F493608

General Info

Members Datasets Scaffolds Average Seq Length
1393 614 2786 304

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0002918|Ga0495583_0002918_11082_12137
Length 337
Sequence VVGSPDAPFITQAGRPPSPASQLPSGEQDQQQIGSDPRYIRGILTAGSPPMAGSSLLVLIDDIAAVXXXXALMTKMAAKKTAGVLGDDLALNAQQVSGVRAEREIPVVWAVAKGSFLNKLILVPAALLISAFAPWAVTPLLMLGGAYLCFEGFEKLAHTFLHKRTEEQAHLVEAVADPATDLVAYEKDKIKGAIRTDFILSAEIIAITLGTVAAAPLMQQVVVLSGIAIVMTIGVYGLVAGIVKLDDLGLWLTQKPGQMARSIGGAILRAAPYMMKSLSVIGTAAMFMVGGGILTHGVPVVHHWIETVSQSTAGLAWLMPTLLNAVAVGKVWRATKS

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
199 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
228 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
234 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
243 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
244 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
245 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
246 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
247 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
248 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
249 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
250 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
251 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
252 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
253 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
254 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
255 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
256 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
257 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
260 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
263 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
264 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
265 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
346 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
396 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
397 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
398 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
399 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
400 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
404 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
411 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
412 2511231004 Pseudomonas sp. GM102 Isolate Nodule
413 2511231006 Pseudomonas sp. GM17 Isolate Nodule
414 2511231007 Pseudomonas sp. GM18 Isolate Nodule
415 2511231008 Pseudomonas sp. GM21 Isolate Nodule
416 2511231010 Pseudomonas sp. GM25 Isolate Nodule
417 2511231011 Pseudomonas sp. GM30 Isolate Nodule
418 2511231012 Pseudomonas sp. GM33 Isolate Nodule
419 2511231014 Pseudomonas sp. GM48 Isolate Nodule
420 2511231015 Pseudomonas sp. GM49 Isolate Nodule
421 2511231016 Pseudomonas sp. GM50 Isolate Nodule
422 2511231017 Pseudomonas sp. GM55 Isolate Nodule
423 2511231018 Pseudomonas sp. GM60 Isolate Nodule
424 2511231019 Pseudomonas sp. GM67 Isolate Nodule
425 2511231020 Pseudomonas sp. GM74 Isolate Nodule
426 2511231021 Pseudomonas sp. GM78 Isolate Nodule
427 2511231022 Pseudomonas sp. GM79 Isolate Nodule
428 2511231023 Pseudomonas sp. GM80 Isolate Nodule
429 2511231024 Pseudomonas sp. GM84 Isolate Nodule
430 2511231031 Pseudomonas sp. GM16 Isolate Nodule
431 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
432 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
433 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
434 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
435 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
436 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
437 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
438 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
439 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
440 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
441 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
442 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
443 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
444 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
445 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
446 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
447 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
448 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
449 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
450 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
451 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
452 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
453 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
454 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
455 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
456 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
457 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
458 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
459 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
460 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
461 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
462 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
463 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
464 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
465 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
466 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
467 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
468 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
469 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
470 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
471 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
472 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
473 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
474 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
475 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
476 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
477 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
478 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
479 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
480 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
481 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
482 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
483 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
484 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
485 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
486 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
487 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
488 2643221570 Acidovorax sp. Root568 Isolate Unclassified
489 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
490 2643221585 Pelomonas sp. Root662 Isolate Unclassified
491 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
492 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
493 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
494 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
495 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
496 2643221652 Acidovorax sp. Root402 Isolate Unclassified
497 2643221656 Pelomonas sp. Root405 Isolate Unclassified
498 2643221660 Methylibium sp. Root1272 Isolate Unclassified
499 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
500 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
501 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
502 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
503 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
504 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
505 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
506 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
507 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
508 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
509 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
510 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
511 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
512 2738541337 Pelomonas sp. BT06 Isolate Unclassified
513 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
514 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
515 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
516 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
517 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
518 2773857670 Pseudomonas sp. 478 Isolate Unclassified
519 2773857673 Pseudomonas sp. 443 Isolate Unclassified
520 2784132063 Pseudomonas sp. 424 Isolate Unclassified
521 2784132072 Pseudomonas sp. 460 Isolate Unclassified
522 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
523 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
524 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
525 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
526 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
527 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
528 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
529 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
530 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
531 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
532 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
533 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
534 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
535 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
536 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
537 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
538 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
539 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
540 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
541 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
542 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
543 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
544 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
545 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
546 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
547 2858950400 Achromobacter sp. K91 Isolate Unclassified
548 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
549 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
550 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
551 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
552 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
553 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
554 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
555 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
556 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
557 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
558 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
559 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
560 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
561 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
562 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
563 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
564 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
565 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
566 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
567 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
568 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
569 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
570 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
571 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
572 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
573 2941479691
574 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
575 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
576 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
577 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
578 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
579 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
580 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
581 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
582 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
583 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
584 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
585 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
586 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
587 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
588 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
589 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
590 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
591 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
592 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
593 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
594 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
595 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
596 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
597 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
598 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
599 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
600 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
601 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
602 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
603 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
604 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
605 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
606 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
607 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
608 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
609 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
610 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
611 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
612 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
613 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
614 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.36
Metatranscriptomes 0
Isolates 14.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.33
Nodule 2.37
Rhizoplane 4.38
Rhizosphere 73.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0002918 3300046506 Bacteria 13800
2 MRS2a_Contig_319 2124908027 Bacteria 10974
3 SwRhRL2b_contig_14979 2162886007 Bacteria 2348
4 JGI25155J39150_1000098 3300002704 Bacteria 48725
5 JGI25156J39149_1000163 3300002705 Bacteria 48762
6 JGI25154J39366_1000183 3300002738 Bacteria 48762
7 JGI25154J39366_1002797 3300002738 Bacteria 4156
8 JGI25157J39369_1000209 3300002741 Bacteria 48762
9 JGI25159J45721_1009212 3300002987 Bacteria 2626
10 JGI25151J46595_10007415 3300003187 Bacteria 5378
11 JGI25160J50197_1000212 3300003354 Bacteria 47984
12 JGI25161J50226_1000151 3300003374 Bacteria 47984
13 Ga0055538_1000058 3300003751 Bacteria 112867
14 Ga0055539_1000087 3300003752 Bacteria 114745
15 Ga0055533_1000097 3300003756 Bacteria 112844
16 Ga0055532_1000156 3300003758 Bacteria 60124
17 Ga0055525_1000428 3300003759 Bacteria 25024
18 Ga0055526_1000665 3300003771 Bacteria 26412
19 Ga0055526_1006387 3300003771 Bacteria 6410
20 Ga0055526_1006416 3300003771 Bacteria 6383
21 Ga0055537_1000005 3300003773 Bacteria 160497
22 Ga0055537_1000709 3300003773 Bacteria 17283
23 Ga0055524_1000082 3300003775 Bacteria 119749
24 Ga0055524_1001237 3300003775 Bacteria 15052
25 Ga0055536_1001960 3300003781 Bacteria 11848
26 Ga0055536_1008459 3300003781 Bacteria 4416
27 Ga0055534_1000493 3300003784 Bacteria 21773
28 Ga0055534_1003222 3300003784 Bacteria 5238
29 Ga0055528_1000082 3300003790 Bacteria 74945
30 Ga0055528_1002394 3300003790 Bacteria 10090
31 Ga0055530_10000357 3300003791 Bacteria 41227
32 Ga0055530_10000688 3300003791 Bacteria 28617
33 Ga0055530_10002633 3300003791 Bacteria 11254
34 Ga0055540_1000010 3300003792 Bacteria 290865
35 Ga0055540_1000014 3300003792 Bacteria 234171
36 Ga0055540_1000076 3300003792 Bacteria 114654
37 Ga0055540_1000253 3300003792 Bacteria 48323
38 Ga0055540_1001210 3300003792 Bacteria 15871
39 Ga0055531_10000769 3300003794 Bacteria 26770
40 Ga0055531_10001153 3300003794 Bacteria 20389
41 Ga0055531_10021777 3300003794 Bacteria 2472
42 Ga0055541_1000060 3300003841 Bacteria 112630
43 Ga0055543_1000526 3300004625 Bacteria 21681
44 Ga0065165_1010723 3300005262 Bacteria 3918
45 Ga0065165_1011785 3300005262 Bacteria 3606
46 Ga0065165_1018022 3300005262 Bacteria 2576
47 Ga0065714_10005879 3300005288 Bacteria 3910
48 Ga0065714_10007382 3300005288 Bacteria 3192
49 Ga0065714_10023056 3300005288 Bacteria 1802
50 Ga0065714_10066205 3300005288 Bacteria 7363
51 Ga0065714_10066523 3300005288 Bacteria 6701
52 Ga0065704_10103302 3300005289 Bacteria 2176
53 Ga0065704_10146264 3300005289 Bacteria 1469
54 Ga0065704_10231731 3300005289 Bacteria 1041
55 Ga0065712_10000624 3300005290 Bacteria 9381
56 Ga0065712_10002139 3300005290 Bacteria 6843
57 Ga0065712_10069768 3300005290 Bacteria 6738
58 Ga0065715_10097314 3300005293 Bacteria 3725
59 Ga0070676_10019903 3300005328 Bacteria 3740
60 Ga0070683_100114202 3300005329 Bacteria 2549
61 Ga0070690_100255831 3300005330 Bacteria 1240
62 Ga0070670_100000573 3300005331 Bacteria 29071
63 Ga0070670_100001103 3300005331 Bacteria 21451
64 Ga0070670_100019134 3300005331 Bacteria 5872
65 Ga0070670_100078619 3300005331 Bacteria 2834
66 Ga0070670_100268858 3300005331 Bacteria 1487
67 Ga0068869_100022441 3300005334 Bacteria 4350
68 Ga0070666_10005190 3300005335 Bacteria 7976
69 Ga0068868_100139270 3300005338 Bacteria 1991
70 Ga0070661_100000029 3300005344 Bacteria 117682
71 Ga0070669_100019134 3300005353 Bacteria 4895
72 Ga0070669_100125513 3300005353 Bacteria 1963
73 Ga0070669_100155027 3300005353 Bacteria 1775
74 Ga0070669_100160965 3300005353 Bacteria 1744
75 Ga0070675_100025997 3300005354 Bacteria 4695
76 Ga0070675_100071088 3300005354 Bacteria 2886
77 Ga0070671_100011056 3300005355 Bacteria 7246
78 Ga0070671_100153324 3300005355 Bacteria 1946
79 Ga0070674_100081819 3300005356 Bacteria 2308
80 Ga0070674_100114468 3300005356 Bacteria 1986
81 Ga0070673_100008668 3300005364 Bacteria 6776
82 Ga0070688_100038778 3300005365 Bacteria 2912
83 Ga0070659_100000877 3300005366 Bacteria 21982
84 Ga0070678_100014404 3300005456 Bacteria 4989
85 Ga0070678_100021363 3300005456 Bacteria 4267
86 Ga0070662_100004039 3300005457 Bacteria 9213
87 Ga0070662_100051420 3300005457 Bacteria 2976
88 Ga0070662_100081568 3300005457 Bacteria 2410
89 Ga0068867_100135231 3300005459 Bacteria 1921
90 Ga0070685_10040301 3300005466 Bacteria 2657
91 Ga0070706_100422077 3300005467 Bacteria 1241
92 Ga0070707_100248249 3300005468 Bacteria 1732
93 Ga0070679_100128294 3300005530 Bacteria 2518
94 Ga0070684_100198280 3300005535 Bacteria 1828
95 Ga0068853_100019145 3300005539 Bacteria 5673
96 Ga0070672_100051800 3300005543 Bacteria 3203
97 Ga0070672_100132531 3300005543 Bacteria 2049
98 Ga0070695_100013037 3300005545 Bacteria 4994
99 Ga0070664_100000046 3300005564 Bacteria 74475
100 Ga0070664_100009920 3300005564 Bacteria 7719
101 Ga0070664_100378919 3300005564 Bacteria 1291
102 Ga0068857_100463531 3300005577 Bacteria 1186
103 Ga0068854_100003507 3300005578 Bacteria 9796
104 Ga0068859_100027466 3300005617 Bacteria 5707
105 Ga0068859_100428626 3300005617 Bacteria 1419
106 Ga0068864_100003420 3300005618 Bacteria 13128
107 Ga0068866_10010526 3300005718 Bacteria 3970
108 Ga0068861_100016003 3300005719 Bacteria 5296
109 Ga0068861_100333011 3300005719 Bacteria 1326
110 Ga0068851_10000050 3300005834 Bacteria 72913
111 Ga0068851_10022967 3300005834 Bacteria 3045
112 Ga0068863_100002555 3300005841 Bacteria 18065
113 Ga0068863_100043982 3300005841 Bacteria 4239
114 Ga0068858_100010086 3300005842 Bacteria 8968
115 Ga0068858_100010413 3300005842 Bacteria 8810
116 Ga0068858_100082497 3300005842 Bacteria 2989
117 Ga0068860_100412779 3300005843 Bacteria 1337
118 Ga0068860_100417924 3300005843 Bacteria 1329
119 Ga0068862_100057800 3300005844 Bacteria 3327
120 Ga0081455_10023769 3300005937 Bacteria 5694
121 Ga0070717_10192879 3300006028 Bacteria 1781
122 Ga0075365_10001663 3300006038 Bacteria 10268
123 Ga0075363_100012995 3300006048 Bacteria 4022
124 Ga0075363_100124350 3300006048 Bacteria 1443
125 Ga0075363_100166680 3300006048 Bacteria 1249
126 Ga0075364_10210962 3300006051 Bacteria 1317
127 Ga0075364_10238757 3300006051 Bacteria 1234
128 Ga0075432_10045718 3300006058 Bacteria 1536
129 Ga0075362_10015018 3300006177 Bacteria 3140
130 Ga0075362_10060855 3300006177 Bacteria 1707
131 Ga0075362_10151221 3300006177 Bacteria 1114
132 Ga0075369_10110775 3300006186 Bacteria 1237
133 Ga0075366_10012451 3300006195 Bacteria 4825
134 Ga0075366_10059694 3300006195 Bacteria 2265
135 Ga0075366_10084264 3300006195 Bacteria 1900
136 Ga0068871_100053445 3300006358 Bacteria 3274
137 Ga0075428_100070983 3300006844 Bacteria 3807
138 Ga0075430_100028327 3300006846 Bacteria 4759
139 Ga0075430_100029379 3300006846 Bacteria 4665
140 Ga0075431_100194929 3300006847 Bacteria 2074
141 Ga0075433_10206265 3300006852 Bacteria 1747
142 Ga0075434_100007145 3300006871 Bacteria 10320
143 Ga0075434_100228445 3300006871 Bacteria 1880
144 Ga0075429_100131261 3300006880 Bacteria 2191
145 Ga0068865_100037755 3300006881 Bacteria 3264
146 Ga0068865_100092987 3300006881 Bacteria 2192
147 Ga0075436_100106412 3300006914 Bacteria 1956
148 Ga0075436_100185608 3300006914 Bacteria 1470
149 Ga0097620_100027466 3300006931 Bacteria 5707
150 Ga0097620_100428610 3300006931 Bacteria 1419
151 Ga0079104_1000013 3300006946 Bacteria 349477
152 Ga0079104_1000438 3300006946 Bacteria 47426
153 Ga0079104_1002086 3300006946 Bacteria 11469
154 Ga0079104_1013864 3300006946 Bacteria 2463
155 Ga0075435_100022552 3300007076 Bacteria 4858
156 Ga0075435_100068148 3300007076 Bacteria 2898
157 Ga0075435_100077609 3300007076 Bacteria 2723
158 Ga0075435_100142506 3300007076 Bacteria 2011
159 Ga0105251_10003624 3300009011 Bacteria 11098
160 Ga0105251_10007394 3300009011 Bacteria 6777
161 Ga0105251_10015196 3300009011 Bacteria 4218
162 Ga0105251_10070773 3300009011 Bacteria 1624
163 Ga0105244_10000632 3300009036 Bacteria 31091
164 Ga0105244_10001388 3300009036 Bacteria 19671
165 Ga0105244_10005166 3300009036 Bacteria 8747
166 Ga0105244_10008699 3300009036 Bacteria 6317
167 Ga0105244_10025168 3300009036 Bacteria 3239
168 Ga0105244_10117166 3300009036 Bacteria 1292
169 Ga0105244_10130581 3300009036 Bacteria 1212
170 Ga0105250_10001902 3300009092 Bacteria 10836
171 Ga0105250_10002234 3300009092 Bacteria 9855
172 Ga0105250_10070763 3300009092 Bacteria 1408
173 Ga0105250_10075441 3300009092 Bacteria 1364
174 Ga0105240_10001650 3300009093 Bacteria 37876
175 Ga0111539_10090021 3300009094 Bacteria 3606
176 Ga0111539_10311619 3300009094 Bacteria 1832
177 Ga0114129_10585770 3300009147 Bacteria 1447
178 Ga0105243_10000158 3300009148 Bacteria 77305
179 Ga0105242_10005191 3300009176 Bacteria 10055
180 Ga0105242_10029447 3300009176 Bacteria 4379
181 Ga0105248_10039796 3300009177 Bacteria 5268
182 Ga0105237_10001262 3300009545 Bacteria 33775
183 Ga0105237_10001445 3300009545 Bacteria 31382
184 Ga0105239_10003184 3300010375 Bacteria 20313
185 Ga0105246_10002056 3300011119 Bacteria 12119
186 Ga0105246_10002917 3300011119 Bacteria 10351
187 Ga0157345_1000315 3300012498 Bacteria 6118
188 Ga0157373_10008336 3300013100 Bacteria 7700
189 Ga0157373_10036295 3300013100 Bacteria 3539
190 Ga0157373_10038710 3300013100 Bacteria 3417
191 Ga0157373_10073683 3300013100 Bacteria 2409
192 Ga0157373_10126229 3300013100 Bacteria 1799
193 Ga0157371_10000003 3300013102 Bacteria 543317
194 Ga0157371_10008703 3300013102 Bacteria 8056
195 Ga0157371_10035808 3300013102 Bacteria 3556
196 Ga0157370_10014439 3300013104 Bacteria 8073
197 Ga0157370_10033631 3300013104 Bacteria 4999
198 Ga0157370_10148550 3300013104 Bacteria 2182
199 Ga0157370_10154564 3300013104 Bacteria 2134
200 Ga0157369_10002431 3300013105 Bacteria 22369
201 Ga0157369_10017719 3300013105 Bacteria 7999
202 Ga0157369_10359308 3300013105 Bacteria 1512
203 Ga0157369_10389948 3300013105 Bacteria 1445
204 Ga0157369_10521987 3300013105 Bacteria 1228
205 Ga0157378_10134728 3300013297 Bacteria 2289
206 Ga0163162_10007458 3300013306 Bacteria 10638
207 Ga0163162_10041733 3300013306 Bacteria 4591
208 Ga0163162_10080883 3300013306 Bacteria 3318
209 Ga0163162_10118081 3300013306 Bacteria 2754
210 Ga0163162_10209402 3300013306 Bacteria 2079
211 Ga0163162_10252735 3300013306 Bacteria 1894
212 Ga0157372_10248323 3300013307 Bacteria 2065
213 Ga0157375_10005173 3300013308 Bacteria 11316
214 Ga0157375_10029502 3300013308 Bacteria 5160
215 Ga0157375_10352996 3300013308 Bacteria 1636
216 Ga0157375_10504861 3300013308 Bacteria 1373
217 Ga0163163_10029028 3300014325 Bacteria 5318
218 Ga0157380_10167625 3300014326 Bacteria 1915
219 Ga0182008_10007753 3300014497 Bacteria 5908
220 Ga0182008_10027899 3300014497 Bacteria 2856
221 Ga0182008_10031040 3300014497 Bacteria 2691
222 Ga0182008_10048085 3300014497 Bacteria 2119
223 Ga0182008_10052853 3300014497 Bacteria 2013
224 Ga0157379_10008130 3300014968 Bacteria 9111
225 Ga0157379_10027378 3300014968 Bacteria 5076
226 Ga0157376_10017549 3300014969 Bacteria 5463
227 Ga0182006_1001026 3300015261 Bacteria 18245
228 Ga0182006_1018698 3300015261 Bacteria 2923
229 Ga0182006_1035530 3300015261 Bacteria 1986
230 Ga0182007_10000638 3300015262 Bacteria 20273
231 Ga0182005_1015155 3300015265 Bacteria 2152
232 Ga0182005_1038132 3300015265 Bacteria 1307
233 Ga0163161_10006835 3300017792 Bacteria 7892
234 Ga0163161_10011701 3300017792 Bacteria 6088
235 Ga0163161_10046047 3300017792 Bacteria 3147
236 Ga0163161_10061272 3300017792 Bacteria 2738
237 Ga0163161_10085719 3300017792 Bacteria 2323
238 Ga0209435_100010 3300025206 Bacteria 475373
239 Ga0209435_103802 3300025206 Bacteria 1714
240 Ga0209784_100040 3300025224 Bacteria 231812
241 Ga0209566_100051 3300025225 Bacteria 231920
242 Ga0209674_100072 3300025226 Bacteria 231812
243 Ga0209147_100067 3300025229 Bacteria 231812
244 Ga0209563_100073 3300025230 Bacteria 231920
245 Ga0209563_100854 3300025230 Bacteria 9072
246 Ga0209437_101937 3300025233 Bacteria 4318
247 Ga0209258_100548 3300025242 Bacteria 33898
248 Ga0209646_1000001 3300025246 Bacteria 3092932
249 Ga0209646_1000455 3300025246 Bacteria 21348
250 Ga0209026_1000001 3300025250 Bacteria 1228671
251 Ga0209677_100063 3300025253 Bacteria 151440
252 Ga0209759_1000001 3300025256 Bacteria 2799452
253 Ga0209759_1005333 3300025256 Bacteria 4530
254 Ga0209565_1000036 3300025263 Bacteria 293334
255 Ga0209565_1000074 3300025263 Bacteria 164237
256 Ga0209565_1000226 3300025263 Bacteria 63161
257 Ga0209673_1000129 3300025273 Bacteria 164238
258 Ga0209673_1000282 3300025273 Bacteria 95013
259 Ga0209130_1000016 3300025284 Bacteria 395540
260 Ga0209130_1000042 3300025284 Bacteria 257581
261 Ga0209130_1000255 3300025284 Bacteria 67166
262 Ga0209675_1000072 3300025291 Bacteria 164237
263 Ga0209675_1000289 3300025291 Bacteria 47643
264 Ga0209675_1003625 3300025291 Bacteria 7246
265 Ga0209676_1000007 3300025292 Bacteria 1029371
266 Ga0209676_1000016 3300025292 Bacteria 655561
267 Ga0209676_1000021 3300025292 Bacteria 609534
268 Ga0209676_1000033 3300025292 Bacteria 463236
269 Ga0209676_1002600 3300025292 Bacteria 12379
270 Ga0209676_1010192 3300025292 Bacteria 3953
271 Ga0209025_1002347 3300025294 Bacteria 20391
272 Ga0209025_1006388 3300025294 Bacteria 9173
273 Ga0209025_1017511 3300025294 Bacteria 4128
274 Ga0209564_1000160 3300025295 Bacteria 164214
275 Ga0209564_1002324 3300025295 Bacteria 15396
276 Ga0209564_1004446 3300025295 Bacteria 8571
277 Ga0209050_1000003 3300025298 Bacteria 1609245
278 Ga0209050_1000036 3300025298 Bacteria 423070
279 Ga0209050_1000235 3300025298 Bacteria 121420
280 Ga0209050_1000595 3300025298 Bacteria 57712
281 Ga0209050_1001021 3300025298 Bacteria 34934
282 Ga0209050_1003407 3300025298 Bacteria 11780
283 Ga0209050_1004120 3300025298 Bacteria 10120
284 Ga0209050_1024161 3300025298 Bacteria 2113
285 Ga0209256_1000001 3300025299 Bacteria 2166974
286 Ga0209256_1000018 3300025299 Bacteria 568467
287 Ga0209256_1000125 3300025299 Bacteria 165336
288 Ga0209256_1013724 3300025299 Bacteria 2983
289 Ga0207426_1000097 3300025302 Bacteria 265930
290 Ga0209051_1000003 3300025303 Bacteria 1609245
291 Ga0209051_1000035 3300025303 Bacteria 346999
292 Ga0209051_1000043 3300025303 Bacteria 305473
293 Ga0209051_1000123 3300025303 Bacteria 144298
294 Ga0209051_1000407 3300025303 Bacteria 59487
295 Ga0209257_1000020 3300025304 Bacteria 773356
296 Ga0209257_1000098 3300025304 Bacteria 256390
297 Ga0209257_1000212 3300025304 Bacteria 138478
298 Ga0209257_1005878 3300025304 Bacteria 8282
299 Ga0207697_10000220 3300025315 Bacteria 30814
300 Ga0207656_10001101 3300025321 Bacteria 8874
301 Ga0207696_1000101 3300025711 Bacteria 170899
302 Ga0207696_1000171 3300025711 Bacteria 102599
303 Ga0207696_1002789 3300025711 Bacteria 8300
304 Ga0207696_1007872 3300025711 Bacteria 4132
305 Ga0207696_1011534 3300025711 Bacteria 3174
306 Ga0207696_1037960 3300025711 Bacteria 1424
307 Ga0207696_1052225 3300025711 Bacteria 1165
308 Ga0207655_1000337 3300025728 Bacteria 68266
309 Ga0207655_1003684 3300025728 Bacteria 11297
310 Ga0207655_1005276 3300025728 Bacteria 8862
311 Ga0207655_1011381 3300025728 Bacteria 5301
312 Ga0207655_1013741 3300025728 Bacteria 4623
313 Ga0207655_1017394 3300025728 Bacteria 3880
314 Ga0207655_1018323 3300025728 Bacteria 3720
315 Ga0207713_1000802 3300025735 Bacteria 29111
316 Ga0207713_1002825 3300025735 Bacteria 12240
317 Ga0207713_1003131 3300025735 Bacteria 11467
318 Ga0207713_1009471 3300025735 Bacteria 5485
319 Ga0207713_1009538 3300025735 Bacteria 5459
320 Ga0207713_1010269 3300025735 Bacteria 5194
321 Ga0207713_1086620 3300025735 Bacteria 1112
322 Ga0207713_1086738 3300025735 Bacteria 1111
323 Ga0207642_10006922 3300025899 Bacteria 3798
324 Ga0207688_10004358 3300025901 Bacteria 7714
325 Ga0207680_10011100 3300025903 Bacteria 4538
326 Ga0207645_10130324 3300025907 Bacteria 1636
327 Ga0207695_10016073 3300025913 Bacteria 8777
328 Ga0207671_10000287 3300025914 Bacteria 74587
329 Ga0207649_10000068 3300025920 Bacteria 91623
330 Ga0207649_10003248 3300025920 Bacteria 8892
331 Ga0207652_10253097 3300025921 Bacteria 1588
332 Ga0207681_10002569 3300025923 Bacteria 11516
333 Ga0207681_10097126 3300025923 Bacteria 2117
334 Ga0207681_10127731 3300025923 Bacteria 1875
335 Ga0207681_10139514 3300025923 Bacteria 1804
336 Ga0207681_10372830 3300025923 Bacteria 1147
337 Ga0207650_10000174 3300025925 Bacteria 75634
338 Ga0207650_10008848 3300025925 Bacteria 6879
339 Ga0207650_10012734 3300025925 Bacteria 5809
340 Ga0207650_10232607 3300025925 Bacteria 1487
341 Ga0207659_10109989 3300025926 Bacteria 2093
342 Ga0207644_10124839 3300025931 Bacteria 1963
343 Ga0207644_10248650 3300025931 Bacteria 1418
344 Ga0207690_10001532 3300025932 Bacteria 14454
345 Ga0207706_10000922 3300025933 Bacteria 30101
346 Ga0207706_10075851 3300025933 Bacteria 2957
347 Ga0207706_10099295 3300025933 Bacteria 2561
348 Ga0207706_10237085 3300025933 Bacteria 1595
349 Ga0207686_10017447 3300025934 Bacteria 4046
350 Ga0207709_10000053 3300025935 Bacteria 225514
351 Ga0207669_10356956 3300025937 Bacteria 1131
352 Ga0207704_10346260 3300025938 Bacteria 1155
353 Ga0207691_10026593 3300025940 Bacteria 5429
354 Ga0207691_10299868 3300025940 Bacteria 1381
355 Ga0207711_10067832 3300025941 Bacteria 3088
356 Ga0207689_10099171 3300025942 Bacteria 2394
357 Ga0207679_10000018 3300025945 Bacteria 238375
358 Ga0207679_10004446 3300025945 Bacteria 8734
359 Ga0207679_10008172 3300025945 Bacteria 6661
360 Ga0207679_10193045 3300025945 Bacteria 1695
361 Ga0207712_10042768 3300025961 Bacteria 3123
362 Ga0207668_10119423 3300025972 Bacteria 1993
363 Ga0207658_10031163 3300025986 Bacteria 3784
364 Ga0207677_10011601 3300026023 Bacteria 5031
365 Ga0207703_10004144 3300026035 Bacteria 11958
366 Ga0207703_10036290 3300026035 Bacteria 3923
367 Ga0207703_10052729 3300026035 Bacteria 3304
368 Ga0207639_10013755 3300026041 Bacteria 5674
369 Ga0207708_10411315 3300026075 Bacteria 1120
370 Ga0207641_10030385 3300026088 Bacteria 4475
371 Ga0207648_10045149 3300026089 Bacteria 3865
372 Ga0207648_10087817 3300026089 Bacteria 2714
373 Ga0207648_10247301 3300026089 Bacteria 1589
374 Ga0207676_10010742 3300026095 Bacteria 6527
375 Ga0207674_10441810 3300026116 Bacteria 1257
376 Ga0207675_100250547 3300026118 Bacteria 1714
377 Ga0207675_100642112 3300026118 Bacteria 1067
378 Ga0207683_10013834 3300026121 Bacteria 6881
379 Ga0209281_1000010 3300027111 Bacteria 726106
380 Ga0209281_1000174 3300027111 Bacteria 151659
381 Ga0209281_1000182 3300027111 Bacteria 145698
382 Ga0209281_1006015 3300027111 Bacteria 3232
383 Ga0209281_1009339 3300027111 Bacteria 2309
384 Ga0209281_1015382 3300027111 Bacteria 1597
385 Ga0209983_1005427 3300027665 Bacteria 2641
386 Ga0209813_10011558 3300027866 Bacteria 2311
387 Ga0207428_10022532 3300027907 Bacteria 5313
388 Ga0207428_10026314 3300027907 Bacteria 4857
389 Ga0207428_10293724 3300027907 Bacteria 1204
390 Ga0268266_10443246 3300028379 Bacteria 1233
391 Ga0268265_10534114 3300028380 Bacteria 1111
392 Ga0268264_10189503 3300028381 Bacteria 1874
393 Ga0268264_10528707 3300028381 Bacteria 1154
394 Ga0307517_10039962 3300028786 Bacteria 5130
395 Ga0307517_10173128 3300028786 Bacteria 1413
396 Ga0307515_10000049 3300028794 Bacteria 278611
397 Ga0307515_10000066 3300028794 Bacteria 244076
398 Ga0307515_10002144 3300028794 Bacteria 43311
399 Ga0307515_10003679 3300028794 Bacteria 32201
400 Ga0307515_10103124 3300028794 Bacteria 3423
401 Ga0307515_10201864 3300028794 Bacteria 1861
402 Ga0307511_10000570 3300030521 Bacteria 39538
403 Ga0316177_1052986 3300030731 Bacteria 12724
404 Ga0316177_1092213 3300030731 Bacteria 4282
405 Ga0316178_1101335 3300030735 Bacteria 1617
406 Ga0316178_1171693 3300030735 Bacteria 22825
407 Ga0316183_1029553 3300030742 Bacteria 2373
408 Ga0316182_1057930 3300030745 Bacteria 2890
409 Ga0265330_10000117 3300031235 Bacteria 63961
410 Ga0265332_10000002 3300031238 Bacteria 709510
411 Ga0307513_10000011 3300031456 Bacteria 354929
412 Ga0307513_10000017 3300031456 Bacteria 282386
413 Ga0307513_10015421 3300031456 Bacteria 9264
414 Ga0307513_10105803 3300031456 Bacteria 2821
415 Ga0307509_10089054 3300031507 Bacteria 3166
416 Ga0307509_10205301 3300031507 Bacteria 1802
417 Ga0307408_100000192 3300031548 Bacteria 65993
418 Ga0307408_100002500 3300031548 Bacteria 12859
419 Ga0307408_100004501 3300031548 Bacteria 9450
420 Ga0307408_100023415 3300031548 Bacteria 4206
421 Ga0307408_100030906 3300031548 Bacteria 3723
422 Ga0307408_100040364 3300031548 Bacteria 3304
423 Ga0307408_100079093 3300031548 Bacteria 2452
424 Ga0307408_100437521 3300031548 Bacteria 1131
425 Ga0307514_10030795 3300031649 Bacteria 4305
426 Ga0265314_10000012 3300031711 Bacteria 415184
427 Ga0307516_10000181 3300031730 Bacteria 81531
428 Ga0307516_10008542 3300031730 Bacteria 11566
429 Ga0307516_10012117 3300031730 Bacteria 9313
430 Ga0307405_10006315 3300031731 Bacteria 5818
431 Ga0307405_10017084 3300031731 Bacteria 3973
432 Ga0307405_10017531 3300031731 Bacteria 3931
433 Ga0307405_10294770 3300031731 Bacteria 1227
434 Ga0307413_10002620 3300031824 Bacteria 7358
435 Ga0307413_10003279 3300031824 Bacteria 6788
436 Ga0307413_10141520 3300031824 Bacteria 1663
437 Ga0307410_10013563 3300031852 Bacteria 4760
438 Ga0307410_10033020 3300031852 Bacteria 3338
439 Ga0307406_10001571 3300031901 Bacteria 12584
440 Ga0307406_10018088 3300031901 Bacteria 4111
441 Ga0307406_10022392 3300031901 Bacteria 3748
442 Ga0307406_10024745 3300031901 Bacteria 3589
443 Ga0307406_10180986 3300031901 Bacteria 1534
444 Ga0307407_10023389 3300031903 Bacteria 3223
445 Ga0307407_10086114 3300031903 Bacteria 1913
446 Ga0307407_10239394 3300031903 Bacteria 1237
447 Ga0307412_10002180 3300031911 Bacteria 10869
448 Ga0307412_10010694 3300031911 Bacteria 5289
449 Ga0307412_10022143 3300031911 Bacteria 3891
450 Ga0307412_10028003 3300031911 Bacteria 3520
451 Ga0307412_10030893 3300031911 Bacteria 3378
452 Ga0307412_10038935 3300031911 Bacteria 3065
453 Ga0307412_10265558 3300031911 Bacteria 1340
454 Ga0307409_100115891 3300031995 Bacteria 2257
455 Ga0307409_100129790 3300031995 Bacteria 2151
456 Ga0307409_100196064 3300031995 Bacteria 1802
457 Ga0307416_100003739 3300032002 Bacteria 9032
458 Ga0307416_100009114 3300032002 Bacteria 6467
459 Ga0307416_100055914 3300032002 Bacteria 3180
460 Ga0307416_100227710 3300032002 Bacteria 1794
461 Ga0307416_100239015 3300032002 Bacteria 1758
462 Ga0307416_100358238 3300032002 Bacteria 1480
463 Ga0307414_10018101 3300032004 Bacteria 4327
464 Ga0307414_10059744 3300032004 Bacteria 2693
465 Ga0307414_10112271 3300032004 Bacteria 2077
466 Ga0307414_10144358 3300032004 Bacteria 1868
467 Ga0307411_10002390 3300032005 Bacteria 8276
468 Ga0307411_10019865 3300032005 Bacteria 3892
469 Ga0307415_100153792 3300032126 Bacteria 1774
470 Ga0307510_10013786 3300033180 Bacteria 9582
471 Ga0373962_0015463 3300035242 Bacteria 1957
472 Ga0316574_0162091 3300035398 Bacteria 1440
473 Ga0395900_0058760 3300037418 Bacteria 3959
474 Ga0395905_0000111 3300037471 Bacteria 136345
475 Ga0395905_0029270 3300037471 Bacteria 5190
476 Ga0395901_0063836 3300038443 Bacteria 3834
477 Ga0400490_23266 3300038726 Bacteria 7398
478 Ga0400483_004246 3300039062 Bacteria 3305
479 Ga0439438_006773 3300041405 Bacteria 4000
480 Ga0439438_009999 3300041405 Bacteria 3033
481 Ga0439438_018822 3300041405 Bacteria 1960
482 Ga0439438_019241 3300041405 Bacteria 1932
483 Ga0439438_019362 3300041405 Bacteria 1923
484 Ga0439438_035933 3300041405 Bacteria 1300
485 Ga0439447_002850 3300041407 Bacteria 6205
486 Ga0439447_004045 3300041407 Bacteria 5120
487 Ga0439447_005181 3300041407 Bacteria 4362
488 Ga0439447_009617 3300041407 Bacteria 2917
489 Ga0439447_018024 3300041407 Bacteria 1912
490 Ga0439447_020625 3300041407 Bacteria 1744
491 Ga0439447_022230 3300041407 Bacteria 1663
492 Ga0439447_029292 3300041407 Bacteria 1394
493 Ga0439461_0034830 3300041410 Bacteria 1065
494 Ga0439466_0000181 3300041411 Bacteria 25115
495 Ga0439466_0000878 3300041411 Bacteria 11440
496 Ga0439466_0011728 3300041411 Bacteria 3236
497 Ga0439466_0025721 3300041411 Bacteria 2052
498 Ga0439466_0028124 3300041411 Bacteria 1942
499 Ga0439466_0051725 3300041411 Bacteria 1344
500 Ga0451843_0113517 3300041509 Bacteria 2601
501 Ga0439431_0010778 3300041997 Bacteria 2081
502 Ga0439437_001194 3300042000 Bacteria 2722
503 Ga0439441_006369 3300042001 Bacteria 1870
504 Ga0439432_008171 3300042006 Bacteria 3680
505 Ga0439432_009089 3300042006 Bacteria 3470
506 Ga0439432_009917 3300042006 Bacteria 3312
507 Ga0439432_012801 3300042006 Bacteria 2860
508 Ga0439432_023065 3300042006 Bacteria 2051
509 Ga0439449_0045091 3300042007 Bacteria 1635
510 Ga0439451_002573 3300042009 Bacteria 3690
511 Ga0439451_004203 3300042009 Bacteria 2920
512 Ga0439451_004767 3300042009 Bacteria 2759
513 Ga0439451_006596 3300042009 Bacteria 2372
514 Ga0439451_011164 3300042009 Bacteria 1812
515 Ga0439451_013491 3300042009 Bacteria 1652
516 Ga0439451_019924 3300042009 Bacteria 1351
517 Ga0439451_033717 3300042009 Bacteria 1029
518 Ga0439452_001154 3300042010 Bacteria 11484
519 Ga0439452_002037 3300042010 Bacteria 7699
520 Ga0439452_003486 3300042010 Bacteria 5502
521 Ga0439452_012323 3300042010 Bacteria 2436
522 Ga0439452_022880 3300042010 Bacteria 1613
523 Ga0439452_023025 3300042010 Bacteria 1607
524 Ga0439452_036678 3300042010 Bacteria 1173
525 Ga0439456_001653 3300042013 Bacteria 4503
526 Ga0439456_002975 3300042013 Bacteria 3426
527 Ga0439456_004070 3300042013 Bacteria 2966
528 Ga0439462_0014323 3300042015 Bacteria 2037
529 Ga0439463_000119 3300042016 Bacteria 19578
530 Ga0439463_000135 3300042016 Bacteria 18610
531 Ga0439463_030801 3300042016 Bacteria 1353
532 Ga0439463_044257 3300042016 Bacteria 1133
533 Ga0450911_000011 3300042115 Bacteria 130739
534 Ga0450911_000708 3300042115 Bacteria 9741
535 Ga0450911_004672 3300042115 Bacteria 2215
536 Ga0450911_007344 3300042115 Bacteria 1601
537 Ga0450919_002168 3300042121 Bacteria 2558
538 Ga0450920_004432 3300042122 Bacteria 2466
539 Ga0450922_003964 3300042124 Bacteria 1362
540 Ga0450888_000889 3300042126 Bacteria 2845
541 Ga0450890_008503 3300042127 Bacteria 1313
542 Ga0450891_000402 3300042129 Bacteria 4527
543 Ga0450892_000986 3300042130 Bacteria 3027
544 Ga0450896_002601 3300042133 Bacteria 2345
545 Ga0450902_023057 3300042137 Bacteria 1033
546 Ga0450903_003483 3300042138 Bacteria 2724
547 Ga0450903_008066 3300042138 Bacteria 1725
548 Ga0450903_015663 3300042138 Bacteria 1193
549 Ga0450904_000171 3300042139 Bacteria 14169
550 Ga0450904_000482 3300042139 Bacteria 7821
551 Ga0450904_003954 3300042139 Bacteria 1566
552 Ga0450889_000148 3300042144 Bacteria 7104
553 Ga0450906_003185 3300042145 Bacteria 3548
554 Ga0450906_008030 3300042145 Bacteria 2057
555 Ga0450907_001074 3300042146 Bacteria 6337
556 Ga0450907_003459 3300042146 Bacteria 2815
557 Ga0450910_000426 3300042147 Bacteria 4990
558 Ga0439446_0000636 3300042156 Bacteria 7264
559 Ga0439446_0004080 3300042156 Bacteria 3680
560 Ga0439446_0006845 3300042156 Bacteria 2985
561 Ga0450908_001481 3300042184 Bacteria 4556
562 Ga0450908_002124 3300042184 Bacteria 3877
563 Ga0450908_010504 3300042184 Bacteria 1708
564 Ga0450909_005842 3300042185 Bacteria 1773
565 Ga0439434_0001856 3300042435 Bacteria 6138
566 Ga0439434_0005608 3300042435 Bacteria 3665
567 Ga0439434_0009004 3300042435 Bacteria 2934
568 Ga0439444_0000913 3300042437 Bacteria 3594
569 Ga0439459_0005479 3300042438 Bacteria 2087
570 Ga0450916_003055 3300042530 Bacteria 1815
571 Ga0450918_000109 3300042531 Bacteria 17693
572 Ga0450918_015318 3300042531 Bacteria 1333
573 Ga0451577_0012487 3300042876 Bacteria 7974
574 Ga0451577_0023296 3300042876 Bacteria 5647
575 Ga0451577_0037186 3300042876 Bacteria 4382
576 Ga0451577_0112001 3300042876 Bacteria 2442
577 Ga0451577_0172106 3300042876 Bacteria 1951
578 Ga0451577_0176352 3300042876 Bacteria 1927
579 Ga0439440_0007687 3300042993 Bacteria 2196
580 Ga0453683_0026029 3300044673 Bacteria 3715
581 Ga0453684_0003069 3300044712 Bacteria 38658
582 Ga0453684_0003996 3300044712 Bacteria 32193
583 Ga0453684_0020726 3300044712 Bacteria 9891
584 Ga0453684_0072068 3300044712 Bacteria 4364
585 Ga0453684_0128380 3300044712 Bacteria 3047
586 Ga0453684_0252937 3300044712 Bacteria 2023
587 Ga0451576_0002831 3300045051 Bacteria 24945
588 Ga0451576_0111991 3300045051 Bacteria 2840
589 Ga0451576_0239496 3300045051 Bacteria 1895
590 Ga0495617_019836 3300046452 Bacteria 2272
591 Ga0495617_023783 3300046452 Bacteria 2068
592 Ga0495617_024908 3300046452 Bacteria 2018
593 Ga0495617_028646 3300046452 Bacteria 1871
594 Ga0495617_029283 3300046452 Bacteria 1851
595 Ga0495617_029611 3300046452 Bacteria 1840
596 Ga0495617_033153 3300046452 Bacteria 1733
597 Ga0495617_057170 3300046452 Bacteria 1293
598 Ga0495617_067354 3300046452 Bacteria 1179
599 Ga0495617_085955 3300046452 Bacteria 1028
600 Ga0495627_002318 3300046453 Bacteria 9361
601 Ga0495627_004002 3300046453 Bacteria 6290
602 Ga0495627_010270 3300046453 Bacteria 3411
603 Ga0495627_026933 3300046453 Bacteria 1848
604 Ga0495627_027411 3300046453 Bacteria 1828
605 Ga0495627_036353 3300046453 Bacteria 1531
606 Ga0495627_038050 3300046453 Bacteria 1489
607 Ga0495603_0027657 3300046455 Bacteria 3421
608 Ga0495590_0003405 3300046457 Bacteria 6503
609 Ga0495590_0008242 3300046457 Bacteria 3984
610 Ga0495590_0009528 3300046457 Bacteria 3686
611 Ga0495590_0028023 3300046457 Bacteria 1976
612 Ga0495590_0049105 3300046457 Bacteria 1472
613 Ga0495590_0051499 3300046457 Bacteria 1438
614 Ga0495590_0081857 3300046457 Bacteria 1137
615 Ga0495591_001049 3300046458 Bacteria 18589
616 Ga0495591_001222 3300046458 Bacteria 16729
617 Ga0495591_001953 3300046458 Bacteria 12055
618 Ga0495591_002999 3300046458 Bacteria 8995
619 Ga0495591_005577 3300046458 Bacteria 5786
620 Ga0495591_005915 3300046458 Bacteria 5531
621 Ga0495591_009977 3300046458 Bacteria 3725
622 Ga0495591_013325 3300046458 Bacteria 3016
623 Ga0495591_027665 3300046458 Bacteria 1745
624 Ga0495591_030174 3300046458 Bacteria 1639
625 Ga0495591_030882 3300046458 Bacteria 1613
626 Ga0495591_031551 3300046458 Bacteria 1588
627 Ga0495629_0034536 3300046459 Bacteria 3575
628 Ga0495638_0006643 3300046460 Bacteria 8400
629 Ga0495638_0024554 3300046460 Bacteria 3928
630 Ga0495638_0027492 3300046460 Bacteria 3681
631 Ga0495638_0035616 3300046460 Bacteria 3172
632 Ga0495638_0083513 3300046460 Bacteria 1934
633 Ga0495638_0087119 3300046460 Bacteria 1886
634 Ga0495638_0095491 3300046460 Bacteria 1785
635 Ga0495638_0097759 3300046460 Bacteria 1760
636 Ga0495638_0099920 3300046460 Bacteria 1736
637 Ga0495638_0128172 3300046460 Bacteria 1493
638 Ga0495638_0136809 3300046460 Bacteria 1433
639 Ga0495638_0185634 3300046460 Bacteria 1183
640 Ga0495653_0008829 3300046463 Bacteria 8252
641 Ga0495653_0025056 3300046463 Bacteria 4799
642 Ga0495653_0108020 3300046463 Bacteria 2004
643 Ga0495653_0112090 3300046463 Bacteria 1958
644 Ga0495650_0002465 3300046471 Bacteria 14902
645 Ga0495650_0003436 3300046471 Bacteria 11555
646 Ga0495650_0010955 3300046471 Bacteria 5016
647 Ga0495650_0013666 3300046471 Bacteria 4279
648 Ga0495650_0022548 3300046471 Bacteria 3017
649 Ga0495650_0028780 3300046471 Bacteria 2542
650 Ga0495650_0041139 3300046471 Bacteria 1978
651 Ga0495650_0042867 3300046471 Bacteria 1924
652 Ga0495650_0048023 3300046471 Bacteria 1781
653 Ga0495650_0100254 3300046471 Bacteria 1088
654 Ga0495580_0100897 3300046472 Bacteria 2007
655 Ga0495582_0047131 3300046473 Bacteria 2373
656 Ga0495605_0000047 3300046474 Bacteria 171270
657 Ga0495605_0000525 3300046474 Bacteria 32358
658 Ga0495605_0001790 3300046474 Bacteria 13787
659 Ga0495605_0008617 3300046474 Bacteria 5761
660 Ga0495605_0011610 3300046474 Bacteria 4904
661 Ga0495605_0017163 3300046474 Bacteria 3904
662 Ga0495605_0044607 3300046474 Bacteria 2191
663 Ga0495605_0054700 3300046474 Bacteria 1932
664 Ga0495605_0075118 3300046474 Bacteria 1589
665 Ga0495605_0075212 3300046474 Bacteria 1588
666 Ga0495605_0113736 3300046474 Bacteria 1232
667 Ga0495639_0001026 3300046475 Bacteria 12605
668 Ga0495639_0071088 3300046475 Bacteria 1608
669 Ga0495584_0001531 3300046491 Bacteria 13751
670 Ga0495584_0003735 3300046491 Bacteria 8296
671 Ga0495584_0007445 3300046491 Bacteria 5708
672 Ga0495584_0015983 3300046491 Bacteria 3829
673 Ga0495584_0021347 3300046491 Bacteria 3290
674 Ga0495584_0044491 3300046491 Bacteria 2240
675 Ga0495584_0061946 3300046491 Bacteria 1880
676 Ga0495584_0070071 3300046491 Bacteria 1762
677 Ga0495584_0091037 3300046491 Bacteria 1538
678 Ga0495584_0091912 3300046491 Bacteria 1530
679 Ga0495584_0094908 3300046491 Bacteria 1506
680 Ga0495584_0120432 3300046491 Bacteria 1329
681 Ga0495584_0169546 3300046491 Bacteria 1109
682 Ga0495585_0013265 3300046492 Bacteria 4826
683 Ga0495585_0019151 3300046492 Bacteria 3949
684 Ga0495585_0053223 3300046492 Bacteria 2240
685 Ga0495585_0083924 3300046492 Bacteria 1723
686 Ga0495585_0085043 3300046492 Bacteria 1710
687 Ga0495585_0152444 3300046492 Bacteria 1204
688 Ga0495585_0168582 3300046492 Bacteria 1132
689 Ga0495594_0004782 3300046499 Bacteria 6974
690 Ga0495594_0073151 3300046499 Bacteria 1907
691 Ga0495596_0006850 3300046500 Bacteria 5195
692 Ga0495607_0000518 3300046501 Bacteria 37977
693 Ga0495607_0001826 3300046501 Bacteria 18146
694 Ga0495607_0007371 3300046501 Bacteria 7615
695 Ga0495607_0014071 3300046501 Bacteria 5221
696 Ga0495607_0024198 3300046501 Bacteria 3789
697 Ga0495607_0026676 3300046501 Bacteria 3582
698 Ga0495607_0066827 3300046501 Bacteria 2021
699 Ga0495607_0082877 3300046501 Bacteria 1758
700 Ga0495607_0086801 3300046501 Bacteria 1705
701 Ga0495607_0101485 3300046501 Bacteria 1540
702 Ga0495607_0107687 3300046501 Bacteria 1482
703 Ga0495607_0114217 3300046501 Bacteria 1427
704 Ga0495607_0167903 3300046501 Bacteria 1110
705 Ga0495583_0000951 3300046506 Bacteria 33709
706 Ga0495583_0001288 3300046506 Bacteria 26166
707 Ga0495583_0001564 3300046506 Bacteria 22613
708 Ga0495583_0002315 3300046506 Bacteria 16595
709 Ga0495583_0002664 3300046506 Bacteria 14863
710 Ga0495583_0004641 3300046506 Bacteria 9695
711 Ga0495583_0006143 3300046506 Bacteria 7915
712 Ga0495583_0018121 3300046506 Bacteria 3716
713 Ga0495583_0055618 3300046506 Bacteria 1787
714 Ga0495583_0102065 3300046506 Bacteria 1223
715 Ga0495583_0114801 3300046506 Bacteria 1138
716 Ga0495606_0002715 3300046507 Bacteria 19952
717 Ga0495606_0003285 3300046507 Bacteria 17312
718 Ga0495606_0010009 3300046507 Bacteria 7928
719 Ga0495606_0011802 3300046507 Bacteria 7079
720 Ga0495606_0017361 3300046507 Bacteria 5443
721 Ga0495606_0031867 3300046507 Bacteria 3659
722 Ga0495606_0035263 3300046507 Bacteria 3422
723 Ga0495606_0037596 3300046507 Bacteria 3286
724 Ga0495606_0059532 3300046507 Bacteria 2450
725 Ga0495606_0074370 3300046507 Bacteria 2128
726 Ga0495606_0091936 3300046507 Bacteria 1864
727 Ga0495606_0097531 3300046507 Bacteria 1795
728 Ga0495606_0102749 3300046507 Bacteria 1737
729 Ga0495606_0268418 3300046507 Bacteria 938
730 Ga0495610_0003261 3300046512 Bacteria 12807
731 Ga0495610_0007060 3300046512 Bacteria 7585
732 Ga0495610_0012127 3300046512 Bacteria 5211
733 Ga0495610_0015116 3300046512 Bacteria 4501
734 Ga0495610_0019253 3300046512 Bacteria 3827
735 Ga0495610_0038888 3300046512 Bacteria 2410
736 Ga0495610_0054135 3300046512 Bacteria 1939
737 Ga0495610_0075903 3300046512 Bacteria 1555
738 Ga0495616_0000033 3300046513 Bacteria 130486
739 Ga0495616_0008301 3300046513 Bacteria 6162
740 Ga0495616_0023442 3300046513 Bacteria 3319
741 Ga0495616_0058108 3300046513 Bacteria 1905
742 Ga0495616_0061381 3300046513 Bacteria 1843
743 Ga0495616_0064861 3300046513 Bacteria 1781
744 Ga0495616_0068188 3300046513 Bacteria 1727
745 Ga0495616_0070593 3300046513 Bacteria 1690
746 Ga0495616_0073691 3300046513 Bacteria 1646
747 Ga0495616_0133589 3300046513 Bacteria 1135
748 Ga0495620_0000681 3300046515 Bacteria 21016
749 Ga0495620_0001574 3300046515 Bacteria 13532
750 Ga0495620_0011570 3300046515 Bacteria 4597
751 Ga0495620_0012675 3300046515 Bacteria 4339
752 Ga0495620_0014528 3300046515 Bacteria 3999
753 Ga0495620_0026268 3300046515 Bacteria 2740
754 Ga0495620_0060649 3300046515 Bacteria 1576
755 Ga0495620_0065810 3300046515 Bacteria 1494
756 Ga0495620_0120619 3300046515 Bacteria 1033
757 Ga0495620_0128980 3300046515 Bacteria 993
758 Ga0495628_0168181 3300046516 Bacteria 1663
759 Ga0495630_0118884 3300046517 Bacteria 2004
760 Ga0495630_0157972 3300046517 Bacteria 1726
761 Ga0495630_0216928 3300046517 Bacteria 1460
762 Ga0495631_0001379 3300046518 Bacteria 14791
763 Ga0495631_0010993 3300046518 Bacteria 4468
764 Ga0495631_0026556 3300046518 Bacteria 2657
765 Ga0495631_0035984 3300046518 Bacteria 2212
766 Ga0495631_0039815 3300046518 Bacteria 2083
767 Ga0495632_0002239 3300046519 Bacteria 14922
768 Ga0495632_0003625 3300046519 Bacteria 10852
769 Ga0495632_0006548 3300046519 Bacteria 7468
770 Ga0495632_0017079 3300046519 Bacteria 4016
771 Ga0495632_0031914 3300046519 Bacteria 2718
772 Ga0495632_0033618 3300046519 Bacteria 2630
773 Ga0495632_0050118 3300046519 Bacteria 2060
774 Ga0495632_0065258 3300046519 Bacteria 1758
775 Ga0495632_0096566 3300046519 Bacteria 1395
776 Ga0495637_0000023 3300046520 Bacteria 172407
777 Ga0495637_0004072 3300046520 Bacteria 7630
778 Ga0495637_0004257 3300046520 Bacteria 7434
779 Ga0495637_0004633 3300046520 Bacteria 7100
780 Ga0495637_0010319 3300046520 Bacteria 4524
781 Ga0495637_0012773 3300046520 Bacteria 4007
782 Ga0495637_0028282 3300046520 Bacteria 2504
783 Ga0495637_0035117 3300046520 Bacteria 2191
784 Ga0495637_0042348 3300046520 Bacteria 1948
785 Ga0495637_0042746 3300046520 Bacteria 1937
786 Ga0495637_0057426 3300046520 Bacteria 1607
787 Ga0495637_0059388 3300046520 Bacteria 1573
788 Ga0495637_0060850 3300046520 Bacteria 1549
789 Ga0495643_0000235 3300046522 Bacteria 83550
790 Ga0495643_0000451 3300046522 Bacteria 52778
791 Ga0495643_0001781 3300046522 Bacteria 18467
792 Ga0495643_0014368 3300046522 Bacteria 4712
793 Ga0495643_0025994 3300046522 Bacteria 3308
794 Ga0495643_0071193 3300046522 Bacteria 1825
795 Ga0495643_0073032 3300046522 Bacteria 1798
796 Ga0495643_0079763 3300046522 Bacteria 1706
797 Ga0495643_0100339 3300046522 Bacteria 1484
798 Ga0495644_0001359 3300046523 Bacteria 9994
799 Ga0495644_0002908 3300046523 Bacteria 6797
800 Ga0495644_0009130 3300046523 Bacteria 3819
801 Ga0495644_0040652 3300046523 Bacteria 1752
802 Ga0495644_0043757 3300046523 Bacteria 1685
803 Ga0495648_0004435 3300046524 Bacteria 11992
804 Ga0495648_0005762 3300046524 Bacteria 10221
805 Ga0495648_0008617 3300046524 Bacteria 8000
806 Ga0495648_0009743 3300046524 Bacteria 7400
807 Ga0495648_0009845 3300046524 Bacteria 7345
808 Ga0495648_0010619 3300046524 Bacteria 6998
809 Ga0495648_0026685 3300046524 Bacteria 3884
810 Ga0495648_0031678 3300046524 Bacteria 3479
811 Ga0495648_0054260 3300046524 Bacteria 2422
812 Ga0495648_0095077 3300046524 Bacteria 1658
813 Ga0495648_0098748 3300046524 Bacteria 1616
814 Ga0495648_0112459 3300046524 Bacteria 1479
815 Ga0495648_0144430 3300046524 Bacteria 1248
816 Ga0495666_0019229 3300046526 Bacteria 3392
817 Ga0495666_0090307 3300046526 Bacteria 1445
818 Ga0495642_0008536 3300046528 Bacteria 3919
819 Ga0495642_0028383 3300046528 Bacteria 2229
820 Ga0495642_0063907 3300046528 Bacteria 1531
821 Ga0495642_0148367 3300046528 Bacteria 1014
822 Ga0495654_0001312 3300046530 Bacteria 17384
823 Ga0495654_0003008 3300046530 Bacteria 10523
824 Ga0495654_0004908 3300046530 Bacteria 7868
825 Ga0495654_0020326 3300046530 Bacteria 3460
826 Ga0495654_0024046 3300046530 Bacteria 3150
827 Ga0495654_0026361 3300046530 Bacteria 2987
828 Ga0495654_0033398 3300046530 Bacteria 2604
829 Ga0495654_0034346 3300046530 Bacteria 2559
830 Ga0495654_0044581 3300046530 Bacteria 2193
831 Ga0495654_0049305 3300046530 Bacteria 2063
832 Ga0495654_0051260 3300046530 Bacteria 2014
833 Ga0495654_0055371 3300046530 Bacteria 1920
834 Ga0495654_0078104 3300046530 Bacteria 1557
835 Ga0495586_0072220 3300046535 Bacteria 1886
836 Ga0495587_0055720 3300046536 Bacteria 2327
837 Ga0495587_0084286 3300046536 Bacteria 1840
838 Ga0495609_0000382 3300046538 Bacteria 37599
839 Ga0495609_0001328 3300046538 Bacteria 16782
840 Ga0495609_0002035 3300046538 Bacteria 12747
841 Ga0495609_0005136 3300046538 Bacteria 6971
842 Ga0495609_0014758 3300046538 Bacteria 3667
843 Ga0495609_0052750 3300046538 Bacteria 1809
844 Ga0495609_0056639 3300046538 Bacteria 1736
845 Ga0495609_0061996 3300046538 Bacteria 1652
846 Ga0495609_0138019 3300046538 Bacteria 1041
847 Ga0495597_0016484 3300046542 Bacteria 3487
848 Ga0495597_0018121 3300046542 Bacteria 3307
849 Ga0495597_0027613 3300046542 Bacteria 2602
850 Ga0495597_0068053 3300046542 Bacteria 1539
851 Ga0495597_0096166 3300046542 Bacteria 1252
852 Ga0495645_0043791 3300046543 Bacteria 3266
853 Ga0495622_0006120 3300046557 Bacteria 5590
854 Ga0495622_0010777 3300046557 Bacteria 4216
855 Ga0495622_0010996 3300046557 Bacteria 4175
856 Ga0495622_0013903 3300046557 Bacteria 3734
857 Ga0495633_0009405 3300046558 Bacteria 5402
858 Ga0495633_0039348 3300046558 Bacteria 2256
859 Ga0495633_0054711 3300046558 Bacteria 1877
860 Ga0495656_0011229 3300046615 Bacteria 3284
861 Ga0495656_0054518 3300046615 Bacteria 1720
862 Ga0495668_0000066 3300046616 Bacteria 178533
863 Ga0495668_0005069 3300046616 Bacteria 9067
864 Ga0495668_0009434 3300046616 Bacteria 5995
865 Ga0495668_0014429 3300046616 Bacteria 4632
866 Ga0495668_0025042 3300046616 Bacteria 3392
867 Ga0495668_0031471 3300046616 Bacteria 2990
868 Ga0495668_0092989 3300046616 Bacteria 1651
869 Ga0495668_0190762 3300046616 Bacteria 1122
870 Ga0495634_0026595 3300046642 Bacteria 4036
871 Ga0495611_0000527 3300046648 Bacteria 22716
872 Ga0495611_0010917 3300046648 Bacteria 3847
873 Ga0495611_0151232 3300046648 Bacteria 1083
874 Ga0495625_0000010 3300046660 Bacteria 381775
875 Ga0495625_0002580 3300046660 Bacteria 19464
876 Ga0495625_0007460 3300046660 Bacteria 9511
877 Ga0495625_0026691 3300046660 Bacteria 4359
878 Ga0495625_0027685 3300046660 Bacteria 4260
879 Ga0495625_0111279 3300046660 Bacteria 1871
880 Ga0495625_0113679 3300046660 Bacteria 1848
881 Ga0495625_0151186 3300046660 Bacteria 1560
882 Ga0495635_0019671 3300046663 Bacteria 4701
883 Ga0495635_0109674 3300046663 Bacteria 1885
884 Ga0495659_0000614 3300046664 Bacteria 13131
885 Ga0495659_0001072 3300046664 Bacteria 9522
886 Ga0495659_0085846 3300046664 Bacteria 1201
887 Ga0495661_0000020 3300046665 Bacteria 196901
888 Ga0495661_0000921 3300046665 Bacteria 26890
889 Ga0495661_0001245 3300046665 Bacteria 21981
890 Ga0495661_0001424 3300046665 Bacteria 20061
891 Ga0495661_0004872 3300046665 Bacteria 9612
892 Ga0495661_0017999 3300046665 Bacteria 4654
893 Ga0495661_0056510 3300046665 Bacteria 2347
894 Ga0495661_0115603 3300046665 Bacteria 1489
895 Ga0495661_0119371 3300046665 Bacteria 1458
896 Ga0495661_0182405 3300046665 Bacteria 1111
897 Ga0495588_0005616 3300046674 Bacteria 5590
898 Ga0495588_0054920 3300046674 Bacteria 2055
899 Ga0495588_0190885 3300046674 Bacteria 1082
900 Ga0495623_0006486 3300046679 Bacteria 7615
901 Ga0495646_0021966 3300046680 Bacteria 4028
902 Ga0495646_0057628 3300046680 Bacteria 2324
903 Ga0495658_0024110 3300046683 Bacteria 3237
904 Ga0495658_0071621 3300046683 Bacteria 2014
905 Ga0495624_0006539 3300046690 Bacteria 8256
906 Ga0495670_0016034 3300046691 Bacteria 3683
907 Ga0495670_0025293 3300046691 Bacteria 2936
908 Ga0495670_0058910 3300046691 Bacteria 1927
909 Ga0495670_0081399 3300046691 Bacteria 1650
910 Ga0495670_0089607 3300046691 Bacteria 1573
911 Ga0495671_0002927 3300046692 Bacteria 10643
912 Ga0495671_0004947 3300046692 Bacteria 7857
913 Ga0495671_0007405 3300046692 Bacteria 6259
914 Ga0495671_0018971 3300046692 Bacteria 3642
915 Ga0495671_0027600 3300046692 Bacteria 2930
916 Ga0495671_0028703 3300046692 Bacteria 2862
917 Ga0495671_0051154 3300046692 Bacteria 2055
918 Ga0495671_0072055 3300046692 Bacteria 1696
919 Ga0495671_0149436 3300046692 Bacteria 1137
920 Ga0495671_0176581 3300046692 Bacteria 1037
921 Ga0495649_0004409 3300046694 Bacteria 9196
922 Ga0495649_0005345 3300046694 Bacteria 8191
923 Ga0495649_0014263 3300046694 Bacteria 4562
924 Ga0495649_0018067 3300046694 Bacteria 3972
925 Ga0495649_0024187 3300046694 Bacteria 3388
926 Ga0495649_0050987 3300046694 Bacteria 2244
927 Ga0495649_0087976 3300046694 Bacteria 1657
928 Ga0495649_0103686 3300046694 Bacteria 1510
929 Ga0495649_0107459 3300046694 Bacteria 1480
930 Ga0495649_0113667 3300046694 Bacteria 1434
931 Ga0495589_0001332 3300046794 Bacteria 14508
932 Ga0495589_0014607 3300046794 Bacteria 4041
933 Ga0495589_0015859 3300046794 Bacteria 3873
934 Ga0495589_0017326 3300046794 Bacteria 3698
935 Ga0495589_0019891 3300046794 Bacteria 3434
936 Ga0495589_0047166 3300046794 Bacteria 2135
937 Ga0495589_0075007 3300046794 Bacteria 1649
938 Ga0495589_0085508 3300046794 Bacteria 1532
939 Ga0495660_0026859 3300046810 Bacteria 3259
940 Ga0495660_0028851 3300046810 Bacteria 3132
941 Ga0495660_0050171 3300046810 Bacteria 2274
942 Ga0495660_0082336 3300046810 Bacteria 1685
943 Ga0495660_0087342 3300046810 Bacteria 1626
944 Ga0495660_0088460 3300046810 Bacteria 1613
945 Ga0495660_0088816 3300046810 Bacteria 1609
946 Ga0495660_0096355 3300046810 Bacteria 1529
947 Ga0495660_0104168 3300046810 Bacteria 1456
948 Ga0495660_0111802 3300046810 Bacteria 1393
949 Ga0495660_0112872 3300046810 Bacteria 1384
950 Ga0495660_0131961 3300046810 Bacteria 1252
951 Ga0495581_0045650 3300047315 Bacteria 2533
952 Ga0495581_0216606 3300047315 Bacteria 1119
953 Ga0495604_0050490 3300047317 Bacteria 3229
954 Ga0495604_0134098 3300047317 Bacteria 1776
955 Ga0495636_0088058 3300047318 Bacteria 1345
956 Ga0495674_0266698 3300047319 Bacteria 1406
957 Ga0495672_0005482 3300047320 Bacteria 10057
958 Ga0495672_0006681 3300047320 Bacteria 8859
959 Ga0495672_0007497 3300047320 Bacteria 8199
960 Ga0495672_0008863 3300047320 Bacteria 7359
961 Ga0495672_0010510 3300047320 Bacteria 6589
962 Ga0495672_0027464 3300047320 Bacteria 3616
963 Ga0495672_0033848 3300047320 Bacteria 3163
964 Ga0495672_0035859 3300047320 Bacteria 3051
965 Ga0495672_0038422 3300047320 Bacteria 2920
966 Ga0495672_0070992 3300047320 Bacteria 1971
967 Ga0495672_0086782 3300047320 Bacteria 1729
968 Ga0495672_0099618 3300047320 Bacteria 1579
969 Ga0495672_0114758 3300047320 Bacteria 1440
970 Ga0495676_0000002 3300047321 Bacteria 373918
971 Ga0495676_0151655 3300047321 Bacteria 1648
972 Ga0495680_0024002 3300047322 Bacteria 5064
973 Ga0495680_0039068 3300047322 Bacteria 3788
974 Ga0495680_0065992 3300047322 Bacteria 2770
975 Ga0495683_0003171 3300047323 Bacteria 9607
976 Ga0495683_0003249 3300047323 Bacteria 9503
977 Ga0495683_0024108 3300047323 Bacteria 3124
978 Ga0495683_0057374 3300047323 Bacteria 1935
979 Ga0495683_0060985 3300047323 Bacteria 1868
980 Ga0495683_0075946 3300047323 Bacteria 1645
981 Ga0495683_0079047 3300047323 Bacteria 1606
982 Ga0495683_0121438 3300047323 Bacteria 1239
983 Ga0495687_007225 3300047443 Bacteria 6598
984 Ga0495687_024579 3300047443 Bacteria 2861
985 Ga0495687_042165 3300047443 Bacteria 1996
986 Ga0495687_053744 3300047443 Bacteria 1694
987 Ga0495687_077151 3300047443 Bacteria 1316
988 Ga0495677_0000650 3300047445 Bacteria 14031
989 Ga0495677_0020960 3300047445 Bacteria 2369
990 Ga0495677_0090162 3300047445 Bacteria 1155
991 Ga0495679_000126 3300047446 Bacteria 68027
992 Ga0495679_001276 3300047446 Bacteria 14778
993 Ga0495679_004444 3300047446 Bacteria 6465
994 Ga0495679_028467 3300047446 Bacteria 1833
995 Ga0495679_028925 3300047446 Bacteria 1812
996 Ga0495679_029111 3300047446 Bacteria 1804
997 Ga0495679_037703 3300047446 Bacteria 1518
998 Ga0495679_039168 3300047446 Bacteria 1479
999 Ga0495679_043219 3300047446 Bacteria 1386
1000 Ga0495673_0005373 3300047469 Bacteria 7761
1001 Ga0495673_0007959 3300047469 Bacteria 6015
1002 Ga0495673_0014503 3300047469 Bacteria 4094
1003 Ga0495673_0016649 3300047469 Bacteria 3754
1004 Ga0495673_0029101 3300047469 Bacteria 2610
1005 Ga0495673_0032526 3300047469 Bacteria 2429
1006 Ga0495673_0041555 3300047469 Bacteria 2069
1007 Ga0495673_0041818 3300047469 Bacteria 2060
1008 Ga0495673_0042449 3300047469 Bacteria 2041
1009 Ga0495673_0046611 3300047469 Bacteria 1919
1010 Ga0495673_0052205 3300047469 Bacteria 1787
1011 Ga0495673_0054042 3300047469 Bacteria 1748
1012 Ga0495673_0077987 3300047469 Bacteria 1378
1013 Ga0495681_0003096 3300047470 Bacteria 11665
1014 Ga0495681_0006229 3300047470 Bacteria 7861
1015 Ga0495681_0006544 3300047470 Bacteria 7633
1016 Ga0495681_0008618 3300047470 Bacteria 6368
1017 Ga0495681_0014387 3300047470 Bacteria 4538
1018 Ga0495681_0014892 3300047470 Bacteria 4431
1019 Ga0495681_0036974 3300047470 Bacteria 2409
1020 Ga0495681_0037159 3300047470 Bacteria 2402
1021 Ga0495681_0037976 3300047470 Bacteria 2365
1022 Ga0495681_0049938 3300047470 Bacteria 1974
1023 Ga0495681_0058808 3300047470 Bacteria 1779
1024 Ga0495681_0078938 3300047470 Bacteria 1473
1025 Ga0495681_0082499 3300047470 Bacteria 1432
1026 Ga0495686_0002019 3300047472 Bacteria 20049
1027 Ga0495686_0027444 3300047472 Bacteria 3717
1028 Ga0495686_0028552 3300047472 Bacteria 3632
1029 Ga0495686_0036418 3300047472 Bacteria 3158
1030 Ga0495686_0050482 3300047472 Bacteria 2613
1031 Ga0495686_0124526 3300047472 Bacteria 1533
1032 Ga0495686_0160304 3300047472 Bacteria 1315
1033 Ga0495686_0248139 3300047472 Bacteria 1001
1034 Ga0495593_0023986 3300047673 Bacteria 3385
1035 Ga0495593_0035478 3300047673 Bacteria 2707
1036 Ga0495593_0049143 3300047673 Bacteria 2239
1037 Ga0495602_0014404 3300048088 Bacteria 8028
1038 Ga0495614_0059153 3300048089 Bacteria 1646
1039 Ga0495626_0000007 3300048091 Bacteria 276374
1040 Ga0495626_0002967 3300048091 Bacteria 11256
1041 Ga0495626_0003463 3300048091 Bacteria 10116
1042 Ga0495626_0009973 3300048091 Bacteria 5100
1043 Ga0495626_0021019 3300048091 Bacteria 3246
1044 Ga0495626_0044378 3300048091 Bacteria 2080
1045 Ga0495626_0058650 3300048091 Bacteria 1758
1046 Ga0495626_0068898 3300048091 Bacteria 1594
1047 Ga0495626_0077102 3300048091 Bacteria 1486
1048 Ga0496102_0039674 3300048905 Bacteria 4255
1049 Ga0496102_0039685 3300048905 Bacteria 4255
1050 Ga0496102_0118982 3300048905 Bacteria 2466
1051 Ga0496103_0009900 3300048906 Bacteria 5639
1052 Ga0496103_0013678 3300048906 Bacteria 4815
1053 Ga0496104_0037906 3300048907 Bacteria 4508
1054 Ga0496106_0269835 3300048909 Bacteria 1362
1055 Ga0496108_0233135 3300048911 Bacteria 1601
1056 Ga0496110_0028872 3300048913 Bacteria 4768
1057 Ga0496110_0104451 3300048913 Bacteria 2542
1058 Ga0496113_0197086 3300048916 Bacteria 1600
1059 Ga0496114_0500498 3300048917 Bacteria 1075
1060 Ga0496116_0011263 3300048919 Bacteria 7422
1061 Ga0496116_0018629 3300048919 Bacteria 5342
1062 Ga0496116_0030573 3300048919 Bacteria 3865
1063 Ga0496116_0068022 3300048919 Bacteria 2271
1064 Ga0496116_0086629 3300048919 Bacteria 1920
1065 Ga0496117_0002615 3300048920 Bacteria 22374
1066 Ga0496117_0060972 3300048920 Bacteria 2595
1067 Ga0496117_0070653 3300048920 Bacteria 2343
1068 Ga0496117_0077206 3300048920 Bacteria 2205
1069 Ga0496117_0134198 3300048920 Bacteria 1494
1070 Ga0496118_0007860 3300048921 Bacteria 11181
1071 Ga0496118_0026123 3300048921 Bacteria 4984
1072 Ga0496118_0038784 3300048921 Bacteria 3812
1073 Ga0496118_0067109 3300048921 Bacteria 2614
1074 Ga0496118_0101749 3300048921 Bacteria 1939
1075 Ga0496118_0108001 3300048921 Bacteria 1856
1076 Ga0496119_0054262 3300048922 Bacteria 2441
1077 Ga0496119_0111054 3300048922 Bacteria 1521
1078 Ga0496120_0025786 3300048923 Bacteria 3643
1079 Ga0496120_0049142 3300048923 Bacteria 2422
1080 Ga0496120_0102175 3300048923 Bacteria 1512
1081 Ga0496121_0007632 3300048924 Bacteria 13001
1082 Ga0496121_0095663 3300048924 Bacteria 2307
1083 Ga0496121_0153244 3300048924 Bacteria 1693
1084 Ga0496122_0006870 3300048925 Bacteria 12884
1085 Ga0496122_0009750 3300048925 Bacteria 10033
1086 Ga0496122_0009960 3300048925 Bacteria 9900
1087 Ga0496122_0037125 3300048925 Bacteria 3928
1088 Ga0496122_0055660 3300048925 Bacteria 2956
1089 Ga0496122_0139048 3300048925 Bacteria 1523
1090 Ga0496122_0159736 3300048925 Bacteria 1376
1091 Ga0496122_0194429 3300048925 Bacteria 1193
1092 Ga0496123_0006780 3300048926 Bacteria 11004
1093 Ga0496123_0025924 3300048926 Bacteria 4406
1094 Ga0496123_0029048 3300048926 Bacteria 4082
1095 Ga0496123_0137870 3300048926 Bacteria 1339
1096 Ga0496124_0000125 3300048927 Bacteria 159942
1097 Ga0496124_0003286 3300048927 Bacteria 19942
1098 Ga0496124_0022394 3300048927 Bacteria 5793
1099 Ga0496124_0033558 3300048927 Bacteria 4514
1100 Ga0496124_0035843 3300048927 Bacteria 4335
1101 Ga0496124_0049764 3300048927 Bacteria 3573
1102 Ga0496124_0090780 3300048927 Bacteria 2490
1103 Ga0496124_0126651 3300048927 Bacteria 2033
1104 Ga0496124_0163497 3300048927 Bacteria 1732
1105 Ga0496125_0000011 3300048928 Bacteria 655895
1106 Ga0496125_0003246 3300048928 Bacteria 20033
1107 Ga0496125_0004490 3300048928 Bacteria 16066
1108 Ga0496125_0009991 3300048928 Bacteria 9645
1109 Ga0496125_0022908 3300048928 Bacteria 5786
1110 Ga0496125_0044334 3300048928 Bacteria 3763
1111 Ga0496125_0083993 3300048928 Bacteria 2420
1112 Ga0496125_0087170 3300048928 Bacteria 2358
1113 Ga0496125_0133183 3300048928 Bacteria 1745
1114 Ga0496125_0159105 3300048928 Bacteria 1537
1115 Ga0496125_0195797 3300048928 Bacteria 1329
1116 Ga0496126_0059046 3300048929 Bacteria 3455
1117 Ga0496126_0093713 3300048929 Bacteria 2636
1118 Ga0496126_0116638 3300048929 Bacteria 2320
1119 Ga0496126_0231402 3300048929 Bacteria 1548
1120 Ga0495678_006783 3300049459 Bacteria 6028
1121 Ga0495678_007143 3300049459 Bacteria 5831
1122 Ga0495678_019023 3300049459 Bacteria 3074
1123 Ga0495678_023986 3300049459 Bacteria 2641
1124 Ga0495678_040582 3300049459 Bacteria 1869
1125 Ga0495678_046826 3300049459 Bacteria 1697
1126 Ga0495678_048857 3300049459 Bacteria 1647
1127 Ga0495678_051151 3300049459 Bacteria 1598
1128 Ga0495678_053717 3300049459 Bacteria 1545
1129 Ga0495678_065771 3300049459 Bacteria 1344
1130 Ga0495678_082491 3300049459 Bacteria 1151
1131 Ga0495678_098546 3300049459 Bacteria 1016
1132 Ga0495682_0001194 3300049460 Bacteria 14764
1133 Ga0495682_0010234 3300049460 Bacteria 3640
1134 Ga0495682_0044936 3300049460 Bacteria 1615
1135 Ga0501032_0032467 3300049569 Bacteria 3578
1136 Ga0501034_0012375 3300049571 Bacteria 8815
1137 Ga0501036_0006094 3300049572 Bacteria 9784
1138 Ga0501039_0353924 3300049575 Bacteria 1154
1139 Ga0501042_0284943 3300049578 Bacteria 1193
1140 Ga0501048_0002402 3300049582 Bacteria 14287
1141 Ga0501071_0017634 3300049587 Bacteria 4928
1142 Ga0501076_0069483 3300049592 Bacteria 2814
1143 Ga0501206_002278 3300049653 Bacteria 2418
1144 Ga0501079_0144960 3300049741 Bacteria 1850
1145 Ga0501079_0355387 3300049741 Bacteria 1148
1146 Ga0501281_01138 3300049777 Bacteria 2134
1147 Ga0501035_0000030 3300049822 Bacteria 176511
1148 Ga0501035_0078387 3300049822 Bacteria 2919
1149 Ga0501226_000049 3300049853 Bacteria 53390
1150 nmdc:mga03683_64453_c1 3300050489 Bacteria 1555
1151 nmdc:mga03n38_13580_c1 3300050490 Bacteria 3099
1152 nmdc:mga0yw44_142413_c1 3300050492 Bacteria 1559
1153 nmdc:mga0yw44_62232_c1 3300050492 Bacteria 2292
1154 nmdc:mga0k408_183058_c1 3300050493 Bacteria 1250
1155 nmdc:mga0k408_184457_c1 3300050493 Bacteria 1244
1156 nmdc:mga0k408_21214_c1 3300050493 Bacteria 3647
1157 nmdc:mga0k408_62433_c1 3300050493 Bacteria 1695
1158 nmdc:mga06z11_145216_c1 3300050494 Bacteria 1344
1159 nmdc:mga07m45_19143_c1 3300050496 Bacteria 3705
1160 nmdc:mga05p37_212236_c1 3300050507 Bacteria 2340
1161 nmdc:mga05p37_556540_c1 3300050507 Bacteria 1304
1162 nmdc:mga09592_340295_c1 3300050508 Bacteria 1299
1163 nmdc:mga0qj67_11616_c1 3300050509 Bacteria 6604
1164 nmdc:mga0qj67_147321_c1 3300050509 Bacteria 1909
1165 nmdc:mga06r32_159119_c1 3300050510 Bacteria 2241
1166 nmdc:mga06r32_29227_c1 3300050510 Bacteria 5164
1167 nmdc:mga08y16_516157_c1 3300050511 Bacteria 1212
1168 nmdc:mga0n895_57493_c1 3300050512 Bacteria 3834
1169 nmdc:mga0n895_84257_c1 3300050512 Bacteria 3172
1170 nmdc:mga0rr50_130397_c1 3300050513 Bacteria 2012
1171 nmdc:mga0a205_111882_c1 3300050515 Bacteria 2630
1172 Ga0500646_0000571 3300053090 Bacteria 10592
1173 Ga0500562_003256 3300053108 Bacteria 4060
1174 Ga0500572_019073 3300053111 Bacteria 1786
1175 Ga0500593_003321 3300053117 Bacteria 6055
1176 Ga0500607_042054 3300053121 Bacteria 2468
1177 Ga0500655_019142 3300053133 Bacteria 1274
1178 Ga0500658_0012861 3300053134 Bacteria 3092
1179 Ga0500616_0035259 3300053153 Bacteria 2721
1180 Ga0500619_000123 3300053154 Bacteria 20368
1181 Ga0500627_0080704 3300053158 Bacteria 1450
1182 Ga0500637_0051278 3300053178 Bacteria 2351
1183 Ga0500645_000317 3300053730 Bacteria 34309
1184 Ga0500645_001087 3300053730 Bacteria 14925
1185 Ga0500645_041314 3300053730 Bacteria 1362
1186 Ga0501084_0164120 3300054114 Bacteria 1875
1187 Ga0590071_007143 3300059421 Bacteria 2645
1188 Ga0501082_0398668 3300060353 Bacteria 1201
1189 Ga0530510_0402880 3300061734 Bacteria 1031
1190 2511244704 2511231002 Bacteria 5042903
1191 2511252504 2511231004 Bacteria 6669789
1192 2511268451 2511231006 Bacteria 6794709
1193 2511272365 2511231007 Bacteria 6306603
1194 2511278616 2511231008 Bacteria 6624100
1195 2511292564 2511231010 Bacteria 6373152
1196 2511298781 2511231011 Bacteria 6149768
1197 2511299911 2511231012 Bacteria 6738011
1198 2511316474 2511231014 Bacteria 6462302
1199 2511320236 2511231015 Bacteria 6598026
1200 2511329390 2511231016 Bacteria 6704427
1201 2511334053 2511231017 Bacteria 6503007
1202 2511337248 2511231018 Bacteria 6436256
1203 2511344301 2511231019 Bacteria 6520662
1204 2511352123 2511231020 Bacteria 6115223
1205 2511357476 2511231021 Bacteria 7302637
1206 2511363912 2511231022 Bacteria 6719296
1207 2511370096 2511231023 Bacteria 6808468
1208 2511373919 2511231024 Bacteria 5835885
1209 2511416275 2511231031 Bacteria 6558529
1210 2511826242 2511231156 Bacteria 6845832
1211 2512324876 2512047018 Bacteria 6663241
1212 2513956161 2513237150 Bacteria 6553639
1213 2514045597 2513237165 Bacteria 6771773
1214 2583791002 2582580891 Bacteria 6800976
1215 2597856853 2597489887 Bacteria 6666321
1216 2597863066 2597489888 Bacteria 6179543
1217 2597868859 2597489889 Bacteria 6297495
1218 2599401648 2599185167 Bacteria 6353609
1219 2599451810 2599185179 Bacteria 6611171
1220 2599483880 2599185185 Bacteria 6652270
1221 2599504212 2599185188 Bacteria 6164180
1222 2599509585 2599185189 Bacteria 5862825
1223 2599514893 2599185190 Bacteria 6285678
1224 2599520990 2599185191 Bacteria 6297582
1225 2599613495 2599185212 Bacteria 6765997
1226 2599772401 2599185248 Bacteria 6696816
1227 2599801526 2599185257 Bacteria 6492581
1228 2599882240 2599185288 Bacteria 6666191
1229 2599888877 2599185289 Bacteria 6778765
1230 2599894310 2599185290 Bacteria 6289611
1231 2599900506 2599185291 Bacteria 6775623
1232 2599933527 2599185300 Bacteria 6062622
1233 2599944021 2599185302 Bacteria 5954930
1234 2599951520 2599185303 Bacteria 6512725
1235 2599955767 2599185304 Bacteria 5951361
1236 2599961402 2599185305 Bacteria 6748700
1237 2599967271 2599185306 Bacteria 6637356
1238 2599971604 2599185307 Bacteria 6194719
1239 2599979334 2599185308 Bacteria 6621546
1240 2599985568 2599185309 Bacteria 5969593
1241 2599989441 2599185310 Bacteria 6014457
1242 2599994364 2599185311 Bacteria 6354990
1243 2600000163 2599185312 Bacteria 5912071
1244 2600008394 2599185313 Bacteria 6658188
1245 2600013219 2599185314 Bacteria 6621749
1246 2600019656 2599185315 Bacteria 6771107
1247 2600023657 2599185316 Bacteria 6320029
1248 2600032540 2599185317 Bacteria 6435722
1249 2600039009 2599185318 Bacteria 6961590
1250 2600044213 2599185319 Bacteria 6637840
1251 2600048470 2599185320 Bacteria 5963263
1252 2600054166 2599185321 Bacteria 6764560
1253 2600060384 2599185322 Bacteria 6763055
1254 2600066522 2599185323 Bacteria 6688755
1255 2600073409 2599185324 Bacteria 6590677
1256 2600078168 2599185325 Bacteria 6324919
1257 2600361731 2600254930 Bacteria 6431253
1258 2600365823 2600254931 Bacteria 6734225
1259 2601625154 2600255283 Bacteria 6061572
1260 2601694223 2600255296 Bacteria 5784754
1261 2601795509 2600255318 Bacteria 6383414
1262 2606075579 2603880185 Bacteria 6379190
1263 2606128510 2603880199 Bacteria 6377649
1264 2624479446 2623620443 Bacteria 6427864
1265 2624493556 2623620446 Bacteria 6500345
1266 2643841744 2643221565 Bacteria 6216018
1267 2643865418 2643221570 Bacteria 5103772
1268 2643871837 2643221571 Bacteria 6228673
1269 2643933136 2643221585 Bacteria 5812563
1270 2643952582 2643221589 Bacteria 6250934
1271 2644022344 2643221602 Bacteria 6249926
1272 2644187141 2643221633 Bacteria 6733554
1273 2644243854 2643221644 Bacteria 6865017
1274 2644286115 2643221650 Bacteria 7029547
1275 2644296125 2643221652 Bacteria 5140275
1276 2644314385 2643221656 Bacteria 5809961
1277 2644340172 2643221660 Bacteria 4208257
1278 2644623110 2643221713 Bacteria 6554480
1279 2652548286 2651869719 Bacteria 6047974
1280 2671093167 2667528170 Bacteria 6786960
1281 2671128966 2667528176 Bacteria 6724917
1282 2671768475 2671180172 Bacteria 6495783
1283 2678264583 2675903515 Bacteria 6580491
1284 2687579268 2687453129 Bacteria 4387428
1285 2715753840 2713897148 Bacteria 5883533
1286 2715757712 2713897149 Bacteria 6506249
1287 2718633293 2718217725 Bacteria 5758958
1288 2723247884 2721755607 Bacteria 5841722
1289 2738810893 2738541294 Bacteria 6925949
1290 2738898253 2738541309 Bacteria 6926455
1291 2739055687 2738541337 Bacteria 6183410
1292 2739200868 2738543004 Bacteria 6381073
1293 2739261120 2738543015 Bacteria 6750701
1294 2739316009 2738543025 Bacteria 6600348
1295 2743736281 2740892503 Bacteria 6855563
1296 2745005037 2744054620 Bacteria 6551379
1297 2774122890 2773857670 Bacteria 6407454
1298 2774137604 2773857673 Bacteria 6513460
1299 2784265647 2784132063 Bacteria 6262788
1300 2784315248 2784132072 Bacteria 6596533
1301 2794595102 2791355520 Bacteria 5948615
1302 2808857035 2808606361 Bacteria 6136259
1303 2808926980 2808606376 Bacteria 6248667
1304 2808927374 2808606377 Bacteria 6646337
1305 2808937107 2808606378 Bacteria 6177535
1306 2808940147 2808606379 Bacteria 5022697
1307 2808949086 2808606380 Bacteria 6248705
1308 2808950087 2808606381 Bacteria 6646461
1309 2808965423 2808606383 Bacteria 6138645
1310 2808979394 2808606385 Bacteria 6711065
1311 2808995318 2808606388 Bacteria 6706662
1312 2809000336 2808606389 Bacteria 6138126
1313 2812370100 2811994881 Bacteria 6298475
1314 2819653999 2818991456 Bacteria 6123676
1315 2825656473 2825651385 Bacteria 6715909
1316 2834029716 2834028612 Bacteria 6354979
1317 2839142910 2839138175 Bacteria 6549354
1318 2842832198 2842826826 Bacteria 5974129
1319 2842832683 2842832357 Bacteria 5959113
1320 2842841510 2842837860 Bacteria 6066181
1321 2842848232 2842843487 Bacteria 6004777
1322 2842856860 2842854478 Bacteria 6143501
1323 2852618401 2852612431 Bacteria 6885235
1324 2852658930 2852657418 Bacteria 6472974
1325 2852673463 2852667396 Bacteria 6885555
1326 2858951017 2858950400 Bacteria 6783797
1327 2860340011 2860339153 Bacteria 6846989
1328 2860869710 2860867994 Bacteria 5645326
1329 2878031449 2878029506 Bacteria 6418441
1330 2880232320 2880230671 Bacteria 6140320
1331 2881105274 2881101125 Bacteria 4590519
1332 2894416965 2894414249 Bacteria 4405451
1333 2904521789 2904518522 Bacteria 6068986
1334 2904553185 2904550169 Bacteria 6221258
1335 2908448650 2908446538 Bacteria 6829095
1336 2913041060 2913036834 Bacteria 6704877
1337 2919064080 2919063839 Bacteria 6302690
1338 2919386413 2919385768 Bacteria 5897293
1339 2919457103 2919456309 Bacteria 6586567
1340 2919486182 2919481497 Bacteria 6907839
1341 2919491304 2919487758 Bacteria 5929766
1342 2919702857 2919697872 Bacteria 6553725
1343 2923155295 2923153595 Bacteria 6870622
1344 2923524190 2923519811 Bacteria 6298479
1345 2923590096 2923586266 Bacteria 6565975
1346 2929148560 2929144301 Bacteria 6622272
1347 2929191683 2929189879 Bacteria 5930554
1348 2931373998 2931369376 Bacteria 6847892
1349 2931392785 2931390751 Bacteria 6273349
1350 2931400098 2931396565 Bacteria 7251677
1351 2939639732 2939636861 Bacteria 6297853
1352 2941481807
1353 2945928884 2945928738 Bacteria 6053221
1354 2945965146 2945961074 Bacteria 7342064
1355 2946011086 2946006987 Bacteria 6705746
1356 2946029966 2946027586 Bacteria 6049274
1357 2947236538 2947233263 Bacteria 6439278
1358 2969306232 2969304461 Bacteria 6601805
1359 2974292113 2974289157 Bacteria 6080362
1360 2984290743 2984286254 Bacteria 6702062
1361 2988730153 2988728565 Bacteria 6124362
1362 2998141628 2998139840 Bacteria 6073514
1363 3007400835 3007395558 Bacteria 6755444
1364 3007513026 3007511990 Bacteria 6481491
1365 3007616408 3007614139 Bacteria 6053559
1366 3007622334 3007619802 Bacteria 6411688
1367 3007723317 3007718800 Bacteria 5971527
1368 3007856219 3007855910 Bacteria 5637581
1369 3007863133 3007861166 Bacteria 6045338
1370 3007868030 3007866637 Bacteria 5899198
1371 644751928 644736347 Bacteria 6476522
1372 8015689513 8015687852 Bacteria 6613826
1373 8019774078 8019769354 Bacteria 6924660
1374 8019780262 8019775933 Bacteria 6858656
1375 8021623401 8021622325 Bacteria 4844743
1376 8021628813 8021626552 Bacteria 4665214
1377 8029999128 8029995093 Bacteria 5990776
1378 8054287239 8054285046 Bacteria 6919322
1379 8054352141 8054347763 Bacteria 5901107
1380 8054505286 8054503363 Bacteria 6101651
1381 8055772650 8055770955 Bacteria 6827675
1382 8055819844 8055817908 Bacteria 6609162
1383 8056130176 8056125926 Bacteria 6228218
1384 8056133609 8056131705 Bacteria 6107031
1385 8056144816 8056143049 Bacteria 6307666
1386 8056150518 8056148874 Bacteria 6479865
1387 8056156221 8056155041 Bacteria 6486948
1388 8056165033 8056161164 Bacteria 6106669
1389 8056169363 8056166840 Bacteria 5820959
1390 8056175548 8056172158 Bacteria 6133900
1391 8056181154 8056177738 Bacteria 6748268
1392 8056573216 8056569372 Bacteria 5997322
1393 8057799078 8057798959 Bacteria 6713499
1394 Ga0495583_0002918
1395 MRS2a_Contig_319
1396 SwRhRL2b_contig_14979
1397 JGI25155J39150_1000098
1398 JGI25156J39149_1000163
1399 JGI25154J39366_1000183
1400 JGI25154J39366_1002797
1401 JGI25157J39369_1000209
1402 JGI25159J45721_1009212
1403 JGI25151J46595_10007415
1404 JGI25160J50197_1000212
1405 JGI25161J50226_1000151
1406 Ga0055538_1000058
1407 Ga0055539_1000087
1408 Ga0055533_1000097
1409 Ga0055532_1000156
1410 Ga0055525_1000428
1411 Ga0055526_1000665
1412 Ga0055526_1006387
1413 Ga0055526_1006416
1414 Ga0055537_1000005
1415 Ga0055537_1000709
1416 Ga0055524_1000082
1417 Ga0055524_1001237
1418 Ga0055536_1001960
1419 Ga0055536_1008459
1420 Ga0055534_1000493
1421 Ga0055534_1003222
1422 Ga0055528_1000082
1423 Ga0055528_1002394
1424 Ga0055530_10000357
1425 Ga0055530_10000688
1426 Ga0055530_10002633
1427 Ga0055540_1000010
1428 Ga0055540_1000014
1429 Ga0055540_1000076
1430 Ga0055540_1000253
1431 Ga0055540_1001210
1432 Ga0055531_10000769
1433 Ga0055531_10001153
1434 Ga0055531_10021777
1435 Ga0055541_1000060
1436 Ga0055543_1000526
1437 Ga0065165_1010723
1438 Ga0065165_1011785
1439 Ga0065165_1018022
1440 Ga0065714_10005879
1441 Ga0065714_10007382
1442 Ga0065714_10023056
1443 Ga0065714_10066205
1444 Ga0065714_10066523
1445 Ga0065704_10103302
1446 Ga0065704_10146264
1447 Ga0065704_10231731
1448 Ga0065712_10000624
1449 Ga0065712_10002139
1450 Ga0065712_10069768
1451 Ga0065715_10097314
1452 Ga0070676_10019903
1453 Ga0070683_100114202
1454 Ga0070690_100255831
1455 Ga0070670_100000573
1456 Ga0070670_100001103
1457 Ga0070670_100019134
1458 Ga0070670_100078619
1459 Ga0070670_100268858
1460 Ga0068869_100022441
1461 Ga0070666_10005190
1462 Ga0068868_100139270
1463 Ga0070661_100000029
1464 Ga0070669_100019134
1465 Ga0070669_100125513
1466 Ga0070669_100155027
1467 Ga0070669_100160965
1468 Ga0070675_100025997
1469 Ga0070675_100071088
1470 Ga0070671_100011056
1471 Ga0070671_100153324
1472 Ga0070674_100081819
1473 Ga0070674_100114468
1474 Ga0070673_100008668
1475 Ga0070688_100038778
1476 Ga0070659_100000877
1477 Ga0070678_100014404
1478 Ga0070678_100021363
1479 Ga0070662_100004039
1480 Ga0070662_100051420
1481 Ga0070662_100081568
1482 Ga0068867_100135231
1483 Ga0070685_10040301
1484 Ga0070706_100422077
1485 Ga0070707_100248249
1486 Ga0070679_100128294
1487 Ga0070684_100198280
1488 Ga0068853_100019145
1489 Ga0070672_100051800
1490 Ga0070672_100132531
1491 Ga0070695_100013037
1492 Ga0070664_100000046
1493 Ga0070664_100009920
1494 Ga0070664_100378919
1495 Ga0068857_100463531
1496 Ga0068854_100003507
1497 Ga0068859_100027466
1498 Ga0068859_100428626
1499 Ga0068864_100003420
1500 Ga0068866_10010526
1501 Ga0068861_100016003
1502 Ga0068861_100333011
1503 Ga0068851_10000050
1504 Ga0068851_10022967
1505 Ga0068863_100002555
1506 Ga0068863_100043982
1507 Ga0068858_100010086
1508 Ga0068858_100010413
1509 Ga0068858_100082497
1510 Ga0068860_100412779
1511 Ga0068860_100417924
1512 Ga0068862_100057800
1513 Ga0081455_10023769
1514 Ga0070717_10192879
1515 Ga0075365_10001663
1516 Ga0075363_100012995
1517 Ga0075363_100124350
1518 Ga0075363_100166680
1519 Ga0075364_10210962
1520 Ga0075364_10238757
1521 Ga0075432_10045718
1522 Ga0075362_10015018
1523 Ga0075362_10060855
1524 Ga0075362_10151221
1525 Ga0075369_10110775
1526 Ga0075366_10012451
1527 Ga0075366_10059694
1528 Ga0075366_10084264
1529 Ga0068871_100053445
1530 Ga0075428_100070983
1531 Ga0075430_100028327
1532 Ga0075430_100029379
1533 Ga0075431_100194929
1534 Ga0075433_10206265
1535 Ga0075434_100007145
1536 Ga0075434_100228445
1537 Ga0075429_100131261
1538 Ga0068865_100037755
1539 Ga0068865_100092987
1540 Ga0075436_100106412
1541 Ga0075436_100185608
1542 Ga0097620_100027466
1543 Ga0097620_100428610
1544 Ga0079104_1000013
1545 Ga0079104_1000438
1546 Ga0079104_1002086
1547 Ga0079104_1013864
1548 Ga0075435_100022552
1549 Ga0075435_100068148
1550 Ga0075435_100077609
1551 Ga0075435_100142506
1552 Ga0105251_10003624
1553 Ga0105251_10007394
1554 Ga0105251_10015196
1555 Ga0105251_10070773
1556 Ga0105244_10000632
1557 Ga0105244_10001388
1558 Ga0105244_10005166
1559 Ga0105244_10008699
1560 Ga0105244_10025168
1561 Ga0105244_10117166
1562 Ga0105244_10130581
1563 Ga0105250_10001902
1564 Ga0105250_10002234
1565 Ga0105250_10070763
1566 Ga0105250_10075441
1567 Ga0105240_10001650
1568 Ga0111539_10090021
1569 Ga0111539_10311619
1570 Ga0114129_10585770
1571 Ga0105243_10000158
1572 Ga0105242_10005191
1573 Ga0105242_10029447
1574 Ga0105248_10039796
1575 Ga0105237_10001262
1576 Ga0105237_10001445
1577 Ga0105239_10003184
1578 Ga0105246_10002056
1579 Ga0105246_10002917
1580 Ga0157345_1000315
1581 Ga0157373_10008336
1582 Ga0157373_10036295
1583 Ga0157373_10038710
1584 Ga0157373_10073683
1585 Ga0157373_10126229
1586 Ga0157371_10000003
1587 Ga0157371_10008703
1588 Ga0157371_10035808
1589 Ga0157370_10014439
1590 Ga0157370_10033631
1591 Ga0157370_10148550
1592 Ga0157370_10154564
1593 Ga0157369_10002431
1594 Ga0157369_10017719
1595 Ga0157369_10359308
1596 Ga0157369_10389948
1597 Ga0157369_10521987
1598 Ga0157378_10134728
1599 Ga0163162_10007458
1600 Ga0163162_10041733
1601 Ga0163162_10080883
1602 Ga0163162_10118081
1603 Ga0163162_10209402
1604 Ga0163162_10252735
1605 Ga0157372_10248323
1606 Ga0157375_10005173
1607 Ga0157375_10029502
1608 Ga0157375_10352996
1609 Ga0157375_10504861
1610 Ga0163163_10029028
1611 Ga0157380_10167625
1612 Ga0182008_10007753
1613 Ga0182008_10027899
1614 Ga0182008_10031040
1615 Ga0182008_10048085
1616 Ga0182008_10052853
1617 Ga0157379_10008130
1618 Ga0157379_10027378
1619 Ga0157376_10017549
1620 Ga0182006_1001026
1621 Ga0182006_1018698
1622 Ga0182006_1035530
1623 Ga0182007_10000638
1624 Ga0182005_1015155
1625 Ga0182005_1038132
1626 Ga0163161_10006835
1627 Ga0163161_10011701
1628 Ga0163161_10046047
1629 Ga0163161_10061272
1630 Ga0163161_10085719
1631 Ga0209435_100010
1632 Ga0209435_103802
1633 Ga0209784_100040
1634 Ga0209566_100051
1635 Ga0209674_100072
1636 Ga0209147_100067
1637 Ga0209563_100073
1638 Ga0209563_100854
1639 Ga0209437_101937
1640 Ga0209258_100548
1641 Ga0209646_1000001
1642 Ga0209646_1000455
1643 Ga0209026_1000001
1644 Ga0209677_100063
1645 Ga0209759_1000001
1646 Ga0209759_1005333
1647 Ga0209565_1000036
1648 Ga0209565_1000074
1649 Ga0209565_1000226
1650 Ga0209673_1000129
1651 Ga0209673_1000282
1652 Ga0209130_1000016
1653 Ga0209130_1000042
1654 Ga0209130_1000255
1655 Ga0209675_1000072
1656 Ga0209675_1000289
1657 Ga0209675_1003625
1658 Ga0209676_1000007
1659 Ga0209676_1000016
1660 Ga0209676_1000021
1661 Ga0209676_1000033
1662 Ga0209676_1002600
1663 Ga0209676_1010192
1664 Ga0209025_1002347
1665 Ga0209025_1006388
1666 Ga0209025_1017511
1667 Ga0209564_1000160
1668 Ga0209564_1002324
1669 Ga0209564_1004446
1670 Ga0209050_1000003
1671 Ga0209050_1000036
1672 Ga0209050_1000235
1673 Ga0209050_1000595
1674 Ga0209050_1001021
1675 Ga0209050_1003407
1676 Ga0209050_1004120
1677 Ga0209050_1024161
1678 Ga0209256_1000001
1679 Ga0209256_1000018
1680 Ga0209256_1000125
1681 Ga0209256_1013724
1682 Ga0207426_1000097
1683 Ga0209051_1000003
1684 Ga0209051_1000035
1685 Ga0209051_1000043
1686 Ga0209051_1000123
1687 Ga0209051_1000407
1688 Ga0209257_1000020
1689 Ga0209257_1000098
1690 Ga0209257_1000212
1691 Ga0209257_1005878
1692 Ga0207697_10000220
1693 Ga0207656_10001101
1694 Ga0207696_1000101
1695 Ga0207696_1000171
1696 Ga0207696_1002789
1697 Ga0207696_1007872
1698 Ga0207696_1011534
1699 Ga0207696_1037960
1700 Ga0207696_1052225
1701 Ga0207655_1000337
1702 Ga0207655_1003684
1703 Ga0207655_1005276
1704 Ga0207655_1011381
1705 Ga0207655_1013741
1706 Ga0207655_1017394
1707 Ga0207655_1018323
1708 Ga0207713_1000802
1709 Ga0207713_1002825
1710 Ga0207713_1003131
1711 Ga0207713_1009471
1712 Ga0207713_1009538
1713 Ga0207713_1010269
1714 Ga0207713_1086620
1715 Ga0207713_1086738
1716 Ga0207642_10006922
1717 Ga0207688_10004358
1718 Ga0207680_10011100
1719 Ga0207645_10130324
1720 Ga0207695_10016073
1721 Ga0207671_10000287
1722 Ga0207649_10000068
1723 Ga0207649_10003248
1724 Ga0207652_10253097
1725 Ga0207681_10002569
1726 Ga0207681_10097126
1727 Ga0207681_10127731
1728 Ga0207681_10139514
1729 Ga0207681_10372830
1730 Ga0207650_10000174
1731 Ga0207650_10008848
1732 Ga0207650_10012734
1733 Ga0207650_10232607
1734 Ga0207659_10109989
1735 Ga0207644_10124839
1736 Ga0207644_10248650
1737 Ga0207690_10001532
1738 Ga0207706_10000922
1739 Ga0207706_10075851
1740 Ga0207706_10099295
1741 Ga0207706_10237085
1742 Ga0207686_10017447
1743 Ga0207709_10000053
1744 Ga0207669_10356956
1745 Ga0207704_10346260
1746 Ga0207691_10026593
1747 Ga0207691_10299868
1748 Ga0207711_10067832
1749 Ga0207689_10099171
1750 Ga0207679_10000018
1751 Ga0207679_10004446
1752 Ga0207679_10008172
1753 Ga0207679_10193045
1754 Ga0207712_10042768
1755 Ga0207668_10119423
1756 Ga0207658_10031163
1757 Ga0207677_10011601
1758 Ga0207703_10004144
1759 Ga0207703_10036290
1760 Ga0207703_10052729
1761 Ga0207639_10013755
1762 Ga0207708_10411315
1763 Ga0207641_10030385
1764 Ga0207648_10045149
1765 Ga0207648_10087817
1766 Ga0207648_10247301
1767 Ga0207676_10010742
1768 Ga0207674_10441810
1769 Ga0207675_100250547
1770 Ga0207675_100642112
1771 Ga0207683_10013834
1772 Ga0209281_1000010
1773 Ga0209281_1000174
1774 Ga0209281_1000182
1775 Ga0209281_1006015
1776 Ga0209281_1009339
1777 Ga0209281_1015382
1778 Ga0209983_1005427
1779 Ga0209813_10011558
1780 Ga0207428_10022532
1781 Ga0207428_10026314
1782 Ga0207428_10293724
1783 Ga0268266_10443246
1784 Ga0268265_10534114
1785 Ga0268264_10189503
1786 Ga0268264_10528707
1787 Ga0307517_10039962
1788 Ga0307517_10173128
1789 Ga0307515_10000049
1790 Ga0307515_10000066
1791 Ga0307515_10002144
1792 Ga0307515_10003679
1793 Ga0307515_10103124
1794 Ga0307515_10201864
1795 Ga0307511_10000570
1796 Ga0316177_1052986
1797 Ga0316177_1092213
1798 Ga0316178_1101335
1799 Ga0316178_1171693
1800 Ga0316183_1029553
1801 Ga0316182_1057930
1802 Ga0265330_10000117
1803 Ga0265332_10000002
1804 Ga0307513_10000011
1805 Ga0307513_10000017
1806 Ga0307513_10015421
1807 Ga0307513_10105803
1808 Ga0307509_10089054
1809 Ga0307509_10205301
1810 Ga0307408_100000192
1811 Ga0307408_100002500
1812 Ga0307408_100004501
1813 Ga0307408_100023415
1814 Ga0307408_100030906
1815 Ga0307408_100040364
1816 Ga0307408_100079093
1817 Ga0307408_100437521
1818 Ga0307514_10030795
1819 Ga0265314_10000012
1820 Ga0307516_10000181
1821 Ga0307516_10008542
1822 Ga0307516_10012117
1823 Ga0307405_10006315
1824 Ga0307405_10017084
1825 Ga0307405_10017531
1826 Ga0307405_10294770
1827 Ga0307413_10002620
1828 Ga0307413_10003279
1829 Ga0307413_10141520
1830 Ga0307410_10013563
1831 Ga0307410_10033020
1832 Ga0307406_10001571
1833 Ga0307406_10018088
1834 Ga0307406_10022392
1835 Ga0307406_10024745
1836 Ga0307406_10180986
1837 Ga0307407_10023389
1838 Ga0307407_10086114
1839 Ga0307407_10239394
1840 Ga0307412_10002180
1841 Ga0307412_10010694
1842 Ga0307412_10022143
1843 Ga0307412_10028003
1844 Ga0307412_10030893
1845 Ga0307412_10038935
1846 Ga0307412_10265558
1847 Ga0307409_100115891
1848 Ga0307409_100129790
1849 Ga0307409_100196064
1850 Ga0307416_100003739
1851 Ga0307416_100009114
1852 Ga0307416_100055914
1853 Ga0307416_100227710
1854 Ga0307416_100239015
1855 Ga0307416_100358238
1856 Ga0307414_10018101
1857 Ga0307414_10059744
1858 Ga0307414_10112271
1859 Ga0307414_10144358
1860 Ga0307411_10002390
1861 Ga0307411_10019865
1862 Ga0307415_100153792
1863 Ga0307510_10013786
1864 Ga0373962_0015463
1865 Ga0316574_0162091
1866 Ga0395900_0058760
1867 Ga0395905_0000111
1868 Ga0395905_0029270
1869 Ga0395901_0063836
1870 Ga0400490_23266
1871 Ga0400483_004246
1872 Ga0439438_006773
1873 Ga0439438_009999
1874 Ga0439438_018822
1875 Ga0439438_019241
1876 Ga0439438_019362
1877 Ga0439438_035933
1878 Ga0439447_002850
1879 Ga0439447_004045
1880 Ga0439447_005181
1881 Ga0439447_009617
1882 Ga0439447_018024
1883 Ga0439447_020625
1884 Ga0439447_022230
1885 Ga0439447_029292
1886 Ga0439461_0034830
1887 Ga0439466_0000181
1888 Ga0439466_0000878
1889 Ga0439466_0011728
1890 Ga0439466_0025721
1891 Ga0439466_0028124
1892 Ga0439466_0051725
1893 Ga0451843_0113517
1894 Ga0439431_0010778
1895 Ga0439437_001194
1896 Ga0439441_006369
1897 Ga0439432_008171
1898 Ga0439432_009089
1899 Ga0439432_009917
1900 Ga0439432_012801
1901 Ga0439432_023065
1902 Ga0439449_0045091
1903 Ga0439451_002573
1904 Ga0439451_004203
1905 Ga0439451_004767
1906 Ga0439451_006596
1907 Ga0439451_011164
1908 Ga0439451_013491
1909 Ga0439451_019924
1910 Ga0439451_033717
1911 Ga0439452_001154
1912 Ga0439452_002037
1913 Ga0439452_003486
1914 Ga0439452_012323
1915 Ga0439452_022880
1916 Ga0439452_023025
1917 Ga0439452_036678
1918 Ga0439456_001653
1919 Ga0439456_002975
1920 Ga0439456_004070
1921 Ga0439462_0014323
1922 Ga0439463_000119
1923 Ga0439463_000135
1924 Ga0439463_030801
1925 Ga0439463_044257
1926 Ga0450911_000011
1927 Ga0450911_000708
1928 Ga0450911_004672
1929 Ga0450911_007344
1930 Ga0450919_002168
1931 Ga0450920_004432
1932 Ga0450922_003964
1933 Ga0450888_000889
1934 Ga0450890_008503
1935 Ga0450891_000402
1936 Ga0450892_000986
1937 Ga0450896_002601
1938 Ga0450902_023057
1939 Ga0450903_003483
1940 Ga0450903_008066
1941 Ga0450903_015663
1942 Ga0450904_000171
1943 Ga0450904_000482
1944 Ga0450904_003954
1945 Ga0450889_000148
1946 Ga0450906_003185
1947 Ga0450906_008030
1948 Ga0450907_001074
1949 Ga0450907_003459
1950 Ga0450910_000426
1951 Ga0439446_0000636
1952 Ga0439446_0004080
1953 Ga0439446_0006845
1954 Ga0450908_001481
1955 Ga0450908_002124
1956 Ga0450908_010504
1957 Ga0450909_005842
1958 Ga0439434_0001856
1959 Ga0439434_0005608
1960 Ga0439434_0009004
1961 Ga0439444_0000913
1962 Ga0439459_0005479
1963 Ga0450916_003055
1964 Ga0450918_000109
1965 Ga0450918_015318
1966 Ga0451577_0012487
1967 Ga0451577_0023296
1968 Ga0451577_0037186
1969 Ga0451577_0112001
1970 Ga0451577_0172106
1971 Ga0451577_0176352
1972 Ga0439440_0007687
1973 Ga0453683_0026029
1974 Ga0453684_0003069
1975 Ga0453684_0003996
1976 Ga0453684_0020726
1977 Ga0453684_0072068
1978 Ga0453684_0128380
1979 Ga0453684_0252937
1980 Ga0451576_0002831
1981 Ga0451576_0111991
1982 Ga0451576_0239496
1983 Ga0495617_019836
1984 Ga0495617_023783
1985 Ga0495617_024908
1986 Ga0495617_028646
1987 Ga0495617_029283
1988 Ga0495617_029611
1989 Ga0495617_033153
1990 Ga0495617_057170
1991 Ga0495617_067354
1992 Ga0495617_085955
1993 Ga0495627_002318
1994 Ga0495627_004002
1995 Ga0495627_010270
1996 Ga0495627_026933
1997 Ga0495627_027411
1998 Ga0495627_036353
1999 Ga0495627_038050
2000 Ga0495603_0027657
2001 Ga0495590_0003405
2002 Ga0495590_0008242
2003 Ga0495590_0009528
2004 Ga0495590_0028023
2005 Ga0495590_0049105
2006 Ga0495590_0051499
2007 Ga0495590_0081857
2008 Ga0495591_001049
2009 Ga0495591_001222
2010 Ga0495591_001953
2011 Ga0495591_002999
2012 Ga0495591_005577
2013 Ga0495591_005915
2014 Ga0495591_009977
2015 Ga0495591_013325
2016 Ga0495591_027665
2017 Ga0495591_030174
2018 Ga0495591_030882
2019 Ga0495591_031551
2020 Ga0495629_0034536
2021 Ga0495638_0006643
2022 Ga0495638_0024554
2023 Ga0495638_0027492
2024 Ga0495638_0035616
2025 Ga0495638_0083513
2026 Ga0495638_0087119
2027 Ga0495638_0095491
2028 Ga0495638_0097759
2029 Ga0495638_0099920
2030 Ga0495638_0128172
2031 Ga0495638_0136809
2032 Ga0495638_0185634
2033 Ga0495653_0008829
2034 Ga0495653_0025056
2035 Ga0495653_0108020
2036 Ga0495653_0112090
2037 Ga0495650_0002465
2038 Ga0495650_0003436
2039 Ga0495650_0010955
2040 Ga0495650_0013666
2041 Ga0495650_0022548
2042 Ga0495650_0028780
2043 Ga0495650_0041139
2044 Ga0495650_0042867
2045 Ga0495650_0048023
2046 Ga0495650_0100254
2047 Ga0495580_0100897
2048 Ga0495582_0047131
2049 Ga0495605_0000047
2050 Ga0495605_0000525
2051 Ga0495605_0001790
2052 Ga0495605_0008617
2053 Ga0495605_0011610
2054 Ga0495605_0017163
2055 Ga0495605_0044607
2056 Ga0495605_0054700
2057 Ga0495605_0075118
2058 Ga0495605_0075212
2059 Ga0495605_0113736
2060 Ga0495639_0001026
2061 Ga0495639_0071088
2062 Ga0495584_0001531
2063 Ga0495584_0003735
2064 Ga0495584_0007445
2065 Ga0495584_0015983
2066 Ga0495584_0021347
2067 Ga0495584_0044491
2068 Ga0495584_0061946
2069 Ga0495584_0070071
2070 Ga0495584_0091037
2071 Ga0495584_0091912
2072 Ga0495584_0094908
2073 Ga0495584_0120432
2074 Ga0495584_0169546
2075 Ga0495585_0013265
2076 Ga0495585_0019151
2077 Ga0495585_0053223
2078 Ga0495585_0083924
2079 Ga0495585_0085043
2080 Ga0495585_0152444
2081 Ga0495585_0168582
2082 Ga0495594_0004782
2083 Ga0495594_0073151
2084 Ga0495596_0006850
2085 Ga0495607_0000518
2086 Ga0495607_0001826
2087 Ga0495607_0007371
2088 Ga0495607_0014071
2089 Ga0495607_0024198
2090 Ga0495607_0026676
2091 Ga0495607_0066827
2092 Ga0495607_0082877
2093 Ga0495607_0086801
2094 Ga0495607_0101485
2095 Ga0495607_0107687
2096 Ga0495607_0114217
2097 Ga0495607_0167903
2098 Ga0495583_0000951
2099 Ga0495583_0001288
2100 Ga0495583_0001564
2101 Ga0495583_0002315
2102 Ga0495583_0002664
2103 Ga0495583_0004641
2104 Ga0495583_0006143
2105 Ga0495583_0018121
2106 Ga0495583_0055618
2107 Ga0495583_0102065
2108 Ga0495583_0114801
2109 Ga0495606_0002715
2110 Ga0495606_0003285
2111 Ga0495606_0010009
2112 Ga0495606_0011802
2113 Ga0495606_0017361
2114 Ga0495606_0031867
2115 Ga0495606_0035263
2116 Ga0495606_0037596
2117 Ga0495606_0059532
2118 Ga0495606_0074370
2119 Ga0495606_0091936
2120 Ga0495606_0097531
2121 Ga0495606_0102749
2122 Ga0495606_0268418
2123 Ga0495610_0003261
2124 Ga0495610_0007060
2125 Ga0495610_0012127
2126 Ga0495610_0015116
2127 Ga0495610_0019253
2128 Ga0495610_0038888
2129 Ga0495610_0054135
2130 Ga0495610_0075903
2131 Ga0495616_0000033
2132 Ga0495616_0008301
2133 Ga0495616_0023442
2134 Ga0495616_0058108
2135 Ga0495616_0061381
2136 Ga0495616_0064861
2137 Ga0495616_0068188
2138 Ga0495616_0070593
2139 Ga0495616_0073691
2140 Ga0495616_0133589
2141 Ga0495620_0000681
2142 Ga0495620_0001574
2143 Ga0495620_0011570
2144 Ga0495620_0012675
2145 Ga0495620_0014528
2146 Ga0495620_0026268
2147 Ga0495620_0060649
2148 Ga0495620_0065810
2149 Ga0495620_0120619
2150 Ga0495620_0128980
2151 Ga0495628_0168181
2152 Ga0495630_0118884
2153 Ga0495630_0157972
2154 Ga0495630_0216928
2155 Ga0495631_0001379
2156 Ga0495631_0010993
2157 Ga0495631_0026556
2158 Ga0495631_0035984
2159 Ga0495631_0039815
2160 Ga0495632_0002239
2161 Ga0495632_0003625
2162 Ga0495632_0006548
2163 Ga0495632_0017079
2164 Ga0495632_0031914
2165 Ga0495632_0033618
2166 Ga0495632_0050118
2167 Ga0495632_0065258
2168 Ga0495632_0096566
2169 Ga0495637_0000023
2170 Ga0495637_0004072
2171 Ga0495637_0004257
2172 Ga0495637_0004633
2173 Ga0495637_0010319
2174 Ga0495637_0012773
2175 Ga0495637_0028282
2176 Ga0495637_0035117
2177 Ga0495637_0042348
2178 Ga0495637_0042746
2179 Ga0495637_0057426
2180 Ga0495637_0059388
2181 Ga0495637_0060850
2182 Ga0495643_0000235
2183 Ga0495643_0000451
2184 Ga0495643_0001781
2185 Ga0495643_0014368
2186 Ga0495643_0025994
2187 Ga0495643_0071193
2188 Ga0495643_0073032
2189 Ga0495643_0079763
2190 Ga0495643_0100339
2191 Ga0495644_0001359
2192 Ga0495644_0002908
2193 Ga0495644_0009130
2194 Ga0495644_0040652
2195 Ga0495644_0043757
2196 Ga0495648_0004435
2197 Ga0495648_0005762
2198 Ga0495648_0008617
2199 Ga0495648_0009743
2200 Ga0495648_0009845
2201 Ga0495648_0010619
2202 Ga0495648_0026685
2203 Ga0495648_0031678
2204 Ga0495648_0054260
2205 Ga0495648_0095077
2206 Ga0495648_0098748
2207 Ga0495648_0112459
2208 Ga0495648_0144430
2209 Ga0495666_0019229
2210 Ga0495666_0090307
2211 Ga0495642_0008536
2212 Ga0495642_0028383
2213 Ga0495642_0063907
2214 Ga0495642_0148367
2215 Ga0495654_0001312
2216 Ga0495654_0003008
2217 Ga0495654_0004908
2218 Ga0495654_0020326
2219 Ga0495654_0024046
2220 Ga0495654_0026361
2221 Ga0495654_0033398
2222 Ga0495654_0034346
2223 Ga0495654_0044581
2224 Ga0495654_0049305
2225 Ga0495654_0051260
2226 Ga0495654_0055371
2227 Ga0495654_0078104
2228 Ga0495586_0072220
2229 Ga0495587_0055720
2230 Ga0495587_0084286
2231 Ga0495609_0000382
2232 Ga0495609_0001328
2233 Ga0495609_0002035
2234 Ga0495609_0005136
2235 Ga0495609_0014758
2236 Ga0495609_0052750
2237 Ga0495609_0056639
2238 Ga0495609_0061996
2239 Ga0495609_0138019
2240 Ga0495597_0016484
2241 Ga0495597_0018121
2242 Ga0495597_0027613
2243 Ga0495597_0068053
2244 Ga0495597_0096166
2245 Ga0495645_0043791
2246 Ga0495622_0006120
2247 Ga0495622_0010777
2248 Ga0495622_0010996
2249 Ga0495622_0013903
2250 Ga0495633_0009405
2251 Ga0495633_0039348
2252 Ga0495633_0054711
2253 Ga0495656_0011229
2254 Ga0495656_0054518
2255 Ga0495668_0000066
2256 Ga0495668_0005069
2257 Ga0495668_0009434
2258 Ga0495668_0014429
2259 Ga0495668_0025042
2260 Ga0495668_0031471
2261 Ga0495668_0092989
2262 Ga0495668_0190762
2263 Ga0495634_0026595
2264 Ga0495611_0000527
2265 Ga0495611_0010917
2266 Ga0495611_0151232
2267 Ga0495625_0000010
2268 Ga0495625_0002580
2269 Ga0495625_0007460
2270 Ga0495625_0026691
2271 Ga0495625_0027685
2272 Ga0495625_0111279
2273 Ga0495625_0113679
2274 Ga0495625_0151186
2275 Ga0495635_0019671
2276 Ga0495635_0109674
2277 Ga0495659_0000614
2278 Ga0495659_0001072
2279 Ga0495659_0085846
2280 Ga0495661_0000020
2281 Ga0495661_0000921
2282 Ga0495661_0001245
2283 Ga0495661_0001424
2284 Ga0495661_0004872
2285 Ga0495661_0017999
2286 Ga0495661_0056510
2287 Ga0495661_0115603
2288 Ga0495661_0119371
2289 Ga0495661_0182405
2290 Ga0495588_0005616
2291 Ga0495588_0054920
2292 Ga0495588_0190885
2293 Ga0495623_0006486
2294 Ga0495646_0021966
2295 Ga0495646_0057628
2296 Ga0495658_0024110
2297 Ga0495658_0071621
2298 Ga0495624_0006539
2299 Ga0495670_0016034
2300 Ga0495670_0025293
2301 Ga0495670_0058910
2302 Ga0495670_0081399
2303 Ga0495670_0089607
2304 Ga0495671_0002927
2305 Ga0495671_0004947
2306 Ga0495671_0007405
2307 Ga0495671_0018971
2308 Ga0495671_0027600
2309 Ga0495671_0028703
2310 Ga0495671_0051154
2311 Ga0495671_0072055
2312 Ga0495671_0149436
2313 Ga0495671_0176581
2314 Ga0495649_0004409
2315 Ga0495649_0005345
2316 Ga0495649_0014263
2317 Ga0495649_0018067
2318 Ga0495649_0024187
2319 Ga0495649_0050987
2320 Ga0495649_0087976
2321 Ga0495649_0103686
2322 Ga0495649_0107459
2323 Ga0495649_0113667
2324 Ga0495589_0001332
2325 Ga0495589_0014607
2326 Ga0495589_0015859
2327 Ga0495589_0017326
2328 Ga0495589_0019891
2329 Ga0495589_0047166
2330 Ga0495589_0075007
2331 Ga0495589_0085508
2332 Ga0495660_0026859
2333 Ga0495660_0028851
2334 Ga0495660_0050171
2335 Ga0495660_0082336
2336 Ga0495660_0087342
2337 Ga0495660_0088460
2338 Ga0495660_0088816
2339 Ga0495660_0096355
2340 Ga0495660_0104168
2341 Ga0495660_0111802
2342 Ga0495660_0112872
2343 Ga0495660_0131961
2344 Ga0495581_0045650
2345 Ga0495581_0216606
2346 Ga0495604_0050490
2347 Ga0495604_0134098
2348 Ga0495636_0088058
2349 Ga0495674_0266698
2350 Ga0495672_0005482
2351 Ga0495672_0006681
2352 Ga0495672_0007497
2353 Ga0495672_0008863
2354 Ga0495672_0010510
2355 Ga0495672_0027464
2356 Ga0495672_0033848
2357 Ga0495672_0035859
2358 Ga0495672_0038422
2359 Ga0495672_0070992
2360 Ga0495672_0086782
2361 Ga0495672_0099618
2362 Ga0495672_0114758
2363 Ga0495676_0000002
2364 Ga0495676_0151655
2365 Ga0495680_0024002
2366 Ga0495680_0039068
2367 Ga0495680_0065992
2368 Ga0495683_0003171
2369 Ga0495683_0003249
2370 Ga0495683_0024108
2371 Ga0495683_0057374
2372 Ga0495683_0060985
2373 Ga0495683_0075946
2374 Ga0495683_0079047
2375 Ga0495683_0121438
2376 Ga0495687_007225
2377 Ga0495687_024579
2378 Ga0495687_042165
2379 Ga0495687_053744
2380 Ga0495687_077151
2381 Ga0495677_0000650
2382 Ga0495677_0020960
2383 Ga0495677_0090162
2384 Ga0495679_000126
2385 Ga0495679_001276
2386 Ga0495679_004444
2387 Ga0495679_028467
2388 Ga0495679_028925
2389 Ga0495679_029111
2390 Ga0495679_037703
2391 Ga0495679_039168
2392 Ga0495679_043219
2393 Ga0495673_0005373
2394 Ga0495673_0007959
2395 Ga0495673_0014503
2396 Ga0495673_0016649
2397 Ga0495673_0029101
2398 Ga0495673_0032526
2399 Ga0495673_0041555
2400 Ga0495673_0041818
2401 Ga0495673_0042449
2402 Ga0495673_0046611
2403 Ga0495673_0052205
2404 Ga0495673_0054042
2405 Ga0495673_0077987
2406 Ga0495681_0003096
2407 Ga0495681_0006229
2408 Ga0495681_0006544
2409 Ga0495681_0008618
2410 Ga0495681_0014387
2411 Ga0495681_0014892
2412 Ga0495681_0036974
2413 Ga0495681_0037159
2414 Ga0495681_0037976
2415 Ga0495681_0049938
2416 Ga0495681_0058808
2417 Ga0495681_0078938
2418 Ga0495681_0082499
2419 Ga0495686_0002019
2420 Ga0495686_0027444
2421 Ga0495686_0028552
2422 Ga0495686_0036418
2423 Ga0495686_0050482
2424 Ga0495686_0124526
2425 Ga0495686_0160304
2426 Ga0495686_0248139
2427 Ga0495593_0023986
2428 Ga0495593_0035478
2429 Ga0495593_0049143
2430 Ga0495602_0014404
2431 Ga0495614_0059153
2432 Ga0495626_0000007
2433 Ga0495626_0002967
2434 Ga0495626_0003463
2435 Ga0495626_0009973
2436 Ga0495626_0021019
2437 Ga0495626_0044378
2438 Ga0495626_0058650
2439 Ga0495626_0068898
2440 Ga0495626_0077102
2441 Ga0496102_0039674
2442 Ga0496102_0039685
2443 Ga0496102_0118982
2444 Ga0496103_0009900
2445 Ga0496103_0013678
2446 Ga0496104_0037906
2447 Ga0496106_0269835
2448 Ga0496108_0233135
2449 Ga0496110_0028872
2450 Ga0496110_0104451
2451 Ga0496113_0197086
2452 Ga0496114_0500498
2453 Ga0496116_0011263
2454 Ga0496116_0018629
2455 Ga0496116_0030573
2456 Ga0496116_0068022
2457 Ga0496116_0086629
2458 Ga0496117_0002615
2459 Ga0496117_0060972
2460 Ga0496117_0070653
2461 Ga0496117_0077206
2462 Ga0496117_0134198
2463 Ga0496118_0007860
2464 Ga0496118_0026123
2465 Ga0496118_0038784
2466 Ga0496118_0067109
2467 Ga0496118_0101749
2468 Ga0496118_0108001
2469 Ga0496119_0054262
2470 Ga0496119_0111054
2471 Ga0496120_0025786
2472 Ga0496120_0049142
2473 Ga0496120_0102175
2474 Ga0496121_0007632
2475 Ga0496121_0095663
2476 Ga0496121_0153244
2477 Ga0496122_0006870
2478 Ga0496122_0009750
2479 Ga0496122_0009960
2480 Ga0496122_0037125
2481 Ga0496122_0055660
2482 Ga0496122_0139048
2483 Ga0496122_0159736
2484 Ga0496122_0194429
2485 Ga0496123_0006780
2486 Ga0496123_0025924
2487 Ga0496123_0029048
2488 Ga0496123_0137870
2489 Ga0496124_0000125
2490 Ga0496124_0003286
2491 Ga0496124_0022394
2492 Ga0496124_0033558
2493 Ga0496124_0035843
2494 Ga0496124_0049764
2495 Ga0496124_0090780
2496 Ga0496124_0126651
2497 Ga0496124_0163497
2498 Ga0496125_0000011
2499 Ga0496125_0003246
2500 Ga0496125_0004490
2501 Ga0496125_0009991
2502 Ga0496125_0022908
2503 Ga0496125_0044334
2504 Ga0496125_0083993
2505 Ga0496125_0087170
2506 Ga0496125_0133183
2507 Ga0496125_0159105
2508 Ga0496125_0195797
2509 Ga0496126_0059046
2510 Ga0496126_0093713
2511 Ga0496126_0116638
2512 Ga0496126_0231402
2513 Ga0495678_006783
2514 Ga0495678_007143
2515 Ga0495678_019023
2516 Ga0495678_023986
2517 Ga0495678_040582
2518 Ga0495678_046826
2519 Ga0495678_048857
2520 Ga0495678_051151
2521 Ga0495678_053717
2522 Ga0495678_065771
2523 Ga0495678_082491
2524 Ga0495678_098546
2525 Ga0495682_0001194
2526 Ga0495682_0010234
2527 Ga0495682_0044936
2528 Ga0501032_0032467
2529 Ga0501034_0012375
2530 Ga0501036_0006094
2531 Ga0501039_0353924
2532 Ga0501042_0284943
2533 Ga0501048_0002402
2534 Ga0501071_0017634
2535 Ga0501076_0069483
2536 Ga0501206_002278
2537 Ga0501079_0144960
2538 Ga0501079_0355387
2539 Ga0501281_01138
2540 Ga0501035_0000030
2541 Ga0501035_0078387
2542 Ga0501226_000049
2543 nmdc:mga03683_64453_c1
2544 nmdc:mga03n38_13580_c1
2545 nmdc:mga0yw44_142413_c1
2546 nmdc:mga0yw44_62232_c1
2547 nmdc:mga0k408_183058_c1
2548 nmdc:mga0k408_184457_c1
2549 nmdc:mga0k408_21214_c1
2550 nmdc:mga0k408_62433_c1
2551 nmdc:mga06z11_145216_c1
2552 nmdc:mga07m45_19143_c1
2553 nmdc:mga05p37_212236_c1
2554 nmdc:mga05p37_556540_c1
2555 nmdc:mga09592_340295_c1
2556 nmdc:mga0qj67_11616_c1
2557 nmdc:mga0qj67_147321_c1
2558 nmdc:mga06r32_159119_c1
2559 nmdc:mga06r32_29227_c1
2560 nmdc:mga08y16_516157_c1
2561 nmdc:mga0n895_57493_c1
2562 nmdc:mga0n895_84257_c1
2563 nmdc:mga0rr50_130397_c1
2564 nmdc:mga0a205_111882_c1
2565 Ga0500646_0000571
2566 Ga0500562_003256
2567 Ga0500572_019073
2568 Ga0500593_003321
2569 Ga0500607_042054
2570 Ga0500655_019142
2571 Ga0500658_0012861
2572 Ga0500616_0035259
2573 Ga0500619_000123
2574 Ga0500627_0080704
2575 Ga0500637_0051278
2576 Ga0500645_000317
2577 Ga0500645_001087
2578 Ga0500645_041314
2579 Ga0501084_0164120
2580 Ga0590071_007143
2581 Ga0501082_0398668
2582 Ga0530510_0402880
2583 2511244704
2584 2511252504
2585 2511268451
2586 2511272365
2587 2511278616
2588 2511292564
2589 2511298781
2590 2511299911
2591 2511316474
2592 2511320236
2593 2511329390
2594 2511334053
2595 2511337248
2596 2511344301
2597 2511352123
2598 2511357476
2599 2511363912
2600 2511370096
2601 2511373919
2602 2511416275
2603 2511826242
2604 2512324876
2605 2513956161
2606 2514045597
2607 2583791002
2608 2597856853
2609 2597863066
2610 2597868859
2611 2599401648
2612 2599451810
2613 2599483880
2614 2599504212
2615 2599509585
2616 2599514893
2617 2599520990
2618 2599613495
2619 2599772401
2620 2599801526
2621 2599882240
2622 2599888877
2623 2599894310
2624 2599900506
2625 2599933527
2626 2599944021
2627 2599951520
2628 2599955767
2629 2599961402
2630 2599967271
2631 2599971604
2632 2599979334
2633 2599985568
2634 2599989441
2635 2599994364
2636 2600000163
2637 2600008394
2638 2600013219
2639 2600019656
2640 2600023657
2641 2600032540
2642 2600039009
2643 2600044213
2644 2600048470
2645 2600054166
2646 2600060384
2647 2600066522
2648 2600073409
2649 2600078168
2650 2600361731
2651 2600365823
2652 2601625154
2653 2601694223
2654 2601795509
2655 2606075579
2656 2606128510
2657 2624479446
2658 2624493556
2659 2643841744
2660 2643865418
2661 2643871837
2662 2643933136
2663 2643952582
2664 2644022344
2665 2644187141
2666 2644243854
2667 2644286115
2668 2644296125
2669 2644314385
2670 2644340172
2671 2644623110
2672 2652548286
2673 2671093167
2674 2671128966
2675 2671768475
2676 2678264583
2677 2687579268
2678 2715753840
2679 2715757712
2680 2718633293
2681 2723247884
2682 2738810893
2683 2738898253
2684 2739055687
2685 2739200868
2686 2739261120
2687 2739316009
2688 2743736281
2689 2745005037
2690 2774122890
2691 2774137604
2692 2784265647
2693 2784315248
2694 2794595102
2695 2808857035
2696 2808926980
2697 2808927374
2698 2808937107
2699 2808940147
2700 2808949086
2701 2808950087
2702 2808965423
2703 2808979394
2704 2808995318
2705 2809000336
2706 2812370100
2707 2819653999
2708 2825656473
2709 2834029716
2710 2839142910
2711 2842832198
2712 2842832683
2713 2842841510
2714 2842848232
2715 2842856860
2716 2852618401
2717 2852658930
2718 2852673463
2719 2858951017
2720 2860340011
2721 2860869710
2722 2878031449
2723 2880232320
2724 2881105274
2725 2894416965
2726 2904521789
2727 2904553185
2728 2908448650
2729 2913041060
2730 2919064080
2731 2919386413
2732 2919457103
2733 2919486182
2734 2919491304
2735 2919702857
2736 2923155295
2737 2923524190
2738 2923590096
2739 2929148560
2740 2929191683
2741 2931373998
2742 2931392785
2743 2931400098
2744 2939639732
2745 2941481807
2746 2945928884
2747 2945965146
2748 2946011086
2749 2946029966
2750 2947236538
2751 2969306232
2752 2974292113
2753 2984290743
2754 2988730153
2755 2998141628
2756 3007400835
2757 3007513026
2758 3007616408
2759 3007622334
2760 3007723317
2761 3007856219
2762 3007863133
2763 3007868030
2764 644751928
2765 8015689513
2766 8019774078
2767 8019780262
2768 8021623401
2769 8021628813
2770 8029999128
2771 8054287239
2772 8054352141
2773 8054505286
2774 8055772650
2775 8055819844
2776 8056130176
2777 8056133609
2778 8056144816
2779 8056150518
2780 8056156221
2781 8056165033
2782 8056169363
2783 8056175548
2784 8056181154
2785 8056573216
2786 8057799078

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05661

DUF808

Protein of unknown function (DUF808)

54

334

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3473 52 239
7xgf-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3348 58 239
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3302 52 239
7xgf-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3202 58 239
4py0-assembly1.cif.gz_A crystal structure of p2y12 receptor in complex with 2mesatp 0.2922 46 262
ID Description Score Start End Superfamily
af_A1Z9U2_489_682_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4528 13 246 1.20.1250.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4468 19 232 1.10.1760.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4408 13 258 1.20.1250.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4336 19 232 1.10.1760.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4292 13 258 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Y4UDK9-F1-model_v4 DUF808 family protein 0.9347 142 297 GO:0005886
AF-A0A560QN11-F1-model_v4 Uncharacterized protein DUF808 0.929 163 301 GO:0005886
AF-A0A2J4YGP3-F1-model_v4 DUF808 domain-containing protein 0.9264 47 295 GO:0005886
AF-A0A560QN11-F1-model_v4 Uncharacterized protein DUF808 0.9165 163 301 GO:0005886
AF-A0A3D0SKE9-F1-model_v4 DUF808 domain-containing protein 0.9108 55 194 GO:0005886

Map