F493607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1393 | 480 | 2786 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1073152|Ga0265337_10731521 |
| Length | 218 |
| Sequence | MGLWLRGLPGVPITGAGFCEIHEPAKDDVTTMGSETRKNVEGTIFLVLFCLTVPTANWMLEHVGTVCPHNGPCLVPVAPGVMAPSGVLLIGAALVLRDLVQRRLGVEFGIGAILAGALISAAFSPGSLVLASASAFLVSEFTDFAVYTPLARRRLVLAVVASGVAGLVVDSIVFLWLAFGSLDFLVGQIVGKLWMVLLAIPLVAYLRRRDERLGLTPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 147 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 148 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 149 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 165 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 258 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 265 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 272 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 280 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 284 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 289 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 297 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 309 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 310 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 311 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 312 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 313 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 406 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 407 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 446 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 447 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 467 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 468 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 469 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 470 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 472 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 478 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 479 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 480 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.07 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 0.22 |
| Rhizoplane | 8.69 |
| Rhizosphere | 86.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265337_1073152 | 3300028556 | Bacteria | 941 |
| 2 | 2214745219 | 2209111006 | Bacteria | 14065 |
| 3 | ARSoilYngRDRAFT_c00268 | 3300000042 | Bacteria | 7919 |
| 4 | ARcpr5yngRDRAFT_c000083 | 3300000043 | Bacteria | 15543 |
| 5 | ARcpr5yngRDRAFT_c000130 | 3300000043 | Bacteria | 11824 |
| 6 | ARSoilOldRDRAFT_c000077 | 3300000044 | Bacteria | 18706 |
| 7 | ARCol0oldRDRAFT_c00092 | 3300000045 | Bacteria | 7574 |
| 8 | ARCol0yngRDRAFT_1000003 | 3300000652 | Bacteria | 53041 |
| 9 | JGI24032J14994_100580 | 3300001430 | Bacteria | 1910 |
| 10 | JGI24736J21556_1009077 | 3300001904 | Bacteria | 1645 |
| 11 | JGI24741J21665_1031641 | 3300001915 | Unclassified | 791 |
| 12 | JGI24752J21851_1002641 | 3300001976 | Bacteria | 2383 |
| 13 | JGI24739J22299_10002161 | 3300001989 | Bacteria | 7538 |
| 14 | JGI24739J22299_10035227 | 3300001989 | Bacteria | 1698 |
| 15 | JGI24737J22298_10002605 | 3300001990 | Bacteria | 6382 |
| 16 | JGI24737J22298_10004159 | 3300001990 | Bacteria | 5058 |
| 17 | JGI24743J22301_10012659 | 3300001991 | Bacteria | 1538 |
| 18 | JGI24750J21931_1000256 | 3300002070 | Bacteria | 9041 |
| 19 | JGI24750J21931_1012825 | 3300002070 | Bacteria | 1115 |
| 20 | JGI24745J21846_1000134 | 3300002073 | Bacteria | 5697 |
| 21 | JGI24748J21848_1000381 | 3300002074 | Bacteria | 5024 |
| 22 | JGI24738J21930_10000425 | 3300002075 | Bacteria | 11873 |
| 23 | JGI24749J21850_1002375 | 3300002076 | Bacteria | 2649 |
| 24 | JGI24744J21845_10006961 | 3300002077 | Bacteria | 2336 |
| 25 | JGI24035J26624_1000030 | 3300002126 | Bacteria | 10265 |
| 26 | JGI24742J22300_10005249 | 3300002244 | Bacteria | 2129 |
| 27 | Ga0065716_1001562 | 3300005277 | Bacteria | 6533 |
| 28 | Ga0065704_10136145 | 3300005289 | Bacteria | 1569 |
| 29 | Ga0065712_10000247 | 3300005290 | Bacteria | 16703 |
| 30 | Ga0065712_10069581 | 3300005290 | Bacteria | 7025 |
| 31 | Ga0065712_10086250 | 3300005290 | Bacteria | 2563 |
| 32 | Ga0065715_10008812 | 3300005293 | Bacteria | 6635 |
| 33 | Ga0070658_10170892 | 3300005327 | Bacteria | 1826 |
| 34 | Ga0070658_10889140 | 3300005327 | Bacteria | 774 |
| 35 | Ga0070676_10000036 | 3300005328 | Bacteria | 40368 |
| 36 | Ga0070676_10018948 | 3300005328 | Bacteria | 3822 |
| 37 | Ga0070676_10517690 | 3300005328 | Bacteria | 849 |
| 38 | Ga0070683_100002049 | 3300005329 | Bacteria | 15883 |
| 39 | Ga0070683_100148974 | 3300005329 | Bacteria | 2218 |
| 40 | Ga0070690_100000402 | 3300005330 | Bacteria | 21886 |
| 41 | Ga0070690_100011862 | 3300005330 | Bacteria | 5114 |
| 42 | Ga0070690_100372751 | 3300005330 | Bacteria | 1042 |
| 43 | Ga0070670_100003778 | 3300005331 | Bacteria | 12606 |
| 44 | Ga0070670_100043329 | 3300005331 | Bacteria | 3869 |
| 45 | Ga0070670_100364312 | 3300005331 | Bacteria | 1271 |
| 46 | Ga0070670_100595565 | 3300005331 | Bacteria | 989 |
| 47 | Ga0070670_101127509 | 3300005331 | Bacteria | 716 |
| 48 | Ga0070677_10000104 | 3300005333 | Bacteria | 27953 |
| 49 | Ga0070677_10066484 | 3300005333 | Bacteria | 1503 |
| 50 | Ga0068869_100000087 | 3300005334 | Bacteria | 42211 |
| 51 | Ga0068869_100276540 | 3300005334 | Bacteria | 1349 |
| 52 | Ga0070666_10014755 | 3300005335 | Bacteria | 4978 |
| 53 | Ga0070666_10019207 | 3300005335 | Bacteria | 4408 |
| 54 | Ga0070666_10109098 | 3300005335 | Bacteria | 1913 |
| 55 | Ga0070680_100003276 | 3300005336 | Bacteria | 12068 |
| 56 | Ga0070680_100014863 | 3300005336 | Bacteria | 6090 |
| 57 | Ga0070680_100095640 | 3300005336 | Bacteria | 2463 |
| 58 | Ga0070680_100177020 | 3300005336 | Bacteria | 1796 |
| 59 | Ga0070680_100231949 | 3300005336 | Bacteria | 1559 |
| 60 | Ga0070680_100495362 | 3300005336 | Bacteria | 1045 |
| 61 | Ga0070682_100000341 | 3300005337 | Bacteria | 32124 |
| 62 | Ga0070682_100049518 | 3300005337 | Bacteria | 2619 |
| 63 | Ga0070682_100055051 | 3300005337 | Bacteria | 2498 |
| 64 | Ga0070682_100102988 | 3300005337 | Bacteria | 1888 |
| 65 | Ga0070682_100802027 | 3300005337 | Unclassified | 765 |
| 66 | Ga0068868_100019047 | 3300005338 | Bacteria | 5138 |
| 67 | Ga0068868_100025389 | 3300005338 | Bacteria | 4508 |
| 68 | Ga0068868_100060002 | 3300005338 | Bacteria | 3010 |
| 69 | Ga0068868_100199902 | 3300005338 | Bacteria | 1666 |
| 70 | Ga0068868_100221219 | 3300005338 | Bacteria | 1585 |
| 71 | Ga0070660_100010783 | 3300005339 | Bacteria | 6469 |
| 72 | Ga0070660_100290416 | 3300005339 | Bacteria | 1339 |
| 73 | Ga0070660_100916569 | 3300005339 | Bacteria | 739 |
| 74 | Ga0070689_100002790 | 3300005340 | Bacteria | 11470 |
| 75 | Ga0070689_100015611 | 3300005340 | Bacteria | 5542 |
| 76 | Ga0070689_100020143 | 3300005340 | Bacteria | 4946 |
| 77 | Ga0070689_100038629 | 3300005340 | Bacteria | 3653 |
| 78 | Ga0070689_100916368 | 3300005340 | Bacteria | 776 |
| 79 | Ga0070691_10000518 | 3300005341 | Bacteria | 14537 |
| 80 | Ga0070687_100003185 | 3300005343 | Bacteria | 6337 |
| 81 | Ga0070687_100121740 | 3300005343 | Bacteria | 1493 |
| 82 | Ga0070687_100227625 | 3300005343 | Bacteria | 1146 |
| 83 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 84 | Ga0070692_10003914 | 3300005345 | Bacteria | 6140 |
| 85 | Ga0070692_10008342 | 3300005345 | Bacteria | 4618 |
| 86 | Ga0070692_10017545 | 3300005345 | Bacteria | 3425 |
| 87 | Ga0070668_100001356 | 3300005347 | Bacteria | 17522 |
| 88 | Ga0070668_100024267 | 3300005347 | Bacteria | 4592 |
| 89 | Ga0070668_100390334 | 3300005347 | Bacteria | 1186 |
| 90 | Ga0070668_101190619 | 3300005347 | Unclassified | 690 |
| 91 | Ga0070669_100000217 | 3300005353 | Bacteria | 47833 |
| 92 | Ga0070669_100020733 | 3300005353 | Bacteria | 4696 |
| 93 | Ga0070669_100038543 | 3300005353 | Bacteria | 3470 |
| 94 | Ga0070669_100401675 | 3300005353 | Bacteria | 1121 |
| 95 | Ga0070669_100631587 | 3300005353 | Bacteria | 899 |
| 96 | Ga0070675_100000088 | 3300005354 | Bacteria | 53698 |
| 97 | Ga0070675_100083481 | 3300005354 | Bacteria | 2667 |
| 98 | Ga0070675_100355553 | 3300005354 | Bacteria | 1300 |
| 99 | Ga0070675_100371770 | 3300005354 | Bacteria | 1271 |
| 100 | Ga0070671_100000768 | 3300005355 | Bacteria | 23064 |
| 101 | Ga0070671_100009332 | 3300005355 | Bacteria | 7877 |
| 102 | Ga0070671_100051153 | 3300005355 | Bacteria | 3436 |
| 103 | Ga0070671_100063167 | 3300005355 | Bacteria | 3083 |
| 104 | Ga0070674_100000623 | 3300005356 | Bacteria | 17847 |
| 105 | Ga0070674_100142650 | 3300005356 | Bacteria | 1799 |
| 106 | Ga0070674_100886731 | 3300005356 | Bacteria | 776 |
| 107 | Ga0070673_100000239 | 3300005364 | Bacteria | 27611 |
| 108 | Ga0070673_100246369 | 3300005364 | Bacteria | 1556 |
| 109 | Ga0070688_100000084 | 3300005365 | Bacteria | 47194 |
| 110 | Ga0070688_100051206 | 3300005365 | Bacteria | 2576 |
| 111 | Ga0070688_100055447 | 3300005365 | Bacteria | 2485 |
| 112 | Ga0070688_100060447 | 3300005365 | Bacteria | 2392 |
| 113 | Ga0070688_100150674 | 3300005365 | Bacteria | 1589 |
| 114 | Ga0070688_100340644 | 3300005365 | Bacteria | 1095 |
| 115 | Ga0070659_100000252 | 3300005366 | Bacteria | 42278 |
| 116 | Ga0070659_100078449 | 3300005366 | Bacteria | 2635 |
| 117 | Ga0070667_100003023 | 3300005367 | Bacteria | 14455 |
| 118 | Ga0070667_100073477 | 3300005367 | Bacteria | 2916 |
| 119 | Ga0070667_100095412 | 3300005367 | Bacteria | 2564 |
| 120 | Ga0070667_100324028 | 3300005367 | Bacteria | 1391 |
| 121 | Ga0070667_100463445 | 3300005367 | Bacteria | 1159 |
| 122 | Ga0070703_10082766 | 3300005406 | Bacteria | 1097 |
| 123 | Ga0070709_10000855 | 3300005434 | Bacteria | 17027 |
| 124 | Ga0070709_10019494 | 3300005434 | Bacteria | 3923 |
| 125 | Ga0070709_10385576 | 3300005434 | Bacteria | 1043 |
| 126 | Ga0070709_10679134 | 3300005434 | Bacteria | 800 |
| 127 | Ga0070709_11140377 | 3300005434 | Bacteria | 625 |
| 128 | Ga0070714_100027442 | 3300005435 | Bacteria | 4716 |
| 129 | Ga0070714_100155351 | 3300005435 | Bacteria | 2065 |
| 130 | Ga0070714_100282856 | 3300005435 | Bacteria | 1542 |
| 131 | Ga0070713_100002359 | 3300005436 | Bacteria | 12318 |
| 132 | Ga0070713_100004066 | 3300005436 | Bacteria | 9738 |
| 133 | Ga0070713_100028260 | 3300005436 | Bacteria | 4427 |
| 134 | Ga0070713_100028319 | 3300005436 | Bacteria | 4423 |
| 135 | Ga0070713_100293816 | 3300005436 | Bacteria | 1494 |
| 136 | Ga0070713_100332468 | 3300005436 | Bacteria | 1406 |
| 137 | Ga0070710_10003385 | 3300005437 | Bacteria | 7554 |
| 138 | Ga0070710_10005726 | 3300005437 | Bacteria | 5915 |
| 139 | Ga0070710_10010156 | 3300005437 | Bacteria | 4620 |
| 140 | Ga0070701_10010531 | 3300005438 | Bacteria | 4091 |
| 141 | Ga0070701_10021527 | 3300005438 | Bacteria | 3080 |
| 142 | Ga0070701_10077963 | 3300005438 | Bacteria | 1787 |
| 143 | Ga0070701_10167933 | 3300005438 | Bacteria | 1276 |
| 144 | Ga0070711_100048712 | 3300005439 | Bacteria | 2899 |
| 145 | Ga0070711_100049571 | 3300005439 | Bacteria | 2876 |
| 146 | Ga0070711_100163935 | 3300005439 | Bacteria | 1687 |
| 147 | Ga0070711_100239142 | 3300005439 | Bacteria | 1419 |
| 148 | Ga0070711_100436722 | 3300005439 | Bacteria | 1069 |
| 149 | Ga0070711_100531250 | 3300005439 | Bacteria | 974 |
| 150 | Ga0070705_100000425 | 3300005440 | Bacteria | 24231 |
| 151 | Ga0070705_100138476 | 3300005440 | Bacteria | 1599 |
| 152 | Ga0070705_100175418 | 3300005440 | Bacteria | 1447 |
| 153 | Ga0070705_100552977 | 3300005440 | Bacteria | 883 |
| 154 | Ga0070700_100000370 | 3300005441 | Bacteria | 23064 |
| 155 | Ga0070694_100000401 | 3300005444 | Bacteria | 23534 |
| 156 | Ga0070694_100039756 | 3300005444 | Bacteria | 3134 |
| 157 | Ga0070708_100004439 | 3300005445 | Bacteria | 11027 |
| 158 | Ga0070663_100000415 | 3300005455 | Bacteria | 22408 |
| 159 | Ga0070663_100064097 | 3300005455 | Bacteria | 2655 |
| 160 | Ga0070663_100110725 | 3300005455 | Bacteria | 2063 |
| 161 | Ga0070678_100000053 | 3300005456 | Bacteria | 40418 |
| 162 | Ga0070678_100026479 | 3300005456 | Bacteria | 3921 |
| 163 | Ga0070662_100003931 | 3300005457 | Bacteria | 9321 |
| 164 | Ga0070662_100008216 | 3300005457 | Bacteria | 6797 |
| 165 | Ga0070662_100042716 | 3300005457 | Bacteria | 3239 |
| 166 | Ga0070662_100371112 | 3300005457 | Bacteria | 1176 |
| 167 | Ga0070681_10000493 | 3300005458 | Bacteria | 32198 |
| 168 | Ga0070681_10004194 | 3300005458 | Bacteria | 13656 |
| 169 | Ga0070681_10051048 | 3300005458 | Bacteria | 4125 |
| 170 | Ga0070681_10191691 | 3300005458 | Bacteria | 1964 |
| 171 | Ga0070681_10652738 | 3300005458 | Bacteria | 967 |
| 172 | Ga0070681_10721152 | 3300005458 | Bacteria | 913 |
| 173 | Ga0068867_100001581 | 3300005459 | Bacteria | 15837 |
| 174 | Ga0068867_100341265 | 3300005459 | Bacteria | 1247 |
| 175 | Ga0070685_10002253 | 3300005466 | Bacteria | 9952 |
| 176 | Ga0070685_10054089 | 3300005466 | Bacteria | 2328 |
| 177 | Ga0070685_10363514 | 3300005466 | Bacteria | 993 |
| 178 | Ga0070707_100473347 | 3300005468 | Bacteria | 1214 |
| 179 | Ga0070707_100514385 | 3300005468 | Bacteria | 1159 |
| 180 | Ga0070699_100238999 | 3300005518 | Bacteria | 1621 |
| 181 | Ga0070699_100833602 | 3300005518 | Bacteria | 844 |
| 182 | Ga0070679_100000679 | 3300005530 | Bacteria | 29087 |
| 183 | Ga0070679_100009527 | 3300005530 | Bacteria | 9187 |
| 184 | Ga0070679_100117175 | 3300005530 | Bacteria | 2648 |
| 185 | Ga0070679_100533222 | 3300005530 | Bacteria | 1118 |
| 186 | Ga0070679_100770342 | 3300005530 | Bacteria | 905 |
| 187 | Ga0070679_100783630 | 3300005530 | Bacteria | 896 |
| 188 | Ga0070679_100801946 | 3300005530 | Bacteria | 885 |
| 189 | Ga0070679_100827510 | 3300005530 | Bacteria | 869 |
| 190 | Ga0070684_100000144 | 3300005535 | Bacteria | 47665 |
| 191 | Ga0070684_100019502 | 3300005535 | Bacteria | 5611 |
| 192 | Ga0070684_100182845 | 3300005535 | Bacteria | 1906 |
| 193 | Ga0070684_100243601 | 3300005535 | Bacteria | 1643 |
| 194 | Ga0070697_100007453 | 3300005536 | Bacteria | 8518 |
| 195 | Ga0070697_100107999 | 3300005536 | Bacteria | 2316 |
| 196 | Ga0068853_100005864 | 3300005539 | Bacteria | 9680 |
| 197 | Ga0068853_100274899 | 3300005539 | Bacteria | 1552 |
| 198 | Ga0068853_100376611 | 3300005539 | Bacteria | 1325 |
| 199 | Ga0068853_101180286 | 3300005539 | Bacteria | 739 |
| 200 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 201 | Ga0070672_100081221 | 3300005543 | Bacteria | 2599 |
| 202 | Ga0070686_100002767 | 3300005544 | Bacteria | 9659 |
| 203 | Ga0070686_100004823 | 3300005544 | Bacteria | 7445 |
| 204 | Ga0070686_100022707 | 3300005544 | Bacteria | 3740 |
| 205 | Ga0070695_100000743 | 3300005545 | Bacteria | 17429 |
| 206 | Ga0070695_100016812 | 3300005545 | Bacteria | 4432 |
| 207 | Ga0070695_100057992 | 3300005545 | Bacteria | 2503 |
| 208 | Ga0070696_100000918 | 3300005546 | Bacteria | 19157 |
| 209 | Ga0070696_100042514 | 3300005546 | Bacteria | 3141 |
| 210 | Ga0070696_100158961 | 3300005546 | Bacteria | 1664 |
| 211 | Ga0070696_100855961 | 3300005546 | Bacteria | 752 |
| 212 | Ga0070693_100000141 | 3300005547 | Bacteria | 32426 |
| 213 | Ga0070693_100046083 | 3300005547 | Bacteria | 2474 |
| 214 | Ga0070693_100049958 | 3300005547 | Bacteria | 2389 |
| 215 | Ga0070693_100524810 | 3300005547 | Bacteria | 844 |
| 216 | Ga0070665_100142534 | 3300005548 | Bacteria | 2400 |
| 217 | Ga0070665_100164036 | 3300005548 | Bacteria | 2224 |
| 218 | Ga0070665_100211546 | 3300005548 | Bacteria | 1940 |
| 219 | Ga0070665_100731487 | 3300005548 | Unclassified | 1002 |
| 220 | Ga0070704_100018885 | 3300005549 | Bacteria | 4420 |
| 221 | Ga0070704_100027667 | 3300005549 | Bacteria | 3763 |
| 222 | Ga0070704_100176643 | 3300005549 | Bacteria | 1704 |
| 223 | Ga0070704_100303129 | 3300005549 | Bacteria | 1332 |
| 224 | Ga0068855_100009106 | 3300005563 | Bacteria | 11994 |
| 225 | Ga0068855_100116787 | 3300005563 | Bacteria | 3058 |
| 226 | Ga0068855_100495601 | 3300005563 | Bacteria | 1328 |
| 227 | Ga0068855_101402648 | 3300005563 | Bacteria | 720 |
| 228 | Ga0070664_100000816 | 3300005564 | Bacteria | 23970 |
| 229 | Ga0070664_100010078 | 3300005564 | Bacteria | 7661 |
| 230 | Ga0070664_100124438 | 3300005564 | Bacteria | 2260 |
| 231 | Ga0070664_100353180 | 3300005564 | Bacteria | 1338 |
| 232 | Ga0070664_100499401 | 3300005564 | Bacteria | 1121 |
| 233 | Ga0070664_101091374 | 3300005564 | Bacteria | 751 |
| 234 | Ga0068857_100000567 | 3300005577 | Bacteria | 26993 |
| 235 | Ga0068857_100218374 | 3300005577 | Bacteria | 1741 |
| 236 | Ga0068857_100259124 | 3300005577 | Bacteria | 1596 |
| 237 | Ga0068854_100000168 | 3300005578 | Bacteria | 44522 |
| 238 | Ga0068854_100012177 | 3300005578 | Bacteria | 5629 |
| 239 | Ga0068854_100080084 | 3300005578 | Bacteria | 2410 |
| 240 | Ga0068856_100000932 | 3300005614 | Bacteria | 31354 |
| 241 | Ga0068856_100186409 | 3300005614 | Bacteria | 2089 |
| 242 | Ga0068856_100412317 | 3300005614 | Bacteria | 1371 |
| 243 | Ga0068856_100530563 | 3300005614 | Unclassified | 1198 |
| 244 | Ga0070702_100000857 | 3300005615 | Bacteria | 11750 |
| 245 | Ga0070702_100009999 | 3300005615 | Bacteria | 4657 |
| 246 | Ga0070702_100090498 | 3300005615 | Bacteria | 1855 |
| 247 | Ga0070702_100118062 | 3300005615 | Bacteria | 1656 |
| 248 | Ga0068852_100002066 | 3300005616 | Bacteria | 13707 |
| 249 | Ga0068852_100045878 | 3300005616 | Bacteria | 3720 |
| 250 | Ga0068852_100814987 | 3300005616 | Bacteria | 948 |
| 251 | Ga0068859_100012990 | 3300005617 | Bacteria | 8367 |
| 252 | Ga0068859_100089849 | 3300005617 | Bacteria | 3122 |
| 253 | Ga0068859_100096223 | 3300005617 | Bacteria | 3014 |
| 254 | Ga0068859_100135079 | 3300005617 | Bacteria | 2539 |
| 255 | Ga0068859_100187426 | 3300005617 | Bacteria | 2153 |
| 256 | Ga0068859_100641823 | 3300005617 | Bacteria | 1154 |
| 257 | Ga0068864_100000980 | 3300005618 | Bacteria | 23924 |
| 258 | Ga0068864_100012023 | 3300005618 | Bacteria | 7148 |
| 259 | Ga0068864_100036853 | 3300005618 | Bacteria | 4170 |
| 260 | Ga0068864_100216411 | 3300005618 | Bacteria | 1766 |
| 261 | Ga0068866_10000264 | 3300005718 | Bacteria | 24776 |
| 262 | Ga0068861_100000315 | 3300005719 | Bacteria | 27094 |
| 263 | Ga0068861_100012399 | 3300005719 | Bacteria | 5945 |
| 264 | Ga0068851_10164085 | 3300005834 | Bacteria | 1222 |
| 265 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 266 | Ga0068863_100001290 | 3300005841 | Bacteria | 25007 |
| 267 | Ga0068863_100009966 | 3300005841 | Bacteria | 9251 |
| 268 | Ga0068863_100950809 | 3300005841 | Bacteria | 861 |
| 269 | Ga0068858_100000356 | 3300005842 | Bacteria | 48189 |
| 270 | Ga0068858_100008336 | 3300005842 | Bacteria | 9972 |
| 271 | Ga0068858_100147954 | 3300005842 | Bacteria | 2207 |
| 272 | Ga0068858_100226555 | 3300005842 | Bacteria | 1771 |
| 273 | Ga0068860_100000747 | 3300005843 | Bacteria | 36976 |
| 274 | Ga0068860_100012816 | 3300005843 | Bacteria | 8242 |
| 275 | Ga0068860_100037658 | 3300005843 | Bacteria | 4630 |
| 276 | Ga0068860_100086784 | 3300005843 | Bacteria | 2978 |
| 277 | Ga0068860_100124678 | 3300005843 | Bacteria | 2469 |
| 278 | Ga0068860_100136158 | 3300005843 | Bacteria | 2359 |
| 279 | Ga0068862_100020195 | 3300005844 | Bacteria | 5563 |
| 280 | Ga0068862_100037959 | 3300005844 | Bacteria | 4084 |
| 281 | Ga0068862_100115302 | 3300005844 | Bacteria | 2362 |
| 282 | Ga0068862_100178430 | 3300005844 | Bacteria | 1905 |
| 283 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 284 | Ga0081455_10000664 | 3300005937 | Bacteria | 44581 |
| 285 | Ga0081455_10004941 | 3300005937 | Bacteria | 14738 |
| 286 | Ga0081455_10014914 | 3300005937 | Bacteria | 7574 |
| 287 | Ga0081455_10094609 | 3300005937 | Bacteria | 2413 |
| 288 | Ga0081455_10308739 | 3300005937 | Bacteria | 1131 |
| 289 | Ga0081540_1012959 | 3300005983 | Bacteria | 5448 |
| 290 | Ga0070717_10000150 | 3300006028 | Bacteria | 51802 |
| 291 | Ga0070717_10009878 | 3300006028 | Bacteria | 7187 |
| 292 | Ga0070717_10088122 | 3300006028 | Bacteria | 2615 |
| 293 | Ga0070717_10230589 | 3300006028 | Bacteria | 1630 |
| 294 | Ga0070717_10250796 | 3300006028 | Bacteria | 1564 |
| 295 | Ga0070717_10624320 | 3300006028 | Bacteria | 978 |
| 296 | Ga0075365_10002448 | 3300006038 | Bacteria | 9108 |
| 297 | Ga0075365_10036248 | 3300006038 | Bacteria | 3195 |
| 298 | Ga0075365_10067547 | 3300006038 | Bacteria | 2400 |
| 299 | Ga0075365_10203384 | 3300006038 | Bacteria | 1388 |
| 300 | Ga0075368_10009470 | 3300006042 | Bacteria | 3503 |
| 301 | Ga0075368_10229286 | 3300006042 | Bacteria | 790 |
| 302 | Ga0075363_100073339 | 3300006048 | Bacteria | 1862 |
| 303 | Ga0075363_100289601 | 3300006048 | Bacteria | 949 |
| 304 | Ga0075363_100314400 | 3300006048 | Bacteria | 910 |
| 305 | Ga0075364_10140177 | 3300006051 | Bacteria | 1626 |
| 306 | Ga0075364_10275776 | 3300006051 | Bacteria | 1144 |
| 307 | Ga0075432_10010169 | 3300006058 | Bacteria | 3193 |
| 308 | Ga0070715_10001585 | 3300006163 | Bacteria | 6694 |
| 309 | Ga0070715_10004724 | 3300006163 | Bacteria | 4501 |
| 310 | Ga0070715_10074547 | 3300006163 | Bacteria | 1525 |
| 311 | Ga0070715_10580149 | 3300006163 | Bacteria | 654 |
| 312 | Ga0070716_100035826 | 3300006173 | Bacteria | 2731 |
| 313 | Ga0070716_100077474 | 3300006173 | Bacteria | 1973 |
| 314 | Ga0070712_100010775 | 3300006175 | Bacteria | 5779 |
| 315 | Ga0070712_100053540 | 3300006175 | Bacteria | 2818 |
| 316 | Ga0070712_100119662 | 3300006175 | Bacteria | 1979 |
| 317 | Ga0075362_10073018 | 3300006177 | Bacteria | 1570 |
| 318 | Ga0075367_10011389 | 3300006178 | Bacteria | 4703 |
| 319 | Ga0075367_10012917 | 3300006178 | Bacteria | 4474 |
| 320 | Ga0075367_10171380 | 3300006178 | Bacteria | 1352 |
| 321 | Ga0075367_10294419 | 3300006178 | Bacteria | 1021 |
| 322 | Ga0075369_10028730 | 3300006186 | Bacteria | 2332 |
| 323 | Ga0075366_10086498 | 3300006195 | Bacteria | 1875 |
| 324 | Ga0075366_10214012 | 3300006195 | Bacteria | 1173 |
| 325 | Ga0075366_10249666 | 3300006195 | Bacteria | 1082 |
| 326 | Ga0075366_10310131 | 3300006195 | Bacteria | 966 |
| 327 | Ga0097621_100000144 | 3300006237 | Bacteria | 43169 |
| 328 | Ga0097621_100100059 | 3300006237 | Bacteria | 2438 |
| 329 | Ga0097621_100215118 | 3300006237 | Bacteria | 1673 |
| 330 | Ga0097621_100588697 | 3300006237 | Bacteria | 1016 |
| 331 | Ga0075370_10224751 | 3300006353 | Bacteria | 1110 |
| 332 | Ga0075370_10484879 | 3300006353 | Bacteria | 745 |
| 333 | Ga0068871_100000110 | 3300006358 | Bacteria | 49756 |
| 334 | Ga0068871_100018783 | 3300006358 | Bacteria | 5265 |
| 335 | Ga0068871_100144775 | 3300006358 | Bacteria | 2022 |
| 336 | Ga0068871_100487910 | 3300006358 | Bacteria | 1109 |
| 337 | Ga0075428_100005798 | 3300006844 | Bacteria | 13717 |
| 338 | Ga0075428_100031464 | 3300006844 | Bacteria | 5864 |
| 339 | Ga0075428_100234676 | 3300006844 | Bacteria | 1979 |
| 340 | Ga0075428_100871418 | 3300006844 | Bacteria | 956 |
| 341 | Ga0075430_100000627 | 3300006846 | Bacteria | 26908 |
| 342 | Ga0075430_100001224 | 3300006846 | Bacteria | 20647 |
| 343 | Ga0075430_100177708 | 3300006846 | Bacteria | 1771 |
| 344 | Ga0075431_100004676 | 3300006847 | Bacteria | 13440 |
| 345 | Ga0075431_100148367 | 3300006847 | Bacteria | 2416 |
| 346 | Ga0075431_100429820 | 3300006847 | Bacteria | 1319 |
| 347 | Ga0075433_10000615 | 3300006852 | Bacteria | 23766 |
| 348 | Ga0075433_10127836 | 3300006852 | Bacteria | 2257 |
| 349 | Ga0075433_10180242 | 3300006852 | Bacteria | 1880 |
| 350 | Ga0075433_10187026 | 3300006852 | Bacteria | 1843 |
| 351 | Ga0075433_10237603 | 3300006852 | Bacteria | 1618 |
| 352 | Ga0075433_10264156 | 3300006852 | Bacteria | 1525 |
| 353 | Ga0075433_10606688 | 3300006852 | Bacteria | 961 |
| 354 | Ga0075434_100000084 | 3300006871 | Bacteria | 50928 |
| 355 | Ga0075434_100011350 | 3300006871 | Bacteria | 8399 |
| 356 | Ga0075434_100077423 | 3300006871 | Bacteria | 3320 |
| 357 | Ga0075434_100084703 | 3300006871 | Bacteria | 3169 |
| 358 | Ga0075434_100163511 | 3300006871 | Bacteria | 2246 |
| 359 | Ga0075434_100216920 | 3300006871 | Bacteria | 1933 |
| 360 | Ga0075434_100265184 | 3300006871 | Bacteria | 1737 |
| 361 | Ga0075434_100524731 | 3300006871 | Bacteria | 1205 |
| 362 | Ga0075434_101030072 | 3300006871 | Bacteria | 837 |
| 363 | Ga0075429_100000877 | 3300006880 | Bacteria | 23746 |
| 364 | Ga0075429_100055477 | 3300006880 | Bacteria | 3447 |
| 365 | Ga0075429_100061051 | 3300006880 | Bacteria | 3283 |
| 366 | Ga0068865_100000066 | 3300006881 | Bacteria | 54564 |
| 367 | Ga0068865_100120679 | 3300006881 | Bacteria | 1949 |
| 368 | Ga0068865_100144822 | 3300006881 | Bacteria | 1796 |
| 369 | Ga0068865_100158837 | 3300006881 | Bacteria | 1722 |
| 370 | Ga0068865_100285756 | 3300006881 | Bacteria | 1315 |
| 371 | Ga0075436_100003795 | 3300006914 | Bacteria | 10364 |
| 372 | Ga0075436_100177044 | 3300006914 | Bacteria | 1507 |
| 373 | Ga0075436_100550516 | 3300006914 | Unclassified | 847 |
| 374 | Ga0075436_100721531 | 3300006914 | Unclassified | 739 |
| 375 | Ga0097620_100012990 | 3300006931 | Bacteria | 8367 |
| 376 | Ga0097620_100089847 | 3300006931 | Bacteria | 3122 |
| 377 | Ga0097620_100096221 | 3300006931 | Bacteria | 3014 |
| 378 | Ga0097620_100135073 | 3300006931 | Bacteria | 2539 |
| 379 | Ga0097620_100187433 | 3300006931 | Bacteria | 2153 |
| 380 | Ga0097620_100641891 | 3300006931 | Bacteria | 1154 |
| 381 | Ga0075435_100018081 | 3300007076 | Bacteria | 5350 |
| 382 | Ga0075435_100078801 | 3300007076 | Bacteria | 2703 |
| 383 | Ga0075435_100224133 | 3300007076 | Bacteria | 1597 |
| 384 | Ga0075435_100324960 | 3300007076 | Bacteria | 1317 |
| 385 | Ga0075435_100902142 | 3300007076 | Unclassified | 771 |
| 386 | Ga0099794_10004157 | 3300007265 | Bacteria | 5642 |
| 387 | Ga0105251_10034792 | 3300009011 | Bacteria | 2490 |
| 388 | Ga0105244_10073449 | 3300009036 | Bacteria | 1702 |
| 389 | Ga0105250_10082372 | 3300009092 | Bacteria | 1305 |
| 390 | Ga0105240_10038616 | 3300009093 | Bacteria | 6122 |
| 391 | Ga0111539_10000423 | 3300009094 | Bacteria | 53050 |
| 392 | Ga0111539_10000652 | 3300009094 | Bacteria | 44828 |
| 393 | Ga0111539_10001255 | 3300009094 | Bacteria | 33804 |
| 394 | Ga0111539_10030559 | 3300009094 | Bacteria | 6546 |
| 395 | Ga0111539_11463397 | 3300009094 | Bacteria | 792 |
| 396 | Ga0105245_10000287 | 3300009098 | Bacteria | 48204 |
| 397 | Ga0105245_10051645 | 3300009098 | Bacteria | 3685 |
| 398 | Ga0105247_10001223 | 3300009101 | Bacteria | 19057 |
| 399 | Ga0105247_10013098 | 3300009101 | Bacteria | 4974 |
| 400 | Ga0105247_10073847 | 3300009101 | Bacteria | 2138 |
| 401 | Ga0105247_10078939 | 3300009101 | Bacteria | 2071 |
| 402 | Ga0105247_10106407 | 3300009101 | Bacteria | 1799 |
| 403 | Ga0114129_10003089 | 3300009147 | Bacteria | 23361 |
| 404 | Ga0114129_10005652 | 3300009147 | Bacteria | 17703 |
| 405 | Ga0114129_10077475 | 3300009147 | Bacteria | 4624 |
| 406 | Ga0114129_10148603 | 3300009147 | Unclassified | 3208 |
| 407 | Ga0114129_10610271 | 3300009147 | Bacteria | 1412 |
| 408 | Ga0105243_10000695 | 3300009148 | Bacteria | 32613 |
| 409 | Ga0105243_10003814 | 3300009148 | Bacteria | 12061 |
| 410 | Ga0105243_10061492 | 3300009148 | Bacteria | 3004 |
| 411 | Ga0105243_10230434 | 3300009148 | Bacteria | 1643 |
| 412 | Ga0105243_11245403 | 3300009148 | Bacteria | 759 |
| 413 | Ga0105241_10002331 | 3300009174 | Bacteria | 14262 |
| 414 | Ga0105241_10048155 | 3300009174 | Bacteria | 3243 |
| 415 | Ga0105241_10072270 | 3300009174 | Bacteria | 2680 |
| 416 | Ga0105241_10299163 | 3300009174 | Bacteria | 1380 |
| 417 | Ga0105242_10000792 | 3300009176 | Bacteria | 24525 |
| 418 | Ga0105242_10018593 | 3300009176 | Bacteria | 5436 |
| 419 | Ga0105242_10054721 | 3300009176 | Bacteria | 3262 |
| 420 | Ga0105242_10150904 | 3300009176 | Bacteria | 2026 |
| 421 | Ga0105242_10427289 | 3300009176 | Bacteria | 1243 |
| 422 | Ga0105248_10000535 | 3300009177 | Bacteria | 43210 |
| 423 | Ga0105248_10038316 | 3300009177 | Bacteria | 5364 |
| 424 | Ga0105248_10076310 | 3300009177 | Bacteria | 3767 |
| 425 | Ga0105248_10140470 | 3300009177 | Bacteria | 2725 |
| 426 | Ga0105248_10240170 | 3300009177 | Bacteria | 2039 |
| 427 | Ga0105248_10353030 | 3300009177 | Bacteria | 1655 |
| 428 | Ga0105237_10002795 | 3300009545 | Bacteria | 21203 |
| 429 | Ga0105237_10018807 | 3300009545 | Bacteria | 7145 |
| 430 | Ga0105237_10067802 | 3300009545 | Bacteria | 3562 |
| 431 | Ga0105238_10155544 | 3300009551 | Bacteria | 2262 |
| 432 | Ga0105249_10000279 | 3300009553 | Bacteria | 53594 |
| 433 | Ga0105249_10003839 | 3300009553 | Bacteria | 12962 |
| 434 | Ga0105249_10268577 | 3300009553 | Bacteria | 1698 |
| 435 | Ga0105249_10619499 | 3300009553 | Bacteria | 1138 |
| 436 | Ga0105239_10001686 | 3300010375 | Bacteria | 29130 |
| 437 | Ga0105239_10161900 | 3300010375 | Bacteria | 2500 |
| 438 | Ga0105239_10497614 | 3300010375 | Bacteria | 1386 |
| 439 | Ga0105239_11163342 | 3300010375 | Bacteria | 889 |
| 440 | Ga0105246_10000095 | 3300011119 | Bacteria | 38417 |
| 441 | Ga0105246_10207203 | 3300011119 | Bacteria | 1528 |
| 442 | Ga0105246_10265856 | 3300011119 | Bacteria | 1369 |
| 443 | Ga0105246_10369344 | 3300011119 | Bacteria | 1181 |
| 444 | Ga0105246_10545677 | 3300011119 | Bacteria | 992 |
| 445 | Ga0157328_1003476 | 3300012478 | Bacteria | 825 |
| 446 | Ga0157343_1003390 | 3300012488 | Bacteria | 931 |
| 447 | Ga0157322_1003278 | 3300012490 | Bacteria | 980 |
| 448 | Ga0157335_1000591 | 3300012492 | Bacteria | 1708 |
| 449 | Ga0157373_10050116 | 3300013100 | Bacteria | 2974 |
| 450 | Ga0157373_10274703 | 3300013100 | Bacteria | 1193 |
| 451 | Ga0157370_10526656 | 3300013104 | Bacteria | 1084 |
| 452 | Ga0157369_10751324 | 3300013105 | Bacteria | 1003 |
| 453 | Ga0157374_10001348 | 3300013296 | Bacteria | 20895 |
| 454 | Ga0157374_10023716 | 3300013296 | Bacteria | 5492 |
| 455 | Ga0157374_10048326 | 3300013296 | Bacteria | 3947 |
| 456 | Ga0157374_10545847 | 3300013296 | Bacteria | 1166 |
| 457 | Ga0157378_10000956 | 3300013297 | Bacteria | 26502 |
| 458 | Ga0157378_10096068 | 3300013297 | Bacteria | 2700 |
| 459 | Ga0157378_10151228 | 3300013297 | Bacteria | 2163 |
| 460 | Ga0157378_10183606 | 3300013297 | Bacteria | 1969 |
| 461 | Ga0163162_10003795 | 3300013306 | Bacteria | 14493 |
| 462 | Ga0163162_10043114 | 3300013306 | Bacteria | 4517 |
| 463 | Ga0163162_10120769 | 3300013306 | Bacteria | 2725 |
| 464 | Ga0163162_10135319 | 3300013306 | Bacteria | 2575 |
| 465 | Ga0163162_11162687 | 3300013306 | Bacteria | 875 |
| 466 | Ga0157372_10009222 | 3300013307 | Bacteria | 10491 |
| 467 | Ga0157375_10001973 | 3300013308 | Bacteria | 17692 |
| 468 | Ga0157375_10014988 | 3300013308 | Bacteria | 6932 |
| 469 | Ga0157375_10348543 | 3300013308 | Bacteria | 1647 |
| 470 | Ga0157375_10355202 | 3300013308 | Bacteria | 1632 |
| 471 | Ga0157375_10980502 | 3300013308 | Bacteria | 986 |
| 472 | Ga0157375_11104255 | 3300013308 | Bacteria | 928 |
| 473 | Ga0163163_10030456 | 3300014325 | Bacteria | 5199 |
| 474 | Ga0163163_10043566 | 3300014325 | Bacteria | 4400 |
| 475 | Ga0163163_10343523 | 3300014325 | Bacteria | 1548 |
| 476 | Ga0163163_10368245 | 3300014325 | Bacteria | 1494 |
| 477 | Ga0163163_10462006 | 3300014325 | Bacteria | 1330 |
| 478 | Ga0163163_11298437 | 3300014325 | Bacteria | 790 |
| 479 | Ga0157380_10000052 | 3300014326 | Bacteria | 67030 |
| 480 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 481 | Ga0157377_10001911 | 3300014745 | Bacteria | 9115 |
| 482 | Ga0157377_10145717 | 3300014745 | Bacteria | 1459 |
| 483 | Ga0157379_10000060 | 3300014968 | Bacteria | 69312 |
| 484 | Ga0157379_10007831 | 3300014968 | Bacteria | 9252 |
| 485 | Ga0157379_10096282 | 3300014968 | Bacteria | 2656 |
| 486 | Ga0157379_10278776 | 3300014968 | Bacteria | 1521 |
| 487 | Ga0157379_10283564 | 3300014968 | Bacteria | 1507 |
| 488 | Ga0157379_10889628 | 3300014968 | Bacteria | 844 |
| 489 | Ga0157376_10000141 | 3300014969 | Bacteria | 49288 |
| 490 | Ga0157376_10154115 | 3300014969 | Bacteria | 2075 |
| 491 | Ga0157376_10393683 | 3300014969 | Bacteria | 1338 |
| 492 | Ga0157376_10671948 | 3300014969 | Bacteria | 1038 |
| 493 | Ga0163161_10000739 | 3300017792 | Bacteria | 25660 |
| 494 | Ga0163161_10213178 | 3300017792 | Bacteria | 1493 |
| 495 | Ga0213872_10033977 | 3300021361 | Bacteria | 2336 |
| 496 | Ga0207666_1000005 | 3300025271 | Bacteria | 54011 |
| 497 | Ga0207666_1010786 | 3300025271 | Bacteria | 1255 |
| 498 | Ga0207673_1000002 | 3300025290 | Bacteria | 18299 |
| 499 | Ga0209025_1004253 | 3300025294 | Bacteria | 12601 |
| 500 | Ga0209025_1061468 | 3300025294 | Bacteria | 1402 |
| 501 | Ga0207426_1060773 | 3300025302 | Bacteria | 1087 |
| 502 | Ga0207697_10000011 | 3300025315 | Bacteria | 65035 |
| 503 | Ga0207697_10005761 | 3300025315 | Bacteria | 5710 |
| 504 | Ga0207697_10114206 | 3300025315 | Bacteria | 1158 |
| 505 | Ga0207656_10098667 | 3300025321 | Bacteria | 1336 |
| 506 | Ga0207656_10201255 | 3300025321 | Bacteria | 962 |
| 507 | Ga0207713_1067930 | 3300025735 | Bacteria | 1327 |
| 508 | Ga0207653_10013990 | 3300025885 | Bacteria | 2515 |
| 509 | Ga0207682_10000051 | 3300025893 | Bacteria | 49249 |
| 510 | Ga0207682_10073811 | 3300025893 | Bacteria | 1449 |
| 511 | Ga0207692_10001465 | 3300025898 | Bacteria | 8838 |
| 512 | Ga0207692_10012868 | 3300025898 | Bacteria | 3609 |
| 513 | Ga0207692_10014564 | 3300025898 | Bacteria | 3439 |
| 514 | Ga0207692_10030425 | 3300025898 | Bacteria | 2575 |
| 515 | Ga0207642_10000176 | 3300025899 | Bacteria | 18394 |
| 516 | Ga0207642_10006839 | 3300025899 | Bacteria | 3816 |
| 517 | Ga0207642_10237429 | 3300025899 | Bacteria | 1027 |
| 518 | Ga0207710_10001284 | 3300025900 | Bacteria | 12696 |
| 519 | Ga0207710_10056174 | 3300025900 | Bacteria | 1776 |
| 520 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 521 | Ga0207688_10002053 | 3300025901 | Bacteria | 10820 |
| 522 | Ga0207688_10045448 | 3300025901 | Bacteria | 2450 |
| 523 | Ga0207688_10203022 | 3300025901 | Bacteria | 1189 |
| 524 | Ga0207680_10002846 | 3300025903 | Bacteria | 8110 |
| 525 | Ga0207680_10112541 | 3300025903 | Bacteria | 1768 |
| 526 | Ga0207647_10001714 | 3300025904 | Bacteria | 16833 |
| 527 | Ga0207647_10018964 | 3300025904 | Bacteria | 4634 |
| 528 | Ga0207647_10037247 | 3300025904 | Bacteria | 3085 |
| 529 | Ga0207685_10003993 | 3300025905 | Bacteria | 3679 |
| 530 | Ga0207685_10103676 | 3300025905 | Bacteria | 1221 |
| 531 | Ga0207699_10001161 | 3300025906 | Bacteria | 12456 |
| 532 | Ga0207699_10008926 | 3300025906 | Bacteria | 4970 |
| 533 | Ga0207699_10142591 | 3300025906 | Bacteria | 1576 |
| 534 | Ga0207699_10532169 | 3300025906 | Unclassified | 851 |
| 535 | Ga0207645_10000121 | 3300025907 | Bacteria | 58999 |
| 536 | Ga0207645_10023007 | 3300025907 | Bacteria | 4050 |
| 537 | Ga0207645_10057479 | 3300025907 | Bacteria | 2483 |
| 538 | Ga0207645_10127211 | 3300025907 | Bacteria | 1657 |
| 539 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 540 | Ga0207643_10012102 | 3300025908 | Bacteria | 4662 |
| 541 | Ga0207705_10194821 | 3300025909 | Bacteria | 1534 |
| 542 | Ga0207684_10521990 | 3300025910 | Bacteria | 1017 |
| 543 | Ga0207654_10001894 | 3300025911 | Bacteria | 10849 |
| 544 | Ga0207654_10121809 | 3300025911 | Bacteria | 1639 |
| 545 | Ga0207707_10000840 | 3300025912 | Bacteria | 30189 |
| 546 | Ga0207707_10140061 | 3300025912 | Bacteria | 2115 |
| 547 | Ga0207707_10443319 | 3300025912 | Bacteria | 1111 |
| 548 | Ga0207695_10535660 | 3300025913 | Bacteria | 1052 |
| 549 | Ga0207671_10007485 | 3300025914 | Bacteria | 9471 |
| 550 | Ga0207671_10078861 | 3300025914 | Bacteria | 2467 |
| 551 | Ga0207671_10180223 | 3300025914 | Bacteria | 1644 |
| 552 | Ga0207693_10025810 | 3300025915 | Bacteria | 4655 |
| 553 | Ga0207693_10038907 | 3300025915 | Bacteria | 3744 |
| 554 | Ga0207693_10040439 | 3300025915 | Bacteria | 3672 |
| 555 | Ga0207693_10078860 | 3300025915 | Bacteria | 2577 |
| 556 | Ga0207693_10295908 | 3300025915 | Bacteria | 1268 |
| 557 | Ga0207663_10005694 | 3300025916 | Bacteria | 6303 |
| 558 | Ga0207663_10051011 | 3300025916 | Bacteria | 2574 |
| 559 | Ga0207663_10108833 | 3300025916 | Bacteria | 1877 |
| 560 | Ga0207663_10157529 | 3300025916 | Bacteria | 1599 |
| 561 | Ga0207663_10170786 | 3300025916 | Bacteria | 1544 |
| 562 | Ga0207663_10222951 | 3300025916 | Bacteria | 1373 |
| 563 | Ga0207660_10000775 | 3300025917 | Bacteria | 21240 |
| 564 | Ga0207660_10018073 | 3300025917 | Bacteria | 4696 |
| 565 | Ga0207660_10028511 | 3300025917 | Bacteria | 3819 |
| 566 | Ga0207660_10225066 | 3300025917 | Bacteria | 1473 |
| 567 | Ga0207662_10002044 | 3300025918 | Bacteria | 9986 |
| 568 | Ga0207662_10004796 | 3300025918 | Bacteria | 7148 |
| 569 | Ga0207662_10178398 | 3300025918 | Bacteria | 1366 |
| 570 | Ga0207662_10250135 | 3300025918 | Bacteria | 1163 |
| 571 | Ga0207657_10002826 | 3300025919 | Bacteria | 18663 |
| 572 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 573 | Ga0207649_10050592 | 3300025920 | Bacteria | 2571 |
| 574 | Ga0207649_10064835 | 3300025920 | Bacteria | 2311 |
| 575 | Ga0207649_10523078 | 3300025920 | Bacteria | 905 |
| 576 | Ga0207652_10000508 | 3300025921 | Bacteria | 39568 |
| 577 | Ga0207652_10151038 | 3300025921 | Bacteria | 2080 |
| 578 | Ga0207652_10309318 | 3300025921 | Bacteria | 1426 |
| 579 | Ga0207652_11079573 | 3300025921 | Bacteria | 703 |
| 580 | Ga0207646_10324433 | 3300025922 | Bacteria | 1391 |
| 581 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 582 | Ga0207681_10064800 | 3300025923 | Bacteria | 2524 |
| 583 | Ga0207681_10200602 | 3300025923 | Bacteria | 1532 |
| 584 | Ga0207694_10063243 | 3300025924 | Bacteria | 2883 |
| 585 | Ga0207650_10000843 | 3300025925 | Bacteria | 23231 |
| 586 | Ga0207650_10014221 | 3300025925 | Bacteria | 5528 |
| 587 | Ga0207650_10121689 | 3300025925 | Bacteria | 2033 |
| 588 | Ga0207650_10157767 | 3300025925 | Bacteria | 1795 |
| 589 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 590 | Ga0207659_10034538 | 3300025926 | Bacteria | 3488 |
| 591 | Ga0207659_10135830 | 3300025926 | Bacteria | 1903 |
| 592 | Ga0207659_10300663 | 3300025926 | Bacteria | 1318 |
| 593 | Ga0207659_10508672 | 3300025926 | Bacteria | 1020 |
| 594 | Ga0207687_10000231 | 3300025927 | Bacteria | 38087 |
| 595 | Ga0207687_10211876 | 3300025927 | Bacteria | 1520 |
| 596 | Ga0207687_10514438 | 3300025927 | Bacteria | 1001 |
| 597 | Ga0207700_10000917 | 3300025928 | Bacteria | 16892 |
| 598 | Ga0207700_10011686 | 3300025928 | Bacteria | 5613 |
| 599 | Ga0207664_10020580 | 3300025929 | Bacteria | 4893 |
| 600 | Ga0207644_10000676 | 3300025931 | Bacteria | 21510 |
| 601 | Ga0207644_10001814 | 3300025931 | Bacteria | 13865 |
| 602 | Ga0207644_10043827 | 3300025931 | Bacteria | 3176 |
| 603 | Ga0207644_10054673 | 3300025931 | Bacteria | 2876 |
| 604 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 605 | Ga0207690_10116101 | 3300025932 | Bacteria | 1936 |
| 606 | Ga0207690_10120447 | 3300025932 | Bacteria | 1905 |
| 607 | Ga0207706_10000261 | 3300025933 | Bacteria | 57530 |
| 608 | Ga0207706_10004416 | 3300025933 | Bacteria | 13214 |
| 609 | Ga0207706_10009549 | 3300025933 | Bacteria | 8908 |
| 610 | Ga0207706_10021020 | 3300025933 | Bacteria | 5863 |
| 611 | Ga0207686_10000171 | 3300025934 | Bacteria | 49624 |
| 612 | Ga0207686_10013538 | 3300025934 | Bacteria | 4515 |
| 613 | Ga0207686_10020728 | 3300025934 | Bacteria | 3760 |
| 614 | Ga0207686_10451846 | 3300025934 | Bacteria | 988 |
| 615 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 616 | Ga0207709_10025934 | 3300025935 | Bacteria | 3361 |
| 617 | Ga0207709_10129415 | 3300025935 | Bacteria | 1718 |
| 618 | Ga0207709_10153199 | 3300025935 | Bacteria | 1599 |
| 619 | Ga0207670_10000169 | 3300025936 | Bacteria | 43470 |
| 620 | Ga0207670_10002052 | 3300025936 | Bacteria | 10560 |
| 621 | Ga0207670_10142574 | 3300025936 | Bacteria | 1768 |
| 622 | Ga0207670_10165003 | 3300025936 | Bacteria | 1657 |
| 623 | Ga0207669_10000351 | 3300025937 | Bacteria | 20924 |
| 624 | Ga0207669_10573935 | 3300025937 | Bacteria | 913 |
| 625 | Ga0207704_10000134 | 3300025938 | Bacteria | 40098 |
| 626 | Ga0207665_10000333 | 3300025939 | Bacteria | 32450 |
| 627 | Ga0207665_10016226 | 3300025939 | Bacteria | 4890 |
| 628 | Ga0207691_10000106 | 3300025940 | Bacteria | 74290 |
| 629 | Ga0207691_10003240 | 3300025940 | Bacteria | 15858 |
| 630 | Ga0207691_10067921 | 3300025940 | Bacteria | 3222 |
| 631 | Ga0207711_10002556 | 3300025941 | Bacteria | 16214 |
| 632 | Ga0207711_10032985 | 3300025941 | Bacteria | 4379 |
| 633 | Ga0207711_10069613 | 3300025941 | Bacteria | 3051 |
| 634 | Ga0207711_10081860 | 3300025941 | Bacteria | 2821 |
| 635 | Ga0207711_10156741 | 3300025941 | Bacteria | 2058 |
| 636 | Ga0207711_10195645 | 3300025941 | Bacteria | 1844 |
| 637 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 638 | Ga0207689_10004674 | 3300025942 | Bacteria | 12360 |
| 639 | Ga0207689_10082593 | 3300025942 | Bacteria | 2641 |
| 640 | Ga0207689_10362319 | 3300025942 | Bacteria | 1206 |
| 641 | Ga0207661_10000219 | 3300025944 | Bacteria | 37298 |
| 642 | Ga0207661_10035787 | 3300025944 | Bacteria | 3872 |
| 643 | Ga0207679_10000493 | 3300025945 | Bacteria | 27242 |
| 644 | Ga0207679_10104199 | 3300025945 | Bacteria | 2225 |
| 645 | Ga0207679_10127031 | 3300025945 | Bacteria | 2039 |
| 646 | Ga0207679_10188150 | 3300025945 | Bacteria | 1714 |
| 647 | Ga0207667_10006216 | 3300025949 | Bacteria | 14494 |
| 648 | Ga0207667_10480892 | 3300025949 | Bacteria | 1261 |
| 649 | Ga0207651_10001402 | 3300025960 | Bacteria | 10939 |
| 650 | Ga0207651_10018651 | 3300025960 | Bacteria | 4136 |
| 651 | Ga0207651_10028266 | 3300025960 | Bacteria | 3535 |
| 652 | Ga0207651_10443064 | 3300025960 | Bacteria | 1113 |
| 653 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 654 | Ga0207712_10007977 | 3300025961 | Bacteria | 6691 |
| 655 | Ga0207712_10103777 | 3300025961 | Bacteria | 2119 |
| 656 | Ga0207668_10000191 | 3300025972 | Bacteria | 41901 |
| 657 | Ga0207668_10371088 | 3300025972 | Bacteria | 1202 |
| 658 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 659 | Ga0207640_10006059 | 3300025981 | Bacteria | 6608 |
| 660 | Ga0207640_10076121 | 3300025981 | Bacteria | 2277 |
| 661 | Ga0207658_10007487 | 3300025986 | Bacteria | 7438 |
| 662 | Ga0207658_10016720 | 3300025986 | Bacteria | 5049 |
| 663 | Ga0207658_10017640 | 3300025986 | Bacteria | 4922 |
| 664 | Ga0207658_10402159 | 3300025986 | Bacteria | 1204 |
| 665 | Ga0207677_10008205 | 3300026023 | Bacteria | 5817 |
| 666 | Ga0207677_10008615 | 3300026023 | Bacteria | 5710 |
| 667 | Ga0207677_10068840 | 3300026023 | Bacteria | 2486 |
| 668 | Ga0207703_10006871 | 3300026035 | Bacteria | 9061 |
| 669 | Ga0207703_10061608 | 3300026035 | Bacteria | 3072 |
| 670 | Ga0207703_10099815 | 3300026035 | Bacteria | 2458 |
| 671 | Ga0207639_10000515 | 3300026041 | Bacteria | 26655 |
| 672 | Ga0207639_10672891 | 3300026041 | Bacteria | 959 |
| 673 | Ga0207639_11333974 | 3300026041 | Bacteria | 673 |
| 674 | Ga0207678_10000137 | 3300026067 | Bacteria | 60700 |
| 675 | Ga0207678_10036253 | 3300026067 | Bacteria | 4293 |
| 676 | Ga0207678_10051389 | 3300026067 | Bacteria | 3558 |
| 677 | Ga0207678_10113973 | 3300026067 | Bacteria | 2307 |
| 678 | Ga0207678_10121219 | 3300026067 | Bacteria | 2232 |
| 679 | Ga0207678_10268819 | 3300026067 | Bacteria | 1462 |
| 680 | Ga0207708_10000250 | 3300026075 | Bacteria | 42228 |
| 681 | Ga0207708_10004315 | 3300026075 | Bacteria | 10470 |
| 682 | Ga0207708_10030828 | 3300026075 | Bacteria | 4067 |
| 683 | Ga0207708_10127005 | 3300026075 | Bacteria | 1991 |
| 684 | Ga0207702_10001067 | 3300026078 | Bacteria | 28056 |
| 685 | Ga0207702_10094267 | 3300026078 | Bacteria | 2627 |
| 686 | Ga0207702_10436146 | 3300026078 | Bacteria | 1269 |
| 687 | Ga0207702_10464148 | 3300026078 | Bacteria | 1230 |
| 688 | Ga0207702_10793372 | 3300026078 | Bacteria | 936 |
| 689 | Ga0207641_10000937 | 3300026088 | Bacteria | 30095 |
| 690 | Ga0207641_10160534 | 3300026088 | Bacteria | 2043 |
| 691 | Ga0207648_10000125 | 3300026089 | Bacteria | 75547 |
| 692 | Ga0207648_10012120 | 3300026089 | Bacteria | 8085 |
| 693 | Ga0207648_10041484 | 3300026089 | Bacteria | 4040 |
| 694 | Ga0207676_10001547 | 3300026095 | Bacteria | 16966 |
| 695 | Ga0207676_10007864 | 3300026095 | Bacteria | 7582 |
| 696 | Ga0207676_10099568 | 3300026095 | Bacteria | 2406 |
| 697 | Ga0207676_10745053 | 3300026095 | Bacteria | 952 |
| 698 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 699 | Ga0207674_10134399 | 3300026116 | Bacteria | 2436 |
| 700 | Ga0207675_100000140 | 3300026118 | Bacteria | 62058 |
| 701 | Ga0207675_100010129 | 3300026118 | Bacteria | 8834 |
| 702 | Ga0207675_100069049 | 3300026118 | Bacteria | 3303 |
| 703 | Ga0207683_10000178 | 3300026121 | Bacteria | 54648 |
| 704 | Ga0207683_10001447 | 3300026121 | Bacteria | 21461 |
| 705 | Ga0207683_10006604 | 3300026121 | Bacteria | 9927 |
| 706 | Ga0207683_10012980 | 3300026121 | Bacteria | 7113 |
| 707 | Ga0207683_10085601 | 3300026121 | Bacteria | 2802 |
| 708 | Ga0207683_10838065 | 3300026121 | Bacteria | 854 |
| 709 | Ga0207698_10001736 | 3300026142 | Bacteria | 12713 |
| 710 | Ga0207698_10026726 | 3300026142 | Bacteria | 4086 |
| 711 | Ga0207698_10133730 | 3300026142 | Bacteria | 2124 |
| 712 | Ga0209973_1030935 | 3300027252 | Bacteria | 754 |
| 713 | Ga0210002_1000669 | 3300027617 | Bacteria | 4628 |
| 714 | Ga0209983_1001836 | 3300027665 | Bacteria | 4720 |
| 715 | Ga0209971_1004192 | 3300027682 | Bacteria | 3420 |
| 716 | Ga0209966_1001385 | 3300027695 | Bacteria | 4240 |
| 717 | Ga0209998_10003015 | 3300027717 | Bacteria | 3745 |
| 718 | Ga0209813_10044685 | 3300027866 | Bacteria | 1362 |
| 719 | Ga0209974_10001253 | 3300027876 | Bacteria | 9106 |
| 720 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 721 | Ga0207428_10000188 | 3300027907 | Bacteria | 85820 |
| 722 | Ga0207428_10001468 | 3300027907 | Bacteria | 24676 |
| 723 | Ga0268266_10020121 | 3300028379 | Bacteria | 5689 |
| 724 | Ga0268266_10056797 | 3300028379 | Bacteria | 3367 |
| 725 | Ga0268265_10000774 | 3300028380 | Bacteria | 30835 |
| 726 | Ga0268265_10036525 | 3300028380 | Bacteria | 3599 |
| 727 | Ga0268265_10293144 | 3300028380 | Bacteria | 1461 |
| 728 | Ga0268264_10000467 | 3300028381 | Bacteria | 54925 |
| 729 | Ga0268264_10028546 | 3300028381 | Bacteria | 4564 |
| 730 | Ga0268264_10097079 | 3300028381 | Bacteria | 2554 |
| 731 | Ga0268264_10611062 | 3300028381 | Bacteria | 1075 |
| 732 | Ga0265338_10056007 | 3300028800 | Bacteria | 3501 |
| 733 | Ga0265760_10047690 | 3300031090 | Bacteria | 1287 |
| 734 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 735 | Ga0265325_10048465 | 3300031241 | Bacteria | 2196 |
| 736 | Ga0265325_10066017 | 3300031241 | Bacteria | 1825 |
| 737 | Ga0265325_10190376 | 3300031241 | Bacteria | 951 |
| 738 | Ga0265340_10000678 | 3300031247 | Bacteria | 19097 |
| 739 | Ga0265339_10000024 | 3300031249 | Bacteria | 169774 |
| 740 | Ga0265339_10009168 | 3300031249 | Bacteria | 6242 |
| 741 | Ga0265331_10008186 | 3300031250 | Bacteria | 5962 |
| 742 | Ga0265316_10080236 | 3300031344 | Bacteria | 2503 |
| 743 | Ga0307408_100353519 | 3300031548 | Bacteria | 1248 |
| 744 | Ga0307408_100946749 | 3300031548 | Bacteria | 791 |
| 745 | Ga0265313_10000006 | 3300031595 | Bacteria | 183184 |
| 746 | Ga0265313_10005135 | 3300031595 | Bacteria | 9745 |
| 747 | Ga0265313_10032825 | 3300031595 | Bacteria | 2645 |
| 748 | Ga0265313_10042538 | 3300031595 | Bacteria | 2230 |
| 749 | Ga0316575_10035256 | 3300031665 | Bacteria | 1966 |
| 750 | Ga0316575_10036030 | 3300031665 | Bacteria | 1946 |
| 751 | Ga0265314_10002604 | 3300031711 | Bacteria | 18249 |
| 752 | Ga0265314_10013825 | 3300031711 | Bacteria | 6499 |
| 753 | Ga0265314_10268610 | 3300031711 | Bacteria | 970 |
| 754 | Ga0265342_10000137 | 3300031712 | Bacteria | 81963 |
| 755 | Ga0265342_10218497 | 3300031712 | Bacteria | 1028 |
| 756 | Ga0316578_10040741 | 3300031728 | Bacteria | 2687 |
| 757 | Ga0307413_10395073 | 3300031824 | Bacteria | 1082 |
| 758 | Ga0316583_10001781 | 3300032133 | Bacteria | 7315 |
| 759 | Ga0373930_0000027 | 3300034816 | Bacteria | 13519 |
| 760 | Ga0373930_0000968 | 3300034816 | Bacteria | 4114 |
| 761 | Ga0373948_0000257 | 3300034817 | Bacteria | 6391 |
| 762 | Ga0373948_0010562 | 3300034817 | Bacteria | 1615 |
| 763 | Ga0373950_0004246 | 3300034818 | Bacteria | 2089 |
| 764 | Ga0373958_0000466 | 3300034819 | Bacteria | 4954 |
| 765 | Ga0373958_0023071 | 3300034819 | Bacteria | 1168 |
| 766 | Ga0373958_0044846 | 3300034819 | Bacteria | 916 |
| 767 | Ga0373959_0000673 | 3300034820 | Bacteria | 5847 |
| 768 | Ga0373959_0005008 | 3300034820 | Bacteria | 2163 |
| 769 | Ga0373959_0033130 | 3300034820 | Bacteria | 1053 |
| 770 | Ga0373959_0061399 | 3300034820 | Bacteria | 832 |
| 771 | Ga0373938_0000020 | 3300034957 | Bacteria | 20855 |
| 772 | Ga0373938_0000687 | 3300034957 | Bacteria | 5457 |
| 773 | Ga0373938_0027235 | 3300034957 | Bacteria | 1201 |
| 774 | Ga0373938_0072251 | 3300034957 | Bacteria | 827 |
| 775 | Ga0373926_0006729 | 3300035083 | Bacteria | 3818 |
| 776 | Ga0373926_0060964 | 3300035083 | Bacteria | 1375 |
| 777 | Ga0373928_0000298 | 3300035084 | Bacteria | 9863 |
| 778 | Ga0373928_0035620 | 3300035084 | Bacteria | 1122 |
| 779 | Ga0373929_0001530 | 3300035085 | Bacteria | 4394 |
| 780 | Ga0373929_0004695 | 3300035085 | Bacteria | 2449 |
| 781 | Ga0373934_0044489 | 3300035086 | Bacteria | 1755 |
| 782 | Ga0373934_0125899 | 3300035086 | Bacteria | 1043 |
| 783 | Ga0373934_0149144 | 3300035086 | Bacteria | 957 |
| 784 | Ga0373940_0000080 | 3300035088 | Bacteria | 11517 |
| 785 | Ga0373940_0002752 | 3300035088 | Bacteria | 3478 |
| 786 | Ga0373944_0007398 | 3300035089 | Bacteria | 2944 |
| 787 | Ga0373944_0010337 | 3300035089 | Bacteria | 2542 |
| 788 | Ga0373944_0031157 | 3300035089 | Bacteria | 1603 |
| 789 | Ga0373944_0053999 | 3300035089 | Bacteria | 1273 |
| 790 | Ga0373944_0183739 | 3300035089 | Bacteria | 751 |
| 791 | Ga0373949_0000753 | 3300035090 | Bacteria | 10447 |
| 792 | Ga0373949_0003030 | 3300035090 | Bacteria | 4125 |
| 793 | Ga0373949_0012113 | 3300035090 | Bacteria | 1905 |
| 794 | Ga0373951_0002017 | 3300035091 | Bacteria | 5203 |
| 795 | Ga0373951_0003271 | 3300035091 | Bacteria | 3961 |
| 796 | Ga0373952_0000333 | 3300035092 | Bacteria | 7972 |
| 797 | Ga0373952_0001012 | 3300035092 | Bacteria | 5139 |
| 798 | Ga0373923_0010840 | 3300035111 | Bacteria | 3328 |
| 799 | Ga0373932_0000316 | 3300035112 | Bacteria | 14729 |
| 800 | Ga0373932_0001502 | 3300035112 | Bacteria | 6492 |
| 801 | Ga0373936_0042386 | 3300035113 | Bacteria | 1827 |
| 802 | Ga0373936_0094973 | 3300035113 | Bacteria | 1253 |
| 803 | Ga0373939_0000429 | 3300035114 | Bacteria | 10556 |
| 804 | Ga0373939_0008875 | 3300035114 | Bacteria | 2477 |
| 805 | Ga0373939_0038640 | 3300035114 | Bacteria | 1424 |
| 806 | Ga0373941_0000079 | 3300035115 | Bacteria | 15666 |
| 807 | Ga0373941_0000521 | 3300035115 | Bacteria | 7708 |
| 808 | Ga0373941_0002321 | 3300035115 | Bacteria | 4170 |
| 809 | Ga0373941_0137001 | 3300035115 | Unclassified | 887 |
| 810 | Ga0373953_0001317 | 3300035117 | Bacteria | 7117 |
| 811 | Ga0373953_0107491 | 3300035117 | Bacteria | 1178 |
| 812 | Ga0373954_0012919 | 3300035118 | Bacteria | 3718 |
| 813 | Ga0373954_0067107 | 3300035118 | Bacteria | 1699 |
| 814 | Ga0373954_0119985 | 3300035118 | Bacteria | 1276 |
| 815 | Ga0373954_0146424 | 3300035118 | Unclassified | 1153 |
| 816 | Ga0373954_0151421 | 3300035118 | Bacteria | 1133 |
| 817 | Ga0373956_0025992 | 3300035119 | Bacteria | 2534 |
| 818 | Ga0373956_0221834 | 3300035119 | Bacteria | 898 |
| 819 | Ga0373957_0001740 | 3300035120 | Bacteria | 5996 |
| 820 | Ga0373957_0227145 | 3300035120 | Bacteria | 782 |
| 821 | Ga0373960_0000127 | 3300035121 | Bacteria | 12399 |
| 822 | Ga0373960_0000335 | 3300035121 | Bacteria | 9006 |
| 823 | Ga0373960_0051633 | 3300035121 | Bacteria | 1222 |
| 824 | Ga0373943_0000221 | 3300035170 | Bacteria | 23249 |
| 825 | Ga0373943_0010555 | 3300035170 | Bacteria | 4140 |
| 826 | Ga0373943_0056155 | 3300035170 | Unclassified | 1953 |
| 827 | Ga0373943_0212770 | 3300035170 | Bacteria | 1074 |
| 828 | Ga0373946_0001071 | 3300035171 | Bacteria | 9426 |
| 829 | Ga0373946_0009682 | 3300035171 | Bacteria | 3556 |
| 830 | Ga0373946_0015697 | 3300035171 | Bacteria | 2876 |
| 831 | Ga0373946_0040118 | 3300035171 | Bacteria | 1914 |
| 832 | Ga0373946_0097955 | 3300035171 | Bacteria | 1310 |
| 833 | Ga0373955_0015524 | 3300035172 | Bacteria | 3731 |
| 834 | Ga0373955_0032173 | 3300035172 | Bacteria | 2751 |
| 835 | Ga0373955_0045328 | 3300035172 | Bacteria | 2373 |
| 836 | Ga0373955_0192120 | 3300035172 | Bacteria | 1214 |
| 837 | Ga0373955_0240895 | 3300035172 | Bacteria | 1083 |
| 838 | Ga0373955_0301113 | 3300035172 | Bacteria | 967 |
| 839 | Ga0373942_0000054 | 3300035207 | Bacteria | 23047 |
| 840 | Ga0373942_0001029 | 3300035207 | Bacteria | 7582 |
| 841 | Ga0373961_0000807 | 3300035241 | Bacteria | 10698 |
| 842 | Ga0373961_0003357 | 3300035241 | Bacteria | 3980 |
| 843 | Ga0373962_0000497 | 3300035242 | Bacteria | 8747 |
| 844 | Ga0373962_0001199 | 3300035242 | Bacteria | 6067 |
| 845 | Ga0373962_0040730 | 3300035242 | Bacteria | 1307 |
| 846 | Ga0316574_0002183 | 3300035398 | Bacteria | 9705 |
| 847 | Ga0373924_0013072 | 3300035410 | Bacteria | 3115 |
| 848 | Ga0373924_0055722 | 3300035410 | Bacteria | 1645 |
| 849 | Ga0373931_0000933 | 3300035691 | Bacteria | 12286 |
| 850 | Ga0373931_0021889 | 3300035691 | Bacteria | 3211 |
| 851 | Ga0373931_0049554 | 3300035691 | Bacteria | 2231 |
| 852 | Ga0373931_0054793 | 3300035691 | Bacteria | 2132 |
| 853 | Ga0373931_0425044 | 3300035691 | Bacteria | 845 |
| 854 | Ga0373935_0008813 | 3300035692 | Bacteria | 6041 |
| 855 | Ga0373935_0049664 | 3300035692 | Bacteria | 2659 |
| 856 | Ga0373935_0187959 | 3300035692 | Bacteria | 1421 |
| 857 | Ga0373935_0278993 | 3300035692 | Bacteria | 1176 |
| 858 | Ga0373927_0003813 | 3300035695 | Bacteria | 10696 |
| 859 | Ga0373927_0007833 | 3300035695 | Bacteria | 7223 |
| 860 | Ga0373933_0002449 | 3300035724 | Bacteria | 10458 |
| 861 | Ga0373933_0158553 | 3300035724 | Bacteria | 1436 |
| 862 | Ga0373947_0005403 | 3300035725 | Bacteria | 7458 |
| 863 | Ga0373947_0026934 | 3300035725 | Bacteria | 3362 |
| 864 | Ga0373947_0079875 | 3300035725 | Bacteria | 2022 |
| 865 | Ga0373947_0094306 | 3300035725 | Bacteria | 1871 |
| 866 | Ga0373947_0097765 | 3300035725 | Bacteria | 1840 |
| 867 | Ga0373947_0139873 | 3300035725 | Bacteria | 1552 |
| 868 | Ga0373947_0169259 | 3300035725 | Bacteria | 1417 |
| 869 | Ga0373947_0488757 | 3300035725 | Bacteria | 836 |
| 870 | Ga0373937_0002996 | 3300036401 | Bacteria | 14164 |
| 871 | Ga0373937_0008068 | 3300036401 | Bacteria | 9135 |
| 872 | Ga0373937_0037813 | 3300036401 | Bacteria | 4399 |
| 873 | Ga0373937_0046602 | 3300036401 | Bacteria | 3965 |
| 874 | Ga0373937_0274390 | 3300036401 | Bacteria | 1592 |
| 875 | Ga0373937_0288581 | 3300036401 | Bacteria | 1550 |
| 876 | Ga0373937_0658258 | 3300036401 | Bacteria | 993 |
| 877 | Ga0316582_0043113 | 3300036647 | Bacteria | 2830 |
| 878 | Ga0373925_0001261 | 3300037068 | Bacteria | 22350 |
| 879 | Ga0373925_0044673 | 3300037068 | Bacteria | 3290 |
| 880 | Ga0373925_0366647 | 3300037068 | Bacteria | 1171 |
| 881 | Ga0395905_0465665 | 3300037471 | Bacteria | 1163 |
| 882 | Ga0395901_0657198 | 3300038443 | Bacteria | 1051 |
| 883 | Ga0242420_003012 | 3300038996 | Bacteria | 2461 |
| 884 | Ga0242420_031031 | 3300038996 | Bacteria | 991 |
| 885 | Ga0436361_1078131 | 3300039447 | Bacteria | 1844 |
| 886 | Ga0451789_0159984 | 3300041443 | Bacteria | 974 |
| 887 | Ga0439463_011909 | 3300042016 | Bacteria | 2137 |
| 888 | Ga0450908_057568 | 3300042184 | Bacteria | 680 |
| 889 | Ga0439464_0040490 | 3300042439 | Bacteria | 1327 |
| 890 | Ga0451577_0055660 | 3300042876 | Bacteria | 3529 |
| 891 | Ga0453683_0120451 | 3300044673 | Bacteria | 1652 |
| 892 | Ga0466966_0075038 | 3300044684 | Bacteria | 2113 |
| 893 | Ga0453684_0239224 | 3300044712 | Bacteria | 2091 |
| 894 | Ga0466968_0102605 | 3300044735 | Bacteria | 1278 |
| 895 | Ga0466959_0055703 | 3300045049 | Bacteria | 2886 |
| 896 | Ga0495617_056072 | 3300046452 | Bacteria | 1307 |
| 897 | Ga0495592_0001840 | 3300046454 | Bacteria | 14914 |
| 898 | Ga0495592_0016710 | 3300046454 | Bacteria | 5569 |
| 899 | Ga0495592_0046904 | 3300046454 | Bacteria | 3219 |
| 900 | Ga0495592_0093904 | 3300046454 | Bacteria | 2148 |
| 901 | Ga0495592_0191214 | 3300046454 | Bacteria | 1387 |
| 902 | Ga0495603_0003594 | 3300046455 | Bacteria | 9221 |
| 903 | Ga0495603_0033217 | 3300046455 | Bacteria | 3104 |
| 904 | Ga0495603_0294936 | 3300046455 | Bacteria | 931 |
| 905 | Ga0495629_0000269 | 3300046459 | Bacteria | 45206 |
| 906 | Ga0495629_0044590 | 3300046459 | Bacteria | 3112 |
| 907 | Ga0495629_0072185 | 3300046459 | Bacteria | 2409 |
| 908 | Ga0495629_0080588 | 3300046459 | Bacteria | 2272 |
| 909 | Ga0495629_0129307 | 3300046459 | Bacteria | 1759 |
| 910 | Ga0495638_0056011 | 3300046460 | Bacteria | 2447 |
| 911 | Ga0495641_0010670 | 3300046461 | Bacteria | 5298 |
| 912 | Ga0495641_0012148 | 3300046461 | Bacteria | 4839 |
| 913 | Ga0495641_0032921 | 3300046461 | Bacteria | 2464 |
| 914 | Ga0495651_0005718 | 3300046462 | Bacteria | 9477 |
| 915 | Ga0495651_0007532 | 3300046462 | Bacteria | 8327 |
| 916 | Ga0495651_0074461 | 3300046462 | Bacteria | 2576 |
| 917 | Ga0495653_0025117 | 3300046463 | Bacteria | 4792 |
| 918 | Ga0495653_0142905 | 3300046463 | Bacteria | 1681 |
| 919 | Ga0495653_0330526 | 3300046463 | Unclassified | 985 |
| 920 | Ga0495653_0499643 | 3300046463 | Bacteria | 758 |
| 921 | Ga0495580_0007748 | 3300046472 | Bacteria | 8606 |
| 922 | Ga0495580_0009445 | 3300046472 | Bacteria | 7670 |
| 923 | Ga0495582_0003928 | 3300046473 | Bacteria | 8349 |
| 924 | Ga0495605_0177368 | 3300046474 | Bacteria | 939 |
| 925 | Ga0495605_0179619 | 3300046474 | Bacteria | 931 |
| 926 | Ga0495639_0011122 | 3300046475 | Bacteria | 3878 |
| 927 | Ga0495662_0001657 | 3300046476 | Bacteria | 11089 |
| 928 | Ga0495664_0000500 | 3300046477 | Bacteria | 19536 |
| 929 | Ga0495664_0047659 | 3300046477 | Bacteria | 2543 |
| 930 | Ga0495584_0003520 | 3300046491 | Bacteria | 8593 |
| 931 | Ga0495585_0001825 | 3300046492 | Bacteria | 16125 |
| 932 | Ga0495585_0052611 | 3300046492 | Bacteria | 2254 |
| 933 | Ga0495585_0096301 | 3300046492 | Bacteria | 1588 |
| 934 | Ga0495594_0004830 | 3300046499 | Bacteria | 6942 |
| 935 | Ga0495594_0124775 | 3300046499 | Bacteria | 1456 |
| 936 | Ga0495607_0034800 | 3300046501 | Bacteria | 3053 |
| 937 | Ga0495607_0037558 | 3300046501 | Bacteria | 2908 |
| 938 | Ga0495607_0160053 | 3300046501 | Bacteria | 1145 |
| 939 | Ga0495608_0001268 | 3300046511 | Bacteria | 17936 |
| 940 | Ga0495616_0148473 | 3300046513 | Bacteria | 1062 |
| 941 | Ga0495618_0001353 | 3300046514 | Bacteria | 16474 |
| 942 | Ga0495618_0011595 | 3300046514 | Bacteria | 5346 |
| 943 | Ga0495618_0579392 | 3300046514 | Unclassified | 669 |
| 944 | Ga0495620_0054906 | 3300046515 | Bacteria | 1681 |
| 945 | Ga0495628_0022229 | 3300046516 | Bacteria | 5211 |
| 946 | Ga0495628_0027611 | 3300046516 | Bacteria | 4616 |
| 947 | Ga0495628_0189267 | 3300046516 | Bacteria | 1554 |
| 948 | Ga0495628_0221657 | 3300046516 | Bacteria | 1420 |
| 949 | Ga0495628_0584128 | 3300046516 | Bacteria | 799 |
| 950 | Ga0495630_0070767 | 3300046517 | Bacteria | 2624 |
| 951 | Ga0495630_0291527 | 3300046517 | Bacteria | 1247 |
| 952 | Ga0495631_0102709 | 3300046518 | Bacteria | 1230 |
| 953 | Ga0495643_0268054 | 3300046522 | Bacteria | 790 |
| 954 | Ga0495644_0001996 | 3300046523 | Bacteria | 8199 |
| 955 | Ga0495644_0042096 | 3300046523 | Bacteria | 1720 |
| 956 | Ga0495644_0300228 | 3300046523 | Bacteria | 628 |
| 957 | Ga0495663_0081329 | 3300046525 | Bacteria | 1044 |
| 958 | Ga0495666_0009092 | 3300046526 | Bacteria | 4970 |
| 959 | Ga0495652_0022225 | 3300046529 | Bacteria | 5630 |
| 960 | Ga0495652_0195557 | 3300046529 | Bacteria | 1539 |
| 961 | Ga0495652_0482909 | 3300046529 | Bacteria | 862 |
| 962 | Ga0495652_0627876 | 3300046529 | Bacteria | 730 |
| 963 | Ga0495665_0008916 | 3300046531 | Bacteria | 5442 |
| 964 | Ga0495665_0009854 | 3300046531 | Bacteria | 5171 |
| 965 | Ga0495665_0025653 | 3300046531 | Bacteria | 3165 |
| 966 | Ga0495665_0218037 | 3300046531 | Bacteria | 987 |
| 967 | Ga0495640_0003333 | 3300046533 | Bacteria | 12927 |
| 968 | Ga0495640_0008735 | 3300046533 | Bacteria | 7939 |
| 969 | Ga0495640_0048712 | 3300046533 | Bacteria | 2926 |
| 970 | Ga0495640_0076077 | 3300046533 | Bacteria | 2240 |
| 971 | Ga0495640_0104222 | 3300046533 | Bacteria | 1859 |
| 972 | Ga0495586_0012313 | 3300046535 | Bacteria | 4539 |
| 973 | Ga0495587_0000620 | 3300046536 | Bacteria | 24097 |
| 974 | Ga0495587_0016528 | 3300046536 | Bacteria | 4590 |
| 975 | Ga0495598_0000497 | 3300046537 | Bacteria | 7249 |
| 976 | Ga0495598_0039419 | 3300046537 | Bacteria | 1373 |
| 977 | Ga0495609_0037320 | 3300046538 | Bacteria | 2192 |
| 978 | Ga0495597_0208568 | 3300046542 | Bacteria | 780 |
| 979 | Ga0495645_0000640 | 3300046543 | Bacteria | 24122 |
| 980 | Ga0495645_0000848 | 3300046543 | Bacteria | 20818 |
| 981 | Ga0495645_0001258 | 3300046543 | Bacteria | 17280 |
| 982 | Ga0495633_0001631 | 3300046558 | Bacteria | 16927 |
| 983 | Ga0495667_0001254 | 3300046559 | Bacteria | 16638 |
| 984 | Ga0495667_0017253 | 3300046559 | Bacteria | 4877 |
| 985 | Ga0495667_0063182 | 3300046559 | Bacteria | 2424 |
| 986 | Ga0495656_0001521 | 3300046615 | Bacteria | 7581 |
| 987 | Ga0495656_0029742 | 3300046615 | Bacteria | 2201 |
| 988 | Ga0495668_0096664 | 3300046616 | Bacteria | 1616 |
| 989 | Ga0495634_0004362 | 3300046642 | Bacteria | 11136 |
| 990 | Ga0495634_0059926 | 3300046642 | Bacteria | 2534 |
| 991 | Ga0495634_0094981 | 3300046642 | Bacteria | 1931 |
| 992 | Ga0495634_0138248 | 3300046642 | Bacteria | 1548 |
| 993 | Ga0495611_0152781 | 3300046648 | Bacteria | 1078 |
| 994 | Ga0495635_0003030 | 3300046663 | Bacteria | 11546 |
| 995 | Ga0495635_0009428 | 3300046663 | Bacteria | 6824 |
| 996 | Ga0495635_0010638 | 3300046663 | Bacteria | 6440 |
| 997 | Ga0495635_0063639 | 3300046663 | Bacteria | 2533 |
| 998 | Ga0495635_0081906 | 3300046663 | Bacteria | 2208 |
| 999 | Ga0495635_0302964 | 3300046663 | Bacteria | 1071 |
| 1000 | Ga0495659_0013369 | 3300046664 | Bacteria | 2673 |
| 1001 | Ga0495659_0178178 | 3300046664 | Bacteria | 865 |
| 1002 | Ga0495661_0041885 | 3300046665 | Bacteria | 2829 |
| 1003 | Ga0495588_0024998 | 3300046674 | Bacteria | 2972 |
| 1004 | Ga0495588_0078061 | 3300046674 | Bacteria | 1727 |
| 1005 | Ga0495657_0002939 | 3300046675 | Bacteria | 14124 |
| 1006 | Ga0495657_0238516 | 3300046675 | Bacteria | 1098 |
| 1007 | Ga0495599_0007257 | 3300046678 | Bacteria | 6715 |
| 1008 | Ga0495623_0006562 | 3300046679 | Bacteria | 7575 |
| 1009 | Ga0495623_0054810 | 3300046679 | Bacteria | 2515 |
| 1010 | Ga0495646_0007927 | 3300046680 | Bacteria | 6747 |
| 1011 | Ga0495646_0010534 | 3300046680 | Bacteria | 5873 |
| 1012 | Ga0495646_0014152 | 3300046680 | Bacteria | 5074 |
| 1013 | Ga0495646_0108471 | 3300046680 | Bacteria | 1583 |
| 1014 | Ga0495647_0006507 | 3300046681 | Bacteria | 3873 |
| 1015 | Ga0495647_0057634 | 3300046681 | Bacteria | 1525 |
| 1016 | Ga0495658_0109370 | 3300046683 | Bacteria | 1660 |
| 1017 | Ga0495658_0495318 | 3300046683 | Bacteria | 782 |
| 1018 | Ga0495669_0069608 | 3300046684 | Bacteria | 1602 |
| 1019 | Ga0495669_0119909 | 3300046684 | Bacteria | 1232 |
| 1020 | Ga0495613_0001384 | 3300046689 | Bacteria | 18433 |
| 1021 | Ga0495613_0023601 | 3300046689 | Bacteria | 4584 |
| 1022 | Ga0495613_0136629 | 3300046689 | Bacteria | 1753 |
| 1023 | Ga0495624_0004076 | 3300046690 | Bacteria | 10749 |
| 1024 | Ga0495624_0010897 | 3300046690 | Bacteria | 6267 |
| 1025 | Ga0495624_0121654 | 3300046690 | Bacteria | 1602 |
| 1026 | Ga0495670_0003495 | 3300046691 | Bacteria | 7714 |
| 1027 | Ga0495670_0019269 | 3300046691 | Bacteria | 3361 |
| 1028 | Ga0495589_0056216 | 3300046794 | Bacteria | 1937 |
| 1029 | Ga0495589_0085962 | 3300046794 | Bacteria | 1528 |
| 1030 | Ga0495600_0007718 | 3300046809 | Bacteria | 6589 |
| 1031 | Ga0495600_0025977 | 3300046809 | Bacteria | 3777 |
| 1032 | Ga0495600_0037538 | 3300046809 | Bacteria | 3150 |
| 1033 | Ga0495600_0185563 | 3300046809 | Bacteria | 1339 |
| 1034 | Ga0495660_0152497 | 3300046810 | Bacteria | 1140 |
| 1035 | Ga0495581_0071963 | 3300047315 | Bacteria | 2001 |
| 1036 | Ga0495581_0127978 | 3300047315 | Bacteria | 1479 |
| 1037 | Ga0495581_0146840 | 3300047315 | Bacteria | 1376 |
| 1038 | Ga0495581_0566970 | 3300047315 | Unclassified | 658 |
| 1039 | Ga0495604_0028071 | 3300047317 | Bacteria | 4476 |
| 1040 | Ga0495604_0135025 | 3300047317 | Bacteria | 1769 |
| 1041 | Ga0495636_0113146 | 3300047318 | Bacteria | 1196 |
| 1042 | Ga0495674_0014366 | 3300047319 | Bacteria | 7414 |
| 1043 | Ga0495674_0018881 | 3300047319 | Bacteria | 6412 |
| 1044 | Ga0495674_0050678 | 3300047319 | Bacteria | 3663 |
| 1045 | Ga0495674_0098959 | 3300047319 | Bacteria | 2483 |
| 1046 | Ga0495674_0466861 | 3300047319 | Bacteria | 1013 |
| 1047 | Ga0495674_0643653 | 3300047319 | Bacteria | 836 |
| 1048 | Ga0495676_0073874 | 3300047321 | Bacteria | 2613 |
| 1049 | Ga0495676_0201351 | 3300047321 | Bacteria | 1383 |
| 1050 | Ga0495680_0001472 | 3300047322 | Bacteria | 25404 |
| 1051 | Ga0495680_0020287 | 3300047322 | Bacteria | 5594 |
| 1052 | Ga0495680_0031933 | 3300047322 | Bacteria | 4280 |
| 1053 | Ga0495680_0036206 | 3300047322 | Bacteria | 3965 |
| 1054 | Ga0495675_0003746 | 3300047444 | Bacteria | 9193 |
| 1055 | Ga0495679_037303 | 3300047446 | Bacteria | 1530 |
| 1056 | Ga0495679_051806 | 3300047446 | Unclassified | 1229 |
| 1057 | Ga0495685_057546 | 3300047447 | Bacteria | 1313 |
| 1058 | Ga0495684_0001677 | 3300047471 | Bacteria | 17797 |
| 1059 | Ga0495684_0012712 | 3300047471 | Bacteria | 6498 |
| 1060 | Ga0495684_0032898 | 3300047471 | Bacteria | 3983 |
| 1061 | Ga0495684_0107728 | 3300047471 | Bacteria | 2104 |
| 1062 | Ga0495684_0196677 | 3300047471 | Bacteria | 1488 |
| 1063 | Ga0495684_0539937 | 3300047471 | Bacteria | 795 |
| 1064 | Ga0495686_0087435 | 3300047472 | Bacteria | 1896 |
| 1065 | Ga0495593_0009116 | 3300047673 | Bacteria | 5756 |
| 1066 | Ga0495593_0028872 | 3300047673 | Bacteria | 3045 |
| 1067 | Ga0495593_0106332 | 3300047673 | Bacteria | 1435 |
| 1068 | Ga0495602_0002664 | 3300048088 | Bacteria | 18252 |
| 1069 | Ga0495602_0033768 | 3300048088 | Bacteria | 4795 |
| 1070 | Ga0495602_0231738 | 3300048088 | Bacteria | 1387 |
| 1071 | Ga0495602_0313080 | 3300048088 | Bacteria | 1145 |
| 1072 | Ga0495614_0096227 | 3300048089 | Bacteria | 1291 |
| 1073 | Ga0496100_0000400 | 3300048903 | Bacteria | 20959 |
| 1074 | Ga0496100_0027571 | 3300048903 | Bacteria | 3494 |
| 1075 | Ga0496100_0117252 | 3300048903 | Bacteria | 1858 |
| 1076 | Ga0496100_0387256 | 3300048903 | Bacteria | 1062 |
| 1077 | Ga0496100_0613532 | 3300048903 | Bacteria | 845 |
| 1078 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 1079 | Ga0496101_0007756 | 3300048904 | Bacteria | 6974 |
| 1080 | Ga0496101_0017588 | 3300048904 | Bacteria | 4849 |
| 1081 | Ga0496101_0108794 | 3300048904 | Bacteria | 2084 |
| 1082 | Ga0496101_0119225 | 3300048904 | Bacteria | 1993 |
| 1083 | Ga0496101_0199750 | 3300048904 | Bacteria | 1545 |
| 1084 | Ga0496101_0266686 | 3300048904 | Bacteria | 1336 |
| 1085 | Ga0496101_0506773 | 3300048904 | Bacteria | 953 |
| 1086 | Ga0496102_0002633 | 3300048905 | Bacteria | 15255 |
| 1087 | Ga0496102_0025278 | 3300048905 | Bacteria | 5285 |
| 1088 | Ga0496102_0149186 | 3300048905 | Bacteria | 2196 |
| 1089 | Ga0496102_0211874 | 3300048905 | Bacteria | 1826 |
| 1090 | Ga0496102_0231268 | 3300048905 | Bacteria | 1743 |
| 1091 | Ga0496102_0467221 | 3300048905 | Bacteria | 1182 |
| 1092 | Ga0496102_0797755 | 3300048905 | Bacteria | 866 |
| 1093 | Ga0496103_0000589 | 3300048906 | Bacteria | 28631 |
| 1094 | Ga0496103_0010136 | 3300048906 | Bacteria | 5572 |
| 1095 | Ga0496103_0024969 | 3300048906 | Bacteria | 3608 |
| 1096 | Ga0496103_0069376 | 3300048906 | Bacteria | 2203 |
| 1097 | Ga0496103_0474130 | 3300048906 | Unclassified | 802 |
| 1098 | Ga0496104_0000495 | 3300048907 | Bacteria | 34041 |
| 1099 | Ga0496104_0001236 | 3300048907 | Bacteria | 22009 |
| 1100 | Ga0496104_0005956 | 3300048907 | Bacteria | 10678 |
| 1101 | Ga0496104_0026745 | 3300048907 | Bacteria | 5331 |
| 1102 | Ga0496104_0039113 | 3300048907 | Bacteria | 4440 |
| 1103 | Ga0496104_0108334 | 3300048907 | Bacteria | 2662 |
| 1104 | Ga0496104_0215540 | 3300048907 | Bacteria | 1831 |
| 1105 | Ga0496104_0529367 | 3300048907 | Bacteria | 1089 |
| 1106 | Ga0496104_0768322 | 3300048907 | Bacteria | 870 |
| 1107 | Ga0496105_0005561 | 3300048908 | Bacteria | 9570 |
| 1108 | Ga0496105_0014666 | 3300048908 | Bacteria | 6239 |
| 1109 | Ga0496105_0018137 | 3300048908 | Bacteria | 5650 |
| 1110 | Ga0496105_0029520 | 3300048908 | Bacteria | 4488 |
| 1111 | Ga0496105_0060930 | 3300048908 | Bacteria | 3114 |
| 1112 | Ga0496105_0112733 | 3300048908 | Bacteria | 2244 |
| 1113 | Ga0496105_0334799 | 3300048908 | Bacteria | 1211 |
| 1114 | Ga0496106_0005428 | 3300048909 | Bacteria | 9431 |
| 1115 | Ga0496106_0006491 | 3300048909 | Bacteria | 8662 |
| 1116 | Ga0496106_0007048 | 3300048909 | Bacteria | 8300 |
| 1117 | Ga0496106_0013672 | 3300048909 | Bacteria | 5993 |
| 1118 | Ga0496106_0047725 | 3300048909 | Bacteria | 3223 |
| 1119 | Ga0496106_0302003 | 3300048909 | Bacteria | 1284 |
| 1120 | Ga0496107_0000959 | 3300048910 | Bacteria | 17091 |
| 1121 | Ga0496107_0010458 | 3300048910 | Bacteria | 6448 |
| 1122 | Ga0496107_0017454 | 3300048910 | Bacteria | 5048 |
| 1123 | Ga0496107_0031662 | 3300048910 | Bacteria | 3776 |
| 1124 | Ga0496107_0073880 | 3300048910 | Bacteria | 2480 |
| 1125 | Ga0496107_0084657 | 3300048910 | Bacteria | 2313 |
| 1126 | Ga0496107_0185056 | 3300048910 | Bacteria | 1547 |
| 1127 | Ga0496107_0303964 | 3300048910 | Bacteria | 1187 |
| 1128 | Ga0496107_0708023 | 3300048910 | Bacteria | 740 |
| 1129 | Ga0496108_0008895 | 3300048911 | Bacteria | 8140 |
| 1130 | Ga0496108_0010769 | 3300048911 | Bacteria | 7423 |
| 1131 | Ga0496108_0015584 | 3300048911 | Bacteria | 6200 |
| 1132 | Ga0496108_0044005 | 3300048911 | Bacteria | 3728 |
| 1133 | Ga0496108_0047786 | 3300048911 | Bacteria | 3578 |
| 1134 | Ga0496108_0079507 | 3300048911 | Bacteria | 2776 |
| 1135 | Ga0496108_0211550 | 3300048911 | Bacteria | 1683 |
| 1136 | Ga0496108_0525078 | 3300048911 | Bacteria | 1033 |
| 1137 | Ga0496108_0579186 | 3300048911 | Bacteria | 978 |
| 1138 | Ga0496108_0687952 | 3300048911 | Bacteria | 887 |
| 1139 | Ga0496109_0000186 | 3300048912 | Bacteria | 62084 |
| 1140 | Ga0496109_0001702 | 3300048912 | Bacteria | 18343 |
| 1141 | Ga0496109_0030370 | 3300048912 | Bacteria | 4844 |
| 1142 | Ga0496109_0052259 | 3300048912 | Bacteria | 3723 |
| 1143 | Ga0496109_0153537 | 3300048912 | Bacteria | 2156 |
| 1144 | Ga0496109_0220273 | 3300048912 | Bacteria | 1784 |
| 1145 | Ga0496109_0318910 | 3300048912 | Bacteria | 1466 |
| 1146 | Ga0496109_0373284 | 3300048912 | Bacteria | 1347 |
| 1147 | Ga0496110_0013927 | 3300048913 | Bacteria | 6663 |
| 1148 | Ga0496110_0018742 | 3300048913 | Bacteria | 5806 |
| 1149 | Ga0496110_0019603 | 3300048913 | Bacteria | 5696 |
| 1150 | Ga0496110_0022421 | 3300048913 | Bacteria | 5361 |
| 1151 | Ga0496110_0101292 | 3300048913 | Bacteria | 2582 |
| 1152 | Ga0496110_0227853 | 3300048913 | Bacteria | 1695 |
| 1153 | Ga0496110_0295823 | 3300048913 | Bacteria | 1475 |
| 1154 | Ga0496110_0684341 | 3300048913 | Bacteria | 926 |
| 1155 | Ga0496111_0005910 | 3300048914 | Bacteria | 7892 |
| 1156 | Ga0496111_0011973 | 3300048914 | Bacteria | 5863 |
| 1157 | Ga0496111_0022603 | 3300048914 | Bacteria | 4405 |
| 1158 | Ga0496111_0024951 | 3300048914 | Bacteria | 4217 |
| 1159 | Ga0496111_0119709 | 3300048914 | Bacteria | 1944 |
| 1160 | Ga0496111_0124886 | 3300048914 | Bacteria | 1902 |
| 1161 | Ga0496111_0208802 | 3300048914 | Bacteria | 1451 |
| 1162 | Ga0496111_0383845 | 3300048914 | Bacteria | 1039 |
| 1163 | Ga0496112_0001465 | 3300048915 | Bacteria | 18127 |
| 1164 | Ga0496112_0034866 | 3300048915 | Bacteria | 4897 |
| 1165 | Ga0496112_0237858 | 3300048915 | Bacteria | 1774 |
| 1166 | Ga0496112_0303362 | 3300048915 | Bacteria | 1542 |
| 1167 | Ga0496112_0376662 | 3300048915 | Bacteria | 1360 |
| 1168 | Ga0496112_0554561 | 3300048915 | Bacteria | 1083 |
| 1169 | Ga0496112_0770654 | 3300048915 | Bacteria | 888 |
| 1170 | Ga0496113_0001663 | 3300048916 | Bacteria | 12569 |
| 1171 | Ga0496113_0001787 | 3300048916 | Bacteria | 12193 |
| 1172 | Ga0496113_0057454 | 3300048916 | Bacteria | 2924 |
| 1173 | Ga0496113_0057793 | 3300048916 | Bacteria | 2917 |
| 1174 | Ga0496113_0070698 | 3300048916 | Bacteria | 2654 |
| 1175 | Ga0496113_0087255 | 3300048916 | Bacteria | 2398 |
| 1176 | Ga0496113_0143263 | 3300048916 | Bacteria | 1881 |
| 1177 | Ga0496113_0209154 | 3300048916 | Bacteria | 1552 |
| 1178 | Ga0496113_0273857 | 3300048916 | Bacteria | 1349 |
| 1179 | Ga0496113_0331299 | 3300048916 | Bacteria | 1220 |
| 1180 | Ga0496113_0551904 | 3300048916 | Bacteria | 924 |
| 1181 | Ga0496114_0005496 | 3300048917 | Bacteria | 9922 |
| 1182 | Ga0496114_0014986 | 3300048917 | Bacteria | 6232 |
| 1183 | Ga0496114_0020643 | 3300048917 | Bacteria | 5347 |
| 1184 | Ga0496114_0028137 | 3300048917 | Bacteria | 4609 |
| 1185 | Ga0496114_0109954 | 3300048917 | Bacteria | 2360 |
| 1186 | Ga0496114_0122360 | 3300048917 | Bacteria | 2239 |
| 1187 | Ga0496115_0002326 | 3300048918 | Bacteria | 13618 |
| 1188 | Ga0496115_0032093 | 3300048918 | Bacteria | 4143 |
| 1189 | Ga0496115_0054620 | 3300048918 | Bacteria | 3207 |
| 1190 | Ga0496115_0117517 | 3300048918 | Bacteria | 2187 |
| 1191 | Ga0496115_0300578 | 3300048918 | Bacteria | 1315 |
| 1192 | Ga0496115_0387524 | 3300048918 | Bacteria | 1135 |
| 1193 | Ga0501031_0026122 | 3300049568 | Bacteria | 3809 |
| 1194 | Ga0501031_0183336 | 3300049568 | Bacteria | 1367 |
| 1195 | Ga0501032_0056981 | 3300049569 | Bacteria | 2625 |
| 1196 | Ga0501033_0017988 | 3300049570 | Bacteria | 5336 |
| 1197 | Ga0501033_0037189 | 3300049570 | Bacteria | 3644 |
| 1198 | Ga0501034_0001527 | 3300049571 | Bacteria | 30368 |
| 1199 | Ga0501034_0005707 | 3300049571 | Bacteria | 13528 |
| 1200 | Ga0501034_0050911 | 3300049571 | Bacteria | 4176 |
| 1201 | Ga0501034_0087839 | 3300049571 | Bacteria | 3108 |
| 1202 | Ga0501034_0093242 | 3300049571 | Bacteria | 3007 |
| 1203 | Ga0501036_0001725 | 3300049572 | Bacteria | 16998 |
| 1204 | Ga0501036_0149894 | 3300049572 | Bacteria | 1967 |
| 1205 | Ga0501036_0226117 | 3300049572 | Bacteria | 1570 |
| 1206 | Ga0501037_0013915 | 3300049573 | Bacteria | 5929 |
| 1207 | Ga0501037_0014525 | 3300049573 | Bacteria | 5792 |
| 1208 | Ga0501037_0018328 | 3300049573 | Bacteria | 5158 |
| 1209 | Ga0501037_0537925 | 3300049573 | Bacteria | 789 |
| 1210 | Ga0501038_0123196 | 3300049574 | Bacteria | 2135 |
| 1211 | Ga0501038_0262288 | 3300049574 | Bacteria | 1365 |
| 1212 | Ga0501039_0009607 | 3300049575 | Bacteria | 7374 |
| 1213 | Ga0501039_0018275 | 3300049575 | Bacteria | 5380 |
| 1214 | Ga0501039_0578502 | 3300049575 | Bacteria | 881 |
| 1215 | Ga0501040_0272667 | 3300049576 | Bacteria | 1208 |
| 1216 | Ga0501042_0088942 | 3300049578 | Bacteria | 2216 |
| 1217 | Ga0501042_0218862 | 3300049578 | Bacteria | 1373 |
| 1218 | Ga0501042_0706075 | 3300049578 | Bacteria | 733 |
| 1219 | Ga0501043_0002647 | 3300049579 | Bacteria | 15054 |
| 1220 | Ga0501043_0017342 | 3300049579 | Bacteria | 5647 |
| 1221 | Ga0501043_0174822 | 3300049579 | Bacteria | 1674 |
| 1222 | Ga0501046_0014888 | 3300049580 | Bacteria | 6545 |
| 1223 | Ga0501046_0241727 | 3300049580 | Bacteria | 1331 |
| 1224 | Ga0501046_0658897 | 3300049580 | Unclassified | 739 |
| 1225 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 1226 | Ga0501047_0220996 | 3300049581 | Bacteria | 1751 |
| 1227 | Ga0501048_0001647 | 3300049582 | Bacteria | 17021 |
| 1228 | Ga0501048_0006384 | 3300049582 | Bacteria | 8963 |
| 1229 | Ga0501048_0089548 | 3300049582 | Bacteria | 2171 |
| 1230 | Ga0501067_0046483 | 3300049583 | Bacteria | 2409 |
| 1231 | Ga0501067_0102759 | 3300049583 | Bacteria | 1588 |
| 1232 | Ga0501068_0002435 | 3300049584 | Bacteria | 9877 |
| 1233 | Ga0501069_0001787 | 3300049585 | Bacteria | 10754 |
| 1234 | Ga0501069_0539777 | 3300049585 | Unclassified | 697 |
| 1235 | Ga0501070_0067395 | 3300049586 | Bacteria | 2964 |
| 1236 | Ga0501070_0072653 | 3300049586 | Bacteria | 2847 |
| 1237 | Ga0501070_0137249 | 3300049586 | Bacteria | 2019 |
| 1238 | Ga0501070_0353920 | 3300049586 | Bacteria | 1191 |
| 1239 | Ga0501071_0357238 | 3300049587 | Bacteria | 1112 |
| 1240 | Ga0501072_0142420 | 3300049588 | Bacteria | 1912 |
| 1241 | Ga0501072_0261204 | 3300049588 | Bacteria | 1378 |
| 1242 | Ga0501072_0412207 | 3300049588 | Bacteria | 1071 |
| 1243 | Ga0501073_0033155 | 3300049589 | Bacteria | 3679 |
| 1244 | Ga0501073_0159973 | 3300049589 | Bacteria | 1560 |
| 1245 | Ga0501073_0182084 | 3300049589 | Bacteria | 1454 |
| 1246 | Ga0501073_0469887 | 3300049589 | Unclassified | 869 |
| 1247 | Ga0501074_0012445 | 3300049590 | Bacteria | 6184 |
| 1248 | Ga0501074_0025365 | 3300049590 | Bacteria | 4305 |
| 1249 | Ga0501074_0047729 | 3300049590 | Bacteria | 3094 |
| 1250 | Ga0501076_0370174 | 3300049592 | Bacteria | 1177 |
| 1251 | Ga0501077_0055643 | 3300049593 | Bacteria | 2512 |
| 1252 | Ga0501079_0039730 | 3300049741 | Bacteria | 3629 |
| 1253 | Ga0501079_0146376 | 3300049741 | Bacteria | 1841 |
| 1254 | Ga0501080_0000409 | 3300049742 | Bacteria | 33000 |
| 1255 | Ga0501080_0010799 | 3300049742 | Bacteria | 8358 |
| 1256 | Ga0501080_0057968 | 3300049742 | Bacteria | 3605 |
| 1257 | Ga0501080_0125865 | 3300049742 | Bacteria | 2373 |
| 1258 | Ga0501080_0180479 | 3300049742 | Bacteria | 1943 |
| 1259 | Ga0501083_0007542 | 3300049744 | Bacteria | 7710 |
| 1260 | Ga0501083_0016908 | 3300049744 | Bacteria | 5095 |
| 1261 | Ga0501083_0110967 | 3300049744 | Bacteria | 1803 |
| 1262 | Ga0501083_0144052 | 3300049744 | Bacteria | 1560 |
| 1263 | Ga0501083_0184437 | 3300049744 | Bacteria | 1362 |
| 1264 | Ga0501083_0189477 | 3300049744 | Bacteria | 1342 |
| 1265 | Ga0501083_0339210 | 3300049744 | Bacteria | 977 |
| 1266 | Ga0501035_0043099 | 3300049822 | Bacteria | 4067 |
| 1267 | Ga0501035_0172078 | 3300049822 | Bacteria | 1870 |
| 1268 | Ga0501044_0009294 | 3300049823 | Bacteria | 10727 |
| 1269 | Ga0501044_0076894 | 3300049823 | Bacteria | 3386 |
| 1270 | Ga0501044_0157762 | 3300049823 | Bacteria | 2247 |
| 1271 | Ga0501044_0218325 | 3300049823 | Bacteria | 1858 |
| 1272 | Ga0501044_0761316 | 3300049823 | Bacteria | 850 |
| 1273 | Ga0501045_0328714 | 3300049824 | Unclassified | 1138 |
| 1274 | Ga0501045_0536058 | 3300049824 | Bacteria | 869 |
| 1275 | nmdc:mga03683_204343_c1 | 3300050489 | Bacteria | 907 |
| 1276 | nmdc:mga03n38_164456_c1 | 3300050490 | Bacteria | 1126 |
| 1277 | nmdc:mga03n38_170246_c1 | 3300050490 | Bacteria | 1109 |
| 1278 | nmdc:mga03n38_24890_c1 | 3300050490 | Bacteria | 2452 |
| 1279 | nmdc:mga03n38_292733_c1 | 3300050490 | Bacteria | 872 |
| 1280 | nmdc:mga00v17_35357_c1 | 3300050491 | Bacteria | 2972 |
| 1281 | nmdc:mga00v17_89938_c1 | 3300050491 | Bacteria | 1927 |
| 1282 | nmdc:mga0yw44_12590_c1 | 3300050492 | Bacteria | 4417 |
| 1283 | nmdc:mga0yw44_1365_c1 | 3300050492 | Bacteria | 9675 |
| 1284 | nmdc:mga0yw44_257115_c1 | 3300050492 | Bacteria | 1163 |
| 1285 | nmdc:mga0yw44_4638_c1 | 3300050492 | Bacteria | 6346 |
| 1286 | nmdc:mga0yw44_552281_c1 | 3300050492 | Bacteria | 782 |
| 1287 | nmdc:mga0k408_125156_c1 | 3300050493 | Bacteria | 1524 |
| 1288 | nmdc:mga06z11_40711_c1 | 3300050494 | Bacteria | 2321 |
| 1289 | nmdc:mga04h51_321848_c1 | 3300050495 | Bacteria | 634 |
| 1290 | nmdc:mga07m45_18231_c1 | 3300050496 | Bacteria | 3784 |
| 1291 | nmdc:mga07m45_377173_c1 | 3300050496 | Bacteria | 824 |
| 1292 | nmdc:mga05p37_1028322_c1 | 3300050507 | Bacteria | 872 |
| 1293 | nmdc:mga05p37_108355_c1 | 3300050507 | Bacteria | 3417 |
| 1294 | nmdc:mga05p37_1888_c1 | 3300050507 | Bacteria | 24396 |
| 1295 | nmdc:mga05p37_2212_c1 | 3300050507 | Bacteria | 22652 |
| 1296 | nmdc:mga05p37_34119_c1 | 3300050507 | Bacteria | 6233 |
| 1297 | nmdc:mga05p37_55603_c1 | 3300050507 | Bacteria | 4871 |
| 1298 | nmdc:mga05p37_669629_c1 | 3300050507 | Bacteria | 1159 |
| 1299 | nmdc:mga09592_222223_c1 | 3300050508 | Bacteria | 1636 |
| 1300 | nmdc:mga09592_35165_c1 | 3300050508 | Bacteria | 4192 |
| 1301 | nmdc:mga09592_6462_c1 | 3300050508 | Bacteria | 9543 |
| 1302 | nmdc:mga0qj67_163958_c1 | 3300050509 | Bacteria | 1804 |
| 1303 | nmdc:mga0qj67_170_c1 | 3300050509 | Bacteria | 43684 |
| 1304 | nmdc:mga0qj67_27717_c1 | 3300050509 | Bacteria | 4393 |
| 1305 | nmdc:mga06r32_119362_c1 | 3300050510 | Bacteria | 2600 |
| 1306 | nmdc:mga06r32_17986_c1 | 3300050510 | Bacteria | 6462 |
| 1307 | nmdc:mga06r32_21973_c1 | 3300050510 | Bacteria | 5892 |
| 1308 | nmdc:mga08y16_1034655_c1 | 3300050511 | Bacteria | 799 |
| 1309 | nmdc:mga08y16_1219_c1 | 3300050511 | Bacteria | 25435 |
| 1310 | nmdc:mga08y16_311_c1 | 3300050511 | Bacteria | 43954 |
| 1311 | nmdc:mga08y16_358230_c1 | 3300050511 | Bacteria | 1498 |
| 1312 | nmdc:mga08y16_41461_c1 | 3300050511 | Bacteria | 4822 |
| 1313 | nmdc:mga08y16_5010_c1 | 3300050511 | Bacteria | 13856 |
| 1314 | nmdc:mga0n895_1127766_c1 | 3300050512 | Bacteria | 761 |
| 1315 | nmdc:mga0n895_175188_c1 | 3300050512 | Bacteria | 2176 |
| 1316 | nmdc:mga0n895_1869_c1 | 3300050512 | Bacteria | 16078 |
| 1317 | nmdc:mga0n895_22756_c1 | 3300050512 | Bacteria | 5878 |
| 1318 | nmdc:mga0n895_286906_c1 | 3300050512 | Bacteria | 1669 |
| 1319 | nmdc:mga0n895_309956_c1 | 3300050512 | Bacteria | 1600 |
| 1320 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 1321 | nmdc:mga0rr50_123619_c1 | 3300050513 | Bacteria | 2063 |
| 1322 | nmdc:mga0rr50_199664_c1 | 3300050513 | Bacteria | 1643 |
| 1323 | nmdc:mga0rr50_27329_c1 | 3300050513 | Bacteria | 3993 |
| 1324 | nmdc:mga0rr50_2956_c1 | 3300050513 | Bacteria | 9720 |
| 1325 | nmdc:mga0rr50_74403_c1 | 3300050513 | Bacteria | 2600 |
| 1326 | nmdc:mga08x19_165932_c1 | 3300050514 | Bacteria | 1501 |
| 1327 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 1328 | nmdc:mga08x19_376432_c1 | 3300050514 | Bacteria | 994 |
| 1329 | nmdc:mga0a205_1191_c1 | 3300050515 | Bacteria | 21722 |
| 1330 | nmdc:mga0a205_135893_c1 | 3300050515 | Bacteria | 2359 |
| 1331 | nmdc:mga0a205_2311_c2 | 3300050515 | Bacteria | 4611 |
| 1332 | nmdc:mga0a205_235151_c1 | 3300050515 | Bacteria | 1714 |
| 1333 | nmdc:mga0a205_258877_c1 | 3300050515 | Bacteria | 1618 |
| 1334 | nmdc:mga0a205_306294_c1 | 3300050515 | Bacteria | 1461 |
| 1335 | nmdc:mga0a205_332195_c1 | 3300050515 | Bacteria | 1390 |
| 1336 | nmdc:mga0sz30_112583_c1 | 3300050516 | Bacteria | 1193 |
| 1337 | nmdc:mga0sz30_14303_c1 | 3300050516 | Bacteria | 3121 |
| 1338 | Ga0495601_0000109 | 3300053077 | Bacteria | 45069 |
| 1339 | Ga0495601_0037587 | 3300053077 | Bacteria | 3027 |
| 1340 | Ga0495601_0038389 | 3300053077 | Bacteria | 2995 |
| 1341 | Ga0495601_0042078 | 3300053077 | Bacteria | 2865 |
| 1342 | Ga0495601_0372470 | 3300053077 | Bacteria | 927 |
| 1343 | Ga0495601_0609420 | 3300053077 | Bacteria | 700 |
| 1344 | Ga0495601_0625712 | 3300053077 | Bacteria | 689 |
| 1345 | Ga0495612_0005214 | 3300053078 | Bacteria | 5370 |
| 1346 | Ga0495612_0014811 | 3300053078 | Bacteria | 3128 |
| 1347 | Ga0495612_0038255 | 3300053078 | Bacteria | 1949 |
| 1348 | Ga0495612_0044556 | 3300053078 | Bacteria | 1815 |
| 1349 | Ga0495612_0151894 | 3300053078 | Bacteria | 1008 |
| 1350 | Ga0495655_0074355 | 3300053083 | Bacteria | 957 |
| 1351 | Ga0495595_0001271 | 3300053084 | Bacteria | 9824 |
| 1352 | Ga0495595_0001369 | 3300053084 | Bacteria | 9461 |
| 1353 | Ga0495595_0008163 | 3300053084 | Bacteria | 4294 |
| 1354 | Ga0495595_0041930 | 3300053084 | Bacteria | 2096 |
| 1355 | Ga0495595_0101668 | 3300053084 | Bacteria | 1388 |
| 1356 | Ga0495595_0155945 | 3300053084 | Bacteria | 1125 |
| 1357 | Ga0495595_0245971 | 3300053084 | Unclassified | 895 |
| 1358 | Ga0495619_0000289 | 3300053085 | Bacteria | 35778 |
| 1359 | Ga0495619_0000662 | 3300053085 | Bacteria | 22563 |
| 1360 | Ga0495619_0004922 | 3300053085 | Bacteria | 8479 |
| 1361 | Ga0495619_0015029 | 3300053085 | Bacteria | 4892 |
| 1362 | Ga0495619_0045367 | 3300053085 | Bacteria | 2888 |
| 1363 | Ga0495619_0156658 | 3300053085 | Bacteria | 1572 |
| 1364 | Ga0495619_0288449 | 3300053085 | Bacteria | 1137 |
| 1365 | Ga0495619_0683489 | 3300053085 | Bacteria | 698 |
| 1366 | Ga0500643_026811 | 3300053087 | Bacteria | 1799 |
| 1367 | Ga0500644_0000980 | 3300053088 | Bacteria | 8899 |
| 1368 | Ga0500651_0002970 | 3300053093 | Bacteria | 9141 |
| 1369 | Ga0500651_0046098 | 3300053093 | Bacteria | 2742 |
| 1370 | Ga0500651_0364583 | 3300053093 | Bacteria | 818 |
| 1371 | Ga0500593_012871 | 3300053117 | Bacteria | 3557 |
| 1372 | Ga0500593_197068 | 3300053117 | Bacteria | 731 |
| 1373 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 1374 | Ga0500595_019733 | 3300053119 | Bacteria | 2440 |
| 1375 | Ga0500652_005604 | 3300053131 | Bacteria | 3971 |
| 1376 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1377 | Ga0500616_0026394 | 3300053153 | Bacteria | 3215 |
| 1378 | Ga0500616_0133313 | 3300053153 | Bacteria | 1171 |
| 1379 | Ga0500624_033404 | 3300053157 | Bacteria | 895 |
| 1380 | Ga0500627_0038110 | 3300053158 | Bacteria | 2053 |
| 1381 | Ga0500636_0018707 | 3300053177 | Bacteria | 4096 |
| 1382 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 1383 | Ga0501084_0061986 | 3300054114 | Bacteria | 3131 |
| 1384 | Ga0501084_0150577 | 3300054114 | Bacteria | 1961 |
| 1385 | Ga0501084_0314838 | 3300054114 | Bacteria | 1322 |
| 1386 | Ga0501084_0372401 | 3300054114 | Bacteria | 1207 |
| 1387 | Ga0501082_0120885 | 3300060353 | Bacteria | 2270 |
| 1388 | Ga0501082_0272586 | 3300060353 | Bacteria | 1473 |
| 1389 | Ga0501082_0822662 | 3300060353 | Bacteria | 812 |
| 1390 | 2643755885 | 2643221547 | Bacteria | 4740017 |
| 1391 | 2841915816 | 2841911363 | Bacteria | 6173697 |
| 1392 | 2841921803 | 2841917233 | Bacteria | 6173500 |
| 1393 | 2851187309 | 2851182111 | Bacteria | 6047226 |
| 1394 | Ga0265337_1073152 | |||
| 1395 | 2214745219 | |||
| 1396 | ARSoilYngRDRAFT_c00268 | |||
| 1397 | ARcpr5yngRDRAFT_c000083 | |||
| 1398 | ARcpr5yngRDRAFT_c000130 | |||
| 1399 | ARSoilOldRDRAFT_c000077 | |||
| 1400 | ARCol0oldRDRAFT_c00092 | |||
| 1401 | ARCol0yngRDRAFT_1000003 | |||
| 1402 | JGI24032J14994_100580 | |||
| 1403 | JGI24736J21556_1009077 | |||
| 1404 | JGI24741J21665_1031641 | |||
| 1405 | JGI24752J21851_1002641 | |||
| 1406 | JGI24739J22299_10002161 | |||
| 1407 | JGI24739J22299_10035227 | |||
| 1408 | JGI24737J22298_10002605 | |||
| 1409 | JGI24737J22298_10004159 | |||
| 1410 | JGI24743J22301_10012659 | |||
| 1411 | JGI24750J21931_1000256 | |||
| 1412 | JGI24750J21931_1012825 | |||
| 1413 | JGI24745J21846_1000134 | |||
| 1414 | JGI24748J21848_1000381 | |||
| 1415 | JGI24738J21930_10000425 | |||
| 1416 | JGI24749J21850_1002375 | |||
| 1417 | JGI24744J21845_10006961 | |||
| 1418 | JGI24035J26624_1000030 | |||
| 1419 | JGI24742J22300_10005249 | |||
| 1420 | Ga0065716_1001562 | |||
| 1421 | Ga0065704_10136145 | |||
| 1422 | Ga0065712_10000247 | |||
| 1423 | Ga0065712_10069581 | |||
| 1424 | Ga0065712_10086250 | |||
| 1425 | Ga0065715_10008812 | |||
| 1426 | Ga0070658_10170892 | |||
| 1427 | Ga0070658_10889140 | |||
| 1428 | Ga0070676_10000036 | |||
| 1429 | Ga0070676_10018948 | |||
| 1430 | Ga0070676_10517690 | |||
| 1431 | Ga0070683_100002049 | |||
| 1432 | Ga0070683_100148974 | |||
| 1433 | Ga0070690_100000402 | |||
| 1434 | Ga0070690_100011862 | |||
| 1435 | Ga0070690_100372751 | |||
| 1436 | Ga0070670_100003778 | |||
| 1437 | Ga0070670_100043329 | |||
| 1438 | Ga0070670_100364312 | |||
| 1439 | Ga0070670_100595565 | |||
| 1440 | Ga0070670_101127509 | |||
| 1441 | Ga0070677_10000104 | |||
| 1442 | Ga0070677_10066484 | |||
| 1443 | Ga0068869_100000087 | |||
| 1444 | Ga0068869_100276540 | |||
| 1445 | Ga0070666_10014755 | |||
| 1446 | Ga0070666_10019207 | |||
| 1447 | Ga0070666_10109098 | |||
| 1448 | Ga0070680_100003276 | |||
| 1449 | Ga0070680_100014863 | |||
| 1450 | Ga0070680_100095640 | |||
| 1451 | Ga0070680_100177020 | |||
| 1452 | Ga0070680_100231949 | |||
| 1453 | Ga0070680_100495362 | |||
| 1454 | Ga0070682_100000341 | |||
| 1455 | Ga0070682_100049518 | |||
| 1456 | Ga0070682_100055051 | |||
| 1457 | Ga0070682_100102988 | |||
| 1458 | Ga0070682_100802027 | |||
| 1459 | Ga0068868_100019047 | |||
| 1460 | Ga0068868_100025389 | |||
| 1461 | Ga0068868_100060002 | |||
| 1462 | Ga0068868_100199902 | |||
| 1463 | Ga0068868_100221219 | |||
| 1464 | Ga0070660_100010783 | |||
| 1465 | Ga0070660_100290416 | |||
| 1466 | Ga0070660_100916569 | |||
| 1467 | Ga0070689_100002790 | |||
| 1468 | Ga0070689_100015611 | |||
| 1469 | Ga0070689_100020143 | |||
| 1470 | Ga0070689_100038629 | |||
| 1471 | Ga0070689_100916368 | |||
| 1472 | Ga0070691_10000518 | |||
| 1473 | Ga0070687_100003185 | |||
| 1474 | Ga0070687_100121740 | |||
| 1475 | Ga0070687_100227625 | |||
| 1476 | Ga0070661_100000017 | |||
| 1477 | Ga0070692_10003914 | |||
| 1478 | Ga0070692_10008342 | |||
| 1479 | Ga0070692_10017545 | |||
| 1480 | Ga0070668_100001356 | |||
| 1481 | Ga0070668_100024267 | |||
| 1482 | Ga0070668_100390334 | |||
| 1483 | Ga0070668_101190619 | |||
| 1484 | Ga0070669_100000217 | |||
| 1485 | Ga0070669_100020733 | |||
| 1486 | Ga0070669_100038543 | |||
| 1487 | Ga0070669_100401675 | |||
| 1488 | Ga0070669_100631587 | |||
| 1489 | Ga0070675_100000088 | |||
| 1490 | Ga0070675_100083481 | |||
| 1491 | Ga0070675_100355553 | |||
| 1492 | Ga0070675_100371770 | |||
| 1493 | Ga0070671_100000768 | |||
| 1494 | Ga0070671_100009332 | |||
| 1495 | Ga0070671_100051153 | |||
| 1496 | Ga0070671_100063167 | |||
| 1497 | Ga0070674_100000623 | |||
| 1498 | Ga0070674_100142650 | |||
| 1499 | Ga0070674_100886731 | |||
| 1500 | Ga0070673_100000239 | |||
| 1501 | Ga0070673_100246369 | |||
| 1502 | Ga0070688_100000084 | |||
| 1503 | Ga0070688_100051206 | |||
| 1504 | Ga0070688_100055447 | |||
| 1505 | Ga0070688_100060447 | |||
| 1506 | Ga0070688_100150674 | |||
| 1507 | Ga0070688_100340644 | |||
| 1508 | Ga0070659_100000252 | |||
| 1509 | Ga0070659_100078449 | |||
| 1510 | Ga0070667_100003023 | |||
| 1511 | Ga0070667_100073477 | |||
| 1512 | Ga0070667_100095412 | |||
| 1513 | Ga0070667_100324028 | |||
| 1514 | Ga0070667_100463445 | |||
| 1515 | Ga0070703_10082766 | |||
| 1516 | Ga0070709_10000855 | |||
| 1517 | Ga0070709_10019494 | |||
| 1518 | Ga0070709_10385576 | |||
| 1519 | Ga0070709_10679134 | |||
| 1520 | Ga0070709_11140377 | |||
| 1521 | Ga0070714_100027442 | |||
| 1522 | Ga0070714_100155351 | |||
| 1523 | Ga0070714_100282856 | |||
| 1524 | Ga0070713_100002359 | |||
| 1525 | Ga0070713_100004066 | |||
| 1526 | Ga0070713_100028260 | |||
| 1527 | Ga0070713_100028319 | |||
| 1528 | Ga0070713_100293816 | |||
| 1529 | Ga0070713_100332468 | |||
| 1530 | Ga0070710_10003385 | |||
| 1531 | Ga0070710_10005726 | |||
| 1532 | Ga0070710_10010156 | |||
| 1533 | Ga0070701_10010531 | |||
| 1534 | Ga0070701_10021527 | |||
| 1535 | Ga0070701_10077963 | |||
| 1536 | Ga0070701_10167933 | |||
| 1537 | Ga0070711_100048712 | |||
| 1538 | Ga0070711_100049571 | |||
| 1539 | Ga0070711_100163935 | |||
| 1540 | Ga0070711_100239142 | |||
| 1541 | Ga0070711_100436722 | |||
| 1542 | Ga0070711_100531250 | |||
| 1543 | Ga0070705_100000425 | |||
| 1544 | Ga0070705_100138476 | |||
| 1545 | Ga0070705_100175418 | |||
| 1546 | Ga0070705_100552977 | |||
| 1547 | Ga0070700_100000370 | |||
| 1548 | Ga0070694_100000401 | |||
| 1549 | Ga0070694_100039756 | |||
| 1550 | Ga0070708_100004439 | |||
| 1551 | Ga0070663_100000415 | |||
| 1552 | Ga0070663_100064097 | |||
| 1553 | Ga0070663_100110725 | |||
| 1554 | Ga0070678_100000053 | |||
| 1555 | Ga0070678_100026479 | |||
| 1556 | Ga0070662_100003931 | |||
| 1557 | Ga0070662_100008216 | |||
| 1558 | Ga0070662_100042716 | |||
| 1559 | Ga0070662_100371112 | |||
| 1560 | Ga0070681_10000493 | |||
| 1561 | Ga0070681_10004194 | |||
| 1562 | Ga0070681_10051048 | |||
| 1563 | Ga0070681_10191691 | |||
| 1564 | Ga0070681_10652738 | |||
| 1565 | Ga0070681_10721152 | |||
| 1566 | Ga0068867_100001581 | |||
| 1567 | Ga0068867_100341265 | |||
| 1568 | Ga0070685_10002253 | |||
| 1569 | Ga0070685_10054089 | |||
| 1570 | Ga0070685_10363514 | |||
| 1571 | Ga0070707_100473347 | |||
| 1572 | Ga0070707_100514385 | |||
| 1573 | Ga0070699_100238999 | |||
| 1574 | Ga0070699_100833602 | |||
| 1575 | Ga0070679_100000679 | |||
| 1576 | Ga0070679_100009527 | |||
| 1577 | Ga0070679_100117175 | |||
| 1578 | Ga0070679_100533222 | |||
| 1579 | Ga0070679_100770342 | |||
| 1580 | Ga0070679_100783630 | |||
| 1581 | Ga0070679_100801946 | |||
| 1582 | Ga0070679_100827510 | |||
| 1583 | Ga0070684_100000144 | |||
| 1584 | Ga0070684_100019502 | |||
| 1585 | Ga0070684_100182845 | |||
| 1586 | Ga0070684_100243601 | |||
| 1587 | Ga0070697_100007453 | |||
| 1588 | Ga0070697_100107999 | |||
| 1589 | Ga0068853_100005864 | |||
| 1590 | Ga0068853_100274899 | |||
| 1591 | Ga0068853_100376611 | |||
| 1592 | Ga0068853_101180286 | |||
| 1593 | Ga0070672_100000014 | |||
| 1594 | Ga0070672_100081221 | |||
| 1595 | Ga0070686_100002767 | |||
| 1596 | Ga0070686_100004823 | |||
| 1597 | Ga0070686_100022707 | |||
| 1598 | Ga0070695_100000743 | |||
| 1599 | Ga0070695_100016812 | |||
| 1600 | Ga0070695_100057992 | |||
| 1601 | Ga0070696_100000918 | |||
| 1602 | Ga0070696_100042514 | |||
| 1603 | Ga0070696_100158961 | |||
| 1604 | Ga0070696_100855961 | |||
| 1605 | Ga0070693_100000141 | |||
| 1606 | Ga0070693_100046083 | |||
| 1607 | Ga0070693_100049958 | |||
| 1608 | Ga0070693_100524810 | |||
| 1609 | Ga0070665_100142534 | |||
| 1610 | Ga0070665_100164036 | |||
| 1611 | Ga0070665_100211546 | |||
| 1612 | Ga0070665_100731487 | |||
| 1613 | Ga0070704_100018885 | |||
| 1614 | Ga0070704_100027667 | |||
| 1615 | Ga0070704_100176643 | |||
| 1616 | Ga0070704_100303129 | |||
| 1617 | Ga0068855_100009106 | |||
| 1618 | Ga0068855_100116787 | |||
| 1619 | Ga0068855_100495601 | |||
| 1620 | Ga0068855_101402648 | |||
| 1621 | Ga0070664_100000816 | |||
| 1622 | Ga0070664_100010078 | |||
| 1623 | Ga0070664_100124438 | |||
| 1624 | Ga0070664_100353180 | |||
| 1625 | Ga0070664_100499401 | |||
| 1626 | Ga0070664_101091374 | |||
| 1627 | Ga0068857_100000567 | |||
| 1628 | Ga0068857_100218374 | |||
| 1629 | Ga0068857_100259124 | |||
| 1630 | Ga0068854_100000168 | |||
| 1631 | Ga0068854_100012177 | |||
| 1632 | Ga0068854_100080084 | |||
| 1633 | Ga0068856_100000932 | |||
| 1634 | Ga0068856_100186409 | |||
| 1635 | Ga0068856_100412317 | |||
| 1636 | Ga0068856_100530563 | |||
| 1637 | Ga0070702_100000857 | |||
| 1638 | Ga0070702_100009999 | |||
| 1639 | Ga0070702_100090498 | |||
| 1640 | Ga0070702_100118062 | |||
| 1641 | Ga0068852_100002066 | |||
| 1642 | Ga0068852_100045878 | |||
| 1643 | Ga0068852_100814987 | |||
| 1644 | Ga0068859_100012990 | |||
| 1645 | Ga0068859_100089849 | |||
| 1646 | Ga0068859_100096223 | |||
| 1647 | Ga0068859_100135079 | |||
| 1648 | Ga0068859_100187426 | |||
| 1649 | Ga0068859_100641823 | |||
| 1650 | Ga0068864_100000980 | |||
| 1651 | Ga0068864_100012023 | |||
| 1652 | Ga0068864_100036853 | |||
| 1653 | Ga0068864_100216411 | |||
| 1654 | Ga0068866_10000264 | |||
| 1655 | Ga0068861_100000315 | |||
| 1656 | Ga0068861_100012399 | |||
| 1657 | Ga0068851_10164085 | |||
| 1658 | Ga0068870_10000002 | |||
| 1659 | Ga0068863_100001290 | |||
| 1660 | Ga0068863_100009966 | |||
| 1661 | Ga0068863_100950809 | |||
| 1662 | Ga0068858_100000356 | |||
| 1663 | Ga0068858_100008336 | |||
| 1664 | Ga0068858_100147954 | |||
| 1665 | Ga0068858_100226555 | |||
| 1666 | Ga0068860_100000747 | |||
| 1667 | Ga0068860_100012816 | |||
| 1668 | Ga0068860_100037658 | |||
| 1669 | Ga0068860_100086784 | |||
| 1670 | Ga0068860_100124678 | |||
| 1671 | Ga0068860_100136158 | |||
| 1672 | Ga0068862_100020195 | |||
| 1673 | Ga0068862_100037959 | |||
| 1674 | Ga0068862_100115302 | |||
| 1675 | Ga0068862_100178430 | |||
| 1676 | Ga0081455_10000048 | |||
| 1677 | Ga0081455_10000664 | |||
| 1678 | Ga0081455_10004941 | |||
| 1679 | Ga0081455_10014914 | |||
| 1680 | Ga0081455_10094609 | |||
| 1681 | Ga0081455_10308739 | |||
| 1682 | Ga0081540_1012959 | |||
| 1683 | Ga0070717_10000150 | |||
| 1684 | Ga0070717_10009878 | |||
| 1685 | Ga0070717_10088122 | |||
| 1686 | Ga0070717_10230589 | |||
| 1687 | Ga0070717_10250796 | |||
| 1688 | Ga0070717_10624320 | |||
| 1689 | Ga0075365_10002448 | |||
| 1690 | Ga0075365_10036248 | |||
| 1691 | Ga0075365_10067547 | |||
| 1692 | Ga0075365_10203384 | |||
| 1693 | Ga0075368_10009470 | |||
| 1694 | Ga0075368_10229286 | |||
| 1695 | Ga0075363_100073339 | |||
| 1696 | Ga0075363_100289601 | |||
| 1697 | Ga0075363_100314400 | |||
| 1698 | Ga0075364_10140177 | |||
| 1699 | Ga0075364_10275776 | |||
| 1700 | Ga0075432_10010169 | |||
| 1701 | Ga0070715_10001585 | |||
| 1702 | Ga0070715_10004724 | |||
| 1703 | Ga0070715_10074547 | |||
| 1704 | Ga0070715_10580149 | |||
| 1705 | Ga0070716_100035826 | |||
| 1706 | Ga0070716_100077474 | |||
| 1707 | Ga0070712_100010775 | |||
| 1708 | Ga0070712_100053540 | |||
| 1709 | Ga0070712_100119662 | |||
| 1710 | Ga0075362_10073018 | |||
| 1711 | Ga0075367_10011389 | |||
| 1712 | Ga0075367_10012917 | |||
| 1713 | Ga0075367_10171380 | |||
| 1714 | Ga0075367_10294419 | |||
| 1715 | Ga0075369_10028730 | |||
| 1716 | Ga0075366_10086498 | |||
| 1717 | Ga0075366_10214012 | |||
| 1718 | Ga0075366_10249666 | |||
| 1719 | Ga0075366_10310131 | |||
| 1720 | Ga0097621_100000144 | |||
| 1721 | Ga0097621_100100059 | |||
| 1722 | Ga0097621_100215118 | |||
| 1723 | Ga0097621_100588697 | |||
| 1724 | Ga0075370_10224751 | |||
| 1725 | Ga0075370_10484879 | |||
| 1726 | Ga0068871_100000110 | |||
| 1727 | Ga0068871_100018783 | |||
| 1728 | Ga0068871_100144775 | |||
| 1729 | Ga0068871_100487910 | |||
| 1730 | Ga0075428_100005798 | |||
| 1731 | Ga0075428_100031464 | |||
| 1732 | Ga0075428_100234676 | |||
| 1733 | Ga0075428_100871418 | |||
| 1734 | Ga0075430_100000627 | |||
| 1735 | Ga0075430_100001224 | |||
| 1736 | Ga0075430_100177708 | |||
| 1737 | Ga0075431_100004676 | |||
| 1738 | Ga0075431_100148367 | |||
| 1739 | Ga0075431_100429820 | |||
| 1740 | Ga0075433_10000615 | |||
| 1741 | Ga0075433_10127836 | |||
| 1742 | Ga0075433_10180242 | |||
| 1743 | Ga0075433_10187026 | |||
| 1744 | Ga0075433_10237603 | |||
| 1745 | Ga0075433_10264156 | |||
| 1746 | Ga0075433_10606688 | |||
| 1747 | Ga0075434_100000084 | |||
| 1748 | Ga0075434_100011350 | |||
| 1749 | Ga0075434_100077423 | |||
| 1750 | Ga0075434_100084703 | |||
| 1751 | Ga0075434_100163511 | |||
| 1752 | Ga0075434_100216920 | |||
| 1753 | Ga0075434_100265184 | |||
| 1754 | Ga0075434_100524731 | |||
| 1755 | Ga0075434_101030072 | |||
| 1756 | Ga0075429_100000877 | |||
| 1757 | Ga0075429_100055477 | |||
| 1758 | Ga0075429_100061051 | |||
| 1759 | Ga0068865_100000066 | |||
| 1760 | Ga0068865_100120679 | |||
| 1761 | Ga0068865_100144822 | |||
| 1762 | Ga0068865_100158837 | |||
| 1763 | Ga0068865_100285756 | |||
| 1764 | Ga0075436_100003795 | |||
| 1765 | Ga0075436_100177044 | |||
| 1766 | Ga0075436_100550516 | |||
| 1767 | Ga0075436_100721531 | |||
| 1768 | Ga0097620_100012990 | |||
| 1769 | Ga0097620_100089847 | |||
| 1770 | Ga0097620_100096221 | |||
| 1771 | Ga0097620_100135073 | |||
| 1772 | Ga0097620_100187433 | |||
| 1773 | Ga0097620_100641891 | |||
| 1774 | Ga0075435_100018081 | |||
| 1775 | Ga0075435_100078801 | |||
| 1776 | Ga0075435_100224133 | |||
| 1777 | Ga0075435_100324960 | |||
| 1778 | Ga0075435_100902142 | |||
| 1779 | Ga0099794_10004157 | |||
| 1780 | Ga0105251_10034792 | |||
| 1781 | Ga0105244_10073449 | |||
| 1782 | Ga0105250_10082372 | |||
| 1783 | Ga0105240_10038616 | |||
| 1784 | Ga0111539_10000423 | |||
| 1785 | Ga0111539_10000652 | |||
| 1786 | Ga0111539_10001255 | |||
| 1787 | Ga0111539_10030559 | |||
| 1788 | Ga0111539_11463397 | |||
| 1789 | Ga0105245_10000287 | |||
| 1790 | Ga0105245_10051645 | |||
| 1791 | Ga0105247_10001223 | |||
| 1792 | Ga0105247_10013098 | |||
| 1793 | Ga0105247_10073847 | |||
| 1794 | Ga0105247_10078939 | |||
| 1795 | Ga0105247_10106407 | |||
| 1796 | Ga0114129_10003089 | |||
| 1797 | Ga0114129_10005652 | |||
| 1798 | Ga0114129_10077475 | |||
| 1799 | Ga0114129_10148603 | |||
| 1800 | Ga0114129_10610271 | |||
| 1801 | Ga0105243_10000695 | |||
| 1802 | Ga0105243_10003814 | |||
| 1803 | Ga0105243_10061492 | |||
| 1804 | Ga0105243_10230434 | |||
| 1805 | Ga0105243_11245403 | |||
| 1806 | Ga0105241_10002331 | |||
| 1807 | Ga0105241_10048155 | |||
| 1808 | Ga0105241_10072270 | |||
| 1809 | Ga0105241_10299163 | |||
| 1810 | Ga0105242_10000792 | |||
| 1811 | Ga0105242_10018593 | |||
| 1812 | Ga0105242_10054721 | |||
| 1813 | Ga0105242_10150904 | |||
| 1814 | Ga0105242_10427289 | |||
| 1815 | Ga0105248_10000535 | |||
| 1816 | Ga0105248_10038316 | |||
| 1817 | Ga0105248_10076310 | |||
| 1818 | Ga0105248_10140470 | |||
| 1819 | Ga0105248_10240170 | |||
| 1820 | Ga0105248_10353030 | |||
| 1821 | Ga0105237_10002795 | |||
| 1822 | Ga0105237_10018807 | |||
| 1823 | Ga0105237_10067802 | |||
| 1824 | Ga0105238_10155544 | |||
| 1825 | Ga0105249_10000279 | |||
| 1826 | Ga0105249_10003839 | |||
| 1827 | Ga0105249_10268577 | |||
| 1828 | Ga0105249_10619499 | |||
| 1829 | Ga0105239_10001686 | |||
| 1830 | Ga0105239_10161900 | |||
| 1831 | Ga0105239_10497614 | |||
| 1832 | Ga0105239_11163342 | |||
| 1833 | Ga0105246_10000095 | |||
| 1834 | Ga0105246_10207203 | |||
| 1835 | Ga0105246_10265856 | |||
| 1836 | Ga0105246_10369344 | |||
| 1837 | Ga0105246_10545677 | |||
| 1838 | Ga0157328_1003476 | |||
| 1839 | Ga0157343_1003390 | |||
| 1840 | Ga0157322_1003278 | |||
| 1841 | Ga0157335_1000591 | |||
| 1842 | Ga0157373_10050116 | |||
| 1843 | Ga0157373_10274703 | |||
| 1844 | Ga0157370_10526656 | |||
| 1845 | Ga0157369_10751324 | |||
| 1846 | Ga0157374_10001348 | |||
| 1847 | Ga0157374_10023716 | |||
| 1848 | Ga0157374_10048326 | |||
| 1849 | Ga0157374_10545847 | |||
| 1850 | Ga0157378_10000956 | |||
| 1851 | Ga0157378_10096068 | |||
| 1852 | Ga0157378_10151228 | |||
| 1853 | Ga0157378_10183606 | |||
| 1854 | Ga0163162_10003795 | |||
| 1855 | Ga0163162_10043114 | |||
| 1856 | Ga0163162_10120769 | |||
| 1857 | Ga0163162_10135319 | |||
| 1858 | Ga0163162_11162687 | |||
| 1859 | Ga0157372_10009222 | |||
| 1860 | Ga0157375_10001973 | |||
| 1861 | Ga0157375_10014988 | |||
| 1862 | Ga0157375_10348543 | |||
| 1863 | Ga0157375_10355202 | |||
| 1864 | Ga0157375_10980502 | |||
| 1865 | Ga0157375_11104255 | |||
| 1866 | Ga0163163_10030456 | |||
| 1867 | Ga0163163_10043566 | |||
| 1868 | Ga0163163_10343523 | |||
| 1869 | Ga0163163_10368245 | |||
| 1870 | Ga0163163_10462006 | |||
| 1871 | Ga0163163_11298437 | |||
| 1872 | Ga0157380_10000052 | |||
| 1873 | Ga0157377_10000076 | |||
| 1874 | Ga0157377_10001911 | |||
| 1875 | Ga0157377_10145717 | |||
| 1876 | Ga0157379_10000060 | |||
| 1877 | Ga0157379_10007831 | |||
| 1878 | Ga0157379_10096282 | |||
| 1879 | Ga0157379_10278776 | |||
| 1880 | Ga0157379_10283564 | |||
| 1881 | Ga0157379_10889628 | |||
| 1882 | Ga0157376_10000141 | |||
| 1883 | Ga0157376_10154115 | |||
| 1884 | Ga0157376_10393683 | |||
| 1885 | Ga0157376_10671948 | |||
| 1886 | Ga0163161_10000739 | |||
| 1887 | Ga0163161_10213178 | |||
| 1888 | Ga0213872_10033977 | |||
| 1889 | Ga0207666_1000005 | |||
| 1890 | Ga0207666_1010786 | |||
| 1891 | Ga0207673_1000002 | |||
| 1892 | Ga0209025_1004253 | |||
| 1893 | Ga0209025_1061468 | |||
| 1894 | Ga0207426_1060773 | |||
| 1895 | Ga0207697_10000011 | |||
| 1896 | Ga0207697_10005761 | |||
| 1897 | Ga0207697_10114206 | |||
| 1898 | Ga0207656_10098667 | |||
| 1899 | Ga0207656_10201255 | |||
| 1900 | Ga0207713_1067930 | |||
| 1901 | Ga0207653_10013990 | |||
| 1902 | Ga0207682_10000051 | |||
| 1903 | Ga0207682_10073811 | |||
| 1904 | Ga0207692_10001465 | |||
| 1905 | Ga0207692_10012868 | |||
| 1906 | Ga0207692_10014564 | |||
| 1907 | Ga0207692_10030425 | |||
| 1908 | Ga0207642_10000176 | |||
| 1909 | Ga0207642_10006839 | |||
| 1910 | Ga0207642_10237429 | |||
| 1911 | Ga0207710_10001284 | |||
| 1912 | Ga0207710_10056174 | |||
| 1913 | Ga0207688_10000001 | |||
| 1914 | Ga0207688_10002053 | |||
| 1915 | Ga0207688_10045448 | |||
| 1916 | Ga0207688_10203022 | |||
| 1917 | Ga0207680_10002846 | |||
| 1918 | Ga0207680_10112541 | |||
| 1919 | Ga0207647_10001714 | |||
| 1920 | Ga0207647_10018964 | |||
| 1921 | Ga0207647_10037247 | |||
| 1922 | Ga0207685_10003993 | |||
| 1923 | Ga0207685_10103676 | |||
| 1924 | Ga0207699_10001161 | |||
| 1925 | Ga0207699_10008926 | |||
| 1926 | Ga0207699_10142591 | |||
| 1927 | Ga0207699_10532169 | |||
| 1928 | Ga0207645_10000121 | |||
| 1929 | Ga0207645_10023007 | |||
| 1930 | Ga0207645_10057479 | |||
| 1931 | Ga0207645_10127211 | |||
| 1932 | Ga0207643_10000009 | |||
| 1933 | Ga0207643_10012102 | |||
| 1934 | Ga0207705_10194821 | |||
| 1935 | Ga0207684_10521990 | |||
| 1936 | Ga0207654_10001894 | |||
| 1937 | Ga0207654_10121809 | |||
| 1938 | Ga0207707_10000840 | |||
| 1939 | Ga0207707_10140061 | |||
| 1940 | Ga0207707_10443319 | |||
| 1941 | Ga0207695_10535660 | |||
| 1942 | Ga0207671_10007485 | |||
| 1943 | Ga0207671_10078861 | |||
| 1944 | Ga0207671_10180223 | |||
| 1945 | Ga0207693_10025810 | |||
| 1946 | Ga0207693_10038907 | |||
| 1947 | Ga0207693_10040439 | |||
| 1948 | Ga0207693_10078860 | |||
| 1949 | Ga0207693_10295908 | |||
| 1950 | Ga0207663_10005694 | |||
| 1951 | Ga0207663_10051011 | |||
| 1952 | Ga0207663_10108833 | |||
| 1953 | Ga0207663_10157529 | |||
| 1954 | Ga0207663_10170786 | |||
| 1955 | Ga0207663_10222951 | |||
| 1956 | Ga0207660_10000775 | |||
| 1957 | Ga0207660_10018073 | |||
| 1958 | Ga0207660_10028511 | |||
| 1959 | Ga0207660_10225066 | |||
| 1960 | Ga0207662_10002044 | |||
| 1961 | Ga0207662_10004796 | |||
| 1962 | Ga0207662_10178398 | |||
| 1963 | Ga0207662_10250135 | |||
| 1964 | Ga0207657_10002826 | |||
| 1965 | Ga0207649_10000052 | |||
| 1966 | Ga0207649_10050592 | |||
| 1967 | Ga0207649_10064835 | |||
| 1968 | Ga0207649_10523078 | |||
| 1969 | Ga0207652_10000508 | |||
| 1970 | Ga0207652_10151038 | |||
| 1971 | Ga0207652_10309318 | |||
| 1972 | Ga0207652_11079573 | |||
| 1973 | Ga0207646_10324433 | |||
| 1974 | Ga0207681_10000035 | |||
| 1975 | Ga0207681_10064800 | |||
| 1976 | Ga0207681_10200602 | |||
| 1977 | Ga0207694_10063243 | |||
| 1978 | Ga0207650_10000843 | |||
| 1979 | Ga0207650_10014221 | |||
| 1980 | Ga0207650_10121689 | |||
| 1981 | Ga0207650_10157767 | |||
| 1982 | Ga0207659_10000027 | |||
| 1983 | Ga0207659_10034538 | |||
| 1984 | Ga0207659_10135830 | |||
| 1985 | Ga0207659_10300663 | |||
| 1986 | Ga0207659_10508672 | |||
| 1987 | Ga0207687_10000231 | |||
| 1988 | Ga0207687_10211876 | |||
| 1989 | Ga0207687_10514438 | |||
| 1990 | Ga0207700_10000917 | |||
| 1991 | Ga0207700_10011686 | |||
| 1992 | Ga0207664_10020580 | |||
| 1993 | Ga0207644_10000676 | |||
| 1994 | Ga0207644_10001814 | |||
| 1995 | Ga0207644_10043827 | |||
| 1996 | Ga0207644_10054673 | |||
| 1997 | Ga0207690_10000148 | |||
| 1998 | Ga0207690_10116101 | |||
| 1999 | Ga0207690_10120447 | |||
| 2000 | Ga0207706_10000261 | |||
| 2001 | Ga0207706_10004416 | |||
| 2002 | Ga0207706_10009549 | |||
| 2003 | Ga0207706_10021020 | |||
| 2004 | Ga0207686_10000171 | |||
| 2005 | Ga0207686_10013538 | |||
| 2006 | Ga0207686_10020728 | |||
| 2007 | Ga0207686_10451846 | |||
| 2008 | Ga0207709_10000087 | |||
| 2009 | Ga0207709_10025934 | |||
| 2010 | Ga0207709_10129415 | |||
| 2011 | Ga0207709_10153199 | |||
| 2012 | Ga0207670_10000169 | |||
| 2013 | Ga0207670_10002052 | |||
| 2014 | Ga0207670_10142574 | |||
| 2015 | Ga0207670_10165003 | |||
| 2016 | Ga0207669_10000351 | |||
| 2017 | Ga0207669_10573935 | |||
| 2018 | Ga0207704_10000134 | |||
| 2019 | Ga0207665_10000333 | |||
| 2020 | Ga0207665_10016226 | |||
| 2021 | Ga0207691_10000106 | |||
| 2022 | Ga0207691_10003240 | |||
| 2023 | Ga0207691_10067921 | |||
| 2024 | Ga0207711_10002556 | |||
| 2025 | Ga0207711_10032985 | |||
| 2026 | Ga0207711_10069613 | |||
| 2027 | Ga0207711_10081860 | |||
| 2028 | Ga0207711_10156741 | |||
| 2029 | Ga0207711_10195645 | |||
| 2030 | Ga0207689_10000031 | |||
| 2031 | Ga0207689_10004674 | |||
| 2032 | Ga0207689_10082593 | |||
| 2033 | Ga0207689_10362319 | |||
| 2034 | Ga0207661_10000219 | |||
| 2035 | Ga0207661_10035787 | |||
| 2036 | Ga0207679_10000493 | |||
| 2037 | Ga0207679_10104199 | |||
| 2038 | Ga0207679_10127031 | |||
| 2039 | Ga0207679_10188150 | |||
| 2040 | Ga0207667_10006216 | |||
| 2041 | Ga0207667_10480892 | |||
| 2042 | Ga0207651_10001402 | |||
| 2043 | Ga0207651_10018651 | |||
| 2044 | Ga0207651_10028266 | |||
| 2045 | Ga0207651_10443064 | |||
| 2046 | Ga0207712_10000176 | |||
| 2047 | Ga0207712_10007977 | |||
| 2048 | Ga0207712_10103777 | |||
| 2049 | Ga0207668_10000191 | |||
| 2050 | Ga0207668_10371088 | |||
| 2051 | Ga0207640_10000126 | |||
| 2052 | Ga0207640_10006059 | |||
| 2053 | Ga0207640_10076121 | |||
| 2054 | Ga0207658_10007487 | |||
| 2055 | Ga0207658_10016720 | |||
| 2056 | Ga0207658_10017640 | |||
| 2057 | Ga0207658_10402159 | |||
| 2058 | Ga0207677_10008205 | |||
| 2059 | Ga0207677_10008615 | |||
| 2060 | Ga0207677_10068840 | |||
| 2061 | Ga0207703_10006871 | |||
| 2062 | Ga0207703_10061608 | |||
| 2063 | Ga0207703_10099815 | |||
| 2064 | Ga0207639_10000515 | |||
| 2065 | Ga0207639_10672891 | |||
| 2066 | Ga0207639_11333974 | |||
| 2067 | Ga0207678_10000137 | |||
| 2068 | Ga0207678_10036253 | |||
| 2069 | Ga0207678_10051389 | |||
| 2070 | Ga0207678_10113973 | |||
| 2071 | Ga0207678_10121219 | |||
| 2072 | Ga0207678_10268819 | |||
| 2073 | Ga0207708_10000250 | |||
| 2074 | Ga0207708_10004315 | |||
| 2075 | Ga0207708_10030828 | |||
| 2076 | Ga0207708_10127005 | |||
| 2077 | Ga0207702_10001067 | |||
| 2078 | Ga0207702_10094267 | |||
| 2079 | Ga0207702_10436146 | |||
| 2080 | Ga0207702_10464148 | |||
| 2081 | Ga0207702_10793372 | |||
| 2082 | Ga0207641_10000937 | |||
| 2083 | Ga0207641_10160534 | |||
| 2084 | Ga0207648_10000125 | |||
| 2085 | Ga0207648_10012120 | |||
| 2086 | Ga0207648_10041484 | |||
| 2087 | Ga0207676_10001547 | |||
| 2088 | Ga0207676_10007864 | |||
| 2089 | Ga0207676_10099568 | |||
| 2090 | Ga0207676_10745053 | |||
| 2091 | Ga0207674_10000095 | |||
| 2092 | Ga0207674_10134399 | |||
| 2093 | Ga0207675_100000140 | |||
| 2094 | Ga0207675_100010129 | |||
| 2095 | Ga0207675_100069049 | |||
| 2096 | Ga0207683_10000178 | |||
| 2097 | Ga0207683_10001447 | |||
| 2098 | Ga0207683_10006604 | |||
| 2099 | Ga0207683_10012980 | |||
| 2100 | Ga0207683_10085601 | |||
| 2101 | Ga0207683_10838065 | |||
| 2102 | Ga0207698_10001736 | |||
| 2103 | Ga0207698_10026726 | |||
| 2104 | Ga0207698_10133730 | |||
| 2105 | Ga0209973_1030935 | |||
| 2106 | Ga0210002_1000669 | |||
| 2107 | Ga0209983_1001836 | |||
| 2108 | Ga0209971_1004192 | |||
| 2109 | Ga0209966_1001385 | |||
| 2110 | Ga0209998_10003015 | |||
| 2111 | Ga0209813_10044685 | |||
| 2112 | Ga0209974_10001253 | |||
| 2113 | Ga0207428_10000037 | |||
| 2114 | Ga0207428_10000188 | |||
| 2115 | Ga0207428_10001468 | |||
| 2116 | Ga0268266_10020121 | |||
| 2117 | Ga0268266_10056797 | |||
| 2118 | Ga0268265_10000774 | |||
| 2119 | Ga0268265_10036525 | |||
| 2120 | Ga0268265_10293144 | |||
| 2121 | Ga0268264_10000467 | |||
| 2122 | Ga0268264_10028546 | |||
| 2123 | Ga0268264_10097079 | |||
| 2124 | Ga0268264_10611062 | |||
| 2125 | Ga0265338_10056007 | |||
| 2126 | Ga0265760_10047690 | |||
| 2127 | Ga0265325_10000049 | |||
| 2128 | Ga0265325_10048465 | |||
| 2129 | Ga0265325_10066017 | |||
| 2130 | Ga0265325_10190376 | |||
| 2131 | Ga0265340_10000678 | |||
| 2132 | Ga0265339_10000024 | |||
| 2133 | Ga0265339_10009168 | |||
| 2134 | Ga0265331_10008186 | |||
| 2135 | Ga0265316_10080236 | |||
| 2136 | Ga0307408_100353519 | |||
| 2137 | Ga0307408_100946749 | |||
| 2138 | Ga0265313_10000006 | |||
| 2139 | Ga0265313_10005135 | |||
| 2140 | Ga0265313_10032825 | |||
| 2141 | Ga0265313_10042538 | |||
| 2142 | Ga0316575_10035256 | |||
| 2143 | Ga0316575_10036030 | |||
| 2144 | Ga0265314_10002604 | |||
| 2145 | Ga0265314_10013825 | |||
| 2146 | Ga0265314_10268610 | |||
| 2147 | Ga0265342_10000137 | |||
| 2148 | Ga0265342_10218497 | |||
| 2149 | Ga0316578_10040741 | |||
| 2150 | Ga0307413_10395073 | |||
| 2151 | Ga0316583_10001781 | |||
| 2152 | Ga0373930_0000027 | |||
| 2153 | Ga0373930_0000968 | |||
| 2154 | Ga0373948_0000257 | |||
| 2155 | Ga0373948_0010562 | |||
| 2156 | Ga0373950_0004246 | |||
| 2157 | Ga0373958_0000466 | |||
| 2158 | Ga0373958_0023071 | |||
| 2159 | Ga0373958_0044846 | |||
| 2160 | Ga0373959_0000673 | |||
| 2161 | Ga0373959_0005008 | |||
| 2162 | Ga0373959_0033130 | |||
| 2163 | Ga0373959_0061399 | |||
| 2164 | Ga0373938_0000020 | |||
| 2165 | Ga0373938_0000687 | |||
| 2166 | Ga0373938_0027235 | |||
| 2167 | Ga0373938_0072251 | |||
| 2168 | Ga0373926_0006729 | |||
| 2169 | Ga0373926_0060964 | |||
| 2170 | Ga0373928_0000298 | |||
| 2171 | Ga0373928_0035620 | |||
| 2172 | Ga0373929_0001530 | |||
| 2173 | Ga0373929_0004695 | |||
| 2174 | Ga0373934_0044489 | |||
| 2175 | Ga0373934_0125899 | |||
| 2176 | Ga0373934_0149144 | |||
| 2177 | Ga0373940_0000080 | |||
| 2178 | Ga0373940_0002752 | |||
| 2179 | Ga0373944_0007398 | |||
| 2180 | Ga0373944_0010337 | |||
| 2181 | Ga0373944_0031157 | |||
| 2182 | Ga0373944_0053999 | |||
| 2183 | Ga0373944_0183739 | |||
| 2184 | Ga0373949_0000753 | |||
| 2185 | Ga0373949_0003030 | |||
| 2186 | Ga0373949_0012113 | |||
| 2187 | Ga0373951_0002017 | |||
| 2188 | Ga0373951_0003271 | |||
| 2189 | Ga0373952_0000333 | |||
| 2190 | Ga0373952_0001012 | |||
| 2191 | Ga0373923_0010840 | |||
| 2192 | Ga0373932_0000316 | |||
| 2193 | Ga0373932_0001502 | |||
| 2194 | Ga0373936_0042386 | |||
| 2195 | Ga0373936_0094973 | |||
| 2196 | Ga0373939_0000429 | |||
| 2197 | Ga0373939_0008875 | |||
| 2198 | Ga0373939_0038640 | |||
| 2199 | Ga0373941_0000079 | |||
| 2200 | Ga0373941_0000521 | |||
| 2201 | Ga0373941_0002321 | |||
| 2202 | Ga0373941_0137001 | |||
| 2203 | Ga0373953_0001317 | |||
| 2204 | Ga0373953_0107491 | |||
| 2205 | Ga0373954_0012919 | |||
| 2206 | Ga0373954_0067107 | |||
| 2207 | Ga0373954_0119985 | |||
| 2208 | Ga0373954_0146424 | |||
| 2209 | Ga0373954_0151421 | |||
| 2210 | Ga0373956_0025992 | |||
| 2211 | Ga0373956_0221834 | |||
| 2212 | Ga0373957_0001740 | |||
| 2213 | Ga0373957_0227145 | |||
| 2214 | Ga0373960_0000127 | |||
| 2215 | Ga0373960_0000335 | |||
| 2216 | Ga0373960_0051633 | |||
| 2217 | Ga0373943_0000221 | |||
| 2218 | Ga0373943_0010555 | |||
| 2219 | Ga0373943_0056155 | |||
| 2220 | Ga0373943_0212770 | |||
| 2221 | Ga0373946_0001071 | |||
| 2222 | Ga0373946_0009682 | |||
| 2223 | Ga0373946_0015697 | |||
| 2224 | Ga0373946_0040118 | |||
| 2225 | Ga0373946_0097955 | |||
| 2226 | Ga0373955_0015524 | |||
| 2227 | Ga0373955_0032173 | |||
| 2228 | Ga0373955_0045328 | |||
| 2229 | Ga0373955_0192120 | |||
| 2230 | Ga0373955_0240895 | |||
| 2231 | Ga0373955_0301113 | |||
| 2232 | Ga0373942_0000054 | |||
| 2233 | Ga0373942_0001029 | |||
| 2234 | Ga0373961_0000807 | |||
| 2235 | Ga0373961_0003357 | |||
| 2236 | Ga0373962_0000497 | |||
| 2237 | Ga0373962_0001199 | |||
| 2238 | Ga0373962_0040730 | |||
| 2239 | Ga0316574_0002183 | |||
| 2240 | Ga0373924_0013072 | |||
| 2241 | Ga0373924_0055722 | |||
| 2242 | Ga0373931_0000933 | |||
| 2243 | Ga0373931_0021889 | |||
| 2244 | Ga0373931_0049554 | |||
| 2245 | Ga0373931_0054793 | |||
| 2246 | Ga0373931_0425044 | |||
| 2247 | Ga0373935_0008813 | |||
| 2248 | Ga0373935_0049664 | |||
| 2249 | Ga0373935_0187959 | |||
| 2250 | Ga0373935_0278993 | |||
| 2251 | Ga0373927_0003813 | |||
| 2252 | Ga0373927_0007833 | |||
| 2253 | Ga0373933_0002449 | |||
| 2254 | Ga0373933_0158553 | |||
| 2255 | Ga0373947_0005403 | |||
| 2256 | Ga0373947_0026934 | |||
| 2257 | Ga0373947_0079875 | |||
| 2258 | Ga0373947_0094306 | |||
| 2259 | Ga0373947_0097765 | |||
| 2260 | Ga0373947_0139873 | |||
| 2261 | Ga0373947_0169259 | |||
| 2262 | Ga0373947_0488757 | |||
| 2263 | Ga0373937_0002996 | |||
| 2264 | Ga0373937_0008068 | |||
| 2265 | Ga0373937_0037813 | |||
| 2266 | Ga0373937_0046602 | |||
| 2267 | Ga0373937_0274390 | |||
| 2268 | Ga0373937_0288581 | |||
| 2269 | Ga0373937_0658258 | |||
| 2270 | Ga0316582_0043113 | |||
| 2271 | Ga0373925_0001261 | |||
| 2272 | Ga0373925_0044673 | |||
| 2273 | Ga0373925_0366647 | |||
| 2274 | Ga0395905_0465665 | |||
| 2275 | Ga0395901_0657198 | |||
| 2276 | Ga0242420_003012 | |||
| 2277 | Ga0242420_031031 | |||
| 2278 | Ga0436361_1078131 | |||
| 2279 | Ga0451789_0159984 | |||
| 2280 | Ga0439463_011909 | |||
| 2281 | Ga0450908_057568 | |||
| 2282 | Ga0439464_0040490 | |||
| 2283 | Ga0451577_0055660 | |||
| 2284 | Ga0453683_0120451 | |||
| 2285 | Ga0466966_0075038 | |||
| 2286 | Ga0453684_0239224 | |||
| 2287 | Ga0466968_0102605 | |||
| 2288 | Ga0466959_0055703 | |||
| 2289 | Ga0495617_056072 | |||
| 2290 | Ga0495592_0001840 | |||
| 2291 | Ga0495592_0016710 | |||
| 2292 | Ga0495592_0046904 | |||
| 2293 | Ga0495592_0093904 | |||
| 2294 | Ga0495592_0191214 | |||
| 2295 | Ga0495603_0003594 | |||
| 2296 | Ga0495603_0033217 | |||
| 2297 | Ga0495603_0294936 | |||
| 2298 | Ga0495629_0000269 | |||
| 2299 | Ga0495629_0044590 | |||
| 2300 | Ga0495629_0072185 | |||
| 2301 | Ga0495629_0080588 | |||
| 2302 | Ga0495629_0129307 | |||
| 2303 | Ga0495638_0056011 | |||
| 2304 | Ga0495641_0010670 | |||
| 2305 | Ga0495641_0012148 | |||
| 2306 | Ga0495641_0032921 | |||
| 2307 | Ga0495651_0005718 | |||
| 2308 | Ga0495651_0007532 | |||
| 2309 | Ga0495651_0074461 | |||
| 2310 | Ga0495653_0025117 | |||
| 2311 | Ga0495653_0142905 | |||
| 2312 | Ga0495653_0330526 | |||
| 2313 | Ga0495653_0499643 | |||
| 2314 | Ga0495580_0007748 | |||
| 2315 | Ga0495580_0009445 | |||
| 2316 | Ga0495582_0003928 | |||
| 2317 | Ga0495605_0177368 | |||
| 2318 | Ga0495605_0179619 | |||
| 2319 | Ga0495639_0011122 | |||
| 2320 | Ga0495662_0001657 | |||
| 2321 | Ga0495664_0000500 | |||
| 2322 | Ga0495664_0047659 | |||
| 2323 | Ga0495584_0003520 | |||
| 2324 | Ga0495585_0001825 | |||
| 2325 | Ga0495585_0052611 | |||
| 2326 | Ga0495585_0096301 | |||
| 2327 | Ga0495594_0004830 | |||
| 2328 | Ga0495594_0124775 | |||
| 2329 | Ga0495607_0034800 | |||
| 2330 | Ga0495607_0037558 | |||
| 2331 | Ga0495607_0160053 | |||
| 2332 | Ga0495608_0001268 | |||
| 2333 | Ga0495616_0148473 | |||
| 2334 | Ga0495618_0001353 | |||
| 2335 | Ga0495618_0011595 | |||
| 2336 | Ga0495618_0579392 | |||
| 2337 | Ga0495620_0054906 | |||
| 2338 | Ga0495628_0022229 | |||
| 2339 | Ga0495628_0027611 | |||
| 2340 | Ga0495628_0189267 | |||
| 2341 | Ga0495628_0221657 | |||
| 2342 | Ga0495628_0584128 | |||
| 2343 | Ga0495630_0070767 | |||
| 2344 | Ga0495630_0291527 | |||
| 2345 | Ga0495631_0102709 | |||
| 2346 | Ga0495643_0268054 | |||
| 2347 | Ga0495644_0001996 | |||
| 2348 | Ga0495644_0042096 | |||
| 2349 | Ga0495644_0300228 | |||
| 2350 | Ga0495663_0081329 | |||
| 2351 | Ga0495666_0009092 | |||
| 2352 | Ga0495652_0022225 | |||
| 2353 | Ga0495652_0195557 | |||
| 2354 | Ga0495652_0482909 | |||
| 2355 | Ga0495652_0627876 | |||
| 2356 | Ga0495665_0008916 | |||
| 2357 | Ga0495665_0009854 | |||
| 2358 | Ga0495665_0025653 | |||
| 2359 | Ga0495665_0218037 | |||
| 2360 | Ga0495640_0003333 | |||
| 2361 | Ga0495640_0008735 | |||
| 2362 | Ga0495640_0048712 | |||
| 2363 | Ga0495640_0076077 | |||
| 2364 | Ga0495640_0104222 | |||
| 2365 | Ga0495586_0012313 | |||
| 2366 | Ga0495587_0000620 | |||
| 2367 | Ga0495587_0016528 | |||
| 2368 | Ga0495598_0000497 | |||
| 2369 | Ga0495598_0039419 | |||
| 2370 | Ga0495609_0037320 | |||
| 2371 | Ga0495597_0208568 | |||
| 2372 | Ga0495645_0000640 | |||
| 2373 | Ga0495645_0000848 | |||
| 2374 | Ga0495645_0001258 | |||
| 2375 | Ga0495633_0001631 | |||
| 2376 | Ga0495667_0001254 | |||
| 2377 | Ga0495667_0017253 | |||
| 2378 | Ga0495667_0063182 | |||
| 2379 | Ga0495656_0001521 | |||
| 2380 | Ga0495656_0029742 | |||
| 2381 | Ga0495668_0096664 | |||
| 2382 | Ga0495634_0004362 | |||
| 2383 | Ga0495634_0059926 | |||
| 2384 | Ga0495634_0094981 | |||
| 2385 | Ga0495634_0138248 | |||
| 2386 | Ga0495611_0152781 | |||
| 2387 | Ga0495635_0003030 | |||
| 2388 | Ga0495635_0009428 | |||
| 2389 | Ga0495635_0010638 | |||
| 2390 | Ga0495635_0063639 | |||
| 2391 | Ga0495635_0081906 | |||
| 2392 | Ga0495635_0302964 | |||
| 2393 | Ga0495659_0013369 | |||
| 2394 | Ga0495659_0178178 | |||
| 2395 | Ga0495661_0041885 | |||
| 2396 | Ga0495588_0024998 | |||
| 2397 | Ga0495588_0078061 | |||
| 2398 | Ga0495657_0002939 | |||
| 2399 | Ga0495657_0238516 | |||
| 2400 | Ga0495599_0007257 | |||
| 2401 | Ga0495623_0006562 | |||
| 2402 | Ga0495623_0054810 | |||
| 2403 | Ga0495646_0007927 | |||
| 2404 | Ga0495646_0010534 | |||
| 2405 | Ga0495646_0014152 | |||
| 2406 | Ga0495646_0108471 | |||
| 2407 | Ga0495647_0006507 | |||
| 2408 | Ga0495647_0057634 | |||
| 2409 | Ga0495658_0109370 | |||
| 2410 | Ga0495658_0495318 | |||
| 2411 | Ga0495669_0069608 | |||
| 2412 | Ga0495669_0119909 | |||
| 2413 | Ga0495613_0001384 | |||
| 2414 | Ga0495613_0023601 | |||
| 2415 | Ga0495613_0136629 | |||
| 2416 | Ga0495624_0004076 | |||
| 2417 | Ga0495624_0010897 | |||
| 2418 | Ga0495624_0121654 | |||
| 2419 | Ga0495670_0003495 | |||
| 2420 | Ga0495670_0019269 | |||
| 2421 | Ga0495589_0056216 | |||
| 2422 | Ga0495589_0085962 | |||
| 2423 | Ga0495600_0007718 | |||
| 2424 | Ga0495600_0025977 | |||
| 2425 | Ga0495600_0037538 | |||
| 2426 | Ga0495600_0185563 | |||
| 2427 | Ga0495660_0152497 | |||
| 2428 | Ga0495581_0071963 | |||
| 2429 | Ga0495581_0127978 | |||
| 2430 | Ga0495581_0146840 | |||
| 2431 | Ga0495581_0566970 | |||
| 2432 | Ga0495604_0028071 | |||
| 2433 | Ga0495604_0135025 | |||
| 2434 | Ga0495636_0113146 | |||
| 2435 | Ga0495674_0014366 | |||
| 2436 | Ga0495674_0018881 | |||
| 2437 | Ga0495674_0050678 | |||
| 2438 | Ga0495674_0098959 | |||
| 2439 | Ga0495674_0466861 | |||
| 2440 | Ga0495674_0643653 | |||
| 2441 | Ga0495676_0073874 | |||
| 2442 | Ga0495676_0201351 | |||
| 2443 | Ga0495680_0001472 | |||
| 2444 | Ga0495680_0020287 | |||
| 2445 | Ga0495680_0031933 | |||
| 2446 | Ga0495680_0036206 | |||
| 2447 | Ga0495675_0003746 | |||
| 2448 | Ga0495679_037303 | |||
| 2449 | Ga0495679_051806 | |||
| 2450 | Ga0495685_057546 | |||
| 2451 | Ga0495684_0001677 | |||
| 2452 | Ga0495684_0012712 | |||
| 2453 | Ga0495684_0032898 | |||
| 2454 | Ga0495684_0107728 | |||
| 2455 | Ga0495684_0196677 | |||
| 2456 | Ga0495684_0539937 | |||
| 2457 | Ga0495686_0087435 | |||
| 2458 | Ga0495593_0009116 | |||
| 2459 | Ga0495593_0028872 | |||
| 2460 | Ga0495593_0106332 | |||
| 2461 | Ga0495602_0002664 | |||
| 2462 | Ga0495602_0033768 | |||
| 2463 | Ga0495602_0231738 | |||
| 2464 | Ga0495602_0313080 | |||
| 2465 | Ga0495614_0096227 | |||
| 2466 | Ga0496100_0000400 | |||
| 2467 | Ga0496100_0027571 | |||
| 2468 | Ga0496100_0117252 | |||
| 2469 | Ga0496100_0387256 | |||
| 2470 | Ga0496100_0613532 | |||
| 2471 | Ga0496101_0000151 | |||
| 2472 | Ga0496101_0007756 | |||
| 2473 | Ga0496101_0017588 | |||
| 2474 | Ga0496101_0108794 | |||
| 2475 | Ga0496101_0119225 | |||
| 2476 | Ga0496101_0199750 | |||
| 2477 | Ga0496101_0266686 | |||
| 2478 | Ga0496101_0506773 | |||
| 2479 | Ga0496102_0002633 | |||
| 2480 | Ga0496102_0025278 | |||
| 2481 | Ga0496102_0149186 | |||
| 2482 | Ga0496102_0211874 | |||
| 2483 | Ga0496102_0231268 | |||
| 2484 | Ga0496102_0467221 | |||
| 2485 | Ga0496102_0797755 | |||
| 2486 | Ga0496103_0000589 | |||
| 2487 | Ga0496103_0010136 | |||
| 2488 | Ga0496103_0024969 | |||
| 2489 | Ga0496103_0069376 | |||
| 2490 | Ga0496103_0474130 | |||
| 2491 | Ga0496104_0000495 | |||
| 2492 | Ga0496104_0001236 | |||
| 2493 | Ga0496104_0005956 | |||
| 2494 | Ga0496104_0026745 | |||
| 2495 | Ga0496104_0039113 | |||
| 2496 | Ga0496104_0108334 | |||
| 2497 | Ga0496104_0215540 | |||
| 2498 | Ga0496104_0529367 | |||
| 2499 | Ga0496104_0768322 | |||
| 2500 | Ga0496105_0005561 | |||
| 2501 | Ga0496105_0014666 | |||
| 2502 | Ga0496105_0018137 | |||
| 2503 | Ga0496105_0029520 | |||
| 2504 | Ga0496105_0060930 | |||
| 2505 | Ga0496105_0112733 | |||
| 2506 | Ga0496105_0334799 | |||
| 2507 | Ga0496106_0005428 | |||
| 2508 | Ga0496106_0006491 | |||
| 2509 | Ga0496106_0007048 | |||
| 2510 | Ga0496106_0013672 | |||
| 2511 | Ga0496106_0047725 | |||
| 2512 | Ga0496106_0302003 | |||
| 2513 | Ga0496107_0000959 | |||
| 2514 | Ga0496107_0010458 | |||
| 2515 | Ga0496107_0017454 | |||
| 2516 | Ga0496107_0031662 | |||
| 2517 | Ga0496107_0073880 | |||
| 2518 | Ga0496107_0084657 | |||
| 2519 | Ga0496107_0185056 | |||
| 2520 | Ga0496107_0303964 | |||
| 2521 | Ga0496107_0708023 | |||
| 2522 | Ga0496108_0008895 | |||
| 2523 | Ga0496108_0010769 | |||
| 2524 | Ga0496108_0015584 | |||
| 2525 | Ga0496108_0044005 | |||
| 2526 | Ga0496108_0047786 | |||
| 2527 | Ga0496108_0079507 | |||
| 2528 | Ga0496108_0211550 | |||
| 2529 | Ga0496108_0525078 | |||
| 2530 | Ga0496108_0579186 | |||
| 2531 | Ga0496108_0687952 | |||
| 2532 | Ga0496109_0000186 | |||
| 2533 | Ga0496109_0001702 | |||
| 2534 | Ga0496109_0030370 | |||
| 2535 | Ga0496109_0052259 | |||
| 2536 | Ga0496109_0153537 | |||
| 2537 | Ga0496109_0220273 | |||
| 2538 | Ga0496109_0318910 | |||
| 2539 | Ga0496109_0373284 | |||
| 2540 | Ga0496110_0013927 | |||
| 2541 | Ga0496110_0018742 | |||
| 2542 | Ga0496110_0019603 | |||
| 2543 | Ga0496110_0022421 | |||
| 2544 | Ga0496110_0101292 | |||
| 2545 | Ga0496110_0227853 | |||
| 2546 | Ga0496110_0295823 | |||
| 2547 | Ga0496110_0684341 | |||
| 2548 | Ga0496111_0005910 | |||
| 2549 | Ga0496111_0011973 | |||
| 2550 | Ga0496111_0022603 | |||
| 2551 | Ga0496111_0024951 | |||
| 2552 | Ga0496111_0119709 | |||
| 2553 | Ga0496111_0124886 | |||
| 2554 | Ga0496111_0208802 | |||
| 2555 | Ga0496111_0383845 | |||
| 2556 | Ga0496112_0001465 | |||
| 2557 | Ga0496112_0034866 | |||
| 2558 | Ga0496112_0237858 | |||
| 2559 | Ga0496112_0303362 | |||
| 2560 | Ga0496112_0376662 | |||
| 2561 | Ga0496112_0554561 | |||
| 2562 | Ga0496112_0770654 | |||
| 2563 | Ga0496113_0001663 | |||
| 2564 | Ga0496113_0001787 | |||
| 2565 | Ga0496113_0057454 | |||
| 2566 | Ga0496113_0057793 | |||
| 2567 | Ga0496113_0070698 | |||
| 2568 | Ga0496113_0087255 | |||
| 2569 | Ga0496113_0143263 | |||
| 2570 | Ga0496113_0209154 | |||
| 2571 | Ga0496113_0273857 | |||
| 2572 | Ga0496113_0331299 | |||
| 2573 | Ga0496113_0551904 | |||
| 2574 | Ga0496114_0005496 | |||
| 2575 | Ga0496114_0014986 | |||
| 2576 | Ga0496114_0020643 | |||
| 2577 | Ga0496114_0028137 | |||
| 2578 | Ga0496114_0109954 | |||
| 2579 | Ga0496114_0122360 | |||
| 2580 | Ga0496115_0002326 | |||
| 2581 | Ga0496115_0032093 | |||
| 2582 | Ga0496115_0054620 | |||
| 2583 | Ga0496115_0117517 | |||
| 2584 | Ga0496115_0300578 | |||
| 2585 | Ga0496115_0387524 | |||
| 2586 | Ga0501031_0026122 | |||
| 2587 | Ga0501031_0183336 | |||
| 2588 | Ga0501032_0056981 | |||
| 2589 | Ga0501033_0017988 | |||
| 2590 | Ga0501033_0037189 | |||
| 2591 | Ga0501034_0001527 | |||
| 2592 | Ga0501034_0005707 | |||
| 2593 | Ga0501034_0050911 | |||
| 2594 | Ga0501034_0087839 | |||
| 2595 | Ga0501034_0093242 | |||
| 2596 | Ga0501036_0001725 | |||
| 2597 | Ga0501036_0149894 | |||
| 2598 | Ga0501036_0226117 | |||
| 2599 | Ga0501037_0013915 | |||
| 2600 | Ga0501037_0014525 | |||
| 2601 | Ga0501037_0018328 | |||
| 2602 | Ga0501037_0537925 | |||
| 2603 | Ga0501038_0123196 | |||
| 2604 | Ga0501038_0262288 | |||
| 2605 | Ga0501039_0009607 | |||
| 2606 | Ga0501039_0018275 | |||
| 2607 | Ga0501039_0578502 | |||
| 2608 | Ga0501040_0272667 | |||
| 2609 | Ga0501042_0088942 | |||
| 2610 | Ga0501042_0218862 | |||
| 2611 | Ga0501042_0706075 | |||
| 2612 | Ga0501043_0002647 | |||
| 2613 | Ga0501043_0017342 | |||
| 2614 | Ga0501043_0174822 | |||
| 2615 | Ga0501046_0014888 | |||
| 2616 | Ga0501046_0241727 | |||
| 2617 | Ga0501046_0658897 | |||
| 2618 | Ga0501047_0000235 | |||
| 2619 | Ga0501047_0220996 | |||
| 2620 | Ga0501048_0001647 | |||
| 2621 | Ga0501048_0006384 | |||
| 2622 | Ga0501048_0089548 | |||
| 2623 | Ga0501067_0046483 | |||
| 2624 | Ga0501067_0102759 | |||
| 2625 | Ga0501068_0002435 | |||
| 2626 | Ga0501069_0001787 | |||
| 2627 | Ga0501069_0539777 | |||
| 2628 | Ga0501070_0067395 | |||
| 2629 | Ga0501070_0072653 | |||
| 2630 | Ga0501070_0137249 | |||
| 2631 | Ga0501070_0353920 | |||
| 2632 | Ga0501071_0357238 | |||
| 2633 | Ga0501072_0142420 | |||
| 2634 | Ga0501072_0261204 | |||
| 2635 | Ga0501072_0412207 | |||
| 2636 | Ga0501073_0033155 | |||
| 2637 | Ga0501073_0159973 | |||
| 2638 | Ga0501073_0182084 | |||
| 2639 | Ga0501073_0469887 | |||
| 2640 | Ga0501074_0012445 | |||
| 2641 | Ga0501074_0025365 | |||
| 2642 | Ga0501074_0047729 | |||
| 2643 | Ga0501076_0370174 | |||
| 2644 | Ga0501077_0055643 | |||
| 2645 | Ga0501079_0039730 | |||
| 2646 | Ga0501079_0146376 | |||
| 2647 | Ga0501080_0000409 | |||
| 2648 | Ga0501080_0010799 | |||
| 2649 | Ga0501080_0057968 | |||
| 2650 | Ga0501080_0125865 | |||
| 2651 | Ga0501080_0180479 | |||
| 2652 | Ga0501083_0007542 | |||
| 2653 | Ga0501083_0016908 | |||
| 2654 | Ga0501083_0110967 | |||
| 2655 | Ga0501083_0144052 | |||
| 2656 | Ga0501083_0184437 | |||
| 2657 | Ga0501083_0189477 | |||
| 2658 | Ga0501083_0339210 | |||
| 2659 | Ga0501035_0043099 | |||
| 2660 | Ga0501035_0172078 | |||
| 2661 | Ga0501044_0009294 | |||
| 2662 | Ga0501044_0076894 | |||
| 2663 | Ga0501044_0157762 | |||
| 2664 | Ga0501044_0218325 | |||
| 2665 | Ga0501044_0761316 | |||
| 2666 | Ga0501045_0328714 | |||
| 2667 | Ga0501045_0536058 | |||
| 2668 | nmdc:mga03683_204343_c1 | |||
| 2669 | nmdc:mga03n38_164456_c1 | |||
| 2670 | nmdc:mga03n38_170246_c1 | |||
| 2671 | nmdc:mga03n38_24890_c1 | |||
| 2672 | nmdc:mga03n38_292733_c1 | |||
| 2673 | nmdc:mga00v17_35357_c1 | |||
| 2674 | nmdc:mga00v17_89938_c1 | |||
| 2675 | nmdc:mga0yw44_12590_c1 | |||
| 2676 | nmdc:mga0yw44_1365_c1 | |||
| 2677 | nmdc:mga0yw44_257115_c1 | |||
| 2678 | nmdc:mga0yw44_4638_c1 | |||
| 2679 | nmdc:mga0yw44_552281_c1 | |||
| 2680 | nmdc:mga0k408_125156_c1 | |||
| 2681 | nmdc:mga06z11_40711_c1 | |||
| 2682 | nmdc:mga04h51_321848_c1 | |||
| 2683 | nmdc:mga07m45_18231_c1 | |||
| 2684 | nmdc:mga07m45_377173_c1 | |||
| 2685 | nmdc:mga05p37_1028322_c1 | |||
| 2686 | nmdc:mga05p37_108355_c1 | |||
| 2687 | nmdc:mga05p37_1888_c1 | |||
| 2688 | nmdc:mga05p37_2212_c1 | |||
| 2689 | nmdc:mga05p37_34119_c1 | |||
| 2690 | nmdc:mga05p37_55603_c1 | |||
| 2691 | nmdc:mga05p37_669629_c1 | |||
| 2692 | nmdc:mga09592_222223_c1 | |||
| 2693 | nmdc:mga09592_35165_c1 | |||
| 2694 | nmdc:mga09592_6462_c1 | |||
| 2695 | nmdc:mga0qj67_163958_c1 | |||
| 2696 | nmdc:mga0qj67_170_c1 | |||
| 2697 | nmdc:mga0qj67_27717_c1 | |||
| 2698 | nmdc:mga06r32_119362_c1 | |||
| 2699 | nmdc:mga06r32_17986_c1 | |||
| 2700 | nmdc:mga06r32_21973_c1 | |||
| 2701 | nmdc:mga08y16_1034655_c1 | |||
| 2702 | nmdc:mga08y16_1219_c1 | |||
| 2703 | nmdc:mga08y16_311_c1 | |||
| 2704 | nmdc:mga08y16_358230_c1 | |||
| 2705 | nmdc:mga08y16_41461_c1 | |||
| 2706 | nmdc:mga08y16_5010_c1 | |||
| 2707 | nmdc:mga0n895_1127766_c1 | |||
| 2708 | nmdc:mga0n895_175188_c1 | |||
| 2709 | nmdc:mga0n895_1869_c1 | |||
| 2710 | nmdc:mga0n895_22756_c1 | |||
| 2711 | nmdc:mga0n895_286906_c1 | |||
| 2712 | nmdc:mga0n895_309956_c1 | |||
| 2713 | nmdc:mga0n895_62_c1 | |||
| 2714 | nmdc:mga0rr50_123619_c1 | |||
| 2715 | nmdc:mga0rr50_199664_c1 | |||
| 2716 | nmdc:mga0rr50_27329_c1 | |||
| 2717 | nmdc:mga0rr50_2956_c1 | |||
| 2718 | nmdc:mga0rr50_74403_c1 | |||
| 2719 | nmdc:mga08x19_165932_c1 | |||
| 2720 | nmdc:mga08x19_23_c1 | |||
| 2721 | nmdc:mga08x19_376432_c1 | |||
| 2722 | nmdc:mga0a205_1191_c1 | |||
| 2723 | nmdc:mga0a205_135893_c1 | |||
| 2724 | nmdc:mga0a205_2311_c2 | |||
| 2725 | nmdc:mga0a205_235151_c1 | |||
| 2726 | nmdc:mga0a205_258877_c1 | |||
| 2727 | nmdc:mga0a205_306294_c1 | |||
| 2728 | nmdc:mga0a205_332195_c1 | |||
| 2729 | nmdc:mga0sz30_112583_c1 | |||
| 2730 | nmdc:mga0sz30_14303_c1 | |||
| 2731 | Ga0495601_0000109 | |||
| 2732 | Ga0495601_0037587 | |||
| 2733 | Ga0495601_0038389 | |||
| 2734 | Ga0495601_0042078 | |||
| 2735 | Ga0495601_0372470 | |||
| 2736 | Ga0495601_0609420 | |||
| 2737 | Ga0495601_0625712 | |||
| 2738 | Ga0495612_0005214 | |||
| 2739 | Ga0495612_0014811 | |||
| 2740 | Ga0495612_0038255 | |||
| 2741 | Ga0495612_0044556 | |||
| 2742 | Ga0495612_0151894 | |||
| 2743 | Ga0495655_0074355 | |||
| 2744 | Ga0495595_0001271 | |||
| 2745 | Ga0495595_0001369 | |||
| 2746 | Ga0495595_0008163 | |||
| 2747 | Ga0495595_0041930 | |||
| 2748 | Ga0495595_0101668 | |||
| 2749 | Ga0495595_0155945 | |||
| 2750 | Ga0495595_0245971 | |||
| 2751 | Ga0495619_0000289 | |||
| 2752 | Ga0495619_0000662 | |||
| 2753 | Ga0495619_0004922 | |||
| 2754 | Ga0495619_0015029 | |||
| 2755 | Ga0495619_0045367 | |||
| 2756 | Ga0495619_0156658 | |||
| 2757 | Ga0495619_0288449 | |||
| 2758 | Ga0495619_0683489 | |||
| 2759 | Ga0500643_026811 | |||
| 2760 | Ga0500644_0000980 | |||
| 2761 | Ga0500651_0002970 | |||
| 2762 | Ga0500651_0046098 | |||
| 2763 | Ga0500651_0364583 | |||
| 2764 | Ga0500593_012871 | |||
| 2765 | Ga0500593_197068 | |||
| 2766 | Ga0500595_000016 | |||
| 2767 | Ga0500595_019733 | |||
| 2768 | Ga0500652_005604 | |||
| 2769 | Ga0500616_0000006 | |||
| 2770 | Ga0500616_0026394 | |||
| 2771 | Ga0500616_0133313 | |||
| 2772 | Ga0500624_033404 | |||
| 2773 | Ga0500627_0038110 | |||
| 2774 | Ga0500636_0018707 | |||
| 2775 | Ga0500645_000033 | |||
| 2776 | Ga0501084_0061986 | |||
| 2777 | Ga0501084_0150577 | |||
| 2778 | Ga0501084_0314838 | |||
| 2779 | Ga0501084_0372401 | |||
| 2780 | Ga0501082_0120885 | |||
| 2781 | Ga0501082_0272586 | |||
| 2782 | Ga0501082_0822662 | |||
| 2783 | 2643755885 | |||
| 2784 | 2841915816 | |||
| 2785 | 2841921803 | |||
| 2786 | 2851187309 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.508 | 9 | 171 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.4977 | 9 | 171 |
| 2b0h-assembly1.cif.gz_A | solution structure of vbs3 fragment of talin | 0.3909 | 4 | 151 |
| 7qru-assembly1.cif.gz_G | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.3879 | 98 | 185 |
| 4k0d-assembly1.cif.gz_B | periplasmic sensor domain of sensor histidine kinase, adeh_2942 | 0.3876 | 11 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7702 | 56 | 172 | 1.10.1760.20 |
| af_F1RDS4_582_822_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5823 | 74 | 149 | 1.20.1070.10 |
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5746 | 56 | 172 | 1.10.1760.20 |
| af_A0A1D6F4P1_608_734_1.20.58.670 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dsl1p vesicle tethering complex, Tip20p subunit, domain D | 0.4385 | 6 | 94 | 1.20.58.670 |
| af_P23895_1_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.3982 | 57 | 148 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H4MNX0-F1-model_v4 | Vitamin uptake transporter | 0.9683 | 12 | 183 |
GO:0016020
GO:1990397 |
| AF-A0A7W6IKK3-F1-model_v4 | VUT family protein | 0.9645 | 7 | 182 |
GO:0016020
GO:1990397 |
| AF-R7BXE4-F1-model_v4 | VUT family protein | 0.9485 | 7 | 180 |
GO:0016020
GO:1990397 |
| AF-A0A4S1H9Y2-F1-model_v4 | VUT family protein | 0.9467 | 11 | 178 |
GO:0016020
GO:1990397 |
| AF-A0A2H6AY45-F1-model_v4 | VUT family protein | 0.9385 | 12 | 188 |
GO:0016020
GO:1990397 |