:mga0n895_230479_c1 3300050512 Bacteria 1880
1315 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
1316 nmdc:mga0n895_31169_c1 3300050512 Bacteria 5102
1317 nmdc:mga0n895_3140_c1 3300050512 Bacteria 13183
1318 nmdc:mga0n895_38100_c1 3300050512 Bacteria 4657
1319 nmdc:mga0n895_438309_c1 3300050512 Bacteria 1320
1320 nmdc:mga0n895_542862_c1 3300050512 Unclassified 1169
1321 nmdc:mga0n895_69370_c1 3300050512 Bacteria 3493
1322 nmdc:mga0n895_75583_c1 3300050512 Bacteria 3349
1323 nmdc:mga0n895_93994_c1 3300050512 Bacteria 3002
1324 nmdc:mga0rr50_117604_c1 3300050513 Bacteria 2111
1325 nmdc:mga0rr50_13268_c1 3300050513 Bacteria 5359
1326 nmdc:mga0rr50_137614_c1 3300050513 Bacteria 1962
1327 nmdc:mga0rr50_189_c1 3300050513 Bacteria 33360
1328 nmdc:mga0rr50_206759_c1 3300050513 Bacteria 1616
1329 nmdc:mga0rr50_24412_c1 3300050513 Bacteria 4186
1330 nmdc:mga0rr50_381867_c1 3300050513 Bacteria 1188
1331 nmdc:mga0rr50_4734_c1 3300050513 Bacteria 8025
1332 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
1333 nmdc:mga0rr50_65136_c1 3300050513 Bacteria 2110
1334 nmdc:mga0rr50_88017_c1 3300050513 Bacteria 2412
1335 nmdc:mga0rr50_9409_c1 3300050513 Bacteria 6141
1336 nmdc:mga0rr50_94521_c1 3300050513 Bacteria 2335
1337 nmdc:mga08x19_18929_c1 3300050514 Bacteria 4222
1338 nmdc:mga08x19_193_c1 3300050514 Bacteria 47757
1339 nmdc:mga08x19_230579_c1 3300050514 Bacteria 1274
1340 nmdc:mga08x19_28451_c1 3300050514 Bacteria 3501
1341 nmdc:mga08x19_36038_c1 3300050514 Bacteria 3132
1342 nmdc:mga08x19_3741_c1 3300050514 Bacteria 9061
1343 nmdc:mga08x19_39_c1 3300050514 Bacteria 158844
1344 nmdc:mga08x19_552_c1 3300050514 Bacteria 24509
1345 nmdc:mga08x19_6051_c1 3300050514 Bacteria 7148
1346 nmdc:mga08x19_64443_c1 3300050514 Unclassified 2379
1347 nmdc:mga08x19_67122_c1 3300050514 Bacteria 2333
1348 nmdc:mga08x19_68796_c1 3300050514 Unclassified 2305
1349 nmdc:mga08x19_90523_c1 3300050514 Bacteria 2019
1350 nmdc:mga08x19_935_c1 3300050514 Bacteria 18384
1351 nmdc:mga0a205_1070_c1 3300050515 Bacteria 22744
1352 nmdc:mga0a205_157809_c1 3300050515 Bacteria 2167
1353 nmdc:mga0a205_166707_c1 3300050515 Bacteria 2098
1354 nmdc:mga0a205_17003_c1 3300050515 Bacteria 6809
1355 nmdc:mga0a205_17100_c1 3300050515 Bacteria 6790
1356 nmdc:mga0a205_23132_c1 3300050515 Bacteria 5894
1357 nmdc:mga0a205_25660_c1 3300050515 Bacteria 5616
1358 nmdc:mga0a205_27475_c1 3300050515 Bacteria 5433
1359 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
1360 nmdc:mga0a205_334455_c1 3300050515 Unclassified 1384
1361 nmdc:mga0a205_37839_c2 3300050515 Bacteria 1863
1362 nmdc:mga0a205_55818_c1 3300050515 Bacteria 3814
1363 nmdc:mga0a205_619_c1 3300050515 Bacteria 28239
1364 nmdc:mga0a205_82749_c1 3300050515 Bacteria 3100
1365 Ga0495612_0022097 3300053078 Bacteria 2550
1366 Ga0495595_0081047 3300053084 Bacteria 1546
1367 Ga0495619_0003455 3300053085 Bacteria 10194
1368 Ga0495619_0027075 3300053085 Bacteria 3693
1369 Ga0495619_0224215 3300053085 Bacteria 1302
1370 Ga0501084_0004255 3300054114 Bacteria 11644
1371 Ga0501084_0010571 3300054114 Bacteria 7636
1372 Ga0501084_0014550 3300054114 Bacteria 6523
1373 Ga0501084_0071702 3300054114 Bacteria 2901
1374 Ga0501084_0182648 3300054114 Bacteria 1771
1375 Ga0590071_000237 3300059421 Bacteria 16106
1376 Ga0590074_000404 3300059423 Bacteria 6190
1377 Ga0590075_000952 3300059424 Bacteria 7534
1378 Ga0590075_005099 3300059424 Bacteria 3105
1379 Ga0590075_025889 3300059424 Unclassified 1476
1380 Ga0590077_000214 3300059426 Bacteria 16646
1381 Ga0590077_000432 3300059426 Bacteria 11762
1382 Ga0501082_0000531 3300060353 Bacteria 33934
1383 Ga0501082_0002871 3300060353 Bacteria 15013
1384 Ga0501082_0048346 3300060353 Bacteria 3666
1385 Ga0501082_0404830 3300060353 Bacteria 1191
1386 Ga0530510_0007391 3300061734 Bacteria 7647
1387 Ga0530510_0024893 3300061734 Bacteria 4277
1388 Ga0530510_0046708 3300061734 Bacteria 3128
1389 Ga0530510_0090267 3300061734 Bacteria 2235
1390 Ga0530510_0219396 3300061734 Bacteria 1413
1391 2687234418 2684623219 Bacteria 8442773
1392 2688069808 2687453257 Bacteria 6784659
1393 2920109424 2920107658 Bacteria 10042636
1394 Ga0114129_10681966
1395 JGI25406J46586_10020362
1396 Ga0058863_10101987
1397 Ga0058861_11763141
1398 Ga0058862_11755211
1399 Ga0065714_10109055
1400 Ga0065712_10070553
1401 Ga0065712_10088406
1402 Ga0065712_10098888
1403 Ga0065715_10198264
1404 Ga0065707_10002787
1405 Ga0065707_10014613
1406 Ga0065707_10083645
1407 Ga0065707_10094018
1408 Ga0065707_10134884
1409 Ga0065707_10137407
1410 Ga0070676_10027352
1411 Ga0070683_100000048
1412 Ga0070683_100051625
1413 Ga0070683_100054837
1414 Ga0070683_100115499
1415 Ga0070690_100002213
1416 Ga0070670_100003569
1417 Ga0070670_100036486
1418 Ga0070670_100266192
1419 Ga0068869_100075258
1420 Ga0070666_10035605
1421 Ga0070666_10125374
1422 Ga0070680_100012542
1423 Ga0070680_100015561
1424 Ga0070680_100025973
1425 Ga0070680_100122737
1426 Ga0068868_100008891
1427 Ga0068868_100090672
1428 Ga0068868_100165327
1429 Ga0070689_100007004
1430 Ga0070689_100012178
1431 Ga0070689_100214622
1432 Ga0070689_100370373
1433 Ga0070687_100015273
1434 Ga0070687_100016131
1435 Ga0070692_10024447
1436 Ga0070668_100023718
1437 Ga0070668_100357464
1438 Ga0070669_100042332
1439 Ga0070669_100046316
1440 Ga0070669_100065428
1441 Ga0070669_100097360
1442 Ga0070669_100193922
1443 Ga0070669_100325849
1444 Ga0070675_100000863
1445 Ga0070675_100017018
1446 Ga0070675_100091118
1447 Ga0070675_100289465
1448 Ga0070671_100041907
1449 Ga0070671_100167081
1450 Ga0070674_100024753
1451 Ga0070674_100143483
1452 Ga0070673_100004711
1453 Ga0070673_100005778
1454 Ga0070673_100024730
1455 Ga0070673_100080756
1456 Ga0070673_100148706
1457 Ga0070673_100156177
1458 Ga0070688_100021384
1459 Ga0070688_100029736
1460 Ga0070688_100048620
1461 Ga0070688_100056651
1462 Ga0070659_100145925
1463 Ga0070667_100202517
1464 Ga0070703_10000403
1465 Ga0070703_10009210
1466 Ga0070703_10015520
1467 Ga0070703_10062047
1468 Ga0070709_10000029
1469 Ga0070709_10020756
1470 Ga0070709_10039088
1471 Ga0070709_10082239
1472 Ga0070709_10124081
1473 Ga0070709_10185678
1474 Ga0070714_100011082
1475 Ga0070713_100005215
1476 Ga0070713_100008039
1477 Ga0070713_100009698
1478 Ga0070713_100076213
1479 Ga0070713_100297751
1480 Ga0070710_10002860
1481 Ga0070710_10087151
1482 Ga0070710_10120772
1483 Ga0070701_10017984
1484 Ga0070701_10026950
1485 Ga0070701_10027813
1486 Ga0070701_10101166
1487 Ga0070711_100000027
1488 Ga0070711_100003000
1489 Ga0070711_100011074
1490 Ga0070711_100017969
1491 Ga0070711_100042422
1492 Ga0070711_100052621
1493 Ga0070705_100000221
1494 Ga0070705_100002104
1495 Ga0070705_100005766
1496 Ga0070705_100008819
1497 Ga0070705_100088584
1498 Ga0070700_100030711
1499 Ga0070700_100031058
1500 Ga0070694_100003286
1501 Ga0070694_100005213
1502 Ga0070694_100006791
1503 Ga0070694_100102871
1504 Ga0070694_100195836
1505 Ga0070694_100209803
1506 Ga0070708_100006107
1507 Ga0070708_100021130
1508 Ga0070708_100082824
1509 Ga0070708_100295673
1510 Ga0070708_100326402
1511 Ga0070678_100104267
1512 Ga0070678_100262381
1513 Ga0070678_100335093
1514 Ga0070662_100050452
1515 Ga0070662_100081810
1516 Ga0070662_100088775
1517 Ga0070681_10000242
1518 Ga0070681_10008930
1519 Ga0070681_10010266
1520 Ga0070681_10428787
1521 Ga0070681_10447933
1522 Ga0068867_100003936
1523 Ga0068867_100021810
1524 Ga0068867_100038696
1525 Ga0068867_100451137
1526 Ga0070706_100000208
1527 Ga0070706_100007222
1528 Ga0070706_100042144
1529 Ga0070706_100086813
1530 Ga0070706_100156077
1531 Ga0070706_100204180
1532 Ga0070706_100274116
1533 Ga0070706_100430419
1534 Ga0070707_100020689
1535 Ga0070707_100055558
1536 Ga0070707_100081064
1537 Ga0070707_100102983
1538 Ga0070707_100120145
1539 Ga0070707_100191869
1540 Ga0070707_100240742
1541 Ga0070707_100348076
1542 Ga0070707_100461909
1543 Ga0070698_100006201
1544 Ga0070698_100007211
1545 Ga0070698_100014143
1546 Ga0070698_100021538
1547 Ga0070698_100052957
1548 Ga0070698_100145794
1549 Ga0070699_100000029
1550 Ga0070699_100001721
1551 Ga0070699_100001814
1552 Ga0070699_100002759
1553 Ga0070699_100003831
1554 Ga0070699_100011338
1555 Ga0070699_100038432
1556 Ga0070699_100075638
1557 Ga0070699_100114935
1558 Ga0070699_100207133
1559 Ga0070699_100216768
1560 Ga0070699_100260318
1561 Ga0070699_100342557
1562 Ga0070699_100374643
1563 Ga0070699_100379795
1564 Ga0070679_100014473
1565 Ga0070679_100066444
1566 Ga0070684_100000038
1567 Ga0070684_100053735
1568 Ga0070684_100083985
1569 Ga0070684_100408693
1570 Ga0070697_100000522
1571 Ga0070697_100011943
1572 Ga0070697_100027403
1573 Ga0070697_100050479
1574 Ga0070697_100103069
1575 Ga0070697_100286198
1576 Ga0070697_100286644
1577 Ga0070672_100033032
1578 Ga0070672_100041249
1579 Ga0070672_100099821
1580 Ga0070672_100123433
1581 Ga0070686_100002326
1582 Ga0070695_100003478
1583 Ga0070695_100027675
1584 Ga0070695_100093607
1585 Ga0070695_100118096
1586 Ga0070695_100198403
1587 Ga0070696_100000362
1588 Ga0070696_100002039
1589 Ga0070696_100011391
1590 Ga0070696_100015421
1591 Ga0070696_100017408
1592 Ga0070696_100022395
1593 Ga0070696_100039752
1594 Ga0070696_100059475
1595 Ga0070696_100095540
1596 Ga0070696_100133056
1597 Ga0070696_100155335
1598 Ga0070693_100000012
1599 Ga0070693_100033253
1600 Ga0070665_100026922
1601 Ga0070665_100401326
1602 Ga0070704_100003038
1603 Ga0070704_100014058
1604 Ga0070704_100023424
1605 Ga0070704_100040094
1606 Ga0070704_100070671
1607 Ga0070704_100348200
1608 Ga0070704_100398357
1609 Ga0068855_100048548
1610 Ga0068855_100049629
1611 Ga0068855_100051195
1612 Ga0068855_100080341
1613 Ga0070664_100001762
1614 Ga0070664_100079139
1615 Ga0070664_100081513
1616 Ga0070664_100140530
1617 Ga0070664_100421083
1618 Ga0068857_100000538
1619 Ga0068857_100005072
1620 Ga0068857_100022733
1621 Ga0068857_100402436
1622 Ga0068854_100005914
1623 Ga0068854_100148965
1624 Ga0068856_100000618
1625 Ga0068856_100002308
1626 Ga0068856_100017427
1627 Ga0068856_100038178
1628 Ga0070702_100020714
1629 Ga0068852_100119127
1630 Ga0068852_100184558
1631 Ga0068859_100001945
1632 Ga0068859_100063870
1633 Ga0068859_100289434
1634 Ga0068859_100291291
1635 Ga0068859_100342706
1636 Ga0068859_100706628
1637 Ga0068864_100009721
1638 Ga0068864_100015208
1639 Ga0068864_100036850
1640 Ga0068864_100054144
1641 Ga0068864_100128617
1642 Ga0068866_10009281
1643 Ga0068861_100096112
1644 Ga0068861_100101019
1645 Ga0068870_10019398
1646 Ga0068863_100002307
1647 Ga0068863_100006891
1648 Ga0068863_100095180
1649 Ga0068863_100243708
1650 Ga0068863_100280098
1651 Ga0068863_100437126
1652 Ga0068858_100008072
1653 Ga0068858_100009268
1654 Ga0068858_100055451
1655 Ga0068858_100060731
1656 Ga0068858_100209387
1657 Ga0068858_100288158
1658 Ga0068860_100007055
1659 Ga0068860_100013803
1660 Ga0068860_100071180
1661 Ga0068860_100281787
1662 Ga0068860_100347766
1663 Ga0068860_100363247
1664 Ga0068862_100006997
1665 Ga0068862_100084035
1666 Ga0068862_100299418
1667 Ga0068862_100342259
1668 Ga0068862_100427316
1669 Ga0081455_10031589
1670 Ga0081455_10064885
1671 Ga0081455_10119536
1672 Ga0081539_10000034
1673 Ga0081539_10000092
1674 Ga0081539_10000151
1675 Ga0070717_10026495
1676 Ga0070717_10352599
1677 Ga0070717_10357667
1678 Ga0075432_10033266
1679 Ga0075432_10056822
1680 Ga0070715_10009767
1681 Ga0070715_10138434
1682 Ga0070715_10166022
1683 Ga0070716_100000362
1684 Ga0070716_100001947
1685 Ga0070716_100005601
1686 Ga0070716_100010580
1687 Ga0070716_100042990
1688 Ga0070716_100061004
1689 Ga0070716_100095408
1690 Ga0070716_100148845
1691 Ga0097621_100001489
1692 Ga0097621_100030411
1693 Ga0097621_100072830
1694 Ga0097621_100135159
1695 Ga0097621_100155599
1696 Ga0097621_100348193
1697 Ga0075370_10110391
1698 Ga0068871_100006737
1699 Ga0068871_100031351
1700 Ga0068871_100327930
1701 Ga0075428_100000398
1702 Ga0075428_100000421
1703 Ga0075428_100001485
1704 Ga0075428_100002532
1705 Ga0075428_100005186
1706 Ga0075428_100013592
1707 Ga0075428_100014142
1708 Ga0075428_100027532
1709 Ga0075428_100044754
1710 Ga0075428_100070705
1711 Ga0075428_100128474
1712 Ga0075428_100179736
1713 Ga0075428_100248391
1714 Ga0075428_100282848
1715 Ga0075428_100479810
1716 Ga0075430_100000341
1717 Ga0075430_100000882
1718 Ga0075430_100007002
1719 Ga0075430_100007723
1720 Ga0075430_100024148
1721 Ga0075430_100076865
1722 Ga0075430_100127416
1723 Ga0075430_100193047
1724 Ga0075431_100001562
1725 Ga0075431_100002961
1726 Ga0075431_100006021
1727 Ga0075431_100007984
1728 Ga0075431_100019021
1729 Ga0075431_100025142
1730 Ga0075431_100029241
1731 Ga0075431_100031771
1732 Ga0075431_100043975
1733 Ga0075431_100062732
1734 Ga0075431_100227665
1735 Ga0075431_100297281
1736 Ga0075433_10000305
1737 Ga0075433_10000783
1738 Ga0075433_10027368
1739 Ga0075433_10036132
1740 Ga0075433_10065298
1741 Ga0075433_10079756
1742 Ga0075433_10110227
1743 Ga0075433_10133243
1744 Ga0075433_10309278
1745 Ga0075433_10457953
1746 Ga0075434_100000107
1747 Ga0075434_100006811
1748 Ga0075434_100015784
1749 Ga0075434_100033258
1750 Ga0075434_100052289
1751 Ga0075434_100054358
1752 Ga0075434_100056056
1753 Ga0075434_100065144
1754 Ga0075434_100076997
1755 Ga0075434_100085346
1756 Ga0075434_100089634
1757 Ga0075434_100110722
1758 Ga0075434_100141417
1759 Ga0075434_100212937
1760 Ga0075434_100246506
1761 Ga0075434_100454812
1762 Ga0075429_100001205
1763 Ga0075429_100007238
1764 Ga0075429_100011821
1765 Ga0075429_100060770
1766 Ga0075429_100122767
1767 Ga0075429_100199639
1768 Ga0075429_100244247
1769 Ga0075429_100342578
1770 Ga0068865_100206577
1771 Ga0075436_100000592
1772 Ga0075436_100001557
1773 Ga0075436_100001958
1774 Ga0075436_100004307
1775 Ga0075436_100015198
1776 Ga0075436_100017110
1777 Ga0075436_100019077
1778 Ga0075436_100100178
1779 Ga0075436_100190857
1780 Ga0075436_100227566
1781 Ga0097620_100001945
1782 Ga0097620_100063869
1783 Ga0097620_100289466
1784 Ga0097620_100291263
1785 Ga0097620_100342705
1786 Ga0097620_100706566
1787 Ga0075435_100000054
1788 Ga0075435_100007100
1789 Ga0075435_100009536
1790 Ga0075435_100026771
1791 Ga0075435_100067955
1792 Ga0075435_100208621
1793 Ga0075435_100278562
1794 Ga0099794_10000854
1795 Ga0099795_10001407
1796 Ga0105240_10002241
1797 Ga0105240_10006423
1798 Ga0105240_10020126
1799 Ga0105240_10074666
1800 Ga0105240_10136821
1801 Ga0105240_10270955
1802 Ga0105240_10377190
1803 Ga0111539_10000455
1804 Ga0111539_10000481
1805 Ga0111539_10005828
1806 Ga0111539_10011459
1807 Ga0111539_10012335
1808 Ga0111539_10014217
1809 Ga0111539_10016344
1810 Ga0111539_10023394
1811 Ga0111539_10042847
1812 Ga0111539_10044646
1813 Ga0111539_10046140
1814 Ga0111539_10449260
1815 Ga0111539_10514303
1816 Ga0111539_10542901
1817 Ga0105245_10099472
1818 Ga0105245_10336882
1819 Ga0114129_10000704
1820 Ga0114129_10000726
1821 Ga0114129_10001085
1822 Ga0114129_10004758
1823 Ga0114129_10005676
1824 Ga0114129_10007659
1825 Ga0114129_10008153
1826 Ga0114129_10008312
1827 Ga0114129_10011034
1828 Ga0114129_10011480
1829 Ga0114129_10014123
1830 Ga0114129_10017003
1831 Ga0114129_10060780
1832 Ga0114129_10067842
1833 Ga0114129_10070576
1834 Ga0114129_10114235
1835 Ga0114129_10125199
1836 Ga0114129_10149319
1837 Ga0114129_10208823
1838 Ga0114129_10211980
1839 Ga0114129_10227596
1840 Ga0114129_10433135
1841 Ga0114129_10463942
1842 Ga0114129_10579607
1843 Ga0114129_10810959
1844 Ga0114129_10831590
1845 Ga0114129_10849499
1846 Ga0105243_10047807
1847 Ga0105243_10064744
1848 Ga0105243_10132232
1849 Ga0105241_10091402
1850 Ga0105241_10381854
1851 Ga0105242_10094144
1852 Ga0105242_10134854
1853 Ga0105248_10007473
1854 Ga0105248_10030650
1855 Ga0105248_10059915
1856 Ga0105248_10093653
1857 Ga0105248_10117414
1858 Ga0105248_10327642
1859 Ga0105248_10608518
1860 Ga0105237_10020943
1861 Ga0105237_10026934
1862 Ga0105238_10000180
1863 Ga0105238_10014879
1864 Ga0105249_10025544
1865 Ga0105249_10096944
1866 Ga0105249_10270463
1867 Ga0105249_10341706
1868 Ga0105239_10006705
1869 Ga0105246_10486348
1870 Ga0157370_10001165
1871 Ga0157370_10083174
1872 Ga0157370_10094048
1873 Ga0157369_10000592
1874 Ga0157369_10115282
1875 Ga0157369_10140362
1876 Ga0157374_10000441
1877 Ga0157374_10204452
1878 Ga0157374_10242671
1879 Ga0157374_10447025
1880 Ga0157374_10462557
1881 Ga0157378_10003579
1882 Ga0157378_10025611
1883 Ga0157378_10069837
1884 Ga0157378_10129379
1885 Ga0157378_10248636
1886 Ga0163162_10282195
1887 Ga0163162_10404675
1888 Ga0157372_10003362
1889 Ga0157372_10074245
1890 Ga0157375_10085469
1891 Ga0157375_10140687
1892 Ga0157375_10148545
1893 Ga0157375_10202265
1894 Ga0157375_10206437
1895 Ga0157375_10262360
1896 Ga0163163_10038117
1897 Ga0163163_10043789
1898 Ga0163163_10083176
1899 Ga0157380_10033796
1900 Ga0157380_10131806
1901 Ga0157380_10345636
1902 Ga0157380_10346626
1903 Ga0157377_10057953
1904 Ga0157377_10100110
1905 Ga0157379_10076476
1906 Ga0157379_10102677
1907 Ga0157379_10177469
1908 Ga0157376_10000023
1909 Ga0157376_10141115
1910 Ga0157376_10182248
1911 Ga0157376_10204088
1912 Ga0157376_10209775
1913 Ga0157376_10224760
1914 Ga0163161_10072203
1915 Ga0163161_10305681
1916 Ga0206351_10837870
1917 Ga0213873_10001907
1918 Ga0213876_10038824
1919 Ga0213876_10039142
1920 Ga0213875_10004157
1921 Ga0224572_1004837
1922 Ga0207697_10087921
1923 Ga0207653_10000261
1924 Ga0207653_10011963
1925 Ga0207692_10013816
1926 Ga0207692_10014017
1927 Ga0207642_10089922
1928 Ga0207680_10026853
1929 Ga0207685_10028201
1930 Ga0207685_10045856
1931 Ga0207699_10000002
1932 Ga0207699_10024147
1933 Ga0207699_10067158
1934 Ga0207699_10110748
1935 Ga0207699_10114079
1936 Ga0207645_10034133
1937 Ga0207643_10033372
1938 Ga0207643_10200598
1939 Ga0207705_10228325
1940 Ga0207684_10000248
1941 Ga0207684_10005571
1942 Ga0207684_10100352
1943 Ga0207684_10404860
1944 Ga0207654_10032115
1945 Ga0207654_10211716
1946 Ga0207707_10001311
1947 Ga0207707_10003312
1948 Ga0207707_10010191
1949 Ga0207707_10061912
1950 Ga0207695_10017728
1951 Ga0207695_10024628
1952 Ga0207695_10033917
1953 Ga0207695_10070335
1954 Ga0207695_10087358
1955 Ga0207695_10238563
1956 Ga0207671_10021128
1957 Ga0207671_10112684
1958 Ga0207693_10021548
1959 Ga0207693_10028502
1960 Ga0207663_10000006
1961 Ga0207663_10072055
1962 Ga0207663_10112826
1963 Ga0207663_10132277
1964 Ga0207660_10006198
1965 Ga0207660_10021369
1966 Ga0207660_10038159
1967 Ga0207660_10067295
1968 Ga0207660_10069252
1969 Ga0207660_10108957
1970 Ga0207662_10013275
1971 Ga0207662_10083186
1972 Ga0207662_10267709
1973 Ga0207657_10159172
1974 Ga0207652_10016229
1975 Ga0207652_10153166
1976 Ga0207652_10240188
1977 Ga0207646_10000922
1978 Ga0207646_10012116
1979 Ga0207646_10063648
1980 Ga0207646_10071503
1981 Ga0207646_10138884
1982 Ga0207646_10147840
1983 Ga0207646_10151667
1984 Ga0207646_10275898
1985 Ga0207681_10002867
1986 Ga0207681_10014305
1987 Ga0207681_10033869
1988 Ga0207681_10097069
1989 Ga0207681_10298208
1990 Ga0207694_10001880
1991 Ga0207694_10120402
1992 Ga0207650_10009543
1993 Ga0207650_10063244
1994 Ga0207650_10109073
1995 Ga0207650_10212015
1996 Ga0207659_10001044
1997 Ga0207659_10026922
1998 Ga0207659_10058293
1999 Ga0207659_10074768
2000 Ga0207659_10106222
2001 Ga0207700_10014372
2002 Ga0207700_10015322
2003 Ga0207700_10020937
2004 Ga0207664_10006353
2005 Ga0207664_10035733
2006 Ga0207644_10011851
2007 Ga0207644_10029360
2008 Ga0207706_10021487
2009 Ga0207706_10066546
2010 Ga0207706_10090817
2011 Ga0207706_10418756
2012 Ga0207686_10048851
2013 Ga0207686_10353113
2014 Ga0207670_10051753
2015 Ga0207670_10185080
2016 Ga0207670_10205114
2017 Ga0207704_10068872
2018 Ga0207704_10223287
2019 Ga0207665_10000680
2020 Ga0207665_10001680
2021 Ga0207665_10006483
2022 Ga0207665_10007762
2023 Ga0207665_10062269
2024 Ga0207665_10083421
2025 Ga0207665_10094458
2026 Ga0207665_10105698
2027 Ga0207665_10106458
2028 Ga0207665_10159758
2029 Ga0207665_10183891
2030 Ga0207665_10253346
2031 Ga0207691_10028579
2032 Ga0207691_10039705
2033 Ga0207691_10069553
2034 Ga0207691_10089330
2035 Ga0207691_10117965
2036 Ga0207691_10236954
2037 Ga0207691_10264970
2038 Ga0207711_10047986
2039 Ga0207711_10126859
2040 Ga0207711_10145833
2041 Ga0207711_10201992
2042 Ga0207711_10326224
2043 Ga0207711_10507248
2044 Ga0207689_10065026
2045 Ga0207689_10325030
2046 Ga0207661_10000049
2047 Ga0207661_10036940
2048 Ga0207661_10197201
2049 Ga0207679_10021463
2050 Ga0207679_10044457
2051 Ga0207679_10127521
2052 Ga0207667_10025881
2053 Ga0207667_10061251
2054 Ga0207667_10067729
2055 Ga0207667_10070057
2056 Ga0207667_10112255
2057 Ga0207667_10167900
2058 Ga0207651_10028984
2059 Ga0207651_10038078
2060 Ga0207651_10093808
2061 Ga0207651_10098282
2062 Ga0207651_10156679
2063 Ga0207712_10123261
2064 Ga0207640_10020149
2065 Ga0207640_10030580
2066 Ga0207640_10328589
2067 Ga0207658_10084783
2068 Ga0207677_10002677
2069 Ga0207677_10268714
2070 Ga0207703_10007033
2071 Ga0207703_10014289
2072 Ga0207703_10042482
2073 Ga0207703_10070079
2074 Ga0207703_10131912
2075 Ga0207703_10168490
2076 Ga0207703_10193609
2077 Ga0207703_10227439
2078 Ga0207703_10325252
2079 Ga0207639_10075419
2080 Ga0207639_10285080
2081 Ga0207678_10113384
2082 Ga0207708_10029732
2083 Ga0207708_10073061
2084 Ga0207708_10314522
2085 Ga0207702_10008916
2086 Ga0207702_10053586
2087 Ga0207702_10056997
2088 Ga0207702_10072126
2089 Ga0207702_10311445
2090 Ga0207641_10001296
2091 Ga0207641_10007090
2092 Ga0207641_10061795
2093 Ga0207641_10246505
2094 Ga0207648_10003070
2095 Ga0207648_10032208
2096 Ga0207648_10249560
2097 Ga0207648_10455626
2098 Ga0207676_10007919
2099 Ga0207676_10032639
2100 Ga0207676_10041790
2101 Ga0207676_10159388
2102 Ga0207676_10175151
2103 Ga0207676_10398658
2104 Ga0207674_10003396
2105 Ga0207674_10003522
2106 Ga0207674_10416422
2107 Ga0207675_100084688
2108 Ga0207675_100207777
2109 Ga0207675_100259118
2110 Ga0207675_100327341
2111 Ga0207675_100362987
2112 Ga0207675_100557414
2113 Ga0207683_10057829
2114 Ga0207683_10081516
2115 Ga0207683_10087107
2116 Ga0207683_10145679
2117 Ga0207683_10152611
2118 Ga0207683_10450535
2119 Ga0207683_10492119
2120 Ga0207698_10057854
2121 Ga0207698_10069312
2122 Ga0207698_10394914
2123 Ga0210000_1017429
2124 Ga0209999_1015149
2125 Ga0209588_1016626
2126 Ga0209588_1036789
2127 Ga0209974_10036009
2128 Ga0209974_10073523
2129 Ga0207428_10000033
2130 Ga0207428_10000435
2131 Ga0207428_10004008
2132 Ga0207428_10009545
2133 Ga0207428_10012546
2134 Ga0207428_10021675
2135 Ga0207428_10111443
2136 Ga0207428_10139690
2137 Ga0265354_1000073
2138 Ga0268266_10000587
2139 Ga0268266_10033791
2140 Ga0268265_10010950
2141 Ga0268265_10011935
2142 Ga0268265_10223774
2143 Ga0268265_10307431
2144 Ga0268264_10025855
2145 Ga0268264_10026177
2146 Ga0268264_10289007
2147 Ga0265319_1002097
2148 Ga0265318_10000420
2149 Ga0265323_10000906
2150 Ga0265323_10007258
2151 Ga0265323_10045981
2152 Ga0265323_10047002
2153 Ga0265322_10000885
2154 Ga0265336_10001709
2155 Ga0265338_10000139
2156 Ga0265338_10003099
2157 Ga0265338_10009300
2158 Ga0265338_10025506
2159 Ga0265338_10033630
2160 Ga0265338_10056841
2161 Ga0265770_1002159
2162 Ga0265330_10025272
2163 Ga0265328_10008223
2164 Ga0265320_10001344
2165 Ga0265320_10031720
2166 Ga0265325_10052872
2167 Ga0265325_10113238
2168 Ga0265329_10000405
2169 Ga0265340_10008053
2170 Ga0265340_10018270
2171 Ga0265339_10000182
2172 Ga0265339_10053495
2173 Ga0265331_10000317
2174 Ga0265331_10000366
2175 Ga0265331_10018808
2176 Ga0265316_10002192
2177 Ga0265316_10008727
2178 Ga0265316_10024251
2179 Ga0265316_10025334
2180 Ga0265316_10045315
2181 Ga0265316_10046649
2182 Ga0265316_10074387
2183 Ga0265316_10088326
2184 Ga0265316_10095040
2185 Ga0265316_10097504
2186 Ga0265316_10189558
2187 Ga0307408_100040504
2188 Ga0307408_100076057
2189 Ga0307408_100133647
2190 Ga0307408_100137991
2191 Ga0307408_100213002
2192 Ga0307408_100216978
2193 Ga0307408_100360712
2194 Ga0265313_10000255
2195 Ga0265313_10002537
2196 Ga0316579_10083524
2197 Ga0265314_10000408
2198 Ga0265314_10083298
2199 Ga0265342_10001004
2200 Ga0265342_10018922
2201 Ga0265342_10030867
2202 Ga0265342_10045070
2203 Ga0316578_10000576
2204 Ga0307405_10052667
2205 Ga0307405_10274282
2206 Ga0307413_10015980
2207 Ga0307413_10090835
2208 Ga0307410_10000584
2209 Ga0307410_10021988
2210 Ga0307410_10027478
2211 Ga0307410_10363650
2212 Ga0307406_10256534
2213 Ga0307407_10007994
2214 Ga0307407_10015484
2215 Ga0307407_10031272
2216 Ga0307407_10182902
2217 Ga0307412_10008811
2218 Ga0307412_10022102
2219 Ga0307412_10043309
2220 Ga0307409_100001963
2221 Ga0307409_100009405
2222 Ga0307409_100170895
2223 Ga0307409_100475203
2224 Ga0307409_100592578
2225 Ga0307416_100002140
2226 Ga0307416_100008530
2227 Ga0307416_100013568
2228 Ga0307416_100022496
2229 Ga0307416_100257865
2230 Ga0307414_10006358
2231 Ga0307414_10015416
2232 Ga0307414_10064531
2233 Ga0307411_10001766
2234 Ga0307411_10006989
2235 Ga0307411_10010855
2236 Ga0307411_10291488
2237 Ga0307411_10325012
2238 Ga0316580_10047029
2239 Ga0316592_1002075
2240 Ga0316592_1007560
2241 Ga0316588_1000364
2242 Ga0316596_1008554
2243 Ga0316212_1000277
2244 Ga0373948_0011441
2245 Ga0373958_0022934
2246 Ga0373959_0002633
2247 Ga0373938_0000411
2248 Ga0373926_0001952
2249 Ga0373926_0017848
2250 Ga0373928_0003168
2251 Ga0373929_0003351
2252 Ga0373934_0010338
2253 Ga0373934_0032053
2254 Ga0373944_0066540
2255 Ga0373951_0001893
2256 Ga0373952_0002290
2257 Ga0373923_0049358
2258 Ga0373923_0115880
2259 Ga0373932_0003415
2260 Ga0373936_0021294
2261 Ga0373936_0032866
2262 Ga0373939_0003135
2263 Ga0373941_0000100
2264 Ga0373945_0005208
2265 Ga0373945_0018312
2266 Ga0373945_0050565
2267 Ga0373953_0005563
2268 Ga0373954_0001733
2269 Ga0373954_0063400
2270 Ga0373954_0070445
2271 Ga0373954_0100924
2272 Ga0373954_0120788
2273 Ga0373956_0005358
2274 Ga0373956_0013358
2275 Ga0373960_0001352
2276 Ga0373943_0057785
2277 Ga0373943_0064135
2278 Ga0373943_0155902
2279 Ga0373946_0001535
2280 Ga0373946_0040845
2281 Ga0373946_0052362
2282 Ga0373946_0082587
2283 Ga0373955_0002172
2284 Ga0373955_0020850
2285 Ga0373955_0066556
2286 Ga0373942_0003366
2287 Ga0373961_0001007
2288 Ga0373961_0047257
2289 Ga0316574_0009468
2290 Ga0373924_0184404
2291 Ga0373931_0000326
2292 Ga0373931_0011882
2293 Ga0373931_0045572
2294 Ga0373935_0007305
2295 Ga0373935_0017708
2296 Ga0373935_0043884
2297 Ga0373935_0083190
2298 Ga0373927_0001044
2299 Ga0373927_0003851
2300 Ga0373927_0007815
2301 Ga0373927_0012069
2302 Ga0373927_0081468
2303 Ga0373927_0133512
2304 Ga0373933_0012932
2305 Ga0373933_0060171
2306 Ga0373933_0118591
2307 Ga0373947_0001564
2308 Ga0373947_0005841
2309 Ga0373947_0006086
2310 Ga0373947_0072097
2311 Ga0373947_0082739
2312 Ga0373947_0167708
2313 Ga0373947_0187721
2314 Ga0373937_0003455
2315 Ga0373937_0021013
2316 Ga0373937_0082047
2317 Ga0373937_0086200
2318 Ga0373937_0088612
2319 Ga0373937_0192094
2320 Ga0373937_0204030
2321 Ga0316582_0007601
2322 Ga0316582_0008317
2323 Ga0316582_0041012
2324 Ga0316582_0163124
2325 Ga0316584_0133075
2326 Ga0373925_0001268
2327 Ga0373925_0006381
2328 Ga0373925_0007445
2329 Ga0373925_0008189
2330 Ga0373925_0033881
2331 Ga0373925_0161693
2332 Ga0373925_0279063
2333 Ga0373925_0389730
2334 Ga0395899_0048870
2335 Ga0395900_0002799
2336 Ga0395900_0032160
2337 Ga0395898_0002991
2338 Ga0395898_0106762
2339 Ga0395898_0209536
2340 Ga0395898_0212131
2341 Ga0395905_0045314
2342 Ga0395905_0157698
2343 Ga0395905_0275876
2344 Ga0395905_0283114
2345 Ga0395905_0308492
2346 Ga0395905_0337999
2347 Ga0316581_0020655
2348 Ga0436364_0302019
2349 Ga0436364_0305504
2350 Ga0436364_1196049
2351 Ga0395901_0000800
2352 Ga0395901_0066875
2353 Ga0395901_0108573
2354 Ga0395901_0432088
2355 Ga0400488_08526
2356 Ga0400483_133231
2357 Ga0436365_0695601
2358 Ga0436365_0701791
2359 Ga0436365_1368230
2360 Ga0436365_1473988
2361 Ga0436365_1711751
2362 Ga0436360_0811333
2363 Ga0436360_1006139
2364 Ga0436361_0831143
2365 Ga0436363_0100449
2366 Ga0451577_0000102
2367 Ga0451577_0000118
2368 Ga0451577_0000158
2369 Ga0451577_0000342
2370 Ga0451577_0000442
2371 Ga0451577_0002894
2372 Ga0451577_0010768
2373 Ga0451577_0010818
2374 Ga0451577_0024537
2375 Ga0451577_0034248
2376 Ga0451577_0047223
2377 Ga0451577_0062738
2378 Ga0451577_0086879
2379 Ga0451577_0109542
2380 Ga0451577_0122691
2381 Ga0451577_0146091
2382 Ga0451577_0148304
2383 Ga0451577_0202057
2384 Ga0451577_0249939
2385 Ga0451577_0475607
2386 Ga0453683_0000001
2387 Ga0453683_0000095
2388 Ga0453683_0000668
2389 Ga0453683_0014218
2390 Ga0453683_0015951
2391 Ga0453683_0061315
2392 Ga0453683_0095561
2393 Ga0453683_0156752
2394 Ga0453684_0000036
2395 Ga0453684_0000089
2396 Ga0453684_0000249
2397 Ga0453684_0000291
2398 Ga0453684_0000416
2399 Ga0453684_0000931
2400 Ga0453684_0001325
2401 Ga0453684_0002093
2402 Ga0453684_0004587
2403 Ga0453684_0010523
2404 Ga0453684_0012461
2405 Ga0453684_0012798
2406 Ga0453684_0016247
2407 Ga0453684_0016452
2408 Ga0453684_0065370
2409 Ga0451576_0000771
2410 Ga0451576_0000986
2411 Ga0451576_0002308
2412 Ga0451576_0004596
2413 Ga0451576_0006456
2414 Ga0451576_0008282
2415 Ga0451576_0010231
2416 Ga0451576_0017793
2417 Ga0451576_0023257
2418 Ga0451576_0048024
2419 Ga0451576_0055948
2420 Ga0451576_0070865
2421 Ga0451576_0076476
2422 Ga0451576_0089845
2423 Ga0451576_0116955
2424 Ga0451576_0132403
2425 Ga0466967_0049862
2426 Ga0495592_0143522
2427 Ga0495603_0078049
2428 Ga0495603_0173644
2429 Ga0495629_0011921
2430 Ga0495629_0186010
2431 Ga0495651_0015055
2432 Ga0495651_0018396
2433 Ga0495651_0048545
2434 Ga0495651_0179708
2435 Ga0495580_0000698
2436 Ga0495580_0000831
2437 Ga0495580_0003043
2438 Ga0495580_0006590
2439 Ga0495580_0048725
2440 Ga0495580_0049783
2441 Ga0495580_0055509
2442 Ga0495580_0085302
2443 Ga0495580_0107202
2444 Ga0495580_0108584
2445 Ga0495580_0130040
2446 Ga0495580_0209793
2447 Ga0495582_0000811
2448 Ga0495582_0038876
2449 Ga0495582_0097234
2450 Ga0495662_0011005
2451 Ga0495664_0006501
2452 Ga0495664_0046463
2453 Ga0495594_0081059
2454 Ga0495594_0101666
2455 Ga0495608_0084278
2456 Ga0495608_0194539
2457 Ga0495618_0001176
2458 Ga0495628_0036251
2459 Ga0495628_0120163
2460 Ga0495628_0166282
2461 Ga0495630_0006727
2462 Ga0495630_0015944
2463 Ga0495643_0001268
2464 Ga0495666_0065298
2465 Ga0495666_0151869
2466 Ga0495642_0011949
2467 Ga0495642_0012097
2468 Ga0495642_0071469
2469 Ga0495652_0064248
2470 Ga0495652_0140811
2471 Ga0495652_0146033
2472 Ga0495652_0155998
2473 Ga0495665_0002806
2474 Ga0495665_0011553
2475 Ga0495665_0034126
2476 Ga0495640_0036676
2477 Ga0495586_0189269
2478 Ga0495587_0000291
2479 Ga0495587_0004247
2480 Ga0495645_0002293
2481 Ga0495645_0009122
2482 Ga0495645_0215593
2483 Ga0495667_0111047
2484 Ga0495656_0107305
2485 Ga0495634_0057461
2486 Ga0495634_0084864
2487 Ga0495634_0117270
2488 Ga0495635_0049638
2489 Ga0495659_0001646
2490 Ga0495659_0003198
2491 Ga0495659_0008101
2492 Ga0495659_0055608
2493 Ga0495659_0076585
2494 Ga0495588_0002473
2495 Ga0495657_0056537
2496 Ga0495599_0265868
2497 Ga0495623_0027851
2498 Ga0495623_0046467
2499 Ga0495658_0115923
2500 Ga0495658_0187190
2501 Ga0495669_0006346
2502 Ga0495669_0027677
2503 Ga0495669_0033700
2504 Ga0495669_0107491
2505 Ga0495669_0121383
2506 Ga0495613_0040442
2507 Ga0495613_0047111
2508 Ga0495670_0087704
2509 Ga0495600_0190977
2510 Ga0495581_0011957
2511 Ga0495581_0156534
2512 Ga0495604_0000768
2513 Ga0495604_0058699
2514 Ga0495636_0013309
2515 Ga0495636_0154209
2516 Ga0495674_0015837
2517 Ga0495674_0072475
2518 Ga0495674_0190786
2519 Ga0495674_0216134
2520 Ga0495674_0299208
2521 Ga0495674_0376766
2522 Ga0495675_0096815
2523 Ga0495675_0125611
2524 Ga0495675_0175636
2525 Ga0495685_026031
2526 Ga0495684_0004863
2527 Ga0495684_0010480
2528 Ga0495684_0124545
2529 Ga0495684_0176314
2530 Ga0495602_0019958
2531 Ga0495602_0110466
2532 Ga0495602_0132025
2533 Ga0496102_0049189
2534 Ga0496102_0089343
2535 Ga0496104_0122186
2536 Ga0496106_0080674
2537 Ga0496106_0374551
2538 Ga0496112_0044478
2539 Ga0496112_0446153
2540 Ga0496115_0021365
2541 Ga0496115_0358937
2542 Ga0501031_0039173
2543 Ga0501031_0272494
2544 Ga0501032_0063690
2545 Ga0501033_0061239
2546 Ga0501034_0022870
2547 Ga0501034_0042270
2548 Ga0501036_0122531
2549 Ga0501036_0221593
2550 Ga0501036_0265424
2551 Ga0501037_0006924
2552 Ga0501038_0062519
2553 Ga0501038_0152414
2554 Ga0501039_0050461
2555 Ga0501039_0154242
2556 Ga0501040_0005078
2557 Ga0501040_0016245
2558 Ga0501040_0023758
2559 Ga0501040_0068659
2560 Ga0501040_0145822
2561 Ga0501040_0176350
2562 Ga0501041_0001270
2563 Ga0501041_0008158
2564 Ga0501041_0084472
2565 Ga0501041_0183194
2566 Ga0501042_0003910
2567 Ga0501042_0048431
2568 Ga0501042_0057710
2569 Ga0501042_0067909
2570 Ga0501042_0167360
2571 Ga0501043_0096769
2572 Ga0501046_0031516
2573 Ga0501046_0131141
2574 Ga0501047_0006159
2575 Ga0501047_0156444
2576 Ga0501048_0031747
2577 Ga0501048_0037562
2578 Ga0501048_0052967
2579 Ga0501048_0140390
2580 Ga0501048_0260464
2581 Ga0501068_0093735
2582 Ga0501069_0157190
2583 Ga0501070_0019276
2584 Ga0501071_0197027
2585 Ga0501072_0007790
2586 Ga0501072_0008017
2587 Ga0501072_0030980
2588 Ga0501072_0121920
2589 Ga0501072_0222403
2590 Ga0501072_0339496
2591 Ga0501073_0069643
2592 Ga0501074_0014004
2593 Ga0501074_0238228
2594 Ga0501075_0001108
2595 Ga0501075_0021880
2596 Ga0501075_0034963
2597 Ga0501075_0045609
2598 Ga0501075_0062522
2599 Ga0501075_0211343
2600 Ga0501076_0003486
2601 Ga0501076_0006788
2602 Ga0501076_0023621
2603 Ga0501076_0028396
2604 Ga0501076_0049874
2605 Ga0501076_0061604
2606 Ga0501077_0007255
2607 Ga0501077_0023722
2608 Ga0501221_007705
2609 Ga0501079_0023210
2610 Ga0501079_0028665
2611 Ga0501079_0056686
2612 Ga0501079_0079882
2613 Ga0501079_0349400
2614 Ga0501079_0350356
2615 Ga0501080_0229356
2616 Ga0501081_0015900
2617 Ga0501081_0032131
2618 Ga0501081_0102764
2619 Ga0501081_0144610
2620 Ga0501083_0021667
2621 Ga0501083_0122590
2622 Ga0501035_0003460
2623 Ga0501035_0128745
2624 Ga0501035_0300864
2625 Ga0501044_0083960
2626 Ga0501044_0152287
2627 Ga0501044_0187224
2628 Ga0501045_0018388
2629 Ga0501045_0049374
2630 Ga0501045_0061868
2631 Ga0501045_0069794
2632 nmdc:mga07m45_165069_c1
2633 nmdc:mga05p37_109553_c1
2634 nmdc:mga05p37_113948_c1
2635 nmdc:mga05p37_119088_c1
2636 nmdc:mga05p37_1238_c1
2637 nmdc:mga05p37_137766_c1
2638 nmdc:mga05p37_141558_c1
2639 nmdc:mga05p37_15576_c1
2640 nmdc:mga05p37_16644_c1
2641 nmdc:mga05p37_170232_c1
2642 nmdc:mga05p37_193544_c1
2643 nmdc:mga05p37_202927_c1
2644 nmdc:mga05p37_208691_c1
2645 nmdc:mga05p37_214193_c1
2646 nmdc:mga05p37_21975_c1
2647 nmdc:mga05p37_23196_c1
2648 nmdc:mga05p37_2826_c1
2649 nmdc:mga05p37_30941_c1
2650 nmdc:mga05p37_35271_c1
2651 nmdc:mga05p37_3828_c1
2652 nmdc:mga05p37_4725_c1
2653 nmdc:mga05p37_507298_c1
2654 nmdc:mga05p37_571_c1
2655 nmdc:mga05p37_7972_c1
2656 nmdc:mga05p37_830350_c1
2657 nmdc:mga05p37_893_c1
2658 nmdc:mga09592_1061_c1
2659 nmdc:mga09592_109088_c1
2660 nmdc:mga09592_124010_c1
2661 nmdc:mga09592_16949_c1
2662 nmdc:mga09592_1842_c1
2663 nmdc:mga09592_263750_c1
2664 nmdc:mga09592_31912_c1
2665 nmdc:mga09592_47811_c1
2666 nmdc:mga09592_9084_c1
2667 nmdc:mga09592_9871_c1
2668 nmdc:mga0qj67_12967_c1
2669 nmdc:mga0qj67_150404_c1
2670 nmdc:mga0qj67_26317_c1
2671 nmdc:mga0qj67_27875_c1
2672 nmdc:mga0qj67_40407_c1
2673 nmdc:mga0qj67_4733_c1
2674 nmdc:mga0qj67_73685_c1
2675 nmdc:mga0qj67_7669_c1
2676 nmdc:mga0qj67_93375_c1
2677 nmdc:mga06r32_133219_c1
2678 nmdc:mga06r32_16916_c1
2679 nmdc:mga06r32_281346_c1
2680 nmdc:mga06r32_28342_c1
2681 nmdc:mga06r32_29558_c1
2682 nmdc:mga06r32_42603_c1
2683 nmdc:mga06r32_44660_c1
2684 nmdc:mga06r32_6384_c1
2685 nmdc:mga06r32_70113_c1
2686 nmdc:mga08y16_12_c1
2687 nmdc:mga08y16_133721_c1
2688 nmdc:mga08y16_19558_c1
2689 nmdc:mga08y16_2054_c1
2690 nmdc:mga08y16_31818_c1
2691 nmdc:mga08y16_37489_c1
2692 nmdc:mga08y16_379934_c1
2693 nmdc:mga08y16_388882_c1
2694 nmdc:mga08y16_41092_c1
2695 nmdc:mga08y16_485231_c1
2696 nmdc:mga08y16_486273_c1
2697 nmdc:mga08y16_5112_c1
2698 nmdc:mga08y16_58013_c1
2699 nmdc:mga08y16_66988_c1
2700 nmdc:mga0n895_118755_c1
2701 nmdc:mga0n895_123259_c1
2702 nmdc:mga0n895_129696_c1
2703 nmdc:mga0n895_132294_c1
2704 nmdc:mga0n895_172066_c1
2705 nmdc:mga0n895_1792_c1
2706 nmdc:mga0n895_202578_c1
2707 nmdc:mga0n895_230479_c1
2708 nmdc:mga0n895_26_c1
2709 nmdc:mga0n895_31169_c1
2710 nmdc:mga0n895_3140_c1
2711 nmdc:mga0n895_38100_c1
2712 nmdc:mga0n895_438309_c1
2713 nmdc:mga0n895_542862_c1
2714 nmdc:mga0n895_69370_c1
2715 nmdc:mga0n895_75583_c1
2716 nmdc:mga0n895_93994_c1
2717 nmdc:mga0rr50_117604_c1
2718 nmdc:mga0rr50_13268_c1
2719 nmdc:mga0rr50_137614_c1
2720 nmdc:mga0rr50_189_c1
2721 nmdc:mga0rr50_206759_c1
2722 nmdc:mga0rr50_24412_c1
2723 nmdc:mga0rr50_381867_c1
2724 nmdc:mga0rr50_4734_c1
2725 nmdc:mga0rr50_5_c1
2726 nmdc:mga0rr50_65136_c1
2727 nmdc:mga0rr50_88017_c1
2728 nmdc:mga0rr50_9409_c1
2729 nmdc:mga0rr50_94521_c1
2730 nmdc:mga08x19_18929_c1
2731 nmdc:mga08x19_193_c1
2732 nmdc:mga08x19_230579_c1
2733 nmdc:mga08x19_28451_c1
2734 nmdc:mga08x19_36038_c1
2735 nmdc:mga08x19_3741_c1
2736 nmdc:mga08x19_39_c1
2737 nmdc:mga08x19_552_c1
2738 nmdc:mga08x19_6051_c1
2739 nmdc:mga08x19_64443_c1
2740 nmdc:mga08x19_67122_c1
2741 nmdc:mga08x19_68796_c1
2742 nmdc:mga08x19_90523_c1
2743 nmdc:mga08x19_935_c1
2744 nmdc:mga0a205_1070_c1
2745 nmdc:mga0a205_157809_c1
2746 nmdc:mga0a205_166707_c1
2747 nmdc:mga0a205_17003_c1
2748 nmdc:mga0a205_17100_c1
2749 nmdc:mga0a205_23132_c1
2750 nmdc:mga0a205_25660_c1
2751 nmdc:mga0a205_27475_c1
2752 nmdc:mga0a205_32_c1
2753 nmdc:mga0a205_334455_c1
2754 nmdc:mga0a205_37839_c2
2755 nmdc:mga0a205_55818_c1
2756 nmdc:mga0a205_619_c1
2757 nmdc:mga0a205_82749_c1
2758 Ga0495612_0022097
2759 Ga0495595_0081047
2760 Ga0495619_0003455
2761 Ga0495619_0027075
2762 Ga0495619_0224215
2763 Ga0501084_0004255
2764 Ga0501084_0010571
2765 Ga0501084_0014550
2766 Ga0501084_0071702
2767 Ga0501084_0182648
2768 Ga0590071_000237
2769 Ga0590074_000404
2770 Ga0590075_000952
2771 Ga0590075_005099
2772 Ga0590075_025889
2773 Ga0590077_000214
2774 Ga0590077_000432
2775 Ga0501082_0000531
2776 Ga0501082_0002871
2777 Ga0501082_0048346
2778 Ga0501082_0404830
2779 Ga0530510_0007391
2780 Ga0530510_0024893
2781 Ga0530510_0046708
2782 Ga0530510_0090267
2783 Ga0530510_0219396
2784 2687234418
2785 2688069808
2786 2920109424

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

279

375

0.95

PF16285

DUF4931_N

Domain of unknown function (DUF4931) N-terminal domain

169

249

0.9

PF02744

GalP_UDP_tr_C

Galactose-1-phosphate uridyl transferase, C-terminal domain

256

394

0.87

PF01087

GalP_UDP_transf

Galactose-1-phosphate uridyl transferase, N-terminal domain

66

250

0.82

PF16268

DUF4921

Domain of unknown function (DUF4921)

176

404

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zwj-assembly1.cif.gz_A x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 0.9224 8 336
2h39-assembly1.cif.gz_A crystal structure of an adp-glucose phosphorylase from arabidopsis thaliana with bound adp-glucose 0.9175 7 336
1z84-assembly1.cif.gz_B x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 0.9149 6 336
1zwj-assembly1.cif.gz_B x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 0.9098 6 336
1zwj-assembly1.cif.gz_A x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 0.9076 8 336
ID Description Score Start End Superfamily
af_I1MNU2_183_339_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9618 182 339 3.30.428.10
af_I1MNU2_183_339_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9439 182 339 3.30.428.10
af_Q79FY3_3_179_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9364 177 336 3.30.428.10
1gupA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9307 182 335 3.30.428.10
1hxpB01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9138 178 335 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7C4DIP9-F1-model_v4 Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) 0.9922 127 336 GO:0006012
GO:0008108
GO:0008270
AF-A0A7C3XUM2-F1-model_v4 Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) 0.9918 46 336 GO:0006012
GO:0008108
GO:0008270
AF-A0A849Y824-F1-model_v4 DUF4931 domain-containing protein 0.9889 44 339 GO:0006012
GO:0008108
GO:0008270
AF-A0A0F9IPU9-F1-model_v4 HIT domain-containing protein 0.9884 80 336 GO:0006012
GO:0008108
GO:0008270
AF-A0A7X1ZLL9-F1-model_v4 Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) 0.9878 80 314 GO:0006012
GO:0008108
GO:0008270

Map