F493608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1393 | 614 | 2786 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0002918|Ga0495583_0002918_11082_12137 |
| Length | 337 |
| Sequence | VVGSPDAPFITQAGRPPSPASQLPSGEQDQQQIGSDPRYIRGILTAGSPPMAGSSLLVLIDDIAAVXXXXALMTKMAAKKTAGVLGDDLALNAQQVSGVRAEREIPVVWAVAKGSFLNKLILVPAALLISAFAPWAVTPLLMLGGAYLCFEGFEKLAHTFLHKRTEEQAHLVEAVADPATDLVAYEKDKIKGAIRTDFILSAEIIAITLGTVAAAPLMQQVVVLSGIAIVMTIGVYGLVAGIVKLDDLGLWLTQKPGQMARSIGGAILRAAPYMMKSLSVIGTAAMFMVGGGILTHGVPVVHHWIETVSQSTAGLAWLMPTLLNAVAVGKVWRATKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 197 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 198 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 199 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 228 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 234 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 235 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 242 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 243 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 244 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 245 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 246 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 247 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 248 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 249 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 250 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 251 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 252 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 253 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 254 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 255 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 256 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 257 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 260 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 263 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 264 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 265 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 396 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 399 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 401 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 411 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 412 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 413 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 414 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 415 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 416 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 417 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 418 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 419 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 420 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 421 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 422 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 423 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 424 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 425 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 426 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 427 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 428 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 429 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 430 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 431 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 432 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 433 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 434 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 435 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 436 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 437 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 438 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 439 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 440 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 441 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 442 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 443 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 444 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 445 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 446 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 447 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 448 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 449 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 450 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 451 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 452 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 453 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 454 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 455 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 456 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 457 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 458 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 459 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 460 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 461 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 462 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 463 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 464 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 465 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 466 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 467 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 468 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 469 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 470 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 471 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 472 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 473 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 474 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 475 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 476 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 477 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 478 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 479 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 480 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 481 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 482 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 483 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 484 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 485 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 486 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 487 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 488 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 489 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 490 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 491 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 492 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 493 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 494 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 495 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 496 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 497 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 498 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 499 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 500 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 501 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 502 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 503 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 504 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 505 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 506 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 507 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 508 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 509 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 510 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 511 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 512 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 513 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 514 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 515 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 516 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 517 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 518 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 519 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 520 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 521 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 522 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 523 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 524 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 525 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 526 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 527 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 528 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 529 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 530 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 531 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 532 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 533 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 534 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 535 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 536 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 537 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 538 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 539 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 540 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 541 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 542 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 543 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 544 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 545 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 546 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 547 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 548 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 549 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 550 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 551 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 552 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 553 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 554 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 555 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 556 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 557 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 558 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 559 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 560 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 561 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 562 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 563 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 564 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 565 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 566 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 567 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 568 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 569 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 570 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 571 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 572 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 573 | 2941479691 | |||
| 574 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 575 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 576 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 577 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 578 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 579 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 580 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 581 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 582 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 583 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 584 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 585 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 586 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 587 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 588 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 589 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 590 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 591 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 592 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 593 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 594 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 595 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 596 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 597 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 598 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 599 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 600 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 601 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 602 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 603 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 604 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 605 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 606 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 607 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 608 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 609 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 610 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 611 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 612 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 613 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 614 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.36 |
| Metatranscriptomes | 0 |
| Isolates | 14.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.33 |
| Nodule | 2.37 |
| Rhizoplane | 4.38 |
| Rhizosphere | 73.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495583_0002918 | 3300046506 | Bacteria | 13800 |
| 2 | MRS2a_Contig_319 | 2124908027 | Bacteria | 10974 |
| 3 | SwRhRL2b_contig_14979 | 2162886007 | Bacteria | 2348 |
| 4 | JGI25155J39150_1000098 | 3300002704 | Bacteria | 48725 |
| 5 | JGI25156J39149_1000163 | 3300002705 | Bacteria | 48762 |
| 6 | JGI25154J39366_1000183 | 3300002738 | Bacteria | 48762 |
| 7 | JGI25154J39366_1002797 | 3300002738 | Bacteria | 4156 |
| 8 | JGI25157J39369_1000209 | 3300002741 | Bacteria | 48762 |
| 9 | JGI25159J45721_1009212 | 3300002987 | Bacteria | 2626 |
| 10 | JGI25151J46595_10007415 | 3300003187 | Bacteria | 5378 |
| 11 | JGI25160J50197_1000212 | 3300003354 | Bacteria | 47984 |
| 12 | JGI25161J50226_1000151 | 3300003374 | Bacteria | 47984 |
| 13 | Ga0055538_1000058 | 3300003751 | Bacteria | 112867 |
| 14 | Ga0055539_1000087 | 3300003752 | Bacteria | 114745 |
| 15 | Ga0055533_1000097 | 3300003756 | Bacteria | 112844 |
| 16 | Ga0055532_1000156 | 3300003758 | Bacteria | 60124 |
| 17 | Ga0055525_1000428 | 3300003759 | Bacteria | 25024 |
| 18 | Ga0055526_1000665 | 3300003771 | Bacteria | 26412 |
| 19 | Ga0055526_1006387 | 3300003771 | Bacteria | 6410 |
| 20 | Ga0055526_1006416 | 3300003771 | Bacteria | 6383 |
| 21 | Ga0055537_1000005 | 3300003773 | Bacteria | 160497 |
| 22 | Ga0055537_1000709 | 3300003773 | Bacteria | 17283 |
| 23 | Ga0055524_1000082 | 3300003775 | Bacteria | 119749 |
| 24 | Ga0055524_1001237 | 3300003775 | Bacteria | 15052 |
| 25 | Ga0055536_1001960 | 3300003781 | Bacteria | 11848 |
| 26 | Ga0055536_1008459 | 3300003781 | Bacteria | 4416 |
| 27 | Ga0055534_1000493 | 3300003784 | Bacteria | 21773 |
| 28 | Ga0055534_1003222 | 3300003784 | Bacteria | 5238 |
| 29 | Ga0055528_1000082 | 3300003790 | Bacteria | 74945 |
| 30 | Ga0055528_1002394 | 3300003790 | Bacteria | 10090 |
| 31 | Ga0055530_10000357 | 3300003791 | Bacteria | 41227 |
| 32 | Ga0055530_10000688 | 3300003791 | Bacteria | 28617 |
| 33 | Ga0055530_10002633 | 3300003791 | Bacteria | 11254 |
| 34 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 35 | Ga0055540_1000014 | 3300003792 | Bacteria | 234171 |
| 36 | Ga0055540_1000076 | 3300003792 | Bacteria | 114654 |
| 37 | Ga0055540_1000253 | 3300003792 | Bacteria | 48323 |
| 38 | Ga0055540_1001210 | 3300003792 | Bacteria | 15871 |
| 39 | Ga0055531_10000769 | 3300003794 | Bacteria | 26770 |
| 40 | Ga0055531_10001153 | 3300003794 | Bacteria | 20389 |
| 41 | Ga0055531_10021777 | 3300003794 | Bacteria | 2472 |
| 42 | Ga0055541_1000060 | 3300003841 | Bacteria | 112630 |
| 43 | Ga0055543_1000526 | 3300004625 | Bacteria | 21681 |
| 44 | Ga0065165_1010723 | 3300005262 | Bacteria | 3918 |
| 45 | Ga0065165_1011785 | 3300005262 | Bacteria | 3606 |
| 46 | Ga0065165_1018022 | 3300005262 | Bacteria | 2576 |
| 47 | Ga0065714_10005879 | 3300005288 | Bacteria | 3910 |
| 48 | Ga0065714_10007382 | 3300005288 | Bacteria | 3192 |
| 49 | Ga0065714_10023056 | 3300005288 | Bacteria | 1802 |
| 50 | Ga0065714_10066205 | 3300005288 | Bacteria | 7363 |
| 51 | Ga0065714_10066523 | 3300005288 | Bacteria | 6701 |
| 52 | Ga0065704_10103302 | 3300005289 | Bacteria | 2176 |
| 53 | Ga0065704_10146264 | 3300005289 | Bacteria | 1469 |
| 54 | Ga0065704_10231731 | 3300005289 | Bacteria | 1041 |
| 55 | Ga0065712_10000624 | 3300005290 | Bacteria | 9381 |
| 56 | Ga0065712_10002139 | 3300005290 | Bacteria | 6843 |
| 57 | Ga0065712_10069768 | 3300005290 | Bacteria | 6738 |
| 58 | Ga0065715_10097314 | 3300005293 | Bacteria | 3725 |
| 59 | Ga0070676_10019903 | 3300005328 | Bacteria | 3740 |
| 60 | Ga0070683_100114202 | 3300005329 | Bacteria | 2549 |
| 61 | Ga0070690_100255831 | 3300005330 | Bacteria | 1240 |
| 62 | Ga0070670_100000573 | 3300005331 | Bacteria | 29071 |
| 63 | Ga0070670_100001103 | 3300005331 | Bacteria | 21451 |
| 64 | Ga0070670_100019134 | 3300005331 | Bacteria | 5872 |
| 65 | Ga0070670_100078619 | 3300005331 | Bacteria | 2834 |
| 66 | Ga0070670_100268858 | 3300005331 | Bacteria | 1487 |
| 67 | Ga0068869_100022441 | 3300005334 | Bacteria | 4350 |
| 68 | Ga0070666_10005190 | 3300005335 | Bacteria | 7976 |
| 69 | Ga0068868_100139270 | 3300005338 | Bacteria | 1991 |
| 70 | Ga0070661_100000029 | 3300005344 | Bacteria | 117682 |
| 71 | Ga0070669_100019134 | 3300005353 | Bacteria | 4895 |
| 72 | Ga0070669_100125513 | 3300005353 | Bacteria | 1963 |
| 73 | Ga0070669_100155027 | 3300005353 | Bacteria | 1775 |
| 74 | Ga0070669_100160965 | 3300005353 | Bacteria | 1744 |
| 75 | Ga0070675_100025997 | 3300005354 | Bacteria | 4695 |
| 76 | Ga0070675_100071088 | 3300005354 | Bacteria | 2886 |
| 77 | Ga0070671_100011056 | 3300005355 | Bacteria | 7246 |
| 78 | Ga0070671_100153324 | 3300005355 | Bacteria | 1946 |
| 79 | Ga0070674_100081819 | 3300005356 | Bacteria | 2308 |
| 80 | Ga0070674_100114468 | 3300005356 | Bacteria | 1986 |
| 81 | Ga0070673_100008668 | 3300005364 | Bacteria | 6776 |
| 82 | Ga0070688_100038778 | 3300005365 | Bacteria | 2912 |
| 83 | Ga0070659_100000877 | 3300005366 | Bacteria | 21982 |
| 84 | Ga0070678_100014404 | 3300005456 | Bacteria | 4989 |
| 85 | Ga0070678_100021363 | 3300005456 | Bacteria | 4267 |
| 86 | Ga0070662_100004039 | 3300005457 | Bacteria | 9213 |
| 87 | Ga0070662_100051420 | 3300005457 | Bacteria | 2976 |
| 88 | Ga0070662_100081568 | 3300005457 | Bacteria | 2410 |
| 89 | Ga0068867_100135231 | 3300005459 | Bacteria | 1921 |
| 90 | Ga0070685_10040301 | 3300005466 | Bacteria | 2657 |
| 91 | Ga0070706_100422077 | 3300005467 | Bacteria | 1241 |
| 92 | Ga0070707_100248249 | 3300005468 | Bacteria | 1732 |
| 93 | Ga0070679_100128294 | 3300005530 | Bacteria | 2518 |
| 94 | Ga0070684_100198280 | 3300005535 | Bacteria | 1828 |
| 95 | Ga0068853_100019145 | 3300005539 | Bacteria | 5673 |
| 96 | Ga0070672_100051800 | 3300005543 | Bacteria | 3203 |
| 97 | Ga0070672_100132531 | 3300005543 | Bacteria | 2049 |
| 98 | Ga0070695_100013037 | 3300005545 | Bacteria | 4994 |
| 99 | Ga0070664_100000046 | 3300005564 | Bacteria | 74475 |
| 100 | Ga0070664_100009920 | 3300005564 | Bacteria | 7719 |
| 101 | Ga0070664_100378919 | 3300005564 | Bacteria | 1291 |
| 102 | Ga0068857_100463531 | 3300005577 | Bacteria | 1186 |
| 103 | Ga0068854_100003507 | 3300005578 | Bacteria | 9796 |
| 104 | Ga0068859_100027466 | 3300005617 | Bacteria | 5707 |
| 105 | Ga0068859_100428626 | 3300005617 | Bacteria | 1419 |
| 106 | Ga0068864_100003420 | 3300005618 | Bacteria | 13128 |
| 107 | Ga0068866_10010526 | 3300005718 | Bacteria | 3970 |
| 108 | Ga0068861_100016003 | 3300005719 | Bacteria | 5296 |
| 109 | Ga0068861_100333011 | 3300005719 | Bacteria | 1326 |
| 110 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 111 | Ga0068851_10022967 | 3300005834 | Bacteria | 3045 |
| 112 | Ga0068863_100002555 | 3300005841 | Bacteria | 18065 |
| 113 | Ga0068863_100043982 | 3300005841 | Bacteria | 4239 |
| 114 | Ga0068858_100010086 | 3300005842 | Bacteria | 8968 |
| 115 | Ga0068858_100010413 | 3300005842 | Bacteria | 8810 |
| 116 | Ga0068858_100082497 | 3300005842 | Bacteria | 2989 |
| 117 | Ga0068860_100412779 | 3300005843 | Bacteria | 1337 |
| 118 | Ga0068860_100417924 | 3300005843 | Bacteria | 1329 |
| 119 | Ga0068862_100057800 | 3300005844 | Bacteria | 3327 |
| 120 | Ga0081455_10023769 | 3300005937 | Bacteria | 5694 |
| 121 | Ga0070717_10192879 | 3300006028 | Bacteria | 1781 |
| 122 | Ga0075365_10001663 | 3300006038 | Bacteria | 10268 |
| 123 | Ga0075363_100012995 | 3300006048 | Bacteria | 4022 |
| 124 | Ga0075363_100124350 | 3300006048 | Bacteria | 1443 |
| 125 | Ga0075363_100166680 | 3300006048 | Bacteria | 1249 |
| 126 | Ga0075364_10210962 | 3300006051 | Bacteria | 1317 |
| 127 | Ga0075364_10238757 | 3300006051 | Bacteria | 1234 |
| 128 | Ga0075432_10045718 | 3300006058 | Bacteria | 1536 |
| 129 | Ga0075362_10015018 | 3300006177 | Bacteria | 3140 |
| 130 | Ga0075362_10060855 | 3300006177 | Bacteria | 1707 |
| 131 | Ga0075362_10151221 | 3300006177 | Bacteria | 1114 |
| 132 | Ga0075369_10110775 | 3300006186 | Bacteria | 1237 |
| 133 | Ga0075366_10012451 | 3300006195 | Bacteria | 4825 |
| 134 | Ga0075366_10059694 | 3300006195 | Bacteria | 2265 |
| 135 | Ga0075366_10084264 | 3300006195 | Bacteria | 1900 |
| 136 | Ga0068871_100053445 | 3300006358 | Bacteria | 3274 |
| 137 | Ga0075428_100070983 | 3300006844 | Bacteria | 3807 |
| 138 | Ga0075430_100028327 | 3300006846 | Bacteria | 4759 |
| 139 | Ga0075430_100029379 | 3300006846 | Bacteria | 4665 |
| 140 | Ga0075431_100194929 | 3300006847 | Bacteria | 2074 |
| 141 | Ga0075433_10206265 | 3300006852 | Bacteria | 1747 |
| 142 | Ga0075434_100007145 | 3300006871 | Bacteria | 10320 |
| 143 | Ga0075434_100228445 | 3300006871 | Bacteria | 1880 |
| 144 | Ga0075429_100131261 | 3300006880 | Bacteria | 2191 |
| 145 | Ga0068865_100037755 | 3300006881 | Bacteria | 3264 |
| 146 | Ga0068865_100092987 | 3300006881 | Bacteria | 2192 |
| 147 | Ga0075436_100106412 | 3300006914 | Bacteria | 1956 |
| 148 | Ga0075436_100185608 | 3300006914 | Bacteria | 1470 |
| 149 | Ga0097620_100027466 | 3300006931 | Bacteria | 5707 |
| 150 | Ga0097620_100428610 | 3300006931 | Bacteria | 1419 |
| 151 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 152 | Ga0079104_1000438 | 3300006946 | Bacteria | 47426 |
| 153 | Ga0079104_1002086 | 3300006946 | Bacteria | 11469 |
| 154 | Ga0079104_1013864 | 3300006946 | Bacteria | 2463 |
| 155 | Ga0075435_100022552 | 3300007076 | Bacteria | 4858 |
| 156 | Ga0075435_100068148 | 3300007076 | Bacteria | 2898 |
| 157 | Ga0075435_100077609 | 3300007076 | Bacteria | 2723 |
| 158 | Ga0075435_100142506 | 3300007076 | Bacteria | 2011 |
| 159 | Ga0105251_10003624 | 3300009011 | Bacteria | 11098 |
| 160 | Ga0105251_10007394 | 3300009011 | Bacteria | 6777 |
| 161 | Ga0105251_10015196 | 3300009011 | Bacteria | 4218 |
| 162 | Ga0105251_10070773 | 3300009011 | Bacteria | 1624 |
| 163 | Ga0105244_10000632 | 3300009036 | Bacteria | 31091 |
| 164 | Ga0105244_10001388 | 3300009036 | Bacteria | 19671 |
| 165 | Ga0105244_10005166 | 3300009036 | Bacteria | 8747 |
| 166 | Ga0105244_10008699 | 3300009036 | Bacteria | 6317 |
| 167 | Ga0105244_10025168 | 3300009036 | Bacteria | 3239 |
| 168 | Ga0105244_10117166 | 3300009036 | Bacteria | 1292 |
| 169 | Ga0105244_10130581 | 3300009036 | Bacteria | 1212 |
| 170 | Ga0105250_10001902 | 3300009092 | Bacteria | 10836 |
| 171 | Ga0105250_10002234 | 3300009092 | Bacteria | 9855 |
| 172 | Ga0105250_10070763 | 3300009092 | Bacteria | 1408 |
| 173 | Ga0105250_10075441 | 3300009092 | Bacteria | 1364 |
| 174 | Ga0105240_10001650 | 3300009093 | Bacteria | 37876 |
| 175 | Ga0111539_10090021 | 3300009094 | Bacteria | 3606 |
| 176 | Ga0111539_10311619 | 3300009094 | Bacteria | 1832 |
| 177 | Ga0114129_10585770 | 3300009147 | Bacteria | 1447 |
| 178 | Ga0105243_10000158 | 3300009148 | Bacteria | 77305 |
| 179 | Ga0105242_10005191 | 3300009176 | Bacteria | 10055 |
| 180 | Ga0105242_10029447 | 3300009176 | Bacteria | 4379 |
| 181 | Ga0105248_10039796 | 3300009177 | Bacteria | 5268 |
| 182 | Ga0105237_10001262 | 3300009545 | Bacteria | 33775 |
| 183 | Ga0105237_10001445 | 3300009545 | Bacteria | 31382 |
| 184 | Ga0105239_10003184 | 3300010375 | Bacteria | 20313 |
| 185 | Ga0105246_10002056 | 3300011119 | Bacteria | 12119 |
| 186 | Ga0105246_10002917 | 3300011119 | Bacteria | 10351 |
| 187 | Ga0157345_1000315 | 3300012498 | Bacteria | 6118 |
| 188 | Ga0157373_10008336 | 3300013100 | Bacteria | 7700 |
| 189 | Ga0157373_10036295 | 3300013100 | Bacteria | 3539 |
| 190 | Ga0157373_10038710 | 3300013100 | Bacteria | 3417 |
| 191 | Ga0157373_10073683 | 3300013100 | Bacteria | 2409 |
| 192 | Ga0157373_10126229 | 3300013100 | Bacteria | 1799 |
| 193 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 194 | Ga0157371_10008703 | 3300013102 | Bacteria | 8056 |
| 195 | Ga0157371_10035808 | 3300013102 | Bacteria | 3556 |
| 196 | Ga0157370_10014439 | 3300013104 | Bacteria | 8073 |
| 197 | Ga0157370_10033631 | 3300013104 | Bacteria | 4999 |
| 198 | Ga0157370_10148550 | 3300013104 | Bacteria | 2182 |
| 199 | Ga0157370_10154564 | 3300013104 | Bacteria | 2134 |
| 200 | Ga0157369_10002431 | 3300013105 | Bacteria | 22369 |
| 201 | Ga0157369_10017719 | 3300013105 | Bacteria | 7999 |
| 202 | Ga0157369_10359308 | 3300013105 | Bacteria | 1512 |
| 203 | Ga0157369_10389948 | 3300013105 | Bacteria | 1445 |
| 204 | Ga0157369_10521987 | 3300013105 | Bacteria | 1228 |
| 205 | Ga0157378_10134728 | 3300013297 | Bacteria | 2289 |
| 206 | Ga0163162_10007458 | 3300013306 | Bacteria | 10638 |
| 207 | Ga0163162_10041733 | 3300013306 | Bacteria | 4591 |
| 208 | Ga0163162_10080883 | 3300013306 | Bacteria | 3318 |
| 209 | Ga0163162_10118081 | 3300013306 | Bacteria | 2754 |
| 210 | Ga0163162_10209402 | 3300013306 | Bacteria | 2079 |
| 211 | Ga0163162_10252735 | 3300013306 | Bacteria | 1894 |
| 212 | Ga0157372_10248323 | 3300013307 | Bacteria | 2065 |
| 213 | Ga0157375_10005173 | 3300013308 | Bacteria | 11316 |
| 214 | Ga0157375_10029502 | 3300013308 | Bacteria | 5160 |
| 215 | Ga0157375_10352996 | 3300013308 | Bacteria | 1636 |
| 216 | Ga0157375_10504861 | 3300013308 | Bacteria | 1373 |
| 217 | Ga0163163_10029028 | 3300014325 | Bacteria | 5318 |
| 218 | Ga0157380_10167625 | 3300014326 | Bacteria | 1915 |
| 219 | Ga0182008_10007753 | 3300014497 | Bacteria | 5908 |
| 220 | Ga0182008_10027899 | 3300014497 | Bacteria | 2856 |
| 221 | Ga0182008_10031040 | 3300014497 | Bacteria | 2691 |
| 222 | Ga0182008_10048085 | 3300014497 | Bacteria | 2119 |
| 223 | Ga0182008_10052853 | 3300014497 | Bacteria | 2013 |
| 224 | Ga0157379_10008130 | 3300014968 | Bacteria | 9111 |
| 225 | Ga0157379_10027378 | 3300014968 | Bacteria | 5076 |
| 226 | Ga0157376_10017549 | 3300014969 | Bacteria | 5463 |
| 227 | Ga0182006_1001026 | 3300015261 | Bacteria | 18245 |
| 228 | Ga0182006_1018698 | 3300015261 | Bacteria | 2923 |
| 229 | Ga0182006_1035530 | 3300015261 | Bacteria | 1986 |
| 230 | Ga0182007_10000638 | 3300015262 | Bacteria | 20273 |
| 231 | Ga0182005_1015155 | 3300015265 | Bacteria | 2152 |
| 232 | Ga0182005_1038132 | 3300015265 | Bacteria | 1307 |
| 233 | Ga0163161_10006835 | 3300017792 | Bacteria | 7892 |
| 234 | Ga0163161_10011701 | 3300017792 | Bacteria | 6088 |
| 235 | Ga0163161_10046047 | 3300017792 | Bacteria | 3147 |
| 236 | Ga0163161_10061272 | 3300017792 | Bacteria | 2738 |
| 237 | Ga0163161_10085719 | 3300017792 | Bacteria | 2323 |
| 238 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 239 | Ga0209435_103802 | 3300025206 | Bacteria | 1714 |
| 240 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 241 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 242 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 243 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 244 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 245 | Ga0209563_100854 | 3300025230 | Bacteria | 9072 |
| 246 | Ga0209437_101937 | 3300025233 | Bacteria | 4318 |
| 247 | Ga0209258_100548 | 3300025242 | Bacteria | 33898 |
| 248 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 249 | Ga0209646_1000455 | 3300025246 | Bacteria | 21348 |
| 250 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 251 | Ga0209677_100063 | 3300025253 | Bacteria | 151440 |
| 252 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 253 | Ga0209759_1005333 | 3300025256 | Bacteria | 4530 |
| 254 | Ga0209565_1000036 | 3300025263 | Bacteria | 293334 |
| 255 | Ga0209565_1000074 | 3300025263 | Bacteria | 164237 |
| 256 | Ga0209565_1000226 | 3300025263 | Bacteria | 63161 |
| 257 | Ga0209673_1000129 | 3300025273 | Bacteria | 164238 |
| 258 | Ga0209673_1000282 | 3300025273 | Bacteria | 95013 |
| 259 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 260 | Ga0209130_1000042 | 3300025284 | Bacteria | 257581 |
| 261 | Ga0209130_1000255 | 3300025284 | Bacteria | 67166 |
| 262 | Ga0209675_1000072 | 3300025291 | Bacteria | 164237 |
| 263 | Ga0209675_1000289 | 3300025291 | Bacteria | 47643 |
| 264 | Ga0209675_1003625 | 3300025291 | Bacteria | 7246 |
| 265 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 266 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 267 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 268 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 269 | Ga0209676_1002600 | 3300025292 | Bacteria | 12379 |
| 270 | Ga0209676_1010192 | 3300025292 | Bacteria | 3953 |
| 271 | Ga0209025_1002347 | 3300025294 | Bacteria | 20391 |
| 272 | Ga0209025_1006388 | 3300025294 | Bacteria | 9173 |
| 273 | Ga0209025_1017511 | 3300025294 | Bacteria | 4128 |
| 274 | Ga0209564_1000160 | 3300025295 | Bacteria | 164214 |
| 275 | Ga0209564_1002324 | 3300025295 | Bacteria | 15396 |
| 276 | Ga0209564_1004446 | 3300025295 | Bacteria | 8571 |
| 277 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 278 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 279 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 280 | Ga0209050_1000595 | 3300025298 | Bacteria | 57712 |
| 281 | Ga0209050_1001021 | 3300025298 | Bacteria | 34934 |
| 282 | Ga0209050_1003407 | 3300025298 | Bacteria | 11780 |
| 283 | Ga0209050_1004120 | 3300025298 | Bacteria | 10120 |
| 284 | Ga0209050_1024161 | 3300025298 | Bacteria | 2113 |
| 285 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 286 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 287 | Ga0209256_1000125 | 3300025299 | Bacteria | 165336 |
| 288 | Ga0209256_1013724 | 3300025299 | Bacteria | 2983 |
| 289 | Ga0207426_1000097 | 3300025302 | Bacteria | 265930 |
| 290 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 291 | Ga0209051_1000035 | 3300025303 | Bacteria | 346999 |
| 292 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 293 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 294 | Ga0209051_1000407 | 3300025303 | Bacteria | 59487 |
| 295 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 296 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 297 | Ga0209257_1000212 | 3300025304 | Bacteria | 138478 |
| 298 | Ga0209257_1005878 | 3300025304 | Bacteria | 8282 |
| 299 | Ga0207697_10000220 | 3300025315 | Bacteria | 30814 |
| 300 | Ga0207656_10001101 | 3300025321 | Bacteria | 8874 |
| 301 | Ga0207696_1000101 | 3300025711 | Bacteria | 170899 |
| 302 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 303 | Ga0207696_1002789 | 3300025711 | Bacteria | 8300 |
| 304 | Ga0207696_1007872 | 3300025711 | Bacteria | 4132 |
| 305 | Ga0207696_1011534 | 3300025711 | Bacteria | 3174 |
| 306 | Ga0207696_1037960 | 3300025711 | Bacteria | 1424 |
| 307 | Ga0207696_1052225 | 3300025711 | Bacteria | 1165 |
| 308 | Ga0207655_1000337 | 3300025728 | Bacteria | 68266 |
| 309 | Ga0207655_1003684 | 3300025728 | Bacteria | 11297 |
| 310 | Ga0207655_1005276 | 3300025728 | Bacteria | 8862 |
| 311 | Ga0207655_1011381 | 3300025728 | Bacteria | 5301 |
| 312 | Ga0207655_1013741 | 3300025728 | Bacteria | 4623 |
| 313 | Ga0207655_1017394 | 3300025728 | Bacteria | 3880 |
| 314 | Ga0207655_1018323 | 3300025728 | Bacteria | 3720 |
| 315 | Ga0207713_1000802 | 3300025735 | Bacteria | 29111 |
| 316 | Ga0207713_1002825 | 3300025735 | Bacteria | 12240 |
| 317 | Ga0207713_1003131 | 3300025735 | Bacteria | 11467 |
| 318 | Ga0207713_1009471 | 3300025735 | Bacteria | 5485 |
| 319 | Ga0207713_1009538 | 3300025735 | Bacteria | 5459 |
| 320 | Ga0207713_1010269 | 3300025735 | Bacteria | 5194 |
| 321 | Ga0207713_1086620 | 3300025735 | Bacteria | 1112 |
| 322 | Ga0207713_1086738 | 3300025735 | Bacteria | 1111 |
| 323 | Ga0207642_10006922 | 3300025899 | Bacteria | 3798 |
| 324 | Ga0207688_10004358 | 3300025901 | Bacteria | 7714 |
| 325 | Ga0207680_10011100 | 3300025903 | Bacteria | 4538 |
| 326 | Ga0207645_10130324 | 3300025907 | Bacteria | 1636 |
| 327 | Ga0207695_10016073 | 3300025913 | Bacteria | 8777 |
| 328 | Ga0207671_10000287 | 3300025914 | Bacteria | 74587 |
| 329 | Ga0207649_10000068 | 3300025920 | Bacteria | 91623 |
| 330 | Ga0207649_10003248 | 3300025920 | Bacteria | 8892 |
| 331 | Ga0207652_10253097 | 3300025921 | Bacteria | 1588 |
| 332 | Ga0207681_10002569 | 3300025923 | Bacteria | 11516 |
| 333 | Ga0207681_10097126 | 3300025923 | Bacteria | 2117 |
| 334 | Ga0207681_10127731 | 3300025923 | Bacteria | 1875 |
| 335 | Ga0207681_10139514 | 3300025923 | Bacteria | 1804 |
| 336 | Ga0207681_10372830 | 3300025923 | Bacteria | 1147 |
| 337 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 338 | Ga0207650_10008848 | 3300025925 | Bacteria | 6879 |
| 339 | Ga0207650_10012734 | 3300025925 | Bacteria | 5809 |
| 340 | Ga0207650_10232607 | 3300025925 | Bacteria | 1487 |
| 341 | Ga0207659_10109989 | 3300025926 | Bacteria | 2093 |
| 342 | Ga0207644_10124839 | 3300025931 | Bacteria | 1963 |
| 343 | Ga0207644_10248650 | 3300025931 | Bacteria | 1418 |
| 344 | Ga0207690_10001532 | 3300025932 | Bacteria | 14454 |
| 345 | Ga0207706_10000922 | 3300025933 | Bacteria | 30101 |
| 346 | Ga0207706_10075851 | 3300025933 | Bacteria | 2957 |
| 347 | Ga0207706_10099295 | 3300025933 | Bacteria | 2561 |
| 348 | Ga0207706_10237085 | 3300025933 | Bacteria | 1595 |
| 349 | Ga0207686_10017447 | 3300025934 | Bacteria | 4046 |
| 350 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 351 | Ga0207669_10356956 | 3300025937 | Bacteria | 1131 |
| 352 | Ga0207704_10346260 | 3300025938 | Bacteria | 1155 |
| 353 | Ga0207691_10026593 | 3300025940 | Bacteria | 5429 |
| 354 | Ga0207691_10299868 | 3300025940 | Bacteria | 1381 |
| 355 | Ga0207711_10067832 | 3300025941 | Bacteria | 3088 |
| 356 | Ga0207689_10099171 | 3300025942 | Bacteria | 2394 |
| 357 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 358 | Ga0207679_10004446 | 3300025945 | Bacteria | 8734 |
| 359 | Ga0207679_10008172 | 3300025945 | Bacteria | 6661 |
| 360 | Ga0207679_10193045 | 3300025945 | Bacteria | 1695 |
| 361 | Ga0207712_10042768 | 3300025961 | Bacteria | 3123 |
| 362 | Ga0207668_10119423 | 3300025972 | Bacteria | 1993 |
| 363 | Ga0207658_10031163 | 3300025986 | Bacteria | 3784 |
| 364 | Ga0207677_10011601 | 3300026023 | Bacteria | 5031 |
| 365 | Ga0207703_10004144 | 3300026035 | Bacteria | 11958 |
| 366 | Ga0207703_10036290 | 3300026035 | Bacteria | 3923 |
| 367 | Ga0207703_10052729 | 3300026035 | Bacteria | 3304 |
| 368 | Ga0207639_10013755 | 3300026041 | Bacteria | 5674 |
| 369 | Ga0207708_10411315 | 3300026075 | Bacteria | 1120 |
| 370 | Ga0207641_10030385 | 3300026088 | Bacteria | 4475 |
| 371 | Ga0207648_10045149 | 3300026089 | Bacteria | 3865 |
| 372 | Ga0207648_10087817 | 3300026089 | Bacteria | 2714 |
| 373 | Ga0207648_10247301 | 3300026089 | Bacteria | 1589 |
| 374 | Ga0207676_10010742 | 3300026095 | Bacteria | 6527 |
| 375 | Ga0207674_10441810 | 3300026116 | Bacteria | 1257 |
| 376 | Ga0207675_100250547 | 3300026118 | Bacteria | 1714 |
| 377 | Ga0207675_100642112 | 3300026118 | Bacteria | 1067 |
| 378 | Ga0207683_10013834 | 3300026121 | Bacteria | 6881 |
| 379 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 380 | Ga0209281_1000174 | 3300027111 | Bacteria | 151659 |
| 381 | Ga0209281_1000182 | 3300027111 | Bacteria | 145698 |
| 382 | Ga0209281_1006015 | 3300027111 | Bacteria | 3232 |
| 383 | Ga0209281_1009339 | 3300027111 | Bacteria | 2309 |
| 384 | Ga0209281_1015382 | 3300027111 | Bacteria | 1597 |
| 385 | Ga0209983_1005427 | 3300027665 | Bacteria | 2641 |
| 386 | Ga0209813_10011558 | 3300027866 | Bacteria | 2311 |
| 387 | Ga0207428_10022532 | 3300027907 | Bacteria | 5313 |
| 388 | Ga0207428_10026314 | 3300027907 | Bacteria | 4857 |
| 389 | Ga0207428_10293724 | 3300027907 | Bacteria | 1204 |
| 390 | Ga0268266_10443246 | 3300028379 | Bacteria | 1233 |
| 391 | Ga0268265_10534114 | 3300028380 | Bacteria | 1111 |
| 392 | Ga0268264_10189503 | 3300028381 | Bacteria | 1874 |
| 393 | Ga0268264_10528707 | 3300028381 | Bacteria | 1154 |
| 394 | Ga0307517_10039962 | 3300028786 | Bacteria | 5130 |
| 395 | Ga0307517_10173128 | 3300028786 | Bacteria | 1413 |
| 396 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 397 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 398 | Ga0307515_10002144 | 3300028794 | Bacteria | 43311 |
| 399 | Ga0307515_10003679 | 3300028794 | Bacteria | 32201 |
| 400 | Ga0307515_10103124 | 3300028794 | Bacteria | 3423 |
| 401 | Ga0307515_10201864 | 3300028794 | Bacteria | 1861 |
| 402 | Ga0307511_10000570 | 3300030521 | Bacteria | 39538 |
| 403 | Ga0316177_1052986 | 3300030731 | Bacteria | 12724 |
| 404 | Ga0316177_1092213 | 3300030731 | Bacteria | 4282 |
| 405 | Ga0316178_1101335 | 3300030735 | Bacteria | 1617 |
| 406 | Ga0316178_1171693 | 3300030735 | Bacteria | 22825 |
| 407 | Ga0316183_1029553 | 3300030742 | Bacteria | 2373 |
| 408 | Ga0316182_1057930 | 3300030745 | Bacteria | 2890 |
| 409 | Ga0265330_10000117 | 3300031235 | Bacteria | 63961 |
| 410 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 411 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 412 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 413 | Ga0307513_10015421 | 3300031456 | Bacteria | 9264 |
| 414 | Ga0307513_10105803 | 3300031456 | Bacteria | 2821 |
| 415 | Ga0307509_10089054 | 3300031507 | Bacteria | 3166 |
| 416 | Ga0307509_10205301 | 3300031507 | Bacteria | 1802 |
| 417 | Ga0307408_100000192 | 3300031548 | Bacteria | 65993 |
| 418 | Ga0307408_100002500 | 3300031548 | Bacteria | 12859 |
| 419 | Ga0307408_100004501 | 3300031548 | Bacteria | 9450 |
| 420 | Ga0307408_100023415 | 3300031548 | Bacteria | 4206 |
| 421 | Ga0307408_100030906 | 3300031548 | Bacteria | 3723 |
| 422 | Ga0307408_100040364 | 3300031548 | Bacteria | 3304 |
| 423 | Ga0307408_100079093 | 3300031548 | Bacteria | 2452 |
| 424 | Ga0307408_100437521 | 3300031548 | Bacteria | 1131 |
| 425 | Ga0307514_10030795 | 3300031649 | Bacteria | 4305 |
| 426 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 427 | Ga0307516_10000181 | 3300031730 | Bacteria | 81531 |
| 428 | Ga0307516_10008542 | 3300031730 | Bacteria | 11566 |
| 429 | Ga0307516_10012117 | 3300031730 | Bacteria | 9313 |
| 430 | Ga0307405_10006315 | 3300031731 | Bacteria | 5818 |
| 431 | Ga0307405_10017084 | 3300031731 | Bacteria | 3973 |
| 432 | Ga0307405_10017531 | 3300031731 | Bacteria | 3931 |
| 433 | Ga0307405_10294770 | 3300031731 | Bacteria | 1227 |
| 434 | Ga0307413_10002620 | 3300031824 | Bacteria | 7358 |
| 435 | Ga0307413_10003279 | 3300031824 | Bacteria | 6788 |
| 436 | Ga0307413_10141520 | 3300031824 | Bacteria | 1663 |
| 437 | Ga0307410_10013563 | 3300031852 | Bacteria | 4760 |
| 438 | Ga0307410_10033020 | 3300031852 | Bacteria | 3338 |
| 439 | Ga0307406_10001571 | 3300031901 | Bacteria | 12584 |
| 440 | Ga0307406_10018088 | 3300031901 | Bacteria | 4111 |
| 441 | Ga0307406_10022392 | 3300031901 | Bacteria | 3748 |
| 442 | Ga0307406_10024745 | 3300031901 | Bacteria | 3589 |
| 443 | Ga0307406_10180986 | 3300031901 | Bacteria | 1534 |
| 444 | Ga0307407_10023389 | 3300031903 | Bacteria | 3223 |
| 445 | Ga0307407_10086114 | 3300031903 | Bacteria | 1913 |
| 446 | Ga0307407_10239394 | 3300031903 | Bacteria | 1237 |
| 447 | Ga0307412_10002180 | 3300031911 | Bacteria | 10869 |
| 448 | Ga0307412_10010694 | 3300031911 | Bacteria | 5289 |
| 449 | Ga0307412_10022143 | 3300031911 | Bacteria | 3891 |
| 450 | Ga0307412_10028003 | 3300031911 | Bacteria | 3520 |
| 451 | Ga0307412_10030893 | 3300031911 | Bacteria | 3378 |
| 452 | Ga0307412_10038935 | 3300031911 | Bacteria | 3065 |
| 453 | Ga0307412_10265558 | 3300031911 | Bacteria | 1340 |
| 454 | Ga0307409_100115891 | 3300031995 | Bacteria | 2257 |
| 455 | Ga0307409_100129790 | 3300031995 | Bacteria | 2151 |
| 456 | Ga0307409_100196064 | 3300031995 | Bacteria | 1802 |
| 457 | Ga0307416_100003739 | 3300032002 | Bacteria | 9032 |
| 458 | Ga0307416_100009114 | 3300032002 | Bacteria | 6467 |
| 459 | Ga0307416_100055914 | 3300032002 | Bacteria | 3180 |
| 460 | Ga0307416_100227710 | 3300032002 | Bacteria | 1794 |
| 461 | Ga0307416_100239015 | 3300032002 | Bacteria | 1758 |
| 462 | Ga0307416_100358238 | 3300032002 | Bacteria | 1480 |
| 463 | Ga0307414_10018101 | 3300032004 | Bacteria | 4327 |
| 464 | Ga0307414_10059744 | 3300032004 | Bacteria | 2693 |
| 465 | Ga0307414_10112271 | 3300032004 | Bacteria | 2077 |
| 466 | Ga0307414_10144358 | 3300032004 | Bacteria | 1868 |
| 467 | Ga0307411_10002390 | 3300032005 | Bacteria | 8276 |
| 468 | Ga0307411_10019865 | 3300032005 | Bacteria | 3892 |
| 469 | Ga0307415_100153792 | 3300032126 | Bacteria | 1774 |
| 470 | Ga0307510_10013786 | 3300033180 | Bacteria | 9582 |
| 471 | Ga0373962_0015463 | 3300035242 | Bacteria | 1957 |
| 472 | Ga0316574_0162091 | 3300035398 | Bacteria | 1440 |
| 473 | Ga0395900_0058760 | 3300037418 | Bacteria | 3959 |
| 474 | Ga0395905_0000111 | 3300037471 | Bacteria | 136345 |
| 475 | Ga0395905_0029270 | 3300037471 | Bacteria | 5190 |
| 476 | Ga0395901_0063836 | 3300038443 | Bacteria | 3834 |
| 477 | Ga0400490_23266 | 3300038726 | Bacteria | 7398 |
| 478 | Ga0400483_004246 | 3300039062 | Bacteria | 3305 |
| 479 | Ga0439438_006773 | 3300041405 | Bacteria | 4000 |
| 480 | Ga0439438_009999 | 3300041405 | Bacteria | 3033 |
| 481 | Ga0439438_018822 | 3300041405 | Bacteria | 1960 |
| 482 | Ga0439438_019241 | 3300041405 | Bacteria | 1932 |
| 483 | Ga0439438_019362 | 3300041405 | Bacteria | 1923 |
| 484 | Ga0439438_035933 | 3300041405 | Bacteria | 1300 |
| 485 | Ga0439447_002850 | 3300041407 | Bacteria | 6205 |
| 486 | Ga0439447_004045 | 3300041407 | Bacteria | 5120 |
| 487 | Ga0439447_005181 | 3300041407 | Bacteria | 4362 |
| 488 | Ga0439447_009617 | 3300041407 | Bacteria | 2917 |
| 489 | Ga0439447_018024 | 3300041407 | Bacteria | 1912 |
| 490 | Ga0439447_020625 | 3300041407 | Bacteria | 1744 |
| 491 | Ga0439447_022230 | 3300041407 | Bacteria | 1663 |
| 492 | Ga0439447_029292 | 3300041407 | Bacteria | 1394 |
| 493 | Ga0439461_0034830 | 3300041410 | Bacteria | 1065 |
| 494 | Ga0439466_0000181 | 3300041411 | Bacteria | 25115 |
| 495 | Ga0439466_0000878 | 3300041411 | Bacteria | 11440 |
| 496 | Ga0439466_0011728 | 3300041411 | Bacteria | 3236 |
| 497 | Ga0439466_0025721 | 3300041411 | Bacteria | 2052 |
| 498 | Ga0439466_0028124 | 3300041411 | Bacteria | 1942 |
| 499 | Ga0439466_0051725 | 3300041411 | Bacteria | 1344 |
| 500 | Ga0451843_0113517 | 3300041509 | Bacteria | 2601 |
| 501 | Ga0439431_0010778 | 3300041997 | Bacteria | 2081 |
| 502 | Ga0439437_001194 | 3300042000 | Bacteria | 2722 |
| 503 | Ga0439441_006369 | 3300042001 | Bacteria | 1870 |
| 504 | Ga0439432_008171 | 3300042006 | Bacteria | 3680 |
| 505 | Ga0439432_009089 | 3300042006 | Bacteria | 3470 |
| 506 | Ga0439432_009917 | 3300042006 | Bacteria | 3312 |
| 507 | Ga0439432_012801 | 3300042006 | Bacteria | 2860 |
| 508 | Ga0439432_023065 | 3300042006 | Bacteria | 2051 |
| 509 | Ga0439449_0045091 | 3300042007 | Bacteria | 1635 |
| 510 | Ga0439451_002573 | 3300042009 | Bacteria | 3690 |
| 511 | Ga0439451_004203 | 3300042009 | Bacteria | 2920 |
| 512 | Ga0439451_004767 | 3300042009 | Bacteria | 2759 |
| 513 | Ga0439451_006596 | 3300042009 | Bacteria | 2372 |
| 514 | Ga0439451_011164 | 3300042009 | Bacteria | 1812 |
| 515 | Ga0439451_013491 | 3300042009 | Bacteria | 1652 |
| 516 | Ga0439451_019924 | 3300042009 | Bacteria | 1351 |
| 517 | Ga0439451_033717 | 3300042009 | Bacteria | 1029 |
| 518 | Ga0439452_001154 | 3300042010 | Bacteria | 11484 |
| 519 | Ga0439452_002037 | 3300042010 | Bacteria | 7699 |
| 520 | Ga0439452_003486 | 3300042010 | Bacteria | 5502 |
| 521 | Ga0439452_012323 | 3300042010 | Bacteria | 2436 |
| 522 | Ga0439452_022880 | 3300042010 | Bacteria | 1613 |
| 523 | Ga0439452_023025 | 3300042010 | Bacteria | 1607 |
| 524 | Ga0439452_036678 | 3300042010 | Bacteria | 1173 |
| 525 | Ga0439456_001653 | 3300042013 | Bacteria | 4503 |
| 526 | Ga0439456_002975 | 3300042013 | Bacteria | 3426 |
| 527 | Ga0439456_004070 | 3300042013 | Bacteria | 2966 |
| 528 | Ga0439462_0014323 | 3300042015 | Bacteria | 2037 |
| 529 | Ga0439463_000119 | 3300042016 | Bacteria | 19578 |
| 530 | Ga0439463_000135 | 3300042016 | Bacteria | 18610 |
| 531 | Ga0439463_030801 | 3300042016 | Bacteria | 1353 |
| 532 | Ga0439463_044257 | 3300042016 | Bacteria | 1133 |
| 533 | Ga0450911_000011 | 3300042115 | Bacteria | 130739 |
| 534 | Ga0450911_000708 | 3300042115 | Bacteria | 9741 |
| 535 | Ga0450911_004672 | 3300042115 | Bacteria | 2215 |
| 536 | Ga0450911_007344 | 3300042115 | Bacteria | 1601 |
| 537 | Ga0450919_002168 | 3300042121 | Bacteria | 2558 |
| 538 | Ga0450920_004432 | 3300042122 | Bacteria | 2466 |
| 539 | Ga0450922_003964 | 3300042124 | Bacteria | 1362 |
| 540 | Ga0450888_000889 | 3300042126 | Bacteria | 2845 |
| 541 | Ga0450890_008503 | 3300042127 | Bacteria | 1313 |
| 542 | Ga0450891_000402 | 3300042129 | Bacteria | 4527 |
| 543 | Ga0450892_000986 | 3300042130 | Bacteria | 3027 |
| 544 | Ga0450896_002601 | 3300042133 | Bacteria | 2345 |
| 545 | Ga0450902_023057 | 3300042137 | Bacteria | 1033 |
| 546 | Ga0450903_003483 | 3300042138 | Bacteria | 2724 |
| 547 | Ga0450903_008066 | 3300042138 | Bacteria | 1725 |
| 548 | Ga0450903_015663 | 3300042138 | Bacteria | 1193 |
| 549 | Ga0450904_000171 | 3300042139 | Bacteria | 14169 |
| 550 | Ga0450904_000482 | 3300042139 | Bacteria | 7821 |
| 551 | Ga0450904_003954 | 3300042139 | Bacteria | 1566 |
| 552 | Ga0450889_000148 | 3300042144 | Bacteria | 7104 |
| 553 | Ga0450906_003185 | 3300042145 | Bacteria | 3548 |
| 554 | Ga0450906_008030 | 3300042145 | Bacteria | 2057 |
| 555 | Ga0450907_001074 | 3300042146 | Bacteria | 6337 |
| 556 | Ga0450907_003459 | 3300042146 | Bacteria | 2815 |
| 557 | Ga0450910_000426 | 3300042147 | Bacteria | 4990 |
| 558 | Ga0439446_0000636 | 3300042156 | Bacteria | 7264 |
| 559 | Ga0439446_0004080 | 3300042156 | Bacteria | 3680 |
| 560 | Ga0439446_0006845 | 3300042156 | Bacteria | 2985 |
| 561 | Ga0450908_001481 | 3300042184 | Bacteria | 4556 |
| 562 | Ga0450908_002124 | 3300042184 | Bacteria | 3877 |
| 563 | Ga0450908_010504 | 3300042184 | Bacteria | 1708 |
| 564 | Ga0450909_005842 | 3300042185 | Bacteria | 1773 |
| 565 | Ga0439434_0001856 | 3300042435 | Bacteria | 6138 |
| 566 | Ga0439434_0005608 | 3300042435 | Bacteria | 3665 |
| 567 | Ga0439434_0009004 | 3300042435 | Bacteria | 2934 |
| 568 | Ga0439444_0000913 | 3300042437 | Bacteria | 3594 |
| 569 | Ga0439459_0005479 | 3300042438 | Bacteria | 2087 |
| 570 | Ga0450916_003055 | 3300042530 | Bacteria | 1815 |
| 571 | Ga0450918_000109 | 3300042531 | Bacteria | 17693 |
| 572 | Ga0450918_015318 | 3300042531 | Bacteria | 1333 |
| 573 | Ga0451577_0012487 | 3300042876 | Bacteria | 7974 |
| 574 | Ga0451577_0023296 | 3300042876 | Bacteria | 5647 |
| 575 | Ga0451577_0037186 | 3300042876 | Bacteria | 4382 |
| 576 | Ga0451577_0112001 | 3300042876 | Bacteria | 2442 |
| 577 | Ga0451577_0172106 | 3300042876 | Bacteria | 1951 |
| 578 | Ga0451577_0176352 | 3300042876 | Bacteria | 1927 |
| 579 | Ga0439440_0007687 | 3300042993 | Bacteria | 2196 |
| 580 | Ga0453683_0026029 | 3300044673 | Bacteria | 3715 |
| 581 | Ga0453684_0003069 | 3300044712 | Bacteria | 38658 |
| 582 | Ga0453684_0003996 | 3300044712 | Bacteria | 32193 |
| 583 | Ga0453684_0020726 | 3300044712 | Bacteria | 9891 |
| 584 | Ga0453684_0072068 | 3300044712 | Bacteria | 4364 |
| 585 | Ga0453684_0128380 | 3300044712 | Bacteria | 3047 |
| 586 | Ga0453684_0252937 | 3300044712 | Bacteria | 2023 |
| 587 | Ga0451576_0002831 | 3300045051 | Bacteria | 24945 |
| 588 | Ga0451576_0111991 | 3300045051 | Bacteria | 2840 |
| 589 | Ga0451576_0239496 | 3300045051 | Bacteria | 1895 |
| 590 | Ga0495617_019836 | 3300046452 | Bacteria | 2272 |
| 591 | Ga0495617_023783 | 3300046452 | Bacteria | 2068 |
| 592 | Ga0495617_024908 | 3300046452 | Bacteria | 2018 |
| 593 | Ga0495617_028646 | 3300046452 | Bacteria | 1871 |
| 594 | Ga0495617_029283 | 3300046452 | Bacteria | 1851 |
| 595 | Ga0495617_029611 | 3300046452 | Bacteria | 1840 |
| 596 | Ga0495617_033153 | 3300046452 | Bacteria | 1733 |
| 597 | Ga0495617_057170 | 3300046452 | Bacteria | 1293 |
| 598 | Ga0495617_067354 | 3300046452 | Bacteria | 1179 |
| 599 | Ga0495617_085955 | 3300046452 | Bacteria | 1028 |
| 600 | Ga0495627_002318 | 3300046453 | Bacteria | 9361 |
| 601 | Ga0495627_004002 | 3300046453 | Bacteria | 6290 |
| 602 | Ga0495627_010270 | 3300046453 | Bacteria | 3411 |
| 603 | Ga0495627_026933 | 3300046453 | Bacteria | 1848 |
| 604 | Ga0495627_027411 | 3300046453 | Bacteria | 1828 |
| 605 | Ga0495627_036353 | 3300046453 | Bacteria | 1531 |
| 606 | Ga0495627_038050 | 3300046453 | Bacteria | 1489 |
| 607 | Ga0495603_0027657 | 3300046455 | Bacteria | 3421 |
| 608 | Ga0495590_0003405 | 3300046457 | Bacteria | 6503 |
| 609 | Ga0495590_0008242 | 3300046457 | Bacteria | 3984 |
| 610 | Ga0495590_0009528 | 3300046457 | Bacteria | 3686 |
| 611 | Ga0495590_0028023 | 3300046457 | Bacteria | 1976 |
| 612 | Ga0495590_0049105 | 3300046457 | Bacteria | 1472 |
| 613 | Ga0495590_0051499 | 3300046457 | Bacteria | 1438 |
| 614 | Ga0495590_0081857 | 3300046457 | Bacteria | 1137 |
| 615 | Ga0495591_001049 | 3300046458 | Bacteria | 18589 |
| 616 | Ga0495591_001222 | 3300046458 | Bacteria | 16729 |
| 617 | Ga0495591_001953 | 3300046458 | Bacteria | 12055 |
| 618 | Ga0495591_002999 | 3300046458 | Bacteria | 8995 |
| 619 | Ga0495591_005577 | 3300046458 | Bacteria | 5786 |
| 620 | Ga0495591_005915 | 3300046458 | Bacteria | 5531 |
| 621 | Ga0495591_009977 | 3300046458 | Bacteria | 3725 |
| 622 | Ga0495591_013325 | 3300046458 | Bacteria | 3016 |
| 623 | Ga0495591_027665 | 3300046458 | Bacteria | 1745 |
| 624 | Ga0495591_030174 | 3300046458 | Bacteria | 1639 |
| 625 | Ga0495591_030882 | 3300046458 | Bacteria | 1613 |
| 626 | Ga0495591_031551 | 3300046458 | Bacteria | 1588 |
| 627 | Ga0495629_0034536 | 3300046459 | Bacteria | 3575 |
| 628 | Ga0495638_0006643 | 3300046460 | Bacteria | 8400 |
| 629 | Ga0495638_0024554 | 3300046460 | Bacteria | 3928 |
| 630 | Ga0495638_0027492 | 3300046460 | Bacteria | 3681 |
| 631 | Ga0495638_0035616 | 3300046460 | Bacteria | 3172 |
| 632 | Ga0495638_0083513 | 3300046460 | Bacteria | 1934 |
| 633 | Ga0495638_0087119 | 3300046460 | Bacteria | 1886 |
| 634 | Ga0495638_0095491 | 3300046460 | Bacteria | 1785 |
| 635 | Ga0495638_0097759 | 3300046460 | Bacteria | 1760 |
| 636 | Ga0495638_0099920 | 3300046460 | Bacteria | 1736 |
| 637 | Ga0495638_0128172 | 3300046460 | Bacteria | 1493 |
| 638 | Ga0495638_0136809 | 3300046460 | Bacteria | 1433 |
| 639 | Ga0495638_0185634 | 3300046460 | Bacteria | 1183 |
| 640 | Ga0495653_0008829 | 3300046463 | Bacteria | 8252 |
| 641 | Ga0495653_0025056 | 3300046463 | Bacteria | 4799 |
| 642 | Ga0495653_0108020 | 3300046463 | Bacteria | 2004 |
| 643 | Ga0495653_0112090 | 3300046463 | Bacteria | 1958 |
| 644 | Ga0495650_0002465 | 3300046471 | Bacteria | 14902 |
| 645 | Ga0495650_0003436 | 3300046471 | Bacteria | 11555 |
| 646 | Ga0495650_0010955 | 3300046471 | Bacteria | 5016 |
| 647 | Ga0495650_0013666 | 3300046471 | Bacteria | 4279 |
| 648 | Ga0495650_0022548 | 3300046471 | Bacteria | 3017 |
| 649 | Ga0495650_0028780 | 3300046471 | Bacteria | 2542 |
| 650 | Ga0495650_0041139 | 3300046471 | Bacteria | 1978 |
| 651 | Ga0495650_0042867 | 3300046471 | Bacteria | 1924 |
| 652 | Ga0495650_0048023 | 3300046471 | Bacteria | 1781 |
| 653 | Ga0495650_0100254 | 3300046471 | Bacteria | 1088 |
| 654 | Ga0495580_0100897 | 3300046472 | Bacteria | 2007 |
| 655 | Ga0495582_0047131 | 3300046473 | Bacteria | 2373 |
| 656 | Ga0495605_0000047 | 3300046474 | Bacteria | 171270 |
| 657 | Ga0495605_0000525 | 3300046474 | Bacteria | 32358 |
| 658 | Ga0495605_0001790 | 3300046474 | Bacteria | 13787 |
| 659 | Ga0495605_0008617 | 3300046474 | Bacteria | 5761 |
| 660 | Ga0495605_0011610 | 3300046474 | Bacteria | 4904 |
| 661 | Ga0495605_0017163 | 3300046474 | Bacteria | 3904 |
| 662 | Ga0495605_0044607 | 3300046474 | Bacteria | 2191 |
| 663 | Ga0495605_0054700 | 3300046474 | Bacteria | 1932 |
| 664 | Ga0495605_0075118 | 3300046474 | Bacteria | 1589 |
| 665 | Ga0495605_0075212 | 3300046474 | Bacteria | 1588 |
| 666 | Ga0495605_0113736 | 3300046474 | Bacteria | 1232 |
| 667 | Ga0495639_0001026 | 3300046475 | Bacteria | 12605 |
| 668 | Ga0495639_0071088 | 3300046475 | Bacteria | 1608 |
| 669 | Ga0495584_0001531 | 3300046491 | Bacteria | 13751 |
| 670 | Ga0495584_0003735 | 3300046491 | Bacteria | 8296 |
| 671 | Ga0495584_0007445 | 3300046491 | Bacteria | 5708 |
| 672 | Ga0495584_0015983 | 3300046491 | Bacteria | 3829 |
| 673 | Ga0495584_0021347 | 3300046491 | Bacteria | 3290 |
| 674 | Ga0495584_0044491 | 3300046491 | Bacteria | 2240 |
| 675 | Ga0495584_0061946 | 3300046491 | Bacteria | 1880 |
| 676 | Ga0495584_0070071 | 3300046491 | Bacteria | 1762 |
| 677 | Ga0495584_0091037 | 3300046491 | Bacteria | 1538 |
| 678 | Ga0495584_0091912 | 3300046491 | Bacteria | 1530 |
| 679 | Ga0495584_0094908 | 3300046491 | Bacteria | 1506 |
| 680 | Ga0495584_0120432 | 3300046491 | Bacteria | 1329 |
| 681 | Ga0495584_0169546 | 3300046491 | Bacteria | 1109 |
| 682 | Ga0495585_0013265 | 3300046492 | Bacteria | 4826 |
| 683 | Ga0495585_0019151 | 3300046492 | Bacteria | 3949 |
| 684 | Ga0495585_0053223 | 3300046492 | Bacteria | 2240 |
| 685 | Ga0495585_0083924 | 3300046492 | Bacteria | 1723 |
| 686 | Ga0495585_0085043 | 3300046492 | Bacteria | 1710 |
| 687 | Ga0495585_0152444 | 3300046492 | Bacteria | 1204 |
| 688 | Ga0495585_0168582 | 3300046492 | Bacteria | 1132 |
| 689 | Ga0495594_0004782 | 3300046499 | Bacteria | 6974 |
| 690 | Ga0495594_0073151 | 3300046499 | Bacteria | 1907 |
| 691 | Ga0495596_0006850 | 3300046500 | Bacteria | 5195 |
| 692 | Ga0495607_0000518 | 3300046501 | Bacteria | 37977 |
| 693 | Ga0495607_0001826 | 3300046501 | Bacteria | 18146 |
| 694 | Ga0495607_0007371 | 3300046501 | Bacteria | 7615 |
| 695 | Ga0495607_0014071 | 3300046501 | Bacteria | 5221 |
| 696 | Ga0495607_0024198 | 3300046501 | Bacteria | 3789 |
| 697 | Ga0495607_0026676 | 3300046501 | Bacteria | 3582 |
| 698 | Ga0495607_0066827 | 3300046501 | Bacteria | 2021 |
| 699 | Ga0495607_0082877 | 3300046501 | Bacteria | 1758 |
| 700 | Ga0495607_0086801 | 3300046501 | Bacteria | 1705 |
| 701 | Ga0495607_0101485 | 3300046501 | Bacteria | 1540 |
| 702 | Ga0495607_0107687 | 3300046501 | Bacteria | 1482 |
| 703 | Ga0495607_0114217 | 3300046501 | Bacteria | 1427 |
| 704 | Ga0495607_0167903 | 3300046501 | Bacteria | 1110 |
| 705 | Ga0495583_0000951 | 3300046506 | Bacteria | 33709 |
| 706 | Ga0495583_0001288 | 3300046506 | Bacteria | 26166 |
| 707 | Ga0495583_0001564 | 3300046506 | Bacteria | 22613 |
| 708 | Ga0495583_0002315 | 3300046506 | Bacteria | 16595 |
| 709 | Ga0495583_0002664 | 3300046506 | Bacteria | 14863 |
| 710 | Ga0495583_0004641 | 3300046506 | Bacteria | 9695 |
| 711 | Ga0495583_0006143 | 3300046506 | Bacteria | 7915 |
| 712 | Ga0495583_0018121 | 3300046506 | Bacteria | 3716 |
| 713 | Ga0495583_0055618 | 3300046506 | Bacteria | 1787 |
| 714 | Ga0495583_0102065 | 3300046506 | Bacteria | 1223 |
| 715 | Ga0495583_0114801 | 3300046506 | Bacteria | 1138 |
| 716 | Ga0495606_0002715 | 3300046507 | Bacteria | 19952 |
| 717 | Ga0495606_0003285 | 3300046507 | Bacteria | 17312 |
| 718 | Ga0495606_0010009 | 3300046507 | Bacteria | 7928 |
| 719 | Ga0495606_0011802 | 3300046507 | Bacteria | 7079 |
| 720 | Ga0495606_0017361 | 3300046507 | Bacteria | 5443 |
| 721 | Ga0495606_0031867 | 3300046507 | Bacteria | 3659 |
| 722 | Ga0495606_0035263 | 3300046507 | Bacteria | 3422 |
| 723 | Ga0495606_0037596 | 3300046507 | Bacteria | 3286 |
| 724 | Ga0495606_0059532 | 3300046507 | Bacteria | 2450 |
| 725 | Ga0495606_0074370 | 3300046507 | Bacteria | 2128 |
| 726 | Ga0495606_0091936 | 3300046507 | Bacteria | 1864 |
| 727 | Ga0495606_0097531 | 3300046507 | Bacteria | 1795 |
| 728 | Ga0495606_0102749 | 3300046507 | Bacteria | 1737 |
| 729 | Ga0495606_0268418 | 3300046507 | Bacteria | 938 |
| 730 | Ga0495610_0003261 | 3300046512 | Bacteria | 12807 |
| 731 | Ga0495610_0007060 | 3300046512 | Bacteria | 7585 |
| 732 | Ga0495610_0012127 | 3300046512 | Bacteria | 5211 |
| 733 | Ga0495610_0015116 | 3300046512 | Bacteria | 4501 |
| 734 | Ga0495610_0019253 | 3300046512 | Bacteria | 3827 |
| 735 | Ga0495610_0038888 | 3300046512 | Bacteria | 2410 |
| 736 | Ga0495610_0054135 | 3300046512 | Bacteria | 1939 |
| 737 | Ga0495610_0075903 | 3300046512 | Bacteria | 1555 |
| 738 | Ga0495616_0000033 | 3300046513 | Bacteria | 130486 |
| 739 | Ga0495616_0008301 | 3300046513 | Bacteria | 6162 |
| 740 | Ga0495616_0023442 | 3300046513 | Bacteria | 3319 |
| 741 | Ga0495616_0058108 | 3300046513 | Bacteria | 1905 |
| 742 | Ga0495616_0061381 | 3300046513 | Bacteria | 1843 |
| 743 | Ga0495616_0064861 | 3300046513 | Bacteria | 1781 |
| 744 | Ga0495616_0068188 | 3300046513 | Bacteria | 1727 |
| 745 | Ga0495616_0070593 | 3300046513 | Bacteria | 1690 |
| 746 | Ga0495616_0073691 | 3300046513 | Bacteria | 1646 |
| 747 | Ga0495616_0133589 | 3300046513 | Bacteria | 1135 |
| 748 | Ga0495620_0000681 | 3300046515 | Bacteria | 21016 |
| 749 | Ga0495620_0001574 | 3300046515 | Bacteria | 13532 |
| 750 | Ga0495620_0011570 | 3300046515 | Bacteria | 4597 |
| 751 | Ga0495620_0012675 | 3300046515 | Bacteria | 4339 |
| 752 | Ga0495620_0014528 | 3300046515 | Bacteria | 3999 |
| 753 | Ga0495620_0026268 | 3300046515 | Bacteria | 2740 |
| 754 | Ga0495620_0060649 | 3300046515 | Bacteria | 1576 |
| 755 | Ga0495620_0065810 | 3300046515 | Bacteria | 1494 |
| 756 | Ga0495620_0120619 | 3300046515 | Bacteria | 1033 |
| 757 | Ga0495620_0128980 | 3300046515 | Bacteria | 993 |
| 758 | Ga0495628_0168181 | 3300046516 | Bacteria | 1663 |
| 759 | Ga0495630_0118884 | 3300046517 | Bacteria | 2004 |
| 760 | Ga0495630_0157972 | 3300046517 | Bacteria | 1726 |
| 761 | Ga0495630_0216928 | 3300046517 | Bacteria | 1460 |
| 762 | Ga0495631_0001379 | 3300046518 | Bacteria | 14791 |
| 763 | Ga0495631_0010993 | 3300046518 | Bacteria | 4468 |
| 764 | Ga0495631_0026556 | 3300046518 | Bacteria | 2657 |
| 765 | Ga0495631_0035984 | 3300046518 | Bacteria | 2212 |
| 766 | Ga0495631_0039815 | 3300046518 | Bacteria | 2083 |
| 767 | Ga0495632_0002239 | 3300046519 | Bacteria | 14922 |
| 768 | Ga0495632_0003625 | 3300046519 | Bacteria | 10852 |
| 769 | Ga0495632_0006548 | 3300046519 | Bacteria | 7468 |
| 770 | Ga0495632_0017079 | 3300046519 | Bacteria | 4016 |
| 771 | Ga0495632_0031914 | 3300046519 | Bacteria | 2718 |
| 772 | Ga0495632_0033618 | 3300046519 | Bacteria | 2630 |
| 773 | Ga0495632_0050118 | 3300046519 | Bacteria | 2060 |
| 774 | Ga0495632_0065258 | 3300046519 | Bacteria | 1758 |
| 775 | Ga0495632_0096566 | 3300046519 | Bacteria | 1395 |
| 776 | Ga0495637_0000023 | 3300046520 | Bacteria | 172407 |
| 777 | Ga0495637_0004072 | 3300046520 | Bacteria | 7630 |
| 778 | Ga0495637_0004257 | 3300046520 | Bacteria | 7434 |
| 779 | Ga0495637_0004633 | 3300046520 | Bacteria | 7100 |
| 780 | Ga0495637_0010319 | 3300046520 | Bacteria | 4524 |
| 781 | Ga0495637_0012773 | 3300046520 | Bacteria | 4007 |
| 782 | Ga0495637_0028282 | 3300046520 | Bacteria | 2504 |
| 783 | Ga0495637_0035117 | 3300046520 | Bacteria | 2191 |
| 784 | Ga0495637_0042348 | 3300046520 | Bacteria | 1948 |
| 785 | Ga0495637_0042746 | 3300046520 | Bacteria | 1937 |
| 786 | Ga0495637_0057426 | 3300046520 | Bacteria | 1607 |
| 787 | Ga0495637_0059388 | 3300046520 | Bacteria | 1573 |
| 788 | Ga0495637_0060850 | 3300046520 | Bacteria | 1549 |
| 789 | Ga0495643_0000235 | 3300046522 | Bacteria | 83550 |
| 790 | Ga0495643_0000451 | 3300046522 | Bacteria | 52778 |
| 791 | Ga0495643_0001781 | 3300046522 | Bacteria | 18467 |
| 792 | Ga0495643_0014368 | 3300046522 | Bacteria | 4712 |
| 793 | Ga0495643_0025994 | 3300046522 | Bacteria | 3308 |
| 794 | Ga0495643_0071193 | 3300046522 | Bacteria | 1825 |
| 795 | Ga0495643_0073032 | 3300046522 | Bacteria | 1798 |
| 796 | Ga0495643_0079763 | 3300046522 | Bacteria | 1706 |
| 797 | Ga0495643_0100339 | 3300046522 | Bacteria | 1484 |
| 798 | Ga0495644_0001359 | 3300046523 | Bacteria | 9994 |
| 799 | Ga0495644_0002908 | 3300046523 | Bacteria | 6797 |
| 800 | Ga0495644_0009130 | 3300046523 | Bacteria | 3819 |
| 801 | Ga0495644_0040652 | 3300046523 | Bacteria | 1752 |
| 802 | Ga0495644_0043757 | 3300046523 | Bacteria | 1685 |
| 803 | Ga0495648_0004435 | 3300046524 | Bacteria | 11992 |
| 804 | Ga0495648_0005762 | 3300046524 | Bacteria | 10221 |
| 805 | Ga0495648_0008617 | 3300046524 | Bacteria | 8000 |
| 806 | Ga0495648_0009743 | 3300046524 | Bacteria | 7400 |
| 807 | Ga0495648_0009845 | 3300046524 | Bacteria | 7345 |
| 808 | Ga0495648_0010619 | 3300046524 | Bacteria | 6998 |
| 809 | Ga0495648_0026685 | 3300046524 | Bacteria | 3884 |
| 810 | Ga0495648_0031678 | 3300046524 | Bacteria | 3479 |
| 811 | Ga0495648_0054260 | 3300046524 | Bacteria | 2422 |
| 812 | Ga0495648_0095077 | 3300046524 | Bacteria | 1658 |
| 813 | Ga0495648_0098748 | 3300046524 | Bacteria | 1616 |
| 814 | Ga0495648_0112459 | 3300046524 | Bacteria | 1479 |
| 815 | Ga0495648_0144430 | 3300046524 | Bacteria | 1248 |
| 816 | Ga0495666_0019229 | 3300046526 | Bacteria | 3392 |
| 817 | Ga0495666_0090307 | 3300046526 | Bacteria | 1445 |
| 818 | Ga0495642_0008536 | 3300046528 | Bacteria | 3919 |
| 819 | Ga0495642_0028383 | 3300046528 | Bacteria | 2229 |
| 820 | Ga0495642_0063907 | 3300046528 | Bacteria | 1531 |
| 821 | Ga0495642_0148367 | 3300046528 | Bacteria | 1014 |
| 822 | Ga0495654_0001312 | 3300046530 | Bacteria | 17384 |
| 823 | Ga0495654_0003008 | 3300046530 | Bacteria | 10523 |
| 824 | Ga0495654_0004908 | 3300046530 | Bacteria | 7868 |
| 825 | Ga0495654_0020326 | 3300046530 | Bacteria | 3460 |
| 826 | Ga0495654_0024046 | 3300046530 | Bacteria | 3150 |
| 827 | Ga0495654_0026361 | 3300046530 | Bacteria | 2987 |
| 828 | Ga0495654_0033398 | 3300046530 | Bacteria | 2604 |
| 829 | Ga0495654_0034346 | 3300046530 | Bacteria | 2559 |
| 830 | Ga0495654_0044581 | 3300046530 | Bacteria | 2193 |
| 831 | Ga0495654_0049305 | 3300046530 | Bacteria | 2063 |
| 832 | Ga0495654_0051260 | 3300046530 | Bacteria | 2014 |
| 833 | Ga0495654_0055371 | 3300046530 | Bacteria | 1920 |
| 834 | Ga0495654_0078104 | 3300046530 | Bacteria | 1557 |
| 835 | Ga0495586_0072220 | 3300046535 | Bacteria | 1886 |
| 836 | Ga0495587_0055720 | 3300046536 | Bacteria | 2327 |
| 837 | Ga0495587_0084286 | 3300046536 | Bacteria | 1840 |
| 838 | Ga0495609_0000382 | 3300046538 | Bacteria | 37599 |
| 839 | Ga0495609_0001328 | 3300046538 | Bacteria | 16782 |
| 840 | Ga0495609_0002035 | 3300046538 | Bacteria | 12747 |
| 841 | Ga0495609_0005136 | 3300046538 | Bacteria | 6971 |
| 842 | Ga0495609_0014758 | 3300046538 | Bacteria | 3667 |
| 843 | Ga0495609_0052750 | 3300046538 | Bacteria | 1809 |
| 844 | Ga0495609_0056639 | 3300046538 | Bacteria | 1736 |
| 845 | Ga0495609_0061996 | 3300046538 | Bacteria | 1652 |
| 846 | Ga0495609_0138019 | 3300046538 | Bacteria | 1041 |
| 847 | Ga0495597_0016484 | 3300046542 | Bacteria | 3487 |
| 848 | Ga0495597_0018121 | 3300046542 | Bacteria | 3307 |
| 849 | Ga0495597_0027613 | 3300046542 | Bacteria | 2602 |
| 850 | Ga0495597_0068053 | 3300046542 | Bacteria | 1539 |
| 851 | Ga0495597_0096166 | 3300046542 | Bacteria | 1252 |
| 852 | Ga0495645_0043791 | 3300046543 | Bacteria | 3266 |
| 853 | Ga0495622_0006120 | 3300046557 | Bacteria | 5590 |
| 854 | Ga0495622_0010777 | 3300046557 | Bacteria | 4216 |
| 855 | Ga0495622_0010996 | 3300046557 | Bacteria | 4175 |
| 856 | Ga0495622_0013903 | 3300046557 | Bacteria | 3734 |
| 857 | Ga0495633_0009405 | 3300046558 | Bacteria | 5402 |
| 858 | Ga0495633_0039348 | 3300046558 | Bacteria | 2256 |
| 859 | Ga0495633_0054711 | 3300046558 | Bacteria | 1877 |
| 860 | Ga0495656_0011229 | 3300046615 | Bacteria | 3284 |
| 861 | Ga0495656_0054518 | 3300046615 | Bacteria | 1720 |
| 862 | Ga0495668_0000066 | 3300046616 | Bacteria | 178533 |
| 863 | Ga0495668_0005069 | 3300046616 | Bacteria | 9067 |
| 864 | Ga0495668_0009434 | 3300046616 | Bacteria | 5995 |
| 865 | Ga0495668_0014429 | 3300046616 | Bacteria | 4632 |
| 866 | Ga0495668_0025042 | 3300046616 | Bacteria | 3392 |
| 867 | Ga0495668_0031471 | 3300046616 | Bacteria | 2990 |
| 868 | Ga0495668_0092989 | 3300046616 | Bacteria | 1651 |
| 869 | Ga0495668_0190762 | 3300046616 | Bacteria | 1122 |
| 870 | Ga0495634_0026595 | 3300046642 | Bacteria | 4036 |
| 871 | Ga0495611_0000527 | 3300046648 | Bacteria | 22716 |
| 872 | Ga0495611_0010917 | 3300046648 | Bacteria | 3847 |
| 873 | Ga0495611_0151232 | 3300046648 | Bacteria | 1083 |
| 874 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 875 | Ga0495625_0002580 | 3300046660 | Bacteria | 19464 |
| 876 | Ga0495625_0007460 | 3300046660 | Bacteria | 9511 |
| 877 | Ga0495625_0026691 | 3300046660 | Bacteria | 4359 |
| 878 | Ga0495625_0027685 | 3300046660 | Bacteria | 4260 |
| 879 | Ga0495625_0111279 | 3300046660 | Bacteria | 1871 |
| 880 | Ga0495625_0113679 | 3300046660 | Bacteria | 1848 |
| 881 | Ga0495625_0151186 | 3300046660 | Bacteria | 1560 |
| 882 | Ga0495635_0019671 | 3300046663 | Bacteria | 4701 |
| 883 | Ga0495635_0109674 | 3300046663 | Bacteria | 1885 |
| 884 | Ga0495659_0000614 | 3300046664 | Bacteria | 13131 |
| 885 | Ga0495659_0001072 | 3300046664 | Bacteria | 9522 |
| 886 | Ga0495659_0085846 | 3300046664 | Bacteria | 1201 |
| 887 | Ga0495661_0000020 | 3300046665 | Bacteria | 196901 |
| 888 | Ga0495661_0000921 | 3300046665 | Bacteria | 26890 |
| 889 | Ga0495661_0001245 | 3300046665 | Bacteria | 21981 |
| 890 | Ga0495661_0001424 | 3300046665 | Bacteria | 20061 |
| 891 | Ga0495661_0004872 | 3300046665 | Bacteria | 9612 |
| 892 | Ga0495661_0017999 | 3300046665 | Bacteria | 4654 |
| 893 | Ga0495661_0056510 | 3300046665 | Bacteria | 2347 |
| 894 | Ga0495661_0115603 | 3300046665 | Bacteria | 1489 |
| 895 | Ga0495661_0119371 | 3300046665 | Bacteria | 1458 |
| 896 | Ga0495661_0182405 | 3300046665 | Bacteria | 1111 |
| 897 | Ga0495588_0005616 | 3300046674 | Bacteria | 5590 |
| 898 | Ga0495588_0054920 | 3300046674 | Bacteria | 2055 |
| 899 | Ga0495588_0190885 | 3300046674 | Bacteria | 1082 |
| 900 | Ga0495623_0006486 | 3300046679 | Bacteria | 7615 |
| 901 | Ga0495646_0021966 | 3300046680 | Bacteria | 4028 |
| 902 | Ga0495646_0057628 | 3300046680 | Bacteria | 2324 |
| 903 | Ga0495658_0024110 | 3300046683 | Bacteria | 3237 |
| 904 | Ga0495658_0071621 | 3300046683 | Bacteria | 2014 |
| 905 | Ga0495624_0006539 | 3300046690 | Bacteria | 8256 |
| 906 | Ga0495670_0016034 | 3300046691 | Bacteria | 3683 |
| 907 | Ga0495670_0025293 | 3300046691 | Bacteria | 2936 |
| 908 | Ga0495670_0058910 | 3300046691 | Bacteria | 1927 |
| 909 | Ga0495670_0081399 | 3300046691 | Bacteria | 1650 |
| 910 | Ga0495670_0089607 | 3300046691 | Bacteria | 1573 |
| 911 | Ga0495671_0002927 | 3300046692 | Bacteria | 10643 |
| 912 | Ga0495671_0004947 | 3300046692 | Bacteria | 7857 |
| 913 | Ga0495671_0007405 | 3300046692 | Bacteria | 6259 |
| 914 | Ga0495671_0018971 | 3300046692 | Bacteria | 3642 |
| 915 | Ga0495671_0027600 | 3300046692 | Bacteria | 2930 |
| 916 | Ga0495671_0028703 | 3300046692 | Bacteria | 2862 |
| 917 | Ga0495671_0051154 | 3300046692 | Bacteria | 2055 |
| 918 | Ga0495671_0072055 | 3300046692 | Bacteria | 1696 |
| 919 | Ga0495671_0149436 | 3300046692 | Bacteria | 1137 |
| 920 | Ga0495671_0176581 | 3300046692 | Bacteria | 1037 |
| 921 | Ga0495649_0004409 | 3300046694 | Bacteria | 9196 |
| 922 | Ga0495649_0005345 | 3300046694 | Bacteria | 8191 |
| 923 | Ga0495649_0014263 | 3300046694 | Bacteria | 4562 |
| 924 | Ga0495649_0018067 | 3300046694 | Bacteria | 3972 |
| 925 | Ga0495649_0024187 | 3300046694 | Bacteria | 3388 |
| 926 | Ga0495649_0050987 | 3300046694 | Bacteria | 2244 |
| 927 | Ga0495649_0087976 | 3300046694 | Bacteria | 1657 |
| 928 | Ga0495649_0103686 | 3300046694 | Bacteria | 1510 |
| 929 | Ga0495649_0107459 | 3300046694 | Bacteria | 1480 |
| 930 | Ga0495649_0113667 | 3300046694 | Bacteria | 1434 |
| 931 | Ga0495589_0001332 | 3300046794 | Bacteria | 14508 |
| 932 | Ga0495589_0014607 | 3300046794 | Bacteria | 4041 |
| 933 | Ga0495589_0015859 | 3300046794 | Bacteria | 3873 |
| 934 | Ga0495589_0017326 | 3300046794 | Bacteria | 3698 |
| 935 | Ga0495589_0019891 | 3300046794 | Bacteria | 3434 |
| 936 | Ga0495589_0047166 | 3300046794 | Bacteria | 2135 |
| 937 | Ga0495589_0075007 | 3300046794 | Bacteria | 1649 |
| 938 | Ga0495589_0085508 | 3300046794 | Bacteria | 1532 |
| 939 | Ga0495660_0026859 | 3300046810 | Bacteria | 3259 |
| 940 | Ga0495660_0028851 | 3300046810 | Bacteria | 3132 |
| 941 | Ga0495660_0050171 | 3300046810 | Bacteria | 2274 |
| 942 | Ga0495660_0082336 | 3300046810 | Bacteria | 1685 |
| 943 | Ga0495660_0087342 | 3300046810 | Bacteria | 1626 |
| 944 | Ga0495660_0088460 | 3300046810 | Bacteria | 1613 |
| 945 | Ga0495660_0088816 | 3300046810 | Bacteria | 1609 |
| 946 | Ga0495660_0096355 | 3300046810 | Bacteria | 1529 |
| 947 | Ga0495660_0104168 | 3300046810 | Bacteria | 1456 |
| 948 | Ga0495660_0111802 | 3300046810 | Bacteria | 1393 |
| 949 | Ga0495660_0112872 | 3300046810 | Bacteria | 1384 |
| 950 | Ga0495660_0131961 | 3300046810 | Bacteria | 1252 |
| 951 | Ga0495581_0045650 | 3300047315 | Bacteria | 2533 |
| 952 | Ga0495581_0216606 | 3300047315 | Bacteria | 1119 |
| 953 | Ga0495604_0050490 | 3300047317 | Bacteria | 3229 |
| 954 | Ga0495604_0134098 | 3300047317 | Bacteria | 1776 |
| 955 | Ga0495636_0088058 | 3300047318 | Bacteria | 1345 |
| 956 | Ga0495674_0266698 | 3300047319 | Bacteria | 1406 |
| 957 | Ga0495672_0005482 | 3300047320 | Bacteria | 10057 |
| 958 | Ga0495672_0006681 | 3300047320 | Bacteria | 8859 |
| 959 | Ga0495672_0007497 | 3300047320 | Bacteria | 8199 |
| 960 | Ga0495672_0008863 | 3300047320 | Bacteria | 7359 |
| 961 | Ga0495672_0010510 | 3300047320 | Bacteria | 6589 |
| 962 | Ga0495672_0027464 | 3300047320 | Bacteria | 3616 |
| 963 | Ga0495672_0033848 | 3300047320 | Bacteria | 3163 |
| 964 | Ga0495672_0035859 | 3300047320 | Bacteria | 3051 |
| 965 | Ga0495672_0038422 | 3300047320 | Bacteria | 2920 |
| 966 | Ga0495672_0070992 | 3300047320 | Bacteria | 1971 |
| 967 | Ga0495672_0086782 | 3300047320 | Bacteria | 1729 |
| 968 | Ga0495672_0099618 | 3300047320 | Bacteria | 1579 |
| 969 | Ga0495672_0114758 | 3300047320 | Bacteria | 1440 |
| 970 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 971 | Ga0495676_0151655 | 3300047321 | Bacteria | 1648 |
| 972 | Ga0495680_0024002 | 3300047322 | Bacteria | 5064 |
| 973 | Ga0495680_0039068 | 3300047322 | Bacteria | 3788 |
| 974 | Ga0495680_0065992 | 3300047322 | Bacteria | 2770 |
| 975 | Ga0495683_0003171 | 3300047323 | Bacteria | 9607 |
| 976 | Ga0495683_0003249 | 3300047323 | Bacteria | 9503 |
| 977 | Ga0495683_0024108 | 3300047323 | Bacteria | 3124 |
| 978 | Ga0495683_0057374 | 3300047323 | Bacteria | 1935 |
| 979 | Ga0495683_0060985 | 3300047323 | Bacteria | 1868 |
| 980 | Ga0495683_0075946 | 3300047323 | Bacteria | 1645 |
| 981 | Ga0495683_0079047 | 3300047323 | Bacteria | 1606 |
| 982 | Ga0495683_0121438 | 3300047323 | Bacteria | 1239 |
| 983 | Ga0495687_007225 | 3300047443 | Bacteria | 6598 |
| 984 | Ga0495687_024579 | 3300047443 | Bacteria | 2861 |
| 985 | Ga0495687_042165 | 3300047443 | Bacteria | 1996 |
| 986 | Ga0495687_053744 | 3300047443 | Bacteria | 1694 |
| 987 | Ga0495687_077151 | 3300047443 | Bacteria | 1316 |
| 988 | Ga0495677_0000650 | 3300047445 | Bacteria | 14031 |
| 989 | Ga0495677_0020960 | 3300047445 | Bacteria | 2369 |
| 990 | Ga0495677_0090162 | 3300047445 | Bacteria | 1155 |
| 991 | Ga0495679_000126 | 3300047446 | Bacteria | 68027 |
| 992 | Ga0495679_001276 | 3300047446 | Bacteria | 14778 |
| 993 | Ga0495679_004444 | 3300047446 | Bacteria | 6465 |
| 994 | Ga0495679_028467 | 3300047446 | Bacteria | 1833 |
| 995 | Ga0495679_028925 | 3300047446 | Bacteria | 1812 |
| 996 | Ga0495679_029111 | 3300047446 | Bacteria | 1804 |
| 997 | Ga0495679_037703 | 3300047446 | Bacteria | 1518 |
| 998 | Ga0495679_039168 | 3300047446 | Bacteria | 1479 |
| 999 | Ga0495679_043219 | 3300047446 | Bacteria | 1386 |
| 1000 | Ga0495673_0005373 | 3300047469 | Bacteria | 7761 |
| 1001 | Ga0495673_0007959 | 3300047469 | Bacteria | 6015 |
| 1002 | Ga0495673_0014503 | 3300047469 | Bacteria | 4094 |
| 1003 | Ga0495673_0016649 | 3300047469 | Bacteria | 3754 |
| 1004 | Ga0495673_0029101 | 3300047469 | Bacteria | 2610 |
| 1005 | Ga0495673_0032526 | 3300047469 | Bacteria | 2429 |
| 1006 | Ga0495673_0041555 | 3300047469 | Bacteria | 2069 |
| 1007 | Ga0495673_0041818 | 3300047469 | Bacteria | 2060 |
| 1008 | Ga0495673_0042449 | 3300047469 | Bacteria | 2041 |
| 1009 | Ga0495673_0046611 | 3300047469 | Bacteria | 1919 |
| 1010 | Ga0495673_0052205 | 3300047469 | Bacteria | 1787 |
| 1011 | Ga0495673_0054042 | 3300047469 | Bacteria | 1748 |
| 1012 | Ga0495673_0077987 | 3300047469 | Bacteria | 1378 |
| 1013 | Ga0495681_0003096 | 3300047470 | Bacteria | 11665 |
| 1014 | Ga0495681_0006229 | 3300047470 | Bacteria | 7861 |
| 1015 | Ga0495681_0006544 | 3300047470 | Bacteria | 7633 |
| 1016 | Ga0495681_0008618 | 3300047470 | Bacteria | 6368 |
| 1017 | Ga0495681_0014387 | 3300047470 | Bacteria | 4538 |
| 1018 | Ga0495681_0014892 | 3300047470 | Bacteria | 4431 |
| 1019 | Ga0495681_0036974 | 3300047470 | Bacteria | 2409 |
| 1020 | Ga0495681_0037159 | 3300047470 | Bacteria | 2402 |
| 1021 | Ga0495681_0037976 | 3300047470 | Bacteria | 2365 |
| 1022 | Ga0495681_0049938 | 3300047470 | Bacteria | 1974 |
| 1023 | Ga0495681_0058808 | 3300047470 | Bacteria | 1779 |
| 1024 | Ga0495681_0078938 | 3300047470 | Bacteria | 1473 |
| 1025 | Ga0495681_0082499 | 3300047470 | Bacteria | 1432 |
| 1026 | Ga0495686_0002019 | 3300047472 | Bacteria | 20049 |
| 1027 | Ga0495686_0027444 | 3300047472 | Bacteria | 3717 |
| 1028 | Ga0495686_0028552 | 3300047472 | Bacteria | 3632 |
| 1029 | Ga0495686_0036418 | 3300047472 | Bacteria | 3158 |
| 1030 | Ga0495686_0050482 | 3300047472 | Bacteria | 2613 |
| 1031 | Ga0495686_0124526 | 3300047472 | Bacteria | 1533 |
| 1032 | Ga0495686_0160304 | 3300047472 | Bacteria | 1315 |
| 1033 | Ga0495686_0248139 | 3300047472 | Bacteria | 1001 |
| 1034 | Ga0495593_0023986 | 3300047673 | Bacteria | 3385 |
| 1035 | Ga0495593_0035478 | 3300047673 | Bacteria | 2707 |
| 1036 | Ga0495593_0049143 | 3300047673 | Bacteria | 2239 |
| 1037 | Ga0495602_0014404 | 3300048088 | Bacteria | 8028 |
| 1038 | Ga0495614_0059153 | 3300048089 | Bacteria | 1646 |
| 1039 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 1040 | Ga0495626_0002967 | 3300048091 | Bacteria | 11256 |
| 1041 | Ga0495626_0003463 | 3300048091 | Bacteria | 10116 |
| 1042 | Ga0495626_0009973 | 3300048091 | Bacteria | 5100 |
| 1043 | Ga0495626_0021019 | 3300048091 | Bacteria | 3246 |
| 1044 | Ga0495626_0044378 | 3300048091 | Bacteria | 2080 |
| 1045 | Ga0495626_0058650 | 3300048091 | Bacteria | 1758 |
| 1046 | Ga0495626_0068898 | 3300048091 | Bacteria | 1594 |
| 1047 | Ga0495626_0077102 | 3300048091 | Bacteria | 1486 |
| 1048 | Ga0496102_0039674 | 3300048905 | Bacteria | 4255 |
| 1049 | Ga0496102_0039685 | 3300048905 | Bacteria | 4255 |
| 1050 | Ga0496102_0118982 | 3300048905 | Bacteria | 2466 |
| 1051 | Ga0496103_0009900 | 3300048906 | Bacteria | 5639 |
| 1052 | Ga0496103_0013678 | 3300048906 | Bacteria | 4815 |
| 1053 | Ga0496104_0037906 | 3300048907 | Bacteria | 4508 |
| 1054 | Ga0496106_0269835 | 3300048909 | Bacteria | 1362 |
| 1055 | Ga0496108_0233135 | 3300048911 | Bacteria | 1601 |
| 1056 | Ga0496110_0028872 | 3300048913 | Bacteria | 4768 |
| 1057 | Ga0496110_0104451 | 3300048913 | Bacteria | 2542 |
| 1058 | Ga0496113_0197086 | 3300048916 | Bacteria | 1600 |
| 1059 | Ga0496114_0500498 | 3300048917 | Bacteria | 1075 |
| 1060 | Ga0496116_0011263 | 3300048919 | Bacteria | 7422 |
| 1061 | Ga0496116_0018629 | 3300048919 | Bacteria | 5342 |
| 1062 | Ga0496116_0030573 | 3300048919 | Bacteria | 3865 |
| 1063 | Ga0496116_0068022 | 3300048919 | Bacteria | 2271 |
| 1064 | Ga0496116_0086629 | 3300048919 | Bacteria | 1920 |
| 1065 | Ga0496117_0002615 | 3300048920 | Bacteria | 22374 |
| 1066 | Ga0496117_0060972 | 3300048920 | Bacteria | 2595 |
| 1067 | Ga0496117_0070653 | 3300048920 | Bacteria | 2343 |
| 1068 | Ga0496117_0077206 | 3300048920 | Bacteria | 2205 |
| 1069 | Ga0496117_0134198 | 3300048920 | Bacteria | 1494 |
| 1070 | Ga0496118_0007860 | 3300048921 | Bacteria | 11181 |
| 1071 | Ga0496118_0026123 | 3300048921 | Bacteria | 4984 |
| 1072 | Ga0496118_0038784 | 3300048921 | Bacteria | 3812 |
| 1073 | Ga0496118_0067109 | 3300048921 | Bacteria | 2614 |
| 1074 | Ga0496118_0101749 | 3300048921 | Bacteria | 1939 |
| 1075 | Ga0496118_0108001 | 3300048921 | Bacteria | 1856 |
| 1076 | Ga0496119_0054262 | 3300048922 | Bacteria | 2441 |
| 1077 | Ga0496119_0111054 | 3300048922 | Bacteria | 1521 |
| 1078 | Ga0496120_0025786 | 3300048923 | Bacteria | 3643 |
| 1079 | Ga0496120_0049142 | 3300048923 | Bacteria | 2422 |
| 1080 | Ga0496120_0102175 | 3300048923 | Bacteria | 1512 |
| 1081 | Ga0496121_0007632 | 3300048924 | Bacteria | 13001 |
| 1082 | Ga0496121_0095663 | 3300048924 | Bacteria | 2307 |
| 1083 | Ga0496121_0153244 | 3300048924 | Bacteria | 1693 |
| 1084 | Ga0496122_0006870 | 3300048925 | Bacteria | 12884 |
| 1085 | Ga0496122_0009750 | 3300048925 | Bacteria | 10033 |
| 1086 | Ga0496122_0009960 | 3300048925 | Bacteria | 9900 |
| 1087 | Ga0496122_0037125 | 3300048925 | Bacteria | 3928 |
| 1088 | Ga0496122_0055660 | 3300048925 | Bacteria | 2956 |
| 1089 | Ga0496122_0139048 | 3300048925 | Bacteria | 1523 |
| 1090 | Ga0496122_0159736 | 3300048925 | Bacteria | 1376 |
| 1091 | Ga0496122_0194429 | 3300048925 | Bacteria | 1193 |
| 1092 | Ga0496123_0006780 | 3300048926 | Bacteria | 11004 |
| 1093 | Ga0496123_0025924 | 3300048926 | Bacteria | 4406 |
| 1094 | Ga0496123_0029048 | 3300048926 | Bacteria | 4082 |
| 1095 | Ga0496123_0137870 | 3300048926 | Bacteria | 1339 |
| 1096 | Ga0496124_0000125 | 3300048927 | Bacteria | 159942 |
| 1097 | Ga0496124_0003286 | 3300048927 | Bacteria | 19942 |
| 1098 | Ga0496124_0022394 | 3300048927 | Bacteria | 5793 |
| 1099 | Ga0496124_0033558 | 3300048927 | Bacteria | 4514 |
| 1100 | Ga0496124_0035843 | 3300048927 | Bacteria | 4335 |
| 1101 | Ga0496124_0049764 | 3300048927 | Bacteria | 3573 |
| 1102 | Ga0496124_0090780 | 3300048927 | Bacteria | 2490 |
| 1103 | Ga0496124_0126651 | 3300048927 | Bacteria | 2033 |
| 1104 | Ga0496124_0163497 | 3300048927 | Bacteria | 1732 |
| 1105 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1106 | Ga0496125_0003246 | 3300048928 | Bacteria | 20033 |
| 1107 | Ga0496125_0004490 | 3300048928 | Bacteria | 16066 |
| 1108 | Ga0496125_0009991 | 3300048928 | Bacteria | 9645 |
| 1109 | Ga0496125_0022908 | 3300048928 | Bacteria | 5786 |
| 1110 | Ga0496125_0044334 | 3300048928 | Bacteria | 3763 |
| 1111 | Ga0496125_0083993 | 3300048928 | Bacteria | 2420 |
| 1112 | Ga0496125_0087170 | 3300048928 | Bacteria | 2358 |
| 1113 | Ga0496125_0133183 | 3300048928 | Bacteria | 1745 |
| 1114 | Ga0496125_0159105 | 3300048928 | Bacteria | 1537 |
| 1115 | Ga0496125_0195797 | 3300048928 | Bacteria | 1329 |
| 1116 | Ga0496126_0059046 | 3300048929 | Bacteria | 3455 |
| 1117 | Ga0496126_0093713 | 3300048929 | Bacteria | 2636 |
| 1118 | Ga0496126_0116638 | 3300048929 | Bacteria | 2320 |
| 1119 | Ga0496126_0231402 | 3300048929 | Bacteria | 1548 |
| 1120 | Ga0495678_006783 | 3300049459 | Bacteria | 6028 |
| 1121 | Ga0495678_007143 | 3300049459 | Bacteria | 5831 |
| 1122 | Ga0495678_019023 | 3300049459 | Bacteria | 3074 |
| 1123 | Ga0495678_023986 | 3300049459 | Bacteria | 2641 |
| 1124 | Ga0495678_040582 | 3300049459 | Bacteria | 1869 |
| 1125 | Ga0495678_046826 | 3300049459 | Bacteria | 1697 |
| 1126 | Ga0495678_048857 | 3300049459 | Bacteria | 1647 |
| 1127 | Ga0495678_051151 | 3300049459 | Bacteria | 1598 |
| 1128 | Ga0495678_053717 | 3300049459 | Bacteria | 1545 |
| 1129 | Ga0495678_065771 | 3300049459 | Bacteria | 1344 |
| 1130 | Ga0495678_082491 | 3300049459 | Bacteria | 1151 |
| 1131 | Ga0495678_098546 | 3300049459 | Bacteria | 1016 |
| 1132 | Ga0495682_0001194 | 3300049460 | Bacteria | 14764 |
| 1133 | Ga0495682_0010234 | 3300049460 | Bacteria | 3640 |
| 1134 | Ga0495682_0044936 | 3300049460 | Bacteria | 1615 |
| 1135 | Ga0501032_0032467 | 3300049569 | Bacteria | 3578 |
| 1136 | Ga0501034_0012375 | 3300049571 | Bacteria | 8815 |
| 1137 | Ga0501036_0006094 | 3300049572 | Bacteria | 9784 |
| 1138 | Ga0501039_0353924 | 3300049575 | Bacteria | 1154 |
| 1139 | Ga0501042_0284943 | 3300049578 | Bacteria | 1193 |
| 1140 | Ga0501048_0002402 | 3300049582 | Bacteria | 14287 |
| 1141 | Ga0501071_0017634 | 3300049587 | Bacteria | 4928 |
| 1142 | Ga0501076_0069483 | 3300049592 | Bacteria | 2814 |
| 1143 | Ga0501206_002278 | 3300049653 | Bacteria | 2418 |
| 1144 | Ga0501079_0144960 | 3300049741 | Bacteria | 1850 |
| 1145 | Ga0501079_0355387 | 3300049741 | Bacteria | 1148 |
| 1146 | Ga0501281_01138 | 3300049777 | Bacteria | 2134 |
| 1147 | Ga0501035_0000030 | 3300049822 | Bacteria | 176511 |
| 1148 | Ga0501035_0078387 | 3300049822 | Bacteria | 2919 |
| 1149 | Ga0501226_000049 | 3300049853 | Bacteria | 53390 |
| 1150 | nmdc:mga03683_64453_c1 | 3300050489 | Bacteria | 1555 |
| 1151 | nmdc:mga03n38_13580_c1 | 3300050490 | Bacteria | 3099 |
| 1152 | nmdc:mga0yw44_142413_c1 | 3300050492 | Bacteria | 1559 |
| 1153 | nmdc:mga0yw44_62232_c1 | 3300050492 | Bacteria | 2292 |
| 1154 | nmdc:mga0k408_183058_c1 | 3300050493 | Bacteria | 1250 |
| 1155 | nmdc:mga0k408_184457_c1 | 3300050493 | Bacteria | 1244 |
| 1156 | nmdc:mga0k408_21214_c1 | 3300050493 | Bacteria | 3647 |
| 1157 | nmdc:mga0k408_62433_c1 | 3300050493 | Bacteria | 1695 |
| 1158 | nmdc:mga06z11_145216_c1 | 3300050494 | Bacteria | 1344 |
| 1159 | nmdc:mga07m45_19143_c1 | 3300050496 | Bacteria | 3705 |
| 1160 | nmdc:mga05p37_212236_c1 | 3300050507 | Bacteria | 2340 |
| 1161 | nmdc:mga05p37_556540_c1 | 3300050507 | Bacteria | 1304 |
| 1162 | nmdc:mga09592_340295_c1 | 3300050508 | Bacteria | 1299 |
| 1163 | nmdc:mga0qj67_11616_c1 | 3300050509 | Bacteria | 6604 |
| 1164 | nmdc:mga0qj67_147321_c1 | 3300050509 | Bacteria | 1909 |
| 1165 | nmdc:mga06r32_159119_c1 | 3300050510 | Bacteria | 2241 |
| 1166 | nmdc:mga06r32_29227_c1 | 3300050510 | Bacteria | 5164 |
| 1167 | nmdc:mga08y16_516157_c1 | 3300050511 | Bacteria | 1212 |
| 1168 | nmdc:mga0n895_57493_c1 | 3300050512 | Bacteria | 3834 |
| 1169 | nmdc:mga0n895_84257_c1 | 3300050512 | Bacteria | 3172 |
| 1170 | nmdc:mga0rr50_130397_c1 | 3300050513 | Bacteria | 2012 |
| 1171 | nmdc:mga0a205_111882_c1 | 3300050515 | Bacteria | 2630 |
| 1172 | Ga0500646_0000571 | 3300053090 | Bacteria | 10592 |
| 1173 | Ga0500562_003256 | 3300053108 | Bacteria | 4060 |
| 1174 | Ga0500572_019073 | 3300053111 | Bacteria | 1786 |
| 1175 | Ga0500593_003321 | 3300053117 | Bacteria | 6055 |
| 1176 | Ga0500607_042054 | 3300053121 | Bacteria | 2468 |
| 1177 | Ga0500655_019142 | 3300053133 | Bacteria | 1274 |
| 1178 | Ga0500658_0012861 | 3300053134 | Bacteria | 3092 |
| 1179 | Ga0500616_0035259 | 3300053153 | Bacteria | 2721 |
| 1180 | Ga0500619_000123 | 3300053154 | Bacteria | 20368 |
| 1181 | Ga0500627_0080704 | 3300053158 | Bacteria | 1450 |
| 1182 | Ga0500637_0051278 | 3300053178 | Bacteria | 2351 |
| 1183 | Ga0500645_000317 | 3300053730 | Bacteria | 34309 |
| 1184 | Ga0500645_001087 | 3300053730 | Bacteria | 14925 |
| 1185 | Ga0500645_041314 | 3300053730 | Bacteria | 1362 |
| 1186 | Ga0501084_0164120 | 3300054114 | Bacteria | 1875 |
| 1187 | Ga0590071_007143 | 3300059421 | Bacteria | 2645 |
| 1188 | Ga0501082_0398668 | 3300060353 | Bacteria | 1201 |
| 1189 | Ga0530510_0402880 | 3300061734 | Bacteria | 1031 |
| 1190 | 2511244704 | 2511231002 | Bacteria | 5042903 |
| 1191 | 2511252504 | 2511231004 | Bacteria | 6669789 |
| 1192 | 2511268451 | 2511231006 | Bacteria | 6794709 |
| 1193 | 2511272365 | 2511231007 | Bacteria | 6306603 |
| 1194 | 2511278616 | 2511231008 | Bacteria | 6624100 |
| 1195 | 2511292564 | 2511231010 | Bacteria | 6373152 |
| 1196 | 2511298781 | 2511231011 | Bacteria | 6149768 |
| 1197 | 2511299911 | 2511231012 | Bacteria | 6738011 |
| 1198 | 2511316474 | 2511231014 | Bacteria | 6462302 |
| 1199 | 2511320236 | 2511231015 | Bacteria | 6598026 |
| 1200 | 2511329390 | 2511231016 | Bacteria | 6704427 |
| 1201 | 2511334053 | 2511231017 | Bacteria | 6503007 |
| 1202 | 2511337248 | 2511231018 | Bacteria | 6436256 |
| 1203 | 2511344301 | 2511231019 | Bacteria | 6520662 |
| 1204 | 2511352123 | 2511231020 | Bacteria | 6115223 |
| 1205 | 2511357476 | 2511231021 | Bacteria | 7302637 |
| 1206 | 2511363912 | 2511231022 | Bacteria | 6719296 |
| 1207 | 2511370096 | 2511231023 | Bacteria | 6808468 |
| 1208 | 2511373919 | 2511231024 | Bacteria | 5835885 |
| 1209 | 2511416275 | 2511231031 | Bacteria | 6558529 |
| 1210 | 2511826242 | 2511231156 | Bacteria | 6845832 |
| 1211 | 2512324876 | 2512047018 | Bacteria | 6663241 |
| 1212 | 2513956161 | 2513237150 | Bacteria | 6553639 |
| 1213 | 2514045597 | 2513237165 | Bacteria | 6771773 |
| 1214 | 2583791002 | 2582580891 | Bacteria | 6800976 |
| 1215 | 2597856853 | 2597489887 | Bacteria | 6666321 |
| 1216 | 2597863066 | 2597489888 | Bacteria | 6179543 |
| 1217 | 2597868859 | 2597489889 | Bacteria | 6297495 |
| 1218 | 2599401648 | 2599185167 | Bacteria | 6353609 |
| 1219 | 2599451810 | 2599185179 | Bacteria | 6611171 |
| 1220 | 2599483880 | 2599185185 | Bacteria | 6652270 |
| 1221 | 2599504212 | 2599185188 | Bacteria | 6164180 |
| 1222 | 2599509585 | 2599185189 | Bacteria | 5862825 |
| 1223 | 2599514893 | 2599185190 | Bacteria | 6285678 |
| 1224 | 2599520990 | 2599185191 | Bacteria | 6297582 |
| 1225 | 2599613495 | 2599185212 | Bacteria | 6765997 |
| 1226 | 2599772401 | 2599185248 | Bacteria | 6696816 |
| 1227 | 2599801526 | 2599185257 | Bacteria | 6492581 |
| 1228 | 2599882240 | 2599185288 | Bacteria | 6666191 |
| 1229 | 2599888877 | 2599185289 | Bacteria | 6778765 |
| 1230 | 2599894310 | 2599185290 | Bacteria | 6289611 |
| 1231 | 2599900506 | 2599185291 | Bacteria | 6775623 |
| 1232 | 2599933527 | 2599185300 | Bacteria | 6062622 |
| 1233 | 2599944021 | 2599185302 | Bacteria | 5954930 |
| 1234 | 2599951520 | 2599185303 | Bacteria | 6512725 |
| 1235 | 2599955767 | 2599185304 | Bacteria | 5951361 |
| 1236 | 2599961402 | 2599185305 | Bacteria | 6748700 |
| 1237 | 2599967271 | 2599185306 | Bacteria | 6637356 |
| 1238 | 2599971604 | 2599185307 | Bacteria | 6194719 |
| 1239 | 2599979334 | 2599185308 | Bacteria | 6621546 |
| 1240 | 2599985568 | 2599185309 | Bacteria | 5969593 |
| 1241 | 2599989441 | 2599185310 | Bacteria | 6014457 |
| 1242 | 2599994364 | 2599185311 | Bacteria | 6354990 |
| 1243 | 2600000163 | 2599185312 | Bacteria | 5912071 |
| 1244 | 2600008394 | 2599185313 | Bacteria | 6658188 |
| 1245 | 2600013219 | 2599185314 | Bacteria | 6621749 |
| 1246 | 2600019656 | 2599185315 | Bacteria | 6771107 |
| 1247 | 2600023657 | 2599185316 | Bacteria | 6320029 |
| 1248 | 2600032540 | 2599185317 | Bacteria | 6435722 |
| 1249 | 2600039009 | 2599185318 | Bacteria | 6961590 |
| 1250 | 2600044213 | 2599185319 | Bacteria | 6637840 |
| 1251 | 2600048470 | 2599185320 | Bacteria | 5963263 |
| 1252 | 2600054166 | 2599185321 | Bacteria | 6764560 |
| 1253 | 2600060384 | 2599185322 | Bacteria | 6763055 |
| 1254 | 2600066522 | 2599185323 | Bacteria | 6688755 |
| 1255 | 2600073409 | 2599185324 | Bacteria | 6590677 |
| 1256 | 2600078168 | 2599185325 | Bacteria | 6324919 |
| 1257 | 2600361731 | 2600254930 | Bacteria | 6431253 |
| 1258 | 2600365823 | 2600254931 | Bacteria | 6734225 |
| 1259 | 2601625154 | 2600255283 | Bacteria | 6061572 |
| 1260 | 2601694223 | 2600255296 | Bacteria | 5784754 |
| 1261 | 2601795509 | 2600255318 | Bacteria | 6383414 |
| 1262 | 2606075579 | 2603880185 | Bacteria | 6379190 |
| 1263 | 2606128510 | 2603880199 | Bacteria | 6377649 |
| 1264 | 2624479446 | 2623620443 | Bacteria | 6427864 |
| 1265 | 2624493556 | 2623620446 | Bacteria | 6500345 |
| 1266 | 2643841744 | 2643221565 | Bacteria | 6216018 |
| 1267 | 2643865418 | 2643221570 | Bacteria | 5103772 |
| 1268 | 2643871837 | 2643221571 | Bacteria | 6228673 |
| 1269 | 2643933136 | 2643221585 | Bacteria | 5812563 |
| 1270 | 2643952582 | 2643221589 | Bacteria | 6250934 |
| 1271 | 2644022344 | 2643221602 | Bacteria | 6249926 |
| 1272 | 2644187141 | 2643221633 | Bacteria | 6733554 |
| 1273 | 2644243854 | 2643221644 | Bacteria | 6865017 |
| 1274 | 2644286115 | 2643221650 | Bacteria | 7029547 |
| 1275 | 2644296125 | 2643221652 | Bacteria | 5140275 |
| 1276 | 2644314385 | 2643221656 | Bacteria | 5809961 |
| 1277 | 2644340172 | 2643221660 | Bacteria | 4208257 |
| 1278 | 2644623110 | 2643221713 | Bacteria | 6554480 |
| 1279 | 2652548286 | 2651869719 | Bacteria | 6047974 |
| 1280 | 2671093167 | 2667528170 | Bacteria | 6786960 |
| 1281 | 2671128966 | 2667528176 | Bacteria | 6724917 |
| 1282 | 2671768475 | 2671180172 | Bacteria | 6495783 |
| 1283 | 2678264583 | 2675903515 | Bacteria | 6580491 |
| 1284 | 2687579268 | 2687453129 | Bacteria | 4387428 |
| 1285 | 2715753840 | 2713897148 | Bacteria | 5883533 |
| 1286 | 2715757712 | 2713897149 | Bacteria | 6506249 |
| 1287 | 2718633293 | 2718217725 | Bacteria | 5758958 |
| 1288 | 2723247884 | 2721755607 | Bacteria | 5841722 |
| 1289 | 2738810893 | 2738541294 | Bacteria | 6925949 |
| 1290 | 2738898253 | 2738541309 | Bacteria | 6926455 |
| 1291 | 2739055687 | 2738541337 | Bacteria | 6183410 |
| 1292 | 2739200868 | 2738543004 | Bacteria | 6381073 |
| 1293 | 2739261120 | 2738543015 | Bacteria | 6750701 |
| 1294 | 2739316009 | 2738543025 | Bacteria | 6600348 |
| 1295 | 2743736281 | 2740892503 | Bacteria | 6855563 |
| 1296 | 2745005037 | 2744054620 | Bacteria | 6551379 |
| 1297 | 2774122890 | 2773857670 | Bacteria | 6407454 |
| 1298 | 2774137604 | 2773857673 | Bacteria | 6513460 |
| 1299 | 2784265647 | 2784132063 | Bacteria | 6262788 |
| 1300 | 2784315248 | 2784132072 | Bacteria | 6596533 |
| 1301 | 2794595102 | 2791355520 | Bacteria | 5948615 |
| 1302 | 2808857035 | 2808606361 | Bacteria | 6136259 |
| 1303 | 2808926980 | 2808606376 | Bacteria | 6248667 |
| 1304 | 2808927374 | 2808606377 | Bacteria | 6646337 |
| 1305 | 2808937107 | 2808606378 | Bacteria | 6177535 |
| 1306 | 2808940147 | 2808606379 | Bacteria | 5022697 |
| 1307 | 2808949086 | 2808606380 | Bacteria | 6248705 |
| 1308 | 2808950087 | 2808606381 | Bacteria | 6646461 |
| 1309 | 2808965423 | 2808606383 | Bacteria | 6138645 |
| 1310 | 2808979394 | 2808606385 | Bacteria | 6711065 |
| 1311 | 2808995318 | 2808606388 | Bacteria | 6706662 |
| 1312 | 2809000336 | 2808606389 | Bacteria | 6138126 |
| 1313 | 2812370100 | 2811994881 | Bacteria | 6298475 |
| 1314 | 2819653999 | 2818991456 | Bacteria | 6123676 |
| 1315 | 2825656473 | 2825651385 | Bacteria | 6715909 |
| 1316 | 2834029716 | 2834028612 | Bacteria | 6354979 |
| 1317 | 2839142910 | 2839138175 | Bacteria | 6549354 |
| 1318 | 2842832198 | 2842826826 | Bacteria | 5974129 |
| 1319 | 2842832683 | 2842832357 | Bacteria | 5959113 |
| 1320 | 2842841510 | 2842837860 | Bacteria | 6066181 |
| 1321 | 2842848232 | 2842843487 | Bacteria | 6004777 |
| 1322 | 2842856860 | 2842854478 | Bacteria | 6143501 |
| 1323 | 2852618401 | 2852612431 | Bacteria | 6885235 |
| 1324 | 2852658930 | 2852657418 | Bacteria | 6472974 |
| 1325 | 2852673463 | 2852667396 | Bacteria | 6885555 |
| 1326 | 2858951017 | 2858950400 | Bacteria | 6783797 |
| 1327 | 2860340011 | 2860339153 | Bacteria | 6846989 |
| 1328 | 2860869710 | 2860867994 | Bacteria | 5645326 |
| 1329 | 2878031449 | 2878029506 | Bacteria | 6418441 |
| 1330 | 2880232320 | 2880230671 | Bacteria | 6140320 |
| 1331 | 2881105274 | 2881101125 | Bacteria | 4590519 |
| 1332 | 2894416965 | 2894414249 | Bacteria | 4405451 |
| 1333 | 2904521789 | 2904518522 | Bacteria | 6068986 |
| 1334 | 2904553185 | 2904550169 | Bacteria | 6221258 |
| 1335 | 2908448650 | 2908446538 | Bacteria | 6829095 |
| 1336 | 2913041060 | 2913036834 | Bacteria | 6704877 |
| 1337 | 2919064080 | 2919063839 | Bacteria | 6302690 |
| 1338 | 2919386413 | 2919385768 | Bacteria | 5897293 |
| 1339 | 2919457103 | 2919456309 | Bacteria | 6586567 |
| 1340 | 2919486182 | 2919481497 | Bacteria | 6907839 |
| 1341 | 2919491304 | 2919487758 | Bacteria | 5929766 |
| 1342 | 2919702857 | 2919697872 | Bacteria | 6553725 |
| 1343 | 2923155295 | 2923153595 | Bacteria | 6870622 |
| 1344 | 2923524190 | 2923519811 | Bacteria | 6298479 |
| 1345 | 2923590096 | 2923586266 | Bacteria | 6565975 |
| 1346 | 2929148560 | 2929144301 | Bacteria | 6622272 |
| 1347 | 2929191683 | 2929189879 | Bacteria | 5930554 |
| 1348 | 2931373998 | 2931369376 | Bacteria | 6847892 |
| 1349 | 2931392785 | 2931390751 | Bacteria | 6273349 |
| 1350 | 2931400098 | 2931396565 | Bacteria | 7251677 |
| 1351 | 2939639732 | 2939636861 | Bacteria | 6297853 |
| 1352 | 2941481807 | |||
| 1353 | 2945928884 | 2945928738 | Bacteria | 6053221 |
| 1354 | 2945965146 | 2945961074 | Bacteria | 7342064 |
| 1355 | 2946011086 | 2946006987 | Bacteria | 6705746 |
| 1356 | 2946029966 | 2946027586 | Bacteria | 6049274 |
| 1357 | 2947236538 | 2947233263 | Bacteria | 6439278 |
| 1358 | 2969306232 | 2969304461 | Bacteria | 6601805 |
| 1359 | 2974292113 | 2974289157 | Bacteria | 6080362 |
| 1360 | 2984290743 | 2984286254 | Bacteria | 6702062 |
| 1361 | 2988730153 | 2988728565 | Bacteria | 6124362 |
| 1362 | 2998141628 | 2998139840 | Bacteria | 6073514 |
| 1363 | 3007400835 | 3007395558 | Bacteria | 6755444 |
| 1364 | 3007513026 | 3007511990 | Bacteria | 6481491 |
| 1365 | 3007616408 | 3007614139 | Bacteria | 6053559 |
| 1366 | 3007622334 | 3007619802 | Bacteria | 6411688 |
| 1367 | 3007723317 | 3007718800 | Bacteria | 5971527 |
| 1368 | 3007856219 | 3007855910 | Bacteria | 5637581 |
| 1369 | 3007863133 | 3007861166 | Bacteria | 6045338 |
| 1370 | 3007868030 | 3007866637 | Bacteria | 5899198 |
| 1371 | 644751928 | 644736347 | Bacteria | 6476522 |
| 1372 | 8015689513 | 8015687852 | Bacteria | 6613826 |
| 1373 | 8019774078 | 8019769354 | Bacteria | 6924660 |
| 1374 | 8019780262 | 8019775933 | Bacteria | 6858656 |
| 1375 | 8021623401 | 8021622325 | Bacteria | 4844743 |
| 1376 | 8021628813 | 8021626552 | Bacteria | 4665214 |
| 1377 | 8029999128 | 8029995093 | Bacteria | 5990776 |
| 1378 | 8054287239 | 8054285046 | Bacteria | 6919322 |
| 1379 | 8054352141 | 8054347763 | Bacteria | 5901107 |
| 1380 | 8054505286 | 8054503363 | Bacteria | 6101651 |
| 1381 | 8055772650 | 8055770955 | Bacteria | 6827675 |
| 1382 | 8055819844 | 8055817908 | Bacteria | 6609162 |
| 1383 | 8056130176 | 8056125926 | Bacteria | 6228218 |
| 1384 | 8056133609 | 8056131705 | Bacteria | 6107031 |
| 1385 | 8056144816 | 8056143049 | Bacteria | 6307666 |
| 1386 | 8056150518 | 8056148874 | Bacteria | 6479865 |
| 1387 | 8056156221 | 8056155041 | Bacteria | 6486948 |
| 1388 | 8056165033 | 8056161164 | Bacteria | 6106669 |
| 1389 | 8056169363 | 8056166840 | Bacteria | 5820959 |
| 1390 | 8056175548 | 8056172158 | Bacteria | 6133900 |
| 1391 | 8056181154 | 8056177738 | Bacteria | 6748268 |
| 1392 | 8056573216 | 8056569372 | Bacteria | 5997322 |
| 1393 | 8057799078 | 8057798959 | Bacteria | 6713499 |
| 1394 | Ga0495583_0002918 | |||
| 1395 | MRS2a_Contig_319 | |||
| 1396 | SwRhRL2b_contig_14979 | |||
| 1397 | JGI25155J39150_1000098 | |||
| 1398 | JGI25156J39149_1000163 | |||
| 1399 | JGI25154J39366_1000183 | |||
| 1400 | JGI25154J39366_1002797 | |||
| 1401 | JGI25157J39369_1000209 | |||
| 1402 | JGI25159J45721_1009212 | |||
| 1403 | JGI25151J46595_10007415 | |||
| 1404 | JGI25160J50197_1000212 | |||
| 1405 | JGI25161J50226_1000151 | |||
| 1406 | Ga0055538_1000058 | |||
| 1407 | Ga0055539_1000087 | |||
| 1408 | Ga0055533_1000097 | |||
| 1409 | Ga0055532_1000156 | |||
| 1410 | Ga0055525_1000428 | |||
| 1411 | Ga0055526_1000665 | |||
| 1412 | Ga0055526_1006387 | |||
| 1413 | Ga0055526_1006416 | |||
| 1414 | Ga0055537_1000005 | |||
| 1415 | Ga0055537_1000709 | |||
| 1416 | Ga0055524_1000082 | |||
| 1417 | Ga0055524_1001237 | |||
| 1418 | Ga0055536_1001960 | |||
| 1419 | Ga0055536_1008459 | |||
| 1420 | Ga0055534_1000493 | |||
| 1421 | Ga0055534_1003222 | |||
| 1422 | Ga0055528_1000082 | |||
| 1423 | Ga0055528_1002394 | |||
| 1424 | Ga0055530_10000357 | |||
| 1425 | Ga0055530_10000688 | |||
| 1426 | Ga0055530_10002633 | |||
| 1427 | Ga0055540_1000010 | |||
| 1428 | Ga0055540_1000014 | |||
| 1429 | Ga0055540_1000076 | |||
| 1430 | Ga0055540_1000253 | |||
| 1431 | Ga0055540_1001210 | |||
| 1432 | Ga0055531_10000769 | |||
| 1433 | Ga0055531_10001153 | |||
| 1434 | Ga0055531_10021777 | |||
| 1435 | Ga0055541_1000060 | |||
| 1436 | Ga0055543_1000526 | |||
| 1437 | Ga0065165_1010723 | |||
| 1438 | Ga0065165_1011785 | |||
| 1439 | Ga0065165_1018022 | |||
| 1440 | Ga0065714_10005879 | |||
| 1441 | Ga0065714_10007382 | |||
| 1442 | Ga0065714_10023056 | |||
| 1443 | Ga0065714_10066205 | |||
| 1444 | Ga0065714_10066523 | |||
| 1445 | Ga0065704_10103302 | |||
| 1446 | Ga0065704_10146264 | |||
| 1447 | Ga0065704_10231731 | |||
| 1448 | Ga0065712_10000624 | |||
| 1449 | Ga0065712_10002139 | |||
| 1450 | Ga0065712_10069768 | |||
| 1451 | Ga0065715_10097314 | |||
| 1452 | Ga0070676_10019903 | |||
| 1453 | Ga0070683_100114202 | |||
| 1454 | Ga0070690_100255831 | |||
| 1455 | Ga0070670_100000573 | |||
| 1456 | Ga0070670_100001103 | |||
| 1457 | Ga0070670_100019134 | |||
| 1458 | Ga0070670_100078619 | |||
| 1459 | Ga0070670_100268858 | |||
| 1460 | Ga0068869_100022441 | |||
| 1461 | Ga0070666_10005190 | |||
| 1462 | Ga0068868_100139270 | |||
| 1463 | Ga0070661_100000029 | |||
| 1464 | Ga0070669_100019134 | |||
| 1465 | Ga0070669_100125513 | |||
| 1466 | Ga0070669_100155027 | |||
| 1467 | Ga0070669_100160965 | |||
| 1468 | Ga0070675_100025997 | |||
| 1469 | Ga0070675_100071088 | |||
| 1470 | Ga0070671_100011056 | |||
| 1471 | Ga0070671_100153324 | |||
| 1472 | Ga0070674_100081819 | |||
| 1473 | Ga0070674_100114468 | |||
| 1474 | Ga0070673_100008668 | |||
| 1475 | Ga0070688_100038778 | |||
| 1476 | Ga0070659_100000877 | |||
| 1477 | Ga0070678_100014404 | |||
| 1478 | Ga0070678_100021363 | |||
| 1479 | Ga0070662_100004039 | |||
| 1480 | Ga0070662_100051420 | |||
| 1481 | Ga0070662_100081568 | |||
| 1482 | Ga0068867_100135231 | |||
| 1483 | Ga0070685_10040301 | |||
| 1484 | Ga0070706_100422077 | |||
| 1485 | Ga0070707_100248249 | |||
| 1486 | Ga0070679_100128294 | |||
| 1487 | Ga0070684_100198280 | |||
| 1488 | Ga0068853_100019145 | |||
| 1489 | Ga0070672_100051800 | |||
| 1490 | Ga0070672_100132531 | |||
| 1491 | Ga0070695_100013037 | |||
| 1492 | Ga0070664_100000046 | |||
| 1493 | Ga0070664_100009920 | |||
| 1494 | Ga0070664_100378919 | |||
| 1495 | Ga0068857_100463531 | |||
| 1496 | Ga0068854_100003507 | |||
| 1497 | Ga0068859_100027466 | |||
| 1498 | Ga0068859_100428626 | |||
| 1499 | Ga0068864_100003420 | |||
| 1500 | Ga0068866_10010526 | |||
| 1501 | Ga0068861_100016003 | |||
| 1502 | Ga0068861_100333011 | |||
| 1503 | Ga0068851_10000050 | |||
| 1504 | Ga0068851_10022967 | |||
| 1505 | Ga0068863_100002555 | |||
| 1506 | Ga0068863_100043982 | |||
| 1507 | Ga0068858_100010086 | |||
| 1508 | Ga0068858_100010413 | |||
| 1509 | Ga0068858_100082497 | |||
| 1510 | Ga0068860_100412779 | |||
| 1511 | Ga0068860_100417924 | |||
| 1512 | Ga0068862_100057800 | |||
| 1513 | Ga0081455_10023769 | |||
| 1514 | Ga0070717_10192879 | |||
| 1515 | Ga0075365_10001663 | |||
| 1516 | Ga0075363_100012995 | |||
| 1517 | Ga0075363_100124350 | |||
| 1518 | Ga0075363_100166680 | |||
| 1519 | Ga0075364_10210962 | |||
| 1520 | Ga0075364_10238757 | |||
| 1521 | Ga0075432_10045718 | |||
| 1522 | Ga0075362_10015018 | |||
| 1523 | Ga0075362_10060855 | |||
| 1524 | Ga0075362_10151221 | |||
| 1525 | Ga0075369_10110775 | |||
| 1526 | Ga0075366_10012451 | |||
| 1527 | Ga0075366_10059694 | |||
| 1528 | Ga0075366_10084264 | |||
| 1529 | Ga0068871_100053445 | |||
| 1530 | Ga0075428_100070983 | |||
| 1531 | Ga0075430_100028327 | |||
| 1532 | Ga0075430_100029379 | |||
| 1533 | Ga0075431_100194929 | |||
| 1534 | Ga0075433_10206265 | |||
| 1535 | Ga0075434_100007145 | |||
| 1536 | Ga0075434_100228445 | |||
| 1537 | Ga0075429_100131261 | |||
| 1538 | Ga0068865_100037755 | |||
| 1539 | Ga0068865_100092987 | |||
| 1540 | Ga0075436_100106412 | |||
| 1541 | Ga0075436_100185608 | |||
| 1542 | Ga0097620_100027466 | |||
| 1543 | Ga0097620_100428610 | |||
| 1544 | Ga0079104_1000013 | |||
| 1545 | Ga0079104_1000438 | |||
| 1546 | Ga0079104_1002086 | |||
| 1547 | Ga0079104_1013864 | |||
| 1548 | Ga0075435_100022552 | |||
| 1549 | Ga0075435_100068148 | |||
| 1550 | Ga0075435_100077609 | |||
| 1551 | Ga0075435_100142506 | |||
| 1552 | Ga0105251_10003624 | |||
| 1553 | Ga0105251_10007394 | |||
| 1554 | Ga0105251_10015196 | |||
| 1555 | Ga0105251_10070773 | |||
| 1556 | Ga0105244_10000632 | |||
| 1557 | Ga0105244_10001388 | |||
| 1558 | Ga0105244_10005166 | |||
| 1559 | Ga0105244_10008699 | |||
| 1560 | Ga0105244_10025168 | |||
| 1561 | Ga0105244_10117166 | |||
| 1562 | Ga0105244_10130581 | |||
| 1563 | Ga0105250_10001902 | |||
| 1564 | Ga0105250_10002234 | |||
| 1565 | Ga0105250_10070763 | |||
| 1566 | Ga0105250_10075441 | |||
| 1567 | Ga0105240_10001650 | |||
| 1568 | Ga0111539_10090021 | |||
| 1569 | Ga0111539_10311619 | |||
| 1570 | Ga0114129_10585770 | |||
| 1571 | Ga0105243_10000158 | |||
| 1572 | Ga0105242_10005191 | |||
| 1573 | Ga0105242_10029447 | |||
| 1574 | Ga0105248_10039796 | |||
| 1575 | Ga0105237_10001262 | |||
| 1576 | Ga0105237_10001445 | |||
| 1577 | Ga0105239_10003184 | |||
| 1578 | Ga0105246_10002056 | |||
| 1579 | Ga0105246_10002917 | |||
| 1580 | Ga0157345_1000315 | |||
| 1581 | Ga0157373_10008336 | |||
| 1582 | Ga0157373_10036295 | |||
| 1583 | Ga0157373_10038710 | |||
| 1584 | Ga0157373_10073683 | |||
| 1585 | Ga0157373_10126229 | |||
| 1586 | Ga0157371_10000003 | |||
| 1587 | Ga0157371_10008703 | |||
| 1588 | Ga0157371_10035808 | |||
| 1589 | Ga0157370_10014439 | |||
| 1590 | Ga0157370_10033631 | |||
| 1591 | Ga0157370_10148550 | |||
| 1592 | Ga0157370_10154564 | |||
| 1593 | Ga0157369_10002431 | |||
| 1594 | Ga0157369_10017719 | |||
| 1595 | Ga0157369_10359308 | |||
| 1596 | Ga0157369_10389948 | |||
| 1597 | Ga0157369_10521987 | |||
| 1598 | Ga0157378_10134728 | |||
| 1599 | Ga0163162_10007458 | |||
| 1600 | Ga0163162_10041733 | |||
| 1601 | Ga0163162_10080883 | |||
| 1602 | Ga0163162_10118081 | |||
| 1603 | Ga0163162_10209402 | |||
| 1604 | Ga0163162_10252735 | |||
| 1605 | Ga0157372_10248323 | |||
| 1606 | Ga0157375_10005173 | |||
| 1607 | Ga0157375_10029502 | |||
| 1608 | Ga0157375_10352996 | |||
| 1609 | Ga0157375_10504861 | |||
| 1610 | Ga0163163_10029028 | |||
| 1611 | Ga0157380_10167625 | |||
| 1612 | Ga0182008_10007753 | |||
| 1613 | Ga0182008_10027899 | |||
| 1614 | Ga0182008_10031040 | |||
| 1615 | Ga0182008_10048085 | |||
| 1616 | Ga0182008_10052853 | |||
| 1617 | Ga0157379_10008130 | |||
| 1618 | Ga0157379_10027378 | |||
| 1619 | Ga0157376_10017549 | |||
| 1620 | Ga0182006_1001026 | |||
| 1621 | Ga0182006_1018698 | |||
| 1622 | Ga0182006_1035530 | |||
| 1623 | Ga0182007_10000638 | |||
| 1624 | Ga0182005_1015155 | |||
| 1625 | Ga0182005_1038132 | |||
| 1626 | Ga0163161_10006835 | |||
| 1627 | Ga0163161_10011701 | |||
| 1628 | Ga0163161_10046047 | |||
| 1629 | Ga0163161_10061272 | |||
| 1630 | Ga0163161_10085719 | |||
| 1631 | Ga0209435_100010 | |||
| 1632 | Ga0209435_103802 | |||
| 1633 | Ga0209784_100040 | |||
| 1634 | Ga0209566_100051 | |||
| 1635 | Ga0209674_100072 | |||
| 1636 | Ga0209147_100067 | |||
| 1637 | Ga0209563_100073 | |||
| 1638 | Ga0209563_100854 | |||
| 1639 | Ga0209437_101937 | |||
| 1640 | Ga0209258_100548 | |||
| 1641 | Ga0209646_1000001 | |||
| 1642 | Ga0209646_1000455 | |||
| 1643 | Ga0209026_1000001 | |||
| 1644 | Ga0209677_100063 | |||
| 1645 | Ga0209759_1000001 | |||
| 1646 | Ga0209759_1005333 | |||
| 1647 | Ga0209565_1000036 | |||
| 1648 | Ga0209565_1000074 | |||
| 1649 | Ga0209565_1000226 | |||
| 1650 | Ga0209673_1000129 | |||
| 1651 | Ga0209673_1000282 | |||
| 1652 | Ga0209130_1000016 | |||
| 1653 | Ga0209130_1000042 | |||
| 1654 | Ga0209130_1000255 | |||
| 1655 | Ga0209675_1000072 | |||
| 1656 | Ga0209675_1000289 | |||
| 1657 | Ga0209675_1003625 | |||
| 1658 | Ga0209676_1000007 | |||
| 1659 | Ga0209676_1000016 | |||
| 1660 | Ga0209676_1000021 | |||
| 1661 | Ga0209676_1000033 | |||
| 1662 | Ga0209676_1002600 | |||
| 1663 | Ga0209676_1010192 | |||
| 1664 | Ga0209025_1002347 | |||
| 1665 | Ga0209025_1006388 | |||
| 1666 | Ga0209025_1017511 | |||
| 1667 | Ga0209564_1000160 | |||
| 1668 | Ga0209564_1002324 | |||
| 1669 | Ga0209564_1004446 | |||
| 1670 | Ga0209050_1000003 | |||
| 1671 | Ga0209050_1000036 | |||
| 1672 | Ga0209050_1000235 | |||
| 1673 | Ga0209050_1000595 | |||
| 1674 | Ga0209050_1001021 | |||
| 1675 | Ga0209050_1003407 | |||
| 1676 | Ga0209050_1004120 | |||
| 1677 | Ga0209050_1024161 | |||
| 1678 | Ga0209256_1000001 | |||
| 1679 | Ga0209256_1000018 | |||
| 1680 | Ga0209256_1000125 | |||
| 1681 | Ga0209256_1013724 | |||
| 1682 | Ga0207426_1000097 | |||
| 1683 | Ga0209051_1000003 | |||
| 1684 | Ga0209051_1000035 | |||
| 1685 | Ga0209051_1000043 | |||
| 1686 | Ga0209051_1000123 | |||
| 1687 | Ga0209051_1000407 | |||
| 1688 | Ga0209257_1000020 | |||
| 1689 | Ga0209257_1000098 | |||
| 1690 | Ga0209257_1000212 | |||
| 1691 | Ga0209257_1005878 | |||
| 1692 | Ga0207697_10000220 | |||
| 1693 | Ga0207656_10001101 | |||
| 1694 | Ga0207696_1000101 | |||
| 1695 | Ga0207696_1000171 | |||
| 1696 | Ga0207696_1002789 | |||
| 1697 | Ga0207696_1007872 | |||
| 1698 | Ga0207696_1011534 | |||
| 1699 | Ga0207696_1037960 | |||
| 1700 | Ga0207696_1052225 | |||
| 1701 | Ga0207655_1000337 | |||
| 1702 | Ga0207655_1003684 | |||
| 1703 | Ga0207655_1005276 | |||
| 1704 | Ga0207655_1011381 | |||
| 1705 | Ga0207655_1013741 | |||
| 1706 | Ga0207655_1017394 | |||
| 1707 | Ga0207655_1018323 | |||
| 1708 | Ga0207713_1000802 | |||
| 1709 | Ga0207713_1002825 | |||
| 1710 | Ga0207713_1003131 | |||
| 1711 | Ga0207713_1009471 | |||
| 1712 | Ga0207713_1009538 | |||
| 1713 | Ga0207713_1010269 | |||
| 1714 | Ga0207713_1086620 | |||
| 1715 | Ga0207713_1086738 | |||
| 1716 | Ga0207642_10006922 | |||
| 1717 | Ga0207688_10004358 | |||
| 1718 | Ga0207680_10011100 | |||
| 1719 | Ga0207645_10130324 | |||
| 1720 | Ga0207695_10016073 | |||
| 1721 | Ga0207671_10000287 | |||
| 1722 | Ga0207649_10000068 | |||
| 1723 | Ga0207649_10003248 | |||
| 1724 | Ga0207652_10253097 | |||
| 1725 | Ga0207681_10002569 | |||
| 1726 | Ga0207681_10097126 | |||
| 1727 | Ga0207681_10127731 | |||
| 1728 | Ga0207681_10139514 | |||
| 1729 | Ga0207681_10372830 | |||
| 1730 | Ga0207650_10000174 | |||
| 1731 | Ga0207650_10008848 | |||
| 1732 | Ga0207650_10012734 | |||
| 1733 | Ga0207650_10232607 | |||
| 1734 | Ga0207659_10109989 | |||
| 1735 | Ga0207644_10124839 | |||
| 1736 | Ga0207644_10248650 | |||
| 1737 | Ga0207690_10001532 | |||
| 1738 | Ga0207706_10000922 | |||
| 1739 | Ga0207706_10075851 | |||
| 1740 | Ga0207706_10099295 | |||
| 1741 | Ga0207706_10237085 | |||
| 1742 | Ga0207686_10017447 | |||
| 1743 | Ga0207709_10000053 | |||
| 1744 | Ga0207669_10356956 | |||
| 1745 | Ga0207704_10346260 | |||
| 1746 | Ga0207691_10026593 | |||
| 1747 | Ga0207691_10299868 | |||
| 1748 | Ga0207711_10067832 | |||
| 1749 | Ga0207689_10099171 | |||
| 1750 | Ga0207679_10000018 | |||
| 1751 | Ga0207679_10004446 | |||
| 1752 | Ga0207679_10008172 | |||
| 1753 | Ga0207679_10193045 | |||
| 1754 | Ga0207712_10042768 | |||
| 1755 | Ga0207668_10119423 | |||
| 1756 | Ga0207658_10031163 | |||
| 1757 | Ga0207677_10011601 | |||
| 1758 | Ga0207703_10004144 | |||
| 1759 | Ga0207703_10036290 | |||
| 1760 | Ga0207703_10052729 | |||
| 1761 | Ga0207639_10013755 | |||
| 1762 | Ga0207708_10411315 | |||
| 1763 | Ga0207641_10030385 | |||
| 1764 | Ga0207648_10045149 | |||
| 1765 | Ga0207648_10087817 | |||
| 1766 | Ga0207648_10247301 | |||
| 1767 | Ga0207676_10010742 | |||
| 1768 | Ga0207674_10441810 | |||
| 1769 | Ga0207675_100250547 | |||
| 1770 | Ga0207675_100642112 | |||
| 1771 | Ga0207683_10013834 | |||
| 1772 | Ga0209281_1000010 | |||
| 1773 | Ga0209281_1000174 | |||
| 1774 | Ga0209281_1000182 | |||
| 1775 | Ga0209281_1006015 | |||
| 1776 | Ga0209281_1009339 | |||
| 1777 | Ga0209281_1015382 | |||
| 1778 | Ga0209983_1005427 | |||
| 1779 | Ga0209813_10011558 | |||
| 1780 | Ga0207428_10022532 | |||
| 1781 | Ga0207428_10026314 | |||
| 1782 | Ga0207428_10293724 | |||
| 1783 | Ga0268266_10443246 | |||
| 1784 | Ga0268265_10534114 | |||
| 1785 | Ga0268264_10189503 | |||
| 1786 | Ga0268264_10528707 | |||
| 1787 | Ga0307517_10039962 | |||
| 1788 | Ga0307517_10173128 | |||
| 1789 | Ga0307515_10000049 | |||
| 1790 | Ga0307515_10000066 | |||
| 1791 | Ga0307515_10002144 | |||
| 1792 | Ga0307515_10003679 | |||
| 1793 | Ga0307515_10103124 | |||
| 1794 | Ga0307515_10201864 | |||
| 1795 | Ga0307511_10000570 | |||
| 1796 | Ga0316177_1052986 | |||
| 1797 | Ga0316177_1092213 | |||
| 1798 | Ga0316178_1101335 | |||
| 1799 | Ga0316178_1171693 | |||
| 1800 | Ga0316183_1029553 | |||
| 1801 | Ga0316182_1057930 | |||
| 1802 | Ga0265330_10000117 | |||
| 1803 | Ga0265332_10000002 | |||
| 1804 | Ga0307513_10000011 | |||
| 1805 | Ga0307513_10000017 | |||
| 1806 | Ga0307513_10015421 | |||
| 1807 | Ga0307513_10105803 | |||
| 1808 | Ga0307509_10089054 | |||
| 1809 | Ga0307509_10205301 | |||
| 1810 | Ga0307408_100000192 | |||
| 1811 | Ga0307408_100002500 | |||
| 1812 | Ga0307408_100004501 | |||
| 1813 | Ga0307408_100023415 | |||
| 1814 | Ga0307408_100030906 | |||
| 1815 | Ga0307408_100040364 | |||
| 1816 | Ga0307408_100079093 | |||
| 1817 | Ga0307408_100437521 | |||
| 1818 | Ga0307514_10030795 | |||
| 1819 | Ga0265314_10000012 | |||
| 1820 | Ga0307516_10000181 | |||
| 1821 | Ga0307516_10008542 | |||
| 1822 | Ga0307516_10012117 | |||
| 1823 | Ga0307405_10006315 | |||
| 1824 | Ga0307405_10017084 | |||
| 1825 | Ga0307405_10017531 | |||
| 1826 | Ga0307405_10294770 | |||
| 1827 | Ga0307413_10002620 | |||
| 1828 | Ga0307413_10003279 | |||
| 1829 | Ga0307413_10141520 | |||
| 1830 | Ga0307410_10013563 | |||
| 1831 | Ga0307410_10033020 | |||
| 1832 | Ga0307406_10001571 | |||
| 1833 | Ga0307406_10018088 | |||
| 1834 | Ga0307406_10022392 | |||
| 1835 | Ga0307406_10024745 | |||
| 1836 | Ga0307406_10180986 | |||
| 1837 | Ga0307407_10023389 | |||
| 1838 | Ga0307407_10086114 | |||
| 1839 | Ga0307407_10239394 | |||
| 1840 | Ga0307412_10002180 | |||
| 1841 | Ga0307412_10010694 | |||
| 1842 | Ga0307412_10022143 | |||
| 1843 | Ga0307412_10028003 | |||
| 1844 | Ga0307412_10030893 | |||
| 1845 | Ga0307412_10038935 | |||
| 1846 | Ga0307412_10265558 | |||
| 1847 | Ga0307409_100115891 | |||
| 1848 | Ga0307409_100129790 | |||
| 1849 | Ga0307409_100196064 | |||
| 1850 | Ga0307416_100003739 | |||
| 1851 | Ga0307416_100009114 | |||
| 1852 | Ga0307416_100055914 | |||
| 1853 | Ga0307416_100227710 | |||
| 1854 | Ga0307416_100239015 | |||
| 1855 | Ga0307416_100358238 | |||
| 1856 | Ga0307414_10018101 | |||
| 1857 | Ga0307414_10059744 | |||
| 1858 | Ga0307414_10112271 | |||
| 1859 | Ga0307414_10144358 | |||
| 1860 | Ga0307411_10002390 | |||
| 1861 | Ga0307411_10019865 | |||
| 1862 | Ga0307415_100153792 | |||
| 1863 | Ga0307510_10013786 | |||
| 1864 | Ga0373962_0015463 | |||
| 1865 | Ga0316574_0162091 | |||
| 1866 | Ga0395900_0058760 | |||
| 1867 | Ga0395905_0000111 | |||
| 1868 | Ga0395905_0029270 | |||
| 1869 | Ga0395901_0063836 | |||
| 1870 | Ga0400490_23266 | |||
| 1871 | Ga0400483_004246 | |||
| 1872 | Ga0439438_006773 | |||
| 1873 | Ga0439438_009999 | |||
| 1874 | Ga0439438_018822 | |||
| 1875 | Ga0439438_019241 | |||
| 1876 | Ga0439438_019362 | |||
| 1877 | Ga0439438_035933 | |||
| 1878 | Ga0439447_002850 | |||
| 1879 | Ga0439447_004045 | |||
| 1880 | Ga0439447_005181 | |||
| 1881 | Ga0439447_009617 | |||
| 1882 | Ga0439447_018024 | |||
| 1883 | Ga0439447_020625 | |||
| 1884 | Ga0439447_022230 | |||
| 1885 | Ga0439447_029292 | |||
| 1886 | Ga0439461_0034830 | |||
| 1887 | Ga0439466_0000181 | |||
| 1888 | Ga0439466_0000878 | |||
| 1889 | Ga0439466_0011728 | |||
| 1890 | Ga0439466_0025721 | |||
| 1891 | Ga0439466_0028124 | |||
| 1892 | Ga0439466_0051725 | |||
| 1893 | Ga0451843_0113517 | |||
| 1894 | Ga0439431_0010778 | |||
| 1895 | Ga0439437_001194 | |||
| 1896 | Ga0439441_006369 | |||
| 1897 | Ga0439432_008171 | |||
| 1898 | Ga0439432_009089 | |||
| 1899 | Ga0439432_009917 | |||
| 1900 | Ga0439432_012801 | |||
| 1901 | Ga0439432_023065 | |||
| 1902 | Ga0439449_0045091 | |||
| 1903 | Ga0439451_002573 | |||
| 1904 | Ga0439451_004203 | |||
| 1905 | Ga0439451_004767 | |||
| 1906 | Ga0439451_006596 | |||
| 1907 | Ga0439451_011164 | |||
| 1908 | Ga0439451_013491 | |||
| 1909 | Ga0439451_019924 | |||
| 1910 | Ga0439451_033717 | |||
| 1911 | Ga0439452_001154 | |||
| 1912 | Ga0439452_002037 | |||
| 1913 | Ga0439452_003486 | |||
| 1914 | Ga0439452_012323 | |||
| 1915 | Ga0439452_022880 | |||
| 1916 | Ga0439452_023025 | |||
| 1917 | Ga0439452_036678 | |||
| 1918 | Ga0439456_001653 | |||
| 1919 | Ga0439456_002975 | |||
| 1920 | Ga0439456_004070 | |||
| 1921 | Ga0439462_0014323 | |||
| 1922 | Ga0439463_000119 | |||
| 1923 | Ga0439463_000135 | |||
| 1924 | Ga0439463_030801 | |||
| 1925 | Ga0439463_044257 | |||
| 1926 | Ga0450911_000011 | |||
| 1927 | Ga0450911_000708 | |||
| 1928 | Ga0450911_004672 | |||
| 1929 | Ga0450911_007344 | |||
| 1930 | Ga0450919_002168 | |||
| 1931 | Ga0450920_004432 | |||
| 1932 | Ga0450922_003964 | |||
| 1933 | Ga0450888_000889 | |||
| 1934 | Ga0450890_008503 | |||
| 1935 | Ga0450891_000402 | |||
| 1936 | Ga0450892_000986 | |||
| 1937 | Ga0450896_002601 | |||
| 1938 | Ga0450902_023057 | |||
| 1939 | Ga0450903_003483 | |||
| 1940 | Ga0450903_008066 | |||
| 1941 | Ga0450903_015663 | |||
| 1942 | Ga0450904_000171 | |||
| 1943 | Ga0450904_000482 | |||
| 1944 | Ga0450904_003954 | |||
| 1945 | Ga0450889_000148 | |||
| 1946 | Ga0450906_003185 | |||
| 1947 | Ga0450906_008030 | |||
| 1948 | Ga0450907_001074 | |||
| 1949 | Ga0450907_003459 | |||
| 1950 | Ga0450910_000426 | |||
| 1951 | Ga0439446_0000636 | |||
| 1952 | Ga0439446_0004080 | |||
| 1953 | Ga0439446_0006845 | |||
| 1954 | Ga0450908_001481 | |||
| 1955 | Ga0450908_002124 | |||
| 1956 | Ga0450908_010504 | |||
| 1957 | Ga0450909_005842 | |||
| 1958 | Ga0439434_0001856 | |||
| 1959 | Ga0439434_0005608 | |||
| 1960 | Ga0439434_0009004 | |||
| 1961 | Ga0439444_0000913 | |||
| 1962 | Ga0439459_0005479 | |||
| 1963 | Ga0450916_003055 | |||
| 1964 | Ga0450918_000109 | |||
| 1965 | Ga0450918_015318 | |||
| 1966 | Ga0451577_0012487 | |||
| 1967 | Ga0451577_0023296 | |||
| 1968 | Ga0451577_0037186 | |||
| 1969 | Ga0451577_0112001 | |||
| 1970 | Ga0451577_0172106 | |||
| 1971 | Ga0451577_0176352 | |||
| 1972 | Ga0439440_0007687 | |||
| 1973 | Ga0453683_0026029 | |||
| 1974 | Ga0453684_0003069 | |||
| 1975 | Ga0453684_0003996 | |||
| 1976 | Ga0453684_0020726 | |||
| 1977 | Ga0453684_0072068 | |||
| 1978 | Ga0453684_0128380 | |||
| 1979 | Ga0453684_0252937 | |||
| 1980 | Ga0451576_0002831 | |||
| 1981 | Ga0451576_0111991 | |||
| 1982 | Ga0451576_0239496 | |||
| 1983 | Ga0495617_019836 | |||
| 1984 | Ga0495617_023783 | |||
| 1985 | Ga0495617_024908 | |||
| 1986 | Ga0495617_028646 | |||
| 1987 | Ga0495617_029283 | |||
| 1988 | Ga0495617_029611 | |||
| 1989 | Ga0495617_033153 | |||
| 1990 | Ga0495617_057170 | |||
| 1991 | Ga0495617_067354 | |||
| 1992 | Ga0495617_085955 | |||
| 1993 | Ga0495627_002318 | |||
| 1994 | Ga0495627_004002 | |||
| 1995 | Ga0495627_010270 | |||
| 1996 | Ga0495627_026933 | |||
| 1997 | Ga0495627_027411 | |||
| 1998 | Ga0495627_036353 | |||
| 1999 | Ga0495627_038050 | |||
| 2000 | Ga0495603_0027657 | |||
| 2001 | Ga0495590_0003405 | |||
| 2002 | Ga0495590_0008242 | |||
| 2003 | Ga0495590_0009528 | |||
| 2004 | Ga0495590_0028023 | |||
| 2005 | Ga0495590_0049105 | |||
| 2006 | Ga0495590_0051499 | |||
| 2007 | Ga0495590_0081857 | |||
| 2008 | Ga0495591_001049 | |||
| 2009 | Ga0495591_001222 | |||
| 2010 | Ga0495591_001953 | |||
| 2011 | Ga0495591_002999 | |||
| 2012 | Ga0495591_005577 | |||
| 2013 | Ga0495591_005915 | |||
| 2014 | Ga0495591_009977 | |||
| 2015 | Ga0495591_013325 | |||
| 2016 | Ga0495591_027665 | |||
| 2017 | Ga0495591_030174 | |||
| 2018 | Ga0495591_030882 | |||
| 2019 | Ga0495591_031551 | |||
| 2020 | Ga0495629_0034536 | |||
| 2021 | Ga0495638_0006643 | |||
| 2022 | Ga0495638_0024554 | |||
| 2023 | Ga0495638_0027492 | |||
| 2024 | Ga0495638_0035616 | |||
| 2025 | Ga0495638_0083513 | |||
| 2026 | Ga0495638_0087119 | |||
| 2027 | Ga0495638_0095491 | |||
| 2028 | Ga0495638_0097759 | |||
| 2029 | Ga0495638_0099920 | |||
| 2030 | Ga0495638_0128172 | |||
| 2031 | Ga0495638_0136809 | |||
| 2032 | Ga0495638_0185634 | |||
| 2033 | Ga0495653_0008829 | |||
| 2034 | Ga0495653_0025056 | |||
| 2035 | Ga0495653_0108020 | |||
| 2036 | Ga0495653_0112090 | |||
| 2037 | Ga0495650_0002465 | |||
| 2038 | Ga0495650_0003436 | |||
| 2039 | Ga0495650_0010955 | |||
| 2040 | Ga0495650_0013666 | |||
| 2041 | Ga0495650_0022548 | |||
| 2042 | Ga0495650_0028780 | |||
| 2043 | Ga0495650_0041139 | |||
| 2044 | Ga0495650_0042867 | |||
| 2045 | Ga0495650_0048023 | |||
| 2046 | Ga0495650_0100254 | |||
| 2047 | Ga0495580_0100897 | |||
| 2048 | Ga0495582_0047131 | |||
| 2049 | Ga0495605_0000047 | |||
| 2050 | Ga0495605_0000525 | |||
| 2051 | Ga0495605_0001790 | |||
| 2052 | Ga0495605_0008617 | |||
| 2053 | Ga0495605_0011610 | |||
| 2054 | Ga0495605_0017163 | |||
| 2055 | Ga0495605_0044607 | |||
| 2056 | Ga0495605_0054700 | |||
| 2057 | Ga0495605_0075118 | |||
| 2058 | Ga0495605_0075212 | |||
| 2059 | Ga0495605_0113736 | |||
| 2060 | Ga0495639_0001026 | |||
| 2061 | Ga0495639_0071088 | |||
| 2062 | Ga0495584_0001531 | |||
| 2063 | Ga0495584_0003735 | |||
| 2064 | Ga0495584_0007445 | |||
| 2065 | Ga0495584_0015983 | |||
| 2066 | Ga0495584_0021347 | |||
| 2067 | Ga0495584_0044491 | |||
| 2068 | Ga0495584_0061946 | |||
| 2069 | Ga0495584_0070071 | |||
| 2070 | Ga0495584_0091037 | |||
| 2071 | Ga0495584_0091912 | |||
| 2072 | Ga0495584_0094908 | |||
| 2073 | Ga0495584_0120432 | |||
| 2074 | Ga0495584_0169546 | |||
| 2075 | Ga0495585_0013265 | |||
| 2076 | Ga0495585_0019151 | |||
| 2077 | Ga0495585_0053223 | |||
| 2078 | Ga0495585_0083924 | |||
| 2079 | Ga0495585_0085043 | |||
| 2080 | Ga0495585_0152444 | |||
| 2081 | Ga0495585_0168582 | |||
| 2082 | Ga0495594_0004782 | |||
| 2083 | Ga0495594_0073151 | |||
| 2084 | Ga0495596_0006850 | |||
| 2085 | Ga0495607_0000518 | |||
| 2086 | Ga0495607_0001826 | |||
| 2087 | Ga0495607_0007371 | |||
| 2088 | Ga0495607_0014071 | |||
| 2089 | Ga0495607_0024198 | |||
| 2090 | Ga0495607_0026676 | |||
| 2091 | Ga0495607_0066827 | |||
| 2092 | Ga0495607_0082877 | |||
| 2093 | Ga0495607_0086801 | |||
| 2094 | Ga0495607_0101485 | |||
| 2095 | Ga0495607_0107687 | |||
| 2096 | Ga0495607_0114217 | |||
| 2097 | Ga0495607_0167903 | |||
| 2098 | Ga0495583_0000951 | |||
| 2099 | Ga0495583_0001288 | |||
| 2100 | Ga0495583_0001564 | |||
| 2101 | Ga0495583_0002315 | |||
| 2102 | Ga0495583_0002664 | |||
| 2103 | Ga0495583_0004641 | |||
| 2104 | Ga0495583_0006143 | |||
| 2105 | Ga0495583_0018121 | |||
| 2106 | Ga0495583_0055618 | |||
| 2107 | Ga0495583_0102065 | |||
| 2108 | Ga0495583_0114801 | |||
| 2109 | Ga0495606_0002715 | |||
| 2110 | Ga0495606_0003285 | |||
| 2111 | Ga0495606_0010009 | |||
| 2112 | Ga0495606_0011802 | |||
| 2113 | Ga0495606_0017361 | |||
| 2114 | Ga0495606_0031867 | |||
| 2115 | Ga0495606_0035263 | |||
| 2116 | Ga0495606_0037596 | |||
| 2117 | Ga0495606_0059532 | |||
| 2118 | Ga0495606_0074370 | |||
| 2119 | Ga0495606_0091936 | |||
| 2120 | Ga0495606_0097531 | |||
| 2121 | Ga0495606_0102749 | |||
| 2122 | Ga0495606_0268418 | |||
| 2123 | Ga0495610_0003261 | |||
| 2124 | Ga0495610_0007060 | |||
| 2125 | Ga0495610_0012127 | |||
| 2126 | Ga0495610_0015116 | |||
| 2127 | Ga0495610_0019253 | |||
| 2128 | Ga0495610_0038888 | |||
| 2129 | Ga0495610_0054135 | |||
| 2130 | Ga0495610_0075903 | |||
| 2131 | Ga0495616_0000033 | |||
| 2132 | Ga0495616_0008301 | |||
| 2133 | Ga0495616_0023442 | |||
| 2134 | Ga0495616_0058108 | |||
| 2135 | Ga0495616_0061381 | |||
| 2136 | Ga0495616_0064861 | |||
| 2137 | Ga0495616_0068188 | |||
| 2138 | Ga0495616_0070593 | |||
| 2139 | Ga0495616_0073691 | |||
| 2140 | Ga0495616_0133589 | |||
| 2141 | Ga0495620_0000681 | |||
| 2142 | Ga0495620_0001574 | |||
| 2143 | Ga0495620_0011570 | |||
| 2144 | Ga0495620_0012675 | |||
| 2145 | Ga0495620_0014528 | |||
| 2146 | Ga0495620_0026268 | |||
| 2147 | Ga0495620_0060649 | |||
| 2148 | Ga0495620_0065810 | |||
| 2149 | Ga0495620_0120619 | |||
| 2150 | Ga0495620_0128980 | |||
| 2151 | Ga0495628_0168181 | |||
| 2152 | Ga0495630_0118884 | |||
| 2153 | Ga0495630_0157972 | |||
| 2154 | Ga0495630_0216928 | |||
| 2155 | Ga0495631_0001379 | |||
| 2156 | Ga0495631_0010993 | |||
| 2157 | Ga0495631_0026556 | |||
| 2158 | Ga0495631_0035984 | |||
| 2159 | Ga0495631_0039815 | |||
| 2160 | Ga0495632_0002239 | |||
| 2161 | Ga0495632_0003625 | |||
| 2162 | Ga0495632_0006548 | |||
| 2163 | Ga0495632_0017079 | |||
| 2164 | Ga0495632_0031914 | |||
| 2165 | Ga0495632_0033618 | |||
| 2166 | Ga0495632_0050118 | |||
| 2167 | Ga0495632_0065258 | |||
| 2168 | Ga0495632_0096566 | |||
| 2169 | Ga0495637_0000023 | |||
| 2170 | Ga0495637_0004072 | |||
| 2171 | Ga0495637_0004257 | |||
| 2172 | Ga0495637_0004633 | |||
| 2173 | Ga0495637_0010319 | |||
| 2174 | Ga0495637_0012773 | |||
| 2175 | Ga0495637_0028282 | |||
| 2176 | Ga0495637_0035117 | |||
| 2177 | Ga0495637_0042348 | |||
| 2178 | Ga0495637_0042746 | |||
| 2179 | Ga0495637_0057426 | |||
| 2180 | Ga0495637_0059388 | |||
| 2181 | Ga0495637_0060850 | |||
| 2182 | Ga0495643_0000235 | |||
| 2183 | Ga0495643_0000451 | |||
| 2184 | Ga0495643_0001781 | |||
| 2185 | Ga0495643_0014368 | |||
| 2186 | Ga0495643_0025994 | |||
| 2187 | Ga0495643_0071193 | |||
| 2188 | Ga0495643_0073032 | |||
| 2189 | Ga0495643_0079763 | |||
| 2190 | Ga0495643_0100339 | |||
| 2191 | Ga0495644_0001359 | |||
| 2192 | Ga0495644_0002908 | |||
| 2193 | Ga0495644_0009130 | |||
| 2194 | Ga0495644_0040652 | |||
| 2195 | Ga0495644_0043757 | |||
| 2196 | Ga0495648_0004435 | |||
| 2197 | Ga0495648_0005762 | |||
| 2198 | Ga0495648_0008617 | |||
| 2199 | Ga0495648_0009743 | |||
| 2200 | Ga0495648_0009845 | |||
| 2201 | Ga0495648_0010619 | |||
| 2202 | Ga0495648_0026685 | |||
| 2203 | Ga0495648_0031678 | |||
| 2204 | Ga0495648_0054260 | |||
| 2205 | Ga0495648_0095077 | |||
| 2206 | Ga0495648_0098748 | |||
| 2207 | Ga0495648_0112459 | |||
| 2208 | Ga0495648_0144430 | |||
| 2209 | Ga0495666_0019229 | |||
| 2210 | Ga0495666_0090307 | |||
| 2211 | Ga0495642_0008536 | |||
| 2212 | Ga0495642_0028383 | |||
| 2213 | Ga0495642_0063907 | |||
| 2214 | Ga0495642_0148367 | |||
| 2215 | Ga0495654_0001312 | |||
| 2216 | Ga0495654_0003008 | |||
| 2217 | Ga0495654_0004908 | |||
| 2218 | Ga0495654_0020326 | |||
| 2219 | Ga0495654_0024046 | |||
| 2220 | Ga0495654_0026361 | |||
| 2221 | Ga0495654_0033398 | |||
| 2222 | Ga0495654_0034346 | |||
| 2223 | Ga0495654_0044581 | |||
| 2224 | Ga0495654_0049305 | |||
| 2225 | Ga0495654_0051260 | |||
| 2226 | Ga0495654_0055371 | |||
| 2227 | Ga0495654_0078104 | |||
| 2228 | Ga0495586_0072220 | |||
| 2229 | Ga0495587_0055720 | |||
| 2230 | Ga0495587_0084286 | |||
| 2231 | Ga0495609_0000382 | |||
| 2232 | Ga0495609_0001328 | |||
| 2233 | Ga0495609_0002035 | |||
| 2234 | Ga0495609_0005136 | |||
| 2235 | Ga0495609_0014758 | |||
| 2236 | Ga0495609_0052750 | |||
| 2237 | Ga0495609_0056639 | |||
| 2238 | Ga0495609_0061996 | |||
| 2239 | Ga0495609_0138019 | |||
| 2240 | Ga0495597_0016484 | |||
| 2241 | Ga0495597_0018121 | |||
| 2242 | Ga0495597_0027613 | |||
| 2243 | Ga0495597_0068053 | |||
| 2244 | Ga0495597_0096166 | |||
| 2245 | Ga0495645_0043791 | |||
| 2246 | Ga0495622_0006120 | |||
| 2247 | Ga0495622_0010777 | |||
| 2248 | Ga0495622_0010996 | |||
| 2249 | Ga0495622_0013903 | |||
| 2250 | Ga0495633_0009405 | |||
| 2251 | Ga0495633_0039348 | |||
| 2252 | Ga0495633_0054711 | |||
| 2253 | Ga0495656_0011229 | |||
| 2254 | Ga0495656_0054518 | |||
| 2255 | Ga0495668_0000066 | |||
| 2256 | Ga0495668_0005069 | |||
| 2257 | Ga0495668_0009434 | |||
| 2258 | Ga0495668_0014429 | |||
| 2259 | Ga0495668_0025042 | |||
| 2260 | Ga0495668_0031471 | |||
| 2261 | Ga0495668_0092989 | |||
| 2262 | Ga0495668_0190762 | |||
| 2263 | Ga0495634_0026595 | |||
| 2264 | Ga0495611_0000527 | |||
| 2265 | Ga0495611_0010917 | |||
| 2266 | Ga0495611_0151232 | |||
| 2267 | Ga0495625_0000010 | |||
| 2268 | Ga0495625_0002580 | |||
| 2269 | Ga0495625_0007460 | |||
| 2270 | Ga0495625_0026691 | |||
| 2271 | Ga0495625_0027685 | |||
| 2272 | Ga0495625_0111279 | |||
| 2273 | Ga0495625_0113679 | |||
| 2274 | Ga0495625_0151186 | |||
| 2275 | Ga0495635_0019671 | |||
| 2276 | Ga0495635_0109674 | |||
| 2277 | Ga0495659_0000614 | |||
| 2278 | Ga0495659_0001072 | |||
| 2279 | Ga0495659_0085846 | |||
| 2280 | Ga0495661_0000020 | |||
| 2281 | Ga0495661_0000921 | |||
| 2282 | Ga0495661_0001245 | |||
| 2283 | Ga0495661_0001424 | |||
| 2284 | Ga0495661_0004872 | |||
| 2285 | Ga0495661_0017999 | |||
| 2286 | Ga0495661_0056510 | |||
| 2287 | Ga0495661_0115603 | |||
| 2288 | Ga0495661_0119371 | |||
| 2289 | Ga0495661_0182405 | |||
| 2290 | Ga0495588_0005616 | |||
| 2291 | Ga0495588_0054920 | |||
| 2292 | Ga0495588_0190885 | |||
| 2293 | Ga0495623_0006486 | |||
| 2294 | Ga0495646_0021966 | |||
| 2295 | Ga0495646_0057628 | |||
| 2296 | Ga0495658_0024110 | |||
| 2297 | Ga0495658_0071621 | |||
| 2298 | Ga0495624_0006539 | |||
| 2299 | Ga0495670_0016034 | |||
| 2300 | Ga0495670_0025293 | |||
| 2301 | Ga0495670_0058910 | |||
| 2302 | Ga0495670_0081399 | |||
| 2303 | Ga0495670_0089607 | |||
| 2304 | Ga0495671_0002927 | |||
| 2305 | Ga0495671_0004947 | |||
| 2306 | Ga0495671_0007405 | |||
| 2307 | Ga0495671_0018971 | |||
| 2308 | Ga0495671_0027600 | |||
| 2309 | Ga0495671_0028703 | |||
| 2310 | Ga0495671_0051154 | |||
| 2311 | Ga0495671_0072055 | |||
| 2312 | Ga0495671_0149436 | |||
| 2313 | Ga0495671_0176581 | |||
| 2314 | Ga0495649_0004409 | |||
| 2315 | Ga0495649_0005345 | |||
| 2316 | Ga0495649_0014263 | |||
| 2317 | Ga0495649_0018067 | |||
| 2318 | Ga0495649_0024187 | |||
| 2319 | Ga0495649_0050987 | |||
| 2320 | Ga0495649_0087976 | |||
| 2321 | Ga0495649_0103686 | |||
| 2322 | Ga0495649_0107459 | |||
| 2323 | Ga0495649_0113667 | |||
| 2324 | Ga0495589_0001332 | |||
| 2325 | Ga0495589_0014607 | |||
| 2326 | Ga0495589_0015859 | |||
| 2327 | Ga0495589_0017326 | |||
| 2328 | Ga0495589_0019891 | |||
| 2329 | Ga0495589_0047166 | |||
| 2330 | Ga0495589_0075007 | |||
| 2331 | Ga0495589_0085508 | |||
| 2332 | Ga0495660_0026859 | |||
| 2333 | Ga0495660_0028851 | |||
| 2334 | Ga0495660_0050171 | |||
| 2335 | Ga0495660_0082336 | |||
| 2336 | Ga0495660_0087342 | |||
| 2337 | Ga0495660_0088460 | |||
| 2338 | Ga0495660_0088816 | |||
| 2339 | Ga0495660_0096355 | |||
| 2340 | Ga0495660_0104168 | |||
| 2341 | Ga0495660_0111802 | |||
| 2342 | Ga0495660_0112872 | |||
| 2343 | Ga0495660_0131961 | |||
| 2344 | Ga0495581_0045650 | |||
| 2345 | Ga0495581_0216606 | |||
| 2346 | Ga0495604_0050490 | |||
| 2347 | Ga0495604_0134098 | |||
| 2348 | Ga0495636_0088058 | |||
| 2349 | Ga0495674_0266698 | |||
| 2350 | Ga0495672_0005482 | |||
| 2351 | Ga0495672_0006681 | |||
| 2352 | Ga0495672_0007497 | |||
| 2353 | Ga0495672_0008863 | |||
| 2354 | Ga0495672_0010510 | |||
| 2355 | Ga0495672_0027464 | |||
| 2356 | Ga0495672_0033848 | |||
| 2357 | Ga0495672_0035859 | |||
| 2358 | Ga0495672_0038422 | |||
| 2359 | Ga0495672_0070992 | |||
| 2360 | Ga0495672_0086782 | |||
| 2361 | Ga0495672_0099618 | |||
| 2362 | Ga0495672_0114758 | |||
| 2363 | Ga0495676_0000002 | |||
| 2364 | Ga0495676_0151655 | |||
| 2365 | Ga0495680_0024002 | |||
| 2366 | Ga0495680_0039068 | |||
| 2367 | Ga0495680_0065992 | |||
| 2368 | Ga0495683_0003171 | |||
| 2369 | Ga0495683_0003249 | |||
| 2370 | Ga0495683_0024108 | |||
| 2371 | Ga0495683_0057374 | |||
| 2372 | Ga0495683_0060985 | |||
| 2373 | Ga0495683_0075946 | |||
| 2374 | Ga0495683_0079047 | |||
| 2375 | Ga0495683_0121438 | |||
| 2376 | Ga0495687_007225 | |||
| 2377 | Ga0495687_024579 | |||
| 2378 | Ga0495687_042165 | |||
| 2379 | Ga0495687_053744 | |||
| 2380 | Ga0495687_077151 | |||
| 2381 | Ga0495677_0000650 | |||
| 2382 | Ga0495677_0020960 | |||
| 2383 | Ga0495677_0090162 | |||
| 2384 | Ga0495679_000126 | |||
| 2385 | Ga0495679_001276 | |||
| 2386 | Ga0495679_004444 | |||
| 2387 | Ga0495679_028467 | |||
| 2388 | Ga0495679_028925 | |||
| 2389 | Ga0495679_029111 | |||
| 2390 | Ga0495679_037703 | |||
| 2391 | Ga0495679_039168 | |||
| 2392 | Ga0495679_043219 | |||
| 2393 | Ga0495673_0005373 | |||
| 2394 | Ga0495673_0007959 | |||
| 2395 | Ga0495673_0014503 | |||
| 2396 | Ga0495673_0016649 | |||
| 2397 | Ga0495673_0029101 | |||
| 2398 | Ga0495673_0032526 | |||
| 2399 | Ga0495673_0041555 | |||
| 2400 | Ga0495673_0041818 | |||
| 2401 | Ga0495673_0042449 | |||
| 2402 | Ga0495673_0046611 | |||
| 2403 | Ga0495673_0052205 | |||
| 2404 | Ga0495673_0054042 | |||
| 2405 | Ga0495673_0077987 | |||
| 2406 | Ga0495681_0003096 | |||
| 2407 | Ga0495681_0006229 | |||
| 2408 | Ga0495681_0006544 | |||
| 2409 | Ga0495681_0008618 | |||
| 2410 | Ga0495681_0014387 | |||
| 2411 | Ga0495681_0014892 | |||
| 2412 | Ga0495681_0036974 | |||
| 2413 | Ga0495681_0037159 | |||
| 2414 | Ga0495681_0037976 | |||
| 2415 | Ga0495681_0049938 | |||
| 2416 | Ga0495681_0058808 | |||
| 2417 | Ga0495681_0078938 | |||
| 2418 | Ga0495681_0082499 | |||
| 2419 | Ga0495686_0002019 | |||
| 2420 | Ga0495686_0027444 | |||
| 2421 | Ga0495686_0028552 | |||
| 2422 | Ga0495686_0036418 | |||
| 2423 | Ga0495686_0050482 | |||
| 2424 | Ga0495686_0124526 | |||
| 2425 | Ga0495686_0160304 | |||
| 2426 | Ga0495686_0248139 | |||
| 2427 | Ga0495593_0023986 | |||
| 2428 | Ga0495593_0035478 | |||
| 2429 | Ga0495593_0049143 | |||
| 2430 | Ga0495602_0014404 | |||
| 2431 | Ga0495614_0059153 | |||
| 2432 | Ga0495626_0000007 | |||
| 2433 | Ga0495626_0002967 | |||
| 2434 | Ga0495626_0003463 | |||
| 2435 | Ga0495626_0009973 | |||
| 2436 | Ga0495626_0021019 | |||
| 2437 | Ga0495626_0044378 | |||
| 2438 | Ga0495626_0058650 | |||
| 2439 | Ga0495626_0068898 | |||
| 2440 | Ga0495626_0077102 | |||
| 2441 | Ga0496102_0039674 | |||
| 2442 | Ga0496102_0039685 | |||
| 2443 | Ga0496102_0118982 | |||
| 2444 | Ga0496103_0009900 | |||
| 2445 | Ga0496103_0013678 | |||
| 2446 | Ga0496104_0037906 | |||
| 2447 | Ga0496106_0269835 | |||
| 2448 | Ga0496108_0233135 | |||
| 2449 | Ga0496110_0028872 | |||
| 2450 | Ga0496110_0104451 | |||
| 2451 | Ga0496113_0197086 | |||
| 2452 | Ga0496114_0500498 | |||
| 2453 | Ga0496116_0011263 | |||
| 2454 | Ga0496116_0018629 | |||
| 2455 | Ga0496116_0030573 | |||
| 2456 | Ga0496116_0068022 | |||
| 2457 | Ga0496116_0086629 | |||
| 2458 | Ga0496117_0002615 | |||
| 2459 | Ga0496117_0060972 | |||
| 2460 | Ga0496117_0070653 | |||
| 2461 | Ga0496117_0077206 | |||
| 2462 | Ga0496117_0134198 | |||
| 2463 | Ga0496118_0007860 | |||
| 2464 | Ga0496118_0026123 | |||
| 2465 | Ga0496118_0038784 | |||
| 2466 | Ga0496118_0067109 | |||
| 2467 | Ga0496118_0101749 | |||
| 2468 | Ga0496118_0108001 | |||
| 2469 | Ga0496119_0054262 | |||
| 2470 | Ga0496119_0111054 | |||
| 2471 | Ga0496120_0025786 | |||
| 2472 | Ga0496120_0049142 | |||
| 2473 | Ga0496120_0102175 | |||
| 2474 | Ga0496121_0007632 | |||
| 2475 | Ga0496121_0095663 | |||
| 2476 | Ga0496121_0153244 | |||
| 2477 | Ga0496122_0006870 | |||
| 2478 | Ga0496122_0009750 | |||
| 2479 | Ga0496122_0009960 | |||
| 2480 | Ga0496122_0037125 | |||
| 2481 | Ga0496122_0055660 | |||
| 2482 | Ga0496122_0139048 | |||
| 2483 | Ga0496122_0159736 | |||
| 2484 | Ga0496122_0194429 | |||
| 2485 | Ga0496123_0006780 | |||
| 2486 | Ga0496123_0025924 | |||
| 2487 | Ga0496123_0029048 | |||
| 2488 | Ga0496123_0137870 | |||
| 2489 | Ga0496124_0000125 | |||
| 2490 | Ga0496124_0003286 | |||
| 2491 | Ga0496124_0022394 | |||
| 2492 | Ga0496124_0033558 | |||
| 2493 | Ga0496124_0035843 | |||
| 2494 | Ga0496124_0049764 | |||
| 2495 | Ga0496124_0090780 | |||
| 2496 | Ga0496124_0126651 | |||
| 2497 | Ga0496124_0163497 | |||
| 2498 | Ga0496125_0000011 | |||
| 2499 | Ga0496125_0003246 | |||
| 2500 | Ga0496125_0004490 | |||
| 2501 | Ga0496125_0009991 | |||
| 2502 | Ga0496125_0022908 | |||
| 2503 | Ga0496125_0044334 | |||
| 2504 | Ga0496125_0083993 | |||
| 2505 | Ga0496125_0087170 | |||
| 2506 | Ga0496125_0133183 | |||
| 2507 | Ga0496125_0159105 | |||
| 2508 | Ga0496125_0195797 | |||
| 2509 | Ga0496126_0059046 | |||
| 2510 | Ga0496126_0093713 | |||
| 2511 | Ga0496126_0116638 | |||
| 2512 | Ga0496126_0231402 | |||
| 2513 | Ga0495678_006783 | |||
| 2514 | Ga0495678_007143 | |||
| 2515 | Ga0495678_019023 | |||
| 2516 | Ga0495678_023986 | |||
| 2517 | Ga0495678_040582 | |||
| 2518 | Ga0495678_046826 | |||
| 2519 | Ga0495678_048857 | |||
| 2520 | Ga0495678_051151 | |||
| 2521 | Ga0495678_053717 | |||
| 2522 | Ga0495678_065771 | |||
| 2523 | Ga0495678_082491 | |||
| 2524 | Ga0495678_098546 | |||
| 2525 | Ga0495682_0001194 | |||
| 2526 | Ga0495682_0010234 | |||
| 2527 | Ga0495682_0044936 | |||
| 2528 | Ga0501032_0032467 | |||
| 2529 | Ga0501034_0012375 | |||
| 2530 | Ga0501036_0006094 | |||
| 2531 | Ga0501039_0353924 | |||
| 2532 | Ga0501042_0284943 | |||
| 2533 | Ga0501048_0002402 | |||
| 2534 | Ga0501071_0017634 | |||
| 2535 | Ga0501076_0069483 | |||
| 2536 | Ga0501206_002278 | |||
| 2537 | Ga0501079_0144960 | |||
| 2538 | Ga0501079_0355387 | |||
| 2539 | Ga0501281_01138 | |||
| 2540 | Ga0501035_0000030 | |||
| 2541 | Ga0501035_0078387 | |||
| 2542 | Ga0501226_000049 | |||
| 2543 | nmdc:mga03683_64453_c1 | |||
| 2544 | nmdc:mga03n38_13580_c1 | |||
| 2545 | nmdc:mga0yw44_142413_c1 | |||
| 2546 | nmdc:mga0yw44_62232_c1 | |||
| 2547 | nmdc:mga0k408_183058_c1 | |||
| 2548 | nmdc:mga0k408_184457_c1 | |||
| 2549 | nmdc:mga0k408_21214_c1 | |||
| 2550 | nmdc:mga0k408_62433_c1 | |||
| 2551 | nmdc:mga06z11_145216_c1 | |||
| 2552 | nmdc:mga07m45_19143_c1 | |||
| 2553 | nmdc:mga05p37_212236_c1 | |||
| 2554 | nmdc:mga05p37_556540_c1 | |||
| 2555 | nmdc:mga09592_340295_c1 | |||
| 2556 | nmdc:mga0qj67_11616_c1 | |||
| 2557 | nmdc:mga0qj67_147321_c1 | |||
| 2558 | nmdc:mga06r32_159119_c1 | |||
| 2559 | nmdc:mga06r32_29227_c1 | |||
| 2560 | nmdc:mga08y16_516157_c1 | |||
| 2561 | nmdc:mga0n895_57493_c1 | |||
| 2562 | nmdc:mga0n895_84257_c1 | |||
| 2563 | nmdc:mga0rr50_130397_c1 | |||
| 2564 | nmdc:mga0a205_111882_c1 | |||
| 2565 | Ga0500646_0000571 | |||
| 2566 | Ga0500562_003256 | |||
| 2567 | Ga0500572_019073 | |||
| 2568 | Ga0500593_003321 | |||
| 2569 | Ga0500607_042054 | |||
| 2570 | Ga0500655_019142 | |||
| 2571 | Ga0500658_0012861 | |||
| 2572 | Ga0500616_0035259 | |||
| 2573 | Ga0500619_000123 | |||
| 2574 | Ga0500627_0080704 | |||
| 2575 | Ga0500637_0051278 | |||
| 2576 | Ga0500645_000317 | |||
| 2577 | Ga0500645_001087 | |||
| 2578 | Ga0500645_041314 | |||
| 2579 | Ga0501084_0164120 | |||
| 2580 | Ga0590071_007143 | |||
| 2581 | Ga0501082_0398668 | |||
| 2582 | Ga0530510_0402880 | |||
| 2583 | 2511244704 | |||
| 2584 | 2511252504 | |||
| 2585 | 2511268451 | |||
| 2586 | 2511272365 | |||
| 2587 | 2511278616 | |||
| 2588 | 2511292564 | |||
| 2589 | 2511298781 | |||
| 2590 | 2511299911 | |||
| 2591 | 2511316474 | |||
| 2592 | 2511320236 | |||
| 2593 | 2511329390 | |||
| 2594 | 2511334053 | |||
| 2595 | 2511337248 | |||
| 2596 | 2511344301 | |||
| 2597 | 2511352123 | |||
| 2598 | 2511357476 | |||
| 2599 | 2511363912 | |||
| 2600 | 2511370096 | |||
| 2601 | 2511373919 | |||
| 2602 | 2511416275 | |||
| 2603 | 2511826242 | |||
| 2604 | 2512324876 | |||
| 2605 | 2513956161 | |||
| 2606 | 2514045597 | |||
| 2607 | 2583791002 | |||
| 2608 | 2597856853 | |||
| 2609 | 2597863066 | |||
| 2610 | 2597868859 | |||
| 2611 | 2599401648 | |||
| 2612 | 2599451810 | |||
| 2613 | 2599483880 | |||
| 2614 | 2599504212 | |||
| 2615 | 2599509585 | |||
| 2616 | 2599514893 | |||
| 2617 | 2599520990 | |||
| 2618 | 2599613495 | |||
| 2619 | 2599772401 | |||
| 2620 | 2599801526 | |||
| 2621 | 2599882240 | |||
| 2622 | 2599888877 | |||
| 2623 | 2599894310 | |||
| 2624 | 2599900506 | |||
| 2625 | 2599933527 | |||
| 2626 | 2599944021 | |||
| 2627 | 2599951520 | |||
| 2628 | 2599955767 | |||
| 2629 | 2599961402 | |||
| 2630 | 2599967271 | |||
| 2631 | 2599971604 | |||
| 2632 | 2599979334 | |||
| 2633 | 2599985568 | |||
| 2634 | 2599989441 | |||
| 2635 | 2599994364 | |||
| 2636 | 2600000163 | |||
| 2637 | 2600008394 | |||
| 2638 | 2600013219 | |||
| 2639 | 2600019656 | |||
| 2640 | 2600023657 | |||
| 2641 | 2600032540 | |||
| 2642 | 2600039009 | |||
| 2643 | 2600044213 | |||
| 2644 | 2600048470 | |||
| 2645 | 2600054166 | |||
| 2646 | 2600060384 | |||
| 2647 | 2600066522 | |||
| 2648 | 2600073409 | |||
| 2649 | 2600078168 | |||
| 2650 | 2600361731 | |||
| 2651 | 2600365823 | |||
| 2652 | 2601625154 | |||
| 2653 | 2601694223 | |||
| 2654 | 2601795509 | |||
| 2655 | 2606075579 | |||
| 2656 | 2606128510 | |||
| 2657 | 2624479446 | |||
| 2658 | 2624493556 | |||
| 2659 | 2643841744 | |||
| 2660 | 2643865418 | |||
| 2661 | 2643871837 | |||
| 2662 | 2643933136 | |||
| 2663 | 2643952582 | |||
| 2664 | 2644022344 | |||
| 2665 | 2644187141 | |||
| 2666 | 2644243854 | |||
| 2667 | 2644286115 | |||
| 2668 | 2644296125 | |||
| 2669 | 2644314385 | |||
| 2670 | 2644340172 | |||
| 2671 | 2644623110 | |||
| 2672 | 2652548286 | |||
| 2673 | 2671093167 | |||
| 2674 | 2671128966 | |||
| 2675 | 2671768475 | |||
| 2676 | 2678264583 | |||
| 2677 | 2687579268 | |||
| 2678 | 2715753840 | |||
| 2679 | 2715757712 | |||
| 2680 | 2718633293 | |||
| 2681 | 2723247884 | |||
| 2682 | 2738810893 | |||
| 2683 | 2738898253 | |||
| 2684 | 2739055687 | |||
| 2685 | 2739200868 | |||
| 2686 | 2739261120 | |||
| 2687 | 2739316009 | |||
| 2688 | 2743736281 | |||
| 2689 | 2745005037 | |||
| 2690 | 2774122890 | |||
| 2691 | 2774137604 | |||
| 2692 | 2784265647 | |||
| 2693 | 2784315248 | |||
| 2694 | 2794595102 | |||
| 2695 | 2808857035 | |||
| 2696 | 2808926980 | |||
| 2697 | 2808927374 | |||
| 2698 | 2808937107 | |||
| 2699 | 2808940147 | |||
| 2700 | 2808949086 | |||
| 2701 | 2808950087 | |||
| 2702 | 2808965423 | |||
| 2703 | 2808979394 | |||
| 2704 | 2808995318 | |||
| 2705 | 2809000336 | |||
| 2706 | 2812370100 | |||
| 2707 | 2819653999 | |||
| 2708 | 2825656473 | |||
| 2709 | 2834029716 | |||
| 2710 | 2839142910 | |||
| 2711 | 2842832198 | |||
| 2712 | 2842832683 | |||
| 2713 | 2842841510 | |||
| 2714 | 2842848232 | |||
| 2715 | 2842856860 | |||
| 2716 | 2852618401 | |||
| 2717 | 2852658930 | |||
| 2718 | 2852673463 | |||
| 2719 | 2858951017 | |||
| 2720 | 2860340011 | |||
| 2721 | 2860869710 | |||
| 2722 | 2878031449 | |||
| 2723 | 2880232320 | |||
| 2724 | 2881105274 | |||
| 2725 | 2894416965 | |||
| 2726 | 2904521789 | |||
| 2727 | 2904553185 | |||
| 2728 | 2908448650 | |||
| 2729 | 2913041060 | |||
| 2730 | 2919064080 | |||
| 2731 | 2919386413 | |||
| 2732 | 2919457103 | |||
| 2733 | 2919486182 | |||
| 2734 | 2919491304 | |||
| 2735 | 2919702857 | |||
| 2736 | 2923155295 | |||
| 2737 | 2923524190 | |||
| 2738 | 2923590096 | |||
| 2739 | 2929148560 | |||
| 2740 | 2929191683 | |||
| 2741 | 2931373998 | |||
| 2742 | 2931392785 | |||
| 2743 | 2931400098 | |||
| 2744 | 2939639732 | |||
| 2745 | 2941481807 | |||
| 2746 | 2945928884 | |||
| 2747 | 2945965146 | |||
| 2748 | 2946011086 | |||
| 2749 | 2946029966 | |||
| 2750 | 2947236538 | |||
| 2751 | 2969306232 | |||
| 2752 | 2974292113 | |||
| 2753 | 2984290743 | |||
| 2754 | 2988730153 | |||
| 2755 | 2998141628 | |||
| 2756 | 3007400835 | |||
| 2757 | 3007513026 | |||
| 2758 | 3007616408 | |||
| 2759 | 3007622334 | |||
| 2760 | 3007723317 | |||
| 2761 | 3007856219 | |||
| 2762 | 3007863133 | |||
| 2763 | 3007868030 | |||
| 2764 | 644751928 | |||
| 2765 | 8015689513 | |||
| 2766 | 8019774078 | |||
| 2767 | 8019780262 | |||
| 2768 | 8021623401 | |||
| 2769 | 8021628813 | |||
| 2770 | 8029999128 | |||
| 2771 | 8054287239 | |||
| 2772 | 8054352141 | |||
| 2773 | 8054505286 | |||
| 2774 | 8055772650 | |||
| 2775 | 8055819844 | |||
| 2776 | 8056130176 | |||
| 2777 | 8056133609 | |||
| 2778 | 8056144816 | |||
| 2779 | 8056150518 | |||
| 2780 | 8056156221 | |||
| 2781 | 8056165033 | |||
| 2782 | 8056169363 | |||
| 2783 | 8056175548 | |||
| 2784 | 8056181154 | |||
| 2785 | 8056573216 | |||
| 2786 | 8057799078 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xgg-assembly2.cif.gz_D | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3473 | 52 | 239 |
| 7xgf-assembly2.cif.gz_D | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3348 | 58 | 239 |
| 7xgg-assembly2.cif.gz_D | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3302 | 52 | 239 |
| 7xgf-assembly2.cif.gz_D | crystal structure of bcl-xl in complex with computationally designed inhibitor protein | 0.3202 | 58 | 239 |
| 4py0-assembly1.cif.gz_A | crystal structure of p2y12 receptor in complex with 2mesatp | 0.2922 | 46 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1Z9U2_489_682_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4528 | 13 | 246 | 1.20.1250.20 |
| af_P0A766_4_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4468 | 19 | 232 | 1.10.1760.20 |
| af_E7FB53_277_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4408 | 13 | 258 | 1.20.1250.20 |
| af_P0A766_4_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4336 | 19 | 232 | 1.10.1760.20 |
| af_E7FB53_277_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4292 | 13 | 258 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4UDK9-F1-model_v4 | DUF808 family protein | 0.9347 | 142 | 297 |
GO:0005886
|
| AF-A0A560QN11-F1-model_v4 | Uncharacterized protein DUF808 | 0.929 | 163 | 301 |
GO:0005886
|
| AF-A0A2J4YGP3-F1-model_v4 | DUF808 domain-containing protein | 0.9264 | 47 | 295 |
GO:0005886
|
| AF-A0A560QN11-F1-model_v4 | Uncharacterized protein DUF808 | 0.9165 | 163 | 301 |
GO:0005886
|
| AF-A0A3D0SKE9-F1-model_v4 | DUF808 domain-containing protein | 0.9108 | 55 | 194 |
GO:0005886
|