F493665

General Info

Members Datasets Scaffolds Average Seq Length
1399 433 1399 211

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0816944|Ga0501035_0816944_10_693
Length 227
Sequence MLNESQIASGTAAMAERAIRVMLVDDHAVVRMGFRLLLQGTSDIKVTGEADNGEEAVRMYSEVRPQVVVMDISMPGIGGLEAIGRILAREPMARILVLSGHEDVMHARRVLKAGALGYLTKRSAPEALIQAIRQVHQGKTYLEPSIAQQLAVQQLAGEKSPVDMLSEKEFKVFLALARGKSVVEIAQTMSLSPRTVGTHLYNIKQKLGASNSAELAIIAIRAGLIEP

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
216 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
270 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
279 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
280 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
411 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
412 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
413 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
416 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
425 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0.07
Rhizoplane 2.57
Rhizosphere 90.42
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1014378 3300000546 Bacteria 844
2 JGI25152J39213_1004771 3300002773 Bacteria 4166
3 JGI25406J46586_10037638 3300003203 Bacteria 1742
4 rootH1_10060596 3300003323 Bacteria 3645
5 Ga0065712_10069674 3300005290 Bacteria 6904
6 Ga0065715_10132582 3300005293 Bacteria 1988
7 Ga0065707_10003345 3300005295 Bacteria 5308
8 Ga0065707_10032085 3300005295 Unclassified 1027
9 Ga0065707_10115899 3300005295 Bacteria 2253
10 Ga0070658_10566646 3300005327 Bacteria 983
11 Ga0070676_10015473 3300005328 Bacteria 4209
12 Ga0070676_10066124 3300005328 Bacteria 2160
13 Ga0070683_100094324 3300005329 Bacteria 2812
14 Ga0070683_100241146 3300005329 Bacteria 1719
15 Ga0070690_100000463 3300005330 Bacteria 20376
16 Ga0070690_100001163 3300005330 Bacteria 13532
17 Ga0070690_100002453 3300005330 Bacteria 9968
18 Ga0070670_100003232 3300005331 Bacteria 13458
19 Ga0070670_100011499 3300005331 Bacteria 7571
20 Ga0070670_100084458 3300005331 Bacteria 2728
21 Ga0070670_100102724 3300005331 Bacteria 2462
22 Ga0070677_10117647 3300005333 Bacteria 1196
23 Ga0070677_10226881 3300005333 Bacteria 915
24 Ga0068869_100000413 3300005334 Bacteria 23274
25 Ga0068869_100002150 3300005334 Bacteria 11850
26 Ga0068869_100006160 3300005334 Bacteria 7594
27 Ga0068869_100097450 3300005334 Bacteria 2220
28 Ga0068869_100138782 3300005334 Bacteria 1875
29 Ga0068869_100226422 3300005334 Bacteria 1484
30 Ga0068869_100331895 3300005334 Bacteria 1236
31 Ga0070666_10021006 3300005335 Bacteria 4227
32 Ga0070666_10050785 3300005335 Bacteria 2790
33 Ga0070666_10284602 3300005335 Unclassified 1175
34 Ga0070666_10309623 3300005335 Unclassified 1125
35 Ga0070680_100000328 3300005336 Bacteria 31767
36 Ga0070680_100034112 3300005336 Bacteria 4104
37 Ga0070680_100043549 3300005336 Bacteria 3646
38 Ga0070680_100073856 3300005336 Bacteria 2805
39 Ga0070680_100075179 3300005336 Bacteria 2781
40 Ga0070680_100096907 3300005336 Bacteria 2445
41 Ga0070680_100747050 3300005336 Bacteria 842
42 Ga0070680_100867436 3300005336 Bacteria 778
43 Ga0070682_100032450 3300005337 Bacteria 3167
44 Ga0070682_100041903 3300005337 Bacteria 2824
45 Ga0070682_100099358 3300005337 Bacteria 1918
46 Ga0070682_100431152 3300005337 Bacteria 1005
47 Ga0070682_100453223 3300005337 Bacteria 983
48 Ga0070682_100483663 3300005337 Bacteria 955
49 Ga0068868_100004564 3300005338 Bacteria 9722
50 Ga0068868_100004838 3300005338 Bacteria 9452
51 Ga0068868_100055054 3300005338 Bacteria 3137
52 Ga0068868_100087858 3300005338 Bacteria 2501
53 Ga0068868_100146683 3300005338 Bacteria 1941
54 Ga0068868_100270071 3300005338 Bacteria 1437
55 Ga0068868_100307108 3300005338 Bacteria 1349
56 Ga0070660_100168921 3300005339 Bacteria 1766
57 Ga0070660_100276766 3300005339 Bacteria 1373
58 Ga0070689_100000808 3300005340 Bacteria 19300
59 Ga0070689_100010778 3300005340 Bacteria 6529
60 Ga0070689_100050579 3300005340 Bacteria 3211
61 Ga0070689_100318636 3300005340 Unclassified 1298
62 Ga0070691_10108121 3300005341 Bacteria 1388
63 Ga0070691_10118108 3300005341 Bacteria 1333
64 Ga0070691_10372584 3300005341 Bacteria 798
65 Ga0070687_100006496 3300005343 Bacteria 4794
66 Ga0070661_100003991 3300005344 Bacteria 10147
67 Ga0070661_100026423 3300005344 Bacteria 4175
68 Ga0070661_100028573 3300005344 Bacteria 4022
69 Ga0070661_100335280 3300005344 Bacteria 1184
70 Ga0070661_100437490 3300005344 Bacteria 1039
71 Ga0070692_10003532 3300005345 Bacteria 6356
72 Ga0070692_10066941 3300005345 Bacteria 1905
73 Ga0070692_10254546 3300005345 Bacteria 1053
74 Ga0070668_100003501 3300005347 Bacteria 11576
75 Ga0070668_100004999 3300005347 Bacteria 9821
76 Ga0070668_100059691 3300005347 Bacteria 2952
77 Ga0070668_100590941 3300005347 Bacteria 970
78 Ga0070669_100036698 3300005353 Bacteria 3553
79 Ga0070669_100083269 3300005353 Bacteria 2385
80 Ga0070669_100612518 3300005353 Bacteria 913
81 Ga0070669_100794685 3300005353 Bacteria 804
82 Ga0070675_100000822 3300005354 Bacteria 21910
83 Ga0070671_100000211 3300005355 Bacteria 38816
84 Ga0070671_100080314 3300005355 Bacteria 2727
85 Ga0070671_100175490 3300005355 Bacteria 1813
86 Ga0070674_100032815 3300005356 Bacteria 3451
87 Ga0070674_100040003 3300005356 Bacteria 3169
88 Ga0070674_100067519 3300005356 Bacteria 2515
89 Ga0070674_100097019 3300005356 Bacteria 2140
90 Ga0070674_100225680 3300005356 Bacteria 1459
91 Ga0070674_100248966 3300005356 Unclassified 1395
92 Ga0070674_100272703 3300005356 Bacteria 1338
93 Ga0070674_100509188 3300005356 Bacteria 1004
94 Ga0070673_100006208 3300005364 Bacteria 7754
95 Ga0070673_100912400 3300005364 Bacteria 815
96 Ga0070688_100215603 3300005365 Bacteria 1350
97 Ga0070659_100066915 3300005366 Bacteria 2848
98 Ga0070659_100102052 3300005366 Bacteria 2309
99 Ga0070659_100195821 3300005366 Bacteria 1662
100 Ga0070667_100000125 3300005367 Bacteria 97665
101 Ga0070667_100008132 3300005367 Bacteria 8697
102 Ga0070667_100010921 3300005367 Bacteria 7512
103 Ga0070667_100077330 3300005367 Bacteria 2841
104 Ga0070667_100087859 3300005367 Bacteria 2669
105 Ga0070667_100101495 3300005367 Bacteria 2485
106 Ga0070667_100185096 3300005367 Bacteria 1843
107 Ga0070667_100258541 3300005367 Bacteria 1558
108 Ga0070667_100292182 3300005367 Bacteria 1466
109 Ga0070667_100306634 3300005367 Bacteria 1430
110 Ga0070667_100371071 3300005367 Bacteria 1298
111 Ga0070709_10012320 3300005434 Bacteria 4784
112 Ga0070709_10030183 3300005434 Bacteria 3250
113 Ga0070709_10112553 3300005434 Unclassified 1832
114 Ga0070709_10137316 3300005434 Bacteria 1676
115 Ga0070714_100008318 3300005435 Bacteria 8095
116 Ga0070714_100124930 3300005435 Bacteria 2293
117 Ga0070714_100288211 3300005435 Bacteria 1527
118 Ga0070713_100008434 3300005436 Bacteria 7307
119 Ga0070713_100166820 3300005436 Unclassified 1969
120 Ga0070713_100214398 3300005436 Bacteria 1744
121 Ga0070701_10000305 3300005438 Bacteria 16066
122 Ga0070701_10001734 3300005438 Bacteria 8203
123 Ga0070701_10004877 3300005438 Bacteria 5488
124 Ga0070711_100077155 3300005439 Bacteria 2364
125 Ga0070711_100079985 3300005439 Bacteria 2326
126 Ga0070711_100126002 3300005439 Bacteria 1901
127 Ga0070711_100219328 3300005439 Bacteria 1477
128 Ga0070711_100256580 3300005439 Unclassified 1374
129 Ga0070705_100003056 3300005440 Bacteria 8246
130 Ga0070705_100086646 3300005440 Bacteria 1939
131 Ga0070700_100000639 3300005441 Bacteria 17336
132 Ga0070700_100007562 3300005441 Bacteria 5873
133 Ga0070700_100009709 3300005441 Bacteria 5288
134 Ga0070700_100089135 3300005441 Bacteria 2009
135 Ga0070700_100139112 3300005441 Bacteria 1648
136 Ga0070700_100225789 3300005441 Bacteria 1330
137 Ga0070700_100283650 3300005441 Bacteria 1202
138 Ga0070694_100007336 3300005444 Bacteria 6721
139 Ga0070694_100010030 3300005444 Bacteria 5825
140 Ga0070694_100048587 3300005444 Bacteria 2855
141 Ga0070694_100417947 3300005444 Bacteria 1053
142 Ga0070708_100382496 3300005445 Bacteria 1327
143 Ga0070708_100530653 3300005445 Bacteria 1110
144 Ga0070663_100000058 3300005455 Bacteria 48647
145 Ga0070663_100004878 3300005455 Bacteria 7916
146 Ga0070663_100024628 3300005455 Bacteria 4054
147 Ga0070663_100102339 3300005455 Unclassified 2139
148 Ga0070663_100181534 3300005455 Bacteria 1633
149 Ga0070663_100502548 3300005455 Bacteria 1007
150 Ga0070678_100004422 3300005456 Bacteria 7971
151 Ga0070678_100004444 3300005456 Bacteria 7958
152 Ga0070678_100069094 3300005456 Bacteria 2636
153 Ga0070678_100193876 3300005456 Bacteria 1672
154 Ga0070678_100233718 3300005456 Bacteria 1534
155 Ga0070662_100002374 3300005457 Bacteria 11574
156 Ga0070662_100008490 3300005457 Bacteria 6704
157 Ga0070662_100089288 3300005457 Bacteria 2312
158 Ga0070662_100102948 3300005457 Bacteria 2164
159 Ga0070681_10001021 3300005458 Bacteria 23710
160 Ga0070681_10003391 3300005458 Bacteria 14910
161 Ga0070681_10013324 3300005458 Bacteria 8172
162 Ga0070681_10019844 3300005458 Bacteria 6733
163 Ga0070681_10020138 3300005458 Bacteria 6687
164 Ga0070681_10041337 3300005458 Bacteria 4621
165 Ga0070681_10074761 3300005458 Bacteria 3349
166 Ga0070681_10076832 3300005458 Bacteria 3297
167 Ga0070681_10081688 3300005458 Bacteria 3188
168 Ga0070681_10082052 3300005458 Bacteria 3179
169 Ga0070681_10113932 3300005458 Bacteria 2643
170 Ga0070681_10294324 3300005458 Bacteria 1533
171 Ga0070681_10313819 3300005458 Bacteria 1477
172 Ga0070681_10852414 3300005458 Unclassified 829
173 Ga0068867_100000215 3300005459 Bacteria 38520
174 Ga0068867_100001914 3300005459 Bacteria 14493
175 Ga0068867_100004294 3300005459 Bacteria 10031
176 Ga0068867_100015192 3300005459 Bacteria 5460
177 Ga0068867_100016558 3300005459 Bacteria 5235
178 Ga0068867_100304702 3300005459 Bacteria 1314
179 Ga0068867_100348490 3300005459 Bacteria 1235
180 Ga0070685_10003480 3300005466 Bacteria 8011
181 Ga0070685_10033285 3300005466 Bacteria 2894
182 Ga0070685_10037479 3300005466 Bacteria 2746
183 Ga0070685_10195610 3300005466 Bacteria 1311
184 Ga0070706_100020626 3300005467 Bacteria 6073
185 Ga0070707_100013162 3300005468 Bacteria 7733
186 Ga0070698_100162444 3300005471 Bacteria 2177
187 Ga0070699_100150335 3300005518 Bacteria 2059
188 Ga0070679_100000441 3300005530 Bacteria 35288
189 Ga0070679_100010966 3300005530 Bacteria 8612
190 Ga0070679_100034771 3300005530 Bacteria 4997
191 Ga0070679_100047579 3300005530 Bacteria 4274
192 Ga0070679_100067018 3300005530 Bacteria 3580
193 Ga0070679_100075091 3300005530 Bacteria 3371
194 Ga0070679_100105098 3300005530 Unclassified 2810
195 Ga0070679_100119594 3300005530 Bacteria 2619
196 Ga0070679_100249922 3300005530 Bacteria 1730
197 Ga0070679_100455353 3300005530 Bacteria 1224
198 Ga0070684_100002164 3300005535 Bacteria 14505
199 Ga0070684_100051273 3300005535 Bacteria 3584
200 Ga0070684_100209374 3300005535 Bacteria 1777
201 Ga0070697_100001052 3300005536 Bacteria 20835
202 Ga0070697_100155183 3300005536 Bacteria 1932
203 Ga0070697_100546010 3300005536 Bacteria 1016
204 Ga0068853_100000693 3300005539 Bacteria 23244
205 Ga0068853_100016591 3300005539 Bacteria 6064
206 Ga0068853_100136353 3300005539 Bacteria 2200
207 Ga0068853_100208629 3300005539 Bacteria 1780
208 Ga0068853_100299613 3300005539 Bacteria 1486
209 Ga0068853_100734729 3300005539 Bacteria 943
210 Ga0070672_100063309 3300005543 Bacteria 2921
211 Ga0070672_100089741 3300005543 Bacteria 2477
212 Ga0070672_100307253 3300005543 Bacteria 1345
213 Ga0070672_100331601 3300005543 Bacteria 1294
214 Ga0070672_100508041 3300005543 Bacteria 1043
215 Ga0070686_100000567 3300005544 Bacteria 22111
216 Ga0070686_100003157 3300005544 Bacteria 9015
217 Ga0070686_100003546 3300005544 Bacteria 8559
218 Ga0070686_100058746 3300005544 Bacteria 2476
219 Ga0070686_100458343 3300005544 Bacteria 982
220 Ga0070695_100003361 3300005545 Bacteria 9350
221 Ga0070696_100000493 3300005546 Bacteria 24824
222 Ga0070696_100001008 3300005546 Bacteria 18251
223 Ga0070696_100002669 3300005546 Bacteria 11817
224 Ga0070696_100067218 3300005546 Unclassified 2515
225 Ga0070693_100000825 3300005547 Bacteria 13763
226 Ga0070693_100009595 3300005547 Bacteria 4817
227 Ga0070693_100012126 3300005547 Bacteria 4355
228 Ga0070693_100085738 3300005547 Bacteria 1888
229 Ga0070693_100116822 3300005547 Bacteria 1649
230 Ga0070693_100237456 3300005547 Bacteria 1202
231 Ga0070665_100000108 3300005548 Bacteria 155204
232 Ga0070665_100001482 3300005548 Bacteria 27442
233 Ga0070665_100002532 3300005548 Bacteria 20083
234 Ga0070665_100004735 3300005548 Bacteria 14163
235 Ga0070665_100009077 3300005548 Bacteria 10072
236 Ga0070665_100012741 3300005548 Bacteria 8470
237 Ga0070665_100026353 3300005548 Bacteria 5855
238 Ga0070665_100117630 3300005548 Bacteria 2660
239 Ga0070665_100238398 3300005548 Bacteria 1819
240 Ga0070665_100436606 3300005548 Bacteria 1318
241 Ga0070665_100451796 3300005548 Bacteria 1295
242 Ga0070665_100924215 3300005548 Bacteria 885
243 Ga0070704_100002536 3300005549 Bacteria 10281
244 Ga0068855_100002124 3300005563 Bacteria 24517
245 Ga0068855_100003238 3300005563 Bacteria 19931
246 Ga0068855_100003301 3300005563 Bacteria 19747
247 Ga0068855_100014199 3300005563 Bacteria 9595
248 Ga0068855_100050449 3300005563 Bacteria 4904
249 Ga0068855_100155182 3300005563 Bacteria 2601
250 Ga0068855_100246680 3300005563 Bacteria 1993
251 Ga0068855_100369041 3300005563 Bacteria 1578
252 Ga0068855_100543596 3300005563 Bacteria 1258
253 Ga0068855_100606250 3300005563 Bacteria 1180
254 Ga0070664_100000193 3300005564 Bacteria 43118
255 Ga0070664_100013749 3300005564 Bacteria 6597
256 Ga0070664_100065621 3300005564 Bacteria 3098
257 Ga0070664_100244697 3300005564 Bacteria 1611
258 Ga0068857_100005651 3300005577 Bacteria 10694
259 Ga0068857_100026375 3300005577 Bacteria 5122
260 Ga0068857_100080275 3300005577 Bacteria 2913
261 Ga0068857_100082067 3300005577 Bacteria 2879
262 Ga0068857_100232515 3300005577 Bacteria 1686
263 Ga0068857_100252505 3300005577 Bacteria 1617
264 Ga0068854_100009719 3300005578 Bacteria 6215
265 Ga0068854_100010253 3300005578 Bacteria 6075
266 Ga0068854_100301104 3300005578 Bacteria 1297
267 Ga0068856_100035930 3300005614 Bacteria 4858
268 Ga0068856_100072866 3300005614 Bacteria 3401
269 Ga0068856_100149751 3300005614 Bacteria 2342
270 Ga0068856_100552691 3300005614 Unclassified 1172
271 Ga0068856_100803593 3300005614 Bacteria 960
272 Ga0068856_100808496 3300005614 Bacteria 957
273 Ga0068856_100826541 3300005614 Bacteria 946
274 Ga0070702_100000314 3300005615 Bacteria 16792
275 Ga0070702_100000566 3300005615 Bacteria 13463
276 Ga0070702_100037595 3300005615 Bacteria 2689
277 Ga0070702_100048245 3300005615 Bacteria 2423
278 Ga0068852_100005452 3300005616 Bacteria 9098
279 Ga0068852_100035762 3300005616 Bacteria 4146
280 Ga0068852_100060808 3300005616 Bacteria 3280
281 Ga0068852_100124687 3300005616 Bacteria 2363
282 Ga0068852_100352069 3300005616 Bacteria 1438
283 Ga0068852_100712289 3300005616 Bacteria 1014
284 Ga0068852_100725082 3300005616 Bacteria 1005
285 Ga0068859_100000206 3300005617 Bacteria 58246
286 Ga0068859_100003093 3300005617 Bacteria 16888
287 Ga0068859_100003111 3300005617 Bacteria 16848
288 Ga0068859_100010070 3300005617 Bacteria 9532
289 Ga0068859_100011465 3300005617 Bacteria 8911
290 Ga0068859_100034444 3300005617 Bacteria 5082
291 Ga0068859_100040261 3300005617 Bacteria 4691
292 Ga0068859_100222828 3300005617 Bacteria 1974
293 Ga0068859_100896348 3300005617 Bacteria 972
294 Ga0068864_100003617 3300005618 Bacteria 12781
295 Ga0068864_100031075 3300005618 Bacteria 4530
296 Ga0068864_100062235 3300005618 Bacteria 3233
297 Ga0068864_100118817 3300005618 Bacteria 2361
298 Ga0068864_100132657 3300005618 Bacteria 2239
299 Ga0068864_100204997 3300005618 Bacteria 1813
300 Ga0068864_100988995 3300005618 Unclassified 834
301 Ga0068866_10000333 3300005718 Bacteria 22265
302 Ga0068866_10000974 3300005718 Bacteria 12594
303 Ga0068866_10002162 3300005718 Bacteria 8183
304 Ga0068866_10390896 3300005718 Bacteria 894
305 Ga0068861_100003357 3300005719 Bacteria 10608
306 Ga0068861_100003978 3300005719 Bacteria 9899
307 Ga0068861_100004296 3300005719 Bacteria 9560
308 Ga0068861_100004393 3300005719 Bacteria 9451
309 Ga0068861_100057277 3300005719 Bacteria 2976
310 Ga0068861_100085822 3300005719 Unclassified 2473
311 Ga0068861_100832208 3300005719 Bacteria 869
312 Ga0068861_100871489 3300005719 Bacteria 850
313 Ga0068851_10000982 3300005834 Bacteria 12372
314 Ga0068851_10087425 3300005834 Bacteria 1637
315 Ga0068870_10008535 3300005840 Bacteria 4615
316 Ga0068870_10079335 3300005840 Bacteria 1810
317 Ga0068870_10088680 3300005840 Unclassified 1725
318 Ga0068870_10091485 3300005840 Bacteria 1702
319 Ga0068870_10121700 3300005840 Bacteria 1504
320 Ga0068870_10221067 3300005840 Bacteria 1159
321 Ga0068863_100002905 3300005841 Bacteria 16983
322 Ga0068863_100007199 3300005841 Bacteria 10912
323 Ga0068863_100021228 3300005841 Bacteria 6199
324 Ga0068863_100239111 3300005841 Bacteria 1753
325 Ga0068863_100367282 3300005841 Bacteria 1404
326 Ga0068863_100613344 3300005841 Bacteria 1077
327 Ga0068858_100001325 3300005842 Bacteria 25564
328 Ga0068858_100006062 3300005842 Bacteria 11786
329 Ga0068858_100013550 3300005842 Bacteria 7694
330 Ga0068858_100015676 3300005842 Bacteria 7130
331 Ga0068858_100022852 3300005842 Bacteria 5833
332 Ga0068858_100029017 3300005842 Bacteria 5137
333 Ga0068858_100052211 3300005842 Bacteria 3782
334 Ga0068858_100054276 3300005842 Bacteria 3706
335 Ga0068858_100071203 3300005842 Bacteria 3224
336 Ga0068858_100132503 3300005842 Unclassified 2338
337 Ga0068858_100307749 3300005842 Bacteria 1513
338 Ga0068858_100345751 3300005842 Bacteria 1424
339 Ga0068858_100759294 3300005842 Bacteria 945
340 Ga0068860_100001625 3300005843 Bacteria 24111
341 Ga0068860_100010441 3300005843 Bacteria 9180
342 Ga0068860_100022321 3300005843 Bacteria 6124
343 Ga0068860_100027640 3300005843 Bacteria 5462
344 Ga0068860_100101266 3300005843 Bacteria 2748
345 Ga0068860_100161469 3300005843 Bacteria 2161
346 Ga0068860_100163602 3300005843 Bacteria 2146
347 Ga0068860_100339493 3300005843 Bacteria 1477
348 Ga0068860_100340381 3300005843 Bacteria 1475
349 Ga0068860_100358427 3300005843 Unclassified 1436
350 Ga0068860_100563722 3300005843 Bacteria 1142
351 Ga0068860_100652988 3300005843 Bacteria 1060
352 Ga0068862_100000047 3300005844 Bacteria 151607
353 Ga0068862_100003040 3300005844 Bacteria 14608
354 Ga0068862_100009147 3300005844 Bacteria 8203
355 Ga0068862_100011101 3300005844 Bacteria 7440
356 Ga0068862_100028994 3300005844 Bacteria 4663
357 Ga0068862_100074583 3300005844 Bacteria 2933
358 Ga0068862_100079394 3300005844 Bacteria 2844
359 Ga0068862_100107621 3300005844 Unclassified 2444
360 Ga0068862_100127471 3300005844 Bacteria 2248
361 Ga0068862_100360679 3300005844 Bacteria 1351
362 Ga0068862_100450900 3300005844 Bacteria 1213
363 Ga0081455_10000337 3300005937 Bacteria 61669
364 Ga0081455_10190045 3300005937 Bacteria 1547
365 Ga0081540_1065880 3300005983 Bacteria 1701
366 Ga0081539_10000011 3300005985 Bacteria 461887
367 Ga0070717_10027818 3300006028 Bacteria 4521
368 Ga0070717_10193075 3300006028 Unclassified 1780
369 Ga0070712_100040652 3300006175 Bacteria 3189
370 Ga0070712_100061050 3300006175 Unclassified 2662
371 Ga0070712_100077127 3300006175 Bacteria 2401
372 Ga0070712_100151496 3300006175 Bacteria 1781
373 Ga0097621_100002218 3300006237 Bacteria 13312
374 Ga0097621_100007088 3300006237 Bacteria 7991
375 Ga0097621_100018756 3300006237 Bacteria 5294
376 Ga0097621_100166131 3300006237 Bacteria 1900
377 Ga0097621_100290405 3300006237 Bacteria 1441
378 Ga0097621_100964467 3300006237 Bacteria 796
379 Ga0068871_100000969 3300006358 Bacteria 19188
380 Ga0068871_100004832 3300006358 Bacteria 9419
381 Ga0068871_100006522 3300006358 Bacteria 8264
382 Ga0068871_100062644 3300006358 Bacteria 3040
383 Ga0068871_100109329 3300006358 Bacteria 2324
384 Ga0068871_100197865 3300006358 Bacteria 1734
385 Ga0068871_100212610 3300006358 Unclassified 1673
386 Ga0068871_100241864 3300006358 Bacteria 1569
387 Ga0068871_100286067 3300006358 Bacteria 1443
388 Ga0068871_100393168 3300006358 Bacteria 1233
389 Ga0075428_100000333 3300006844 Bacteria 46836
390 Ga0075428_100013405 3300006844 Bacteria 9118
391 Ga0075428_100093192 3300006844 Bacteria 3284
392 Ga0075430_100003144 3300006846 Bacteria 13809
393 Ga0075430_100043043 3300006846 Bacteria 3817
394 Ga0075430_100111521 3300006846 Bacteria 2281
395 Ga0075430_100340961 3300006846 Bacteria 1238
396 Ga0075431_100005132 3300006847 Bacteria 12882
397 Ga0075431_100217208 3300006847 Bacteria 1951
398 Ga0075433_10029610 3300006852 Bacteria 4667
399 Ga0075433_10445630 3300006852 Bacteria 1141
400 Ga0075434_100000495 3300006871 Bacteria 29738
401 Ga0075434_100268609 3300006871 Unclassified 1725
402 Ga0075434_100334352 3300006871 Bacteria 1535
403 Ga0075434_100361765 3300006871 Bacteria 1472
404 Ga0075434_100460070 3300006871 Bacteria 1293
405 Ga0075434_100936425 3300006871 Unclassified 881
406 Ga0075429_100000477 3300006880 Bacteria 29899
407 Ga0075429_100058440 3300006880 Bacteria 3358
408 Ga0075429_100107387 3300006880 Bacteria 2439
409 Ga0075429_100586378 3300006880 Bacteria 977
410 Ga0068865_100002291 3300006881 Bacteria 11278
411 Ga0068865_100003778 3300006881 Bacteria 9092
412 Ga0068865_100018214 3300006881 Bacteria 4530
413 Ga0068865_100026617 3300006881 Bacteria 3815
414 Ga0068865_100051283 3300006881 Bacteria 2855
415 Ga0068865_100107831 3300006881 Bacteria 2049
416 Ga0068865_100136358 3300006881 Bacteria 1845
417 Ga0068865_100354960 3300006881 Bacteria 1189
418 Ga0075436_100002774 3300006914 Bacteria 12008
419 Ga0075436_100029310 3300006914 Bacteria 3784
420 Ga0075436_100158456 3300006914 Bacteria 1595
421 Ga0097620_100000206 3300006931 Bacteria 58246
422 Ga0097620_100003093 3300006931 Bacteria 16888
423 Ga0097620_100003111 3300006931 Bacteria 16848
424 Ga0097620_100010069 3300006931 Bacteria 9532
425 Ga0097620_100011465 3300006931 Bacteria 8911
426 Ga0097620_100034444 3300006931 Bacteria 5082
427 Ga0097620_100040259 3300006931 Bacteria 4691
428 Ga0097620_100222829 3300006931 Bacteria 1974
429 Ga0097620_100303407 3300006931 Bacteria 1690
430 Ga0097620_100896385 3300006931 Bacteria 972
431 Ga0099826_10049432 3300006948 Bacteria 2836
432 Ga0075435_100000068 3300007076 Bacteria 53336
433 Ga0075435_100259239 3300007076 Bacteria 1481
434 Ga0075435_100380878 3300007076 Bacteria 1212
435 Ga0099794_10013916 3300007265 Bacteria 3513
436 Ga0099794_10162671 3300007265 Bacteria 1136
437 Ga0099795_10140662 3300007788 Bacteria 981
438 Ga0105240_10001278 3300009093 Bacteria 43550
439 Ga0105240_10002400 3300009093 Bacteria 30131
440 Ga0105240_10003765 3300009093 Bacteria 23440
441 Ga0105240_10008454 3300009093 Bacteria 14724
442 Ga0105240_10008473 3300009093 Bacteria 14707
443 Ga0105240_10024998 3300009093 Bacteria 7861
444 Ga0105240_10049373 3300009093 Bacteria 5311
445 Ga0105240_10122444 3300009093 Bacteria 3130
446 Ga0105240_10146293 3300009093 Bacteria 2819
447 Ga0105240_10249057 3300009093 Bacteria 2056
448 Ga0105240_10257427 3300009093 Bacteria 2015
449 Ga0105240_10262783 3300009093 Bacteria 1990
450 Ga0105240_11321165 3300009093 Bacteria 760
451 Ga0111539_10045784 3300009094 Bacteria 5235
452 Ga0105245_10000182 3300009098 Bacteria 59361
453 Ga0105245_10004310 3300009098 Bacteria 12593
454 Ga0105245_10203016 3300009098 Bacteria 1904
455 Ga0105247_10000088 3300009101 Bacteria 98964
456 Ga0114129_10001303 3300009147 Bacteria 33282
457 Ga0105243_10001035 3300009148 Bacteria 25558
458 Ga0105243_10001971 3300009148 Bacteria 17496
459 Ga0105243_10064151 3300009148 Bacteria 2946
460 Ga0105243_11501330 3300009148 Bacteria 698
461 Ga0105241_10007691 3300009174 Bacteria 7925
462 Ga0105241_10017197 3300009174 Bacteria 5312
463 Ga0105241_10116442 3300009174 Bacteria 2146
464 Ga0105241_10211445 3300009174 Bacteria 1625
465 Ga0105241_10318283 3300009174 Unclassified 1341
466 Ga0105241_10393632 3300009174 Bacteria 1214
467 Ga0105242_10000907 3300009176 Bacteria 23030
468 Ga0105242_10002390 3300009176 Bacteria 14776
469 Ga0105242_10003377 3300009176 Bacteria 12427
470 Ga0105242_10011646 3300009176 Bacteria 6766
471 Ga0105242_10027916 3300009176 Bacteria 4488
472 Ga0105242_10099477 3300009176 Unclassified 2462
473 Ga0105242_10111092 3300009176 Bacteria 2336
474 Ga0105242_10199222 3300009176 Bacteria 1778
475 Ga0105248_10000741 3300009177 Bacteria 36731
476 Ga0105248_10004329 3300009177 Bacteria 15699
477 Ga0105248_10029394 3300009177 Bacteria 6130
478 Ga0105248_10054720 3300009177 Bacteria 4476
479 Ga0105248_10369011 3300009177 Bacteria 1616
480 Ga0105248_10993144 3300009177 Bacteria 948
481 Ga0105237_10003176 3300009545 Bacteria 19717
482 Ga0105237_10047664 3300009545 Bacteria 4307
483 Ga0105237_10091600 3300009545 Bacteria 3030
484 Ga0105237_10180192 3300009545 Bacteria 2113
485 Ga0105237_10290539 3300009545 Bacteria 1638
486 Ga0105237_10319673 3300009545 Bacteria 1556
487 Ga0105237_10379963 3300009545 Bacteria 1417
488 Ga0105237_10744978 3300009545 Bacteria 986
489 Ga0105238_10000393 3300009551 Bacteria 46691
490 Ga0105238_10000785 3300009551 Bacteria 32983
491 Ga0105238_10032728 3300009551 Bacteria 5292
492 Ga0105238_10055319 3300009551 Bacteria 3983
493 Ga0105238_10110596 3300009551 Bacteria 2728
494 Ga0105238_10151173 3300009551 Unclassified 2297
495 Ga0105238_10247258 3300009551 Bacteria 1761
496 Ga0105249_10000648 3300009553 Bacteria 31755
497 Ga0105249_10005746 3300009553 Bacteria 10728
498 Ga0105249_10006096 3300009553 Bacteria 10452
499 Ga0105249_10007359 3300009553 Bacteria 9598
500 Ga0105249_10016154 3300009553 Bacteria 6619
501 Ga0105249_10025839 3300009553 Bacteria 5289
502 Ga0105249_10112873 3300009553 Bacteria 2571
503 Ga0105249_10155119 3300009553 Bacteria 2208
504 Ga0105249_10278402 3300009553 Bacteria 1670
505 Ga0105249_10350065 3300009553 Bacteria 1496
506 Ga0105249_10534141 3300009553 Bacteria 1222
507 Ga0105249_10600045 3300009553 Bacteria 1156
508 Ga0105249_11098700 3300009553 Bacteria 865
509 Ga0099796_10004434 3300010159 Bacteria 3395
510 Ga0105239_10008370 3300010375 Bacteria 11783
511 Ga0105239_10010816 3300010375 Bacteria 10197
512 Ga0105239_10034090 3300010375 Bacteria 5589
513 Ga0105239_10061287 3300010375 Bacteria 4128
514 Ga0105239_10062131 3300010375 Bacteria 4100
515 Ga0105239_10146697 3300010375 Bacteria 2632
516 Ga0105239_10564154 3300010375 Bacteria 1297
517 Ga0105239_10735161 3300010375 Bacteria 1129
518 Ga0105246_10022423 3300011119 Bacteria 4073
519 Ga0105246_10023781 3300011119 Bacteria 3969
520 Ga0105246_10070670 3300011119 Bacteria 2456
521 Ga0157373_10221451 3300013100 Bacteria 1335
522 Ga0157370_10001131 3300013104 Bacteria 33342
523 Ga0157369_10000463 3300013105 Bacteria 53842
524 Ga0157369_10002625 3300013105 Bacteria 21488
525 Ga0157369_10013410 3300013105 Bacteria 9267
526 Ga0157369_10031832 3300013105 Bacteria 5804
527 Ga0157369_10340343 3300013105 Bacteria 1558
528 Ga0157369_11187569 3300013105 Bacteria 779
529 Ga0157374_10005459 3300013296 Bacteria 10677
530 Ga0157374_10142473 3300013296 Bacteria 2327
531 Ga0157374_10206770 3300013296 Bacteria 1924
532 Ga0157374_10213686 3300013296 Bacteria 1891
533 Ga0157374_10311935 3300013296 Unclassified 1557
534 Ga0157374_10390390 3300013296 Bacteria 1387
535 Ga0157374_10600132 3300013296 Bacteria 1111
536 Ga0157374_11118343 3300013296 Bacteria 808
537 Ga0157378_10004986 3300013297 Bacteria 11644
538 Ga0157378_10013646 3300013297 Bacteria 7105
539 Ga0157378_10018683 3300013297 Bacteria 6094
540 Ga0157378_10182022 3300013297 Bacteria 1977
541 Ga0157378_10223018 3300013297 Bacteria 1793
542 Ga0157378_11345778 3300013297 Bacteria 756
543 Ga0163162_10000655 3300013306 Bacteria 32037
544 Ga0163162_10022358 3300013306 Bacteria 6232
545 Ga0163162_10045208 3300013306 Bacteria 4411
546 Ga0163162_10055888 3300013306 Bacteria 3976
547 Ga0163162_10078684 3300013306 Bacteria 3362
548 Ga0163162_10134104 3300013306 Bacteria 2587
549 Ga0163162_10191813 3300013306 Bacteria 2171
550 Ga0163162_10206757 3300013306 Bacteria 2092
551 Ga0163162_10253767 3300013306 Unclassified 1891
552 Ga0157372_10088473 3300013307 Bacteria 3517
553 Ga0157372_10123362 3300013307 Bacteria 2978
554 Ga0157372_10151453 3300013307 Bacteria 2677
555 Ga0157372_10285620 3300013307 Bacteria 1919
556 Ga0157372_10308655 3300013307 Unclassified 1841
557 Ga0157372_10496608 3300013307 Bacteria 1423
558 Ga0157375_10000702 3300013308 Bacteria 29546
559 Ga0157375_10040107 3300013308 Bacteria 4512
560 Ga0157375_10059781 3300013308 Bacteria 3777
561 Ga0157375_10081810 3300013308 Bacteria 3270
562 Ga0157375_10323338 3300013308 Bacteria 1707
563 Ga0163163_10000534 3300014325 Bacteria 33701
564 Ga0163163_10046158 3300014325 Bacteria 4278
565 Ga0163163_10078500 3300014325 Bacteria 3298
566 Ga0163163_10157786 3300014325 Bacteria 2313
567 Ga0163163_10184306 3300014325 Bacteria 2135
568 Ga0163163_11457579 3300014325 Bacteria 746
569 Ga0157380_10030105 3300014326 Bacteria 4155
570 Ga0157380_10133687 3300014326 Bacteria 2120
571 Ga0157380_10142946 3300014326 Bacteria 2058
572 Ga0157380_10201929 3300014326 Bacteria 1764
573 Ga0157380_10221542 3300014326 Bacteria 1693
574 Ga0182008_10063136 3300014497 Bacteria 1825
575 Ga0157379_10020766 3300014968 Bacteria 5811
576 Ga0157379_10026025 3300014968 Bacteria 5204
577 Ga0157379_10056253 3300014968 Bacteria 3515
578 Ga0157379_10078689 3300014968 Bacteria 2953
579 Ga0157379_10138037 3300014968 Bacteria 2197
580 Ga0157379_10152569 3300014968 Bacteria 2084
581 Ga0157379_10158578 3300014968 Bacteria 2042
582 Ga0157379_10168163 3300014968 Unclassified 1979
583 Ga0157379_10188676 3300014968 Bacteria 1863
584 Ga0157379_10230513 3300014968 Unclassified 1678
585 Ga0157379_10345698 3300014968 Bacteria 1361
586 Ga0157379_10809862 3300014968 Bacteria 884
587 Ga0157376_10001346 3300014969 Bacteria 16193
588 Ga0157376_10028411 3300014969 Bacteria 4445
589 Ga0157376_10124591 3300014969 Bacteria 2289
590 Ga0157376_10432823 3300014969 Bacteria 1279
591 Ga0157376_10440818 3300014969 Bacteria 1268
592 Ga0157376_10449540 3300014969 Bacteria 1256
593 Ga0157376_10679833 3300014969 Bacteria 1032
594 Ga0157376_10857784 3300014969 Unclassified 924
595 Ga0157376_10985537 3300014969 Bacteria 865
596 Ga0163161_10147642 3300017792 Bacteria 1785
597 Ga0163161_10166753 3300017792 Bacteria 1682
598 Ga0163161_10367183 3300017792 Bacteria 1148
599 Ga0206353_11580351 3300020082 Bacteria 1047
600 Ga0213874_10018633 3300021377 Unclassified 1878
601 Ga0213871_10039296 3300021441 Bacteria 1266
602 Ga0224712_10116728 3300022467 Bacteria 1151
603 Ga0224712_10125131 3300022467 Bacteria 1117
604 Ga0209233_1008257 3300025261 Bacteria 3233
605 Ga0207697_10196894 3300025315 Bacteria 886
606 Ga0207656_10004335 3300025321 Bacteria 4948
607 Ga0207656_10120861 3300025321 Bacteria 1219
608 Ga0207653_10006095 3300025885 Bacteria 3757
609 Ga0207682_10036934 3300025893 Bacteria 1978
610 Ga0207642_10003615 3300025899 Bacteria 4905
611 Ga0207642_10006422 3300025899 Bacteria 3906
612 Ga0207642_10008464 3300025899 Bacteria 3531
613 Ga0207642_10106494 3300025899 Bacteria 1419
614 Ga0207642_10158482 3300025899 Bacteria 1213
615 Ga0207710_10000205 3300025900 Bacteria 54586
616 Ga0207688_10028124 3300025901 Bacteria 3094
617 Ga0207688_10031488 3300025901 Bacteria 2928
618 Ga0207688_10163660 3300025901 Bacteria 1320
619 Ga0207688_10439916 3300025901 Bacteria 812
620 Ga0207680_10003078 3300025903 Bacteria 7827
621 Ga0207680_10058406 3300025903 Bacteria 2338
622 Ga0207680_10274869 3300025903 Bacteria 1169
623 Ga0207647_10002915 3300025904 Bacteria 12879
624 Ga0207699_10030107 3300025906 Bacteria 3034
625 Ga0207699_10271939 3300025906 Bacteria 1174
626 Ga0207699_10473271 3300025906 Bacteria 901
627 Ga0207645_10001076 3300025907 Bacteria 22579
628 Ga0207645_10024898 3300025907 Bacteria 3877
629 Ga0207645_10039892 3300025907 Bacteria 3007
630 Ga0207645_10276164 3300025907 Bacteria 1115
631 Ga0207643_10022275 3300025908 Bacteria 3486
632 Ga0207643_10055703 3300025908 Bacteria 2249
633 Ga0207643_10071126 3300025908 Unclassified 2002
634 Ga0207643_10088987 3300025908 Bacteria 1798
635 Ga0207705_10228576 3300025909 Bacteria 1414
636 Ga0207684_10306741 3300025910 Bacteria 1368
637 Ga0207654_10017918 3300025911 Bacteria 3711
638 Ga0207654_10034353 3300025911 Bacteria 2817
639 Ga0207654_10311359 3300025911 Bacteria 1073
640 Ga0207654_10365186 3300025911 Bacteria 997
641 Ga0207654_10368781 3300025911 Bacteria 992
642 Ga0207707_10000123 3300025912 Bacteria 80128
643 Ga0207707_10015018 3300025912 Bacteria 6743
644 Ga0207707_10020159 3300025912 Bacteria 5820
645 Ga0207707_10021490 3300025912 Bacteria 5641
646 Ga0207707_10048203 3300025912 Bacteria 3711
647 Ga0207707_10091789 3300025912 Bacteria 2654
648 Ga0207707_10114736 3300025912 Bacteria 2354
649 Ga0207707_10126956 3300025912 Bacteria 2231
650 Ga0207707_10130761 3300025912 Bacteria 2195
651 Ga0207707_10211547 3300025912 Bacteria 1689
652 Ga0207707_10410048 3300025912 Bacteria 1163
653 Ga0207695_10000033 3300025913 Bacteria 507477
654 Ga0207695_10001393 3300025913 Bacteria 40832
655 Ga0207695_10003645 3300025913 Bacteria 21516
656 Ga0207695_10005921 3300025913 Bacteria 16024
657 Ga0207695_10010979 3300025913 Bacteria 11007
658 Ga0207695_10011168 3300025913 Bacteria 10898
659 Ga0207695_10024319 3300025913 Bacteria 6818
660 Ga0207695_10034290 3300025913 Bacteria 5523
661 Ga0207695_10036698 3300025913 Bacteria 5295
662 Ga0207695_10088396 3300025913 Bacteria 3119
663 Ga0207695_10090031 3300025913 Bacteria 3084
664 Ga0207671_10000363 3300025914 Bacteria 64590
665 Ga0207671_10007676 3300025914 Bacteria 9314
666 Ga0207671_10026162 3300025914 Bacteria 4375
667 Ga0207671_10034031 3300025914 Bacteria 3788
668 Ga0207671_10066759 3300025914 Bacteria 2678
669 Ga0207671_10181814 3300025914 Unclassified 1636
670 Ga0207693_10031565 3300025915 Bacteria 4186
671 Ga0207693_10032059 3300025915 Bacteria 4149
672 Ga0207693_10234635 3300025915 Bacteria 1441
673 Ga0207663_10014293 3300025916 Bacteria 4341
674 Ga0207663_10097806 3300025916 Bacteria 1964
675 Ga0207663_10098857 3300025916 Bacteria 1955
676 Ga0207663_10203623 3300025916 Bacteria 1429
677 Ga0207663_10547479 3300025916 Bacteria 904
678 Ga0207660_10003459 3300025917 Bacteria 10298
679 Ga0207660_10048812 3300025917 Bacteria 2997
680 Ga0207660_10051918 3300025917 Bacteria 2917
681 Ga0207660_10065281 3300025917 Bacteria 2630
682 Ga0207660_10067866 3300025917 Bacteria 2585
683 Ga0207660_10088676 3300025917 Bacteria 2288
684 Ga0207660_10426172 3300025917 Unclassified 1071
685 Ga0207662_10000272 3300025918 Bacteria 23792
686 Ga0207662_10244702 3300025918 Bacteria 1175
687 Ga0207662_10384844 3300025918 Bacteria 948
688 Ga0207657_10191762 3300025919 Bacteria 1648
689 Ga0207649_10036204 3300025920 Bacteria 2971
690 Ga0207649_10038023 3300025920 Bacteria 2911
691 Ga0207649_10041331 3300025920 Bacteria 2806
692 Ga0207649_10249268 3300025920 Unclassified 1278
693 Ga0207649_10503750 3300025920 Bacteria 921
694 Ga0207652_10003226 3300025921 Bacteria 13557
695 Ga0207652_10024110 3300025921 Bacteria 5046
696 Ga0207652_10028076 3300025921 Bacteria 4693
697 Ga0207652_10136359 3300025921 Bacteria 2192
698 Ga0207652_10161992 3300025921 Bacteria 2005
699 Ga0207652_10568336 3300025921 Bacteria 1018
700 Ga0207646_10010165 3300025922 Bacteria 9222
701 Ga0207681_10035199 3300025923 Bacteria 3298
702 Ga0207681_10153469 3300025923 Bacteria 1728
703 Ga0207694_10000460 3300025924 Bacteria 37845
704 Ga0207694_10002668 3300025924 Bacteria 14456
705 Ga0207694_10003738 3300025924 Bacteria 12061
706 Ga0207694_10006970 3300025924 Bacteria 8580
707 Ga0207694_10212590 3300025924 Bacteria 1576
708 Ga0207694_10216251 3300025924 Bacteria 1562
709 Ga0207694_10388954 3300025924 Bacteria 1158
710 Ga0207694_10677527 3300025924 Unclassified 869
711 Ga0207650_10009991 3300025925 Bacteria 6497
712 Ga0207650_10016649 3300025925 Bacteria 5139
713 Ga0207650_10073520 3300025925 Bacteria 2575
714 Ga0207659_10013387 3300025926 Bacteria 5251
715 Ga0207687_10001796 3300025927 Bacteria 14770
716 Ga0207687_10006587 3300025927 Bacteria 7660
717 Ga0207700_10417092 3300025928 Bacteria 1179
718 Ga0207664_10055342 3300025929 Bacteria 3147
719 Ga0207644_10001766 3300025931 Bacteria 14004
720 Ga0207644_10059157 3300025931 Bacteria 2771
721 Ga0207644_10362187 3300025931 Unclassified 1180
722 Ga0207644_10371924 3300025931 Bacteria 1164
723 Ga0207690_10081435 3300025932 Bacteria 2262
724 Ga0207690_10083834 3300025932 Bacteria 2233
725 Ga0207690_10221107 3300025932 Bacteria 1449
726 Ga0207706_10005911 3300025933 Bacteria 11383
727 Ga0207706_10010504 3300025933 Bacteria 8462
728 Ga0207706_10052916 3300025933 Bacteria 3584
729 Ga0207706_10111853 3300025933 Bacteria 2402
730 Ga0207686_10000437 3300025934 Bacteria 28053
731 Ga0207686_10018285 3300025934 Bacteria 3967
732 Ga0207686_10024104 3300025934 Bacteria 3521
733 Ga0207686_10032683 3300025934 Bacteria 3099
734 Ga0207686_10091125 3300025934 Bacteria 2013
735 Ga0207686_10256350 3300025934 Bacteria 1280
736 Ga0207686_10576788 3300025934 Bacteria 882
737 Ga0207709_10002912 3300025935 Bacteria 10448
738 Ga0207709_10202443 3300025935 Bacteria 1419
739 Ga0207670_10009145 3300025936 Bacteria 5634
740 Ga0207670_10014761 3300025936 Bacteria 4647
741 Ga0207670_10023234 3300025936 Bacteria 3856
742 Ga0207669_10120086 3300025937 Bacteria 1782
743 Ga0207669_10171002 3300025937 Bacteria 1546
744 Ga0207669_10258130 3300025937 Bacteria 1302
745 Ga0207704_10002779 3300025938 Bacteria 7897
746 Ga0207704_10017876 3300025938 Bacteria 3687
747 Ga0207704_10040831 3300025938 Bacteria 2715
748 Ga0207704_10042853 3300025938 Bacteria 2668
749 Ga0207704_10147739 3300025938 Bacteria 1654
750 Ga0207704_10634075 3300025938 Bacteria 878
751 Ga0207665_10048364 3300025939 Bacteria 2854
752 Ga0207691_10001926 3300025940 Bacteria 20255
753 Ga0207691_10051522 3300025940 Bacteria 3763
754 Ga0207691_10064713 3300025940 Bacteria 3312
755 Ga0207691_10065302 3300025940 Bacteria 3295
756 Ga0207691_10107043 3300025940 Bacteria 2490
757 Ga0207711_10004901 3300025941 Bacteria 11362
758 Ga0207711_10009454 3300025941 Bacteria 8132
759 Ga0207711_10013075 3300025941 Bacteria 6895
760 Ga0207711_10083997 3300025941 Bacteria 2786
761 Ga0207711_10152426 3300025941 Bacteria 2086
762 Ga0207711_10171916 3300025941 Bacteria 1966
763 Ga0207711_10203674 3300025941 Unclassified 1806
764 Ga0207711_10438297 3300025941 Bacteria 1216
765 Ga0207711_10780177 3300025941 Bacteria 890
766 Ga0207689_10000269 3300025942 Bacteria 46995
767 Ga0207689_10000500 3300025942 Bacteria 37039
768 Ga0207689_10003291 3300025942 Bacteria 14792
769 Ga0207689_10006515 3300025942 Bacteria 10308
770 Ga0207689_10011249 3300025942 Bacteria 7681
771 Ga0207689_10058057 3300025942 Bacteria 3183
772 Ga0207689_10158405 3300025942 Bacteria 1866
773 Ga0207689_10164619 3300025942 Bacteria 1827
774 Ga0207661_10144587 3300025944 Bacteria 2050
775 Ga0207661_10163717 3300025944 Bacteria 1931
776 Ga0207661_10485474 3300025944 Bacteria 1128
777 Ga0207679_10009993 3300025945 Bacteria 6098
778 Ga0207679_10011318 3300025945 Bacteria 5772
779 Ga0207679_10062681 3300025945 Bacteria 2772
780 Ga0207667_10002092 3300025949 Bacteria 25018
781 Ga0207667_10006403 3300025949 Bacteria 14270
782 Ga0207667_10014833 3300025949 Bacteria 8862
783 Ga0207667_10036094 3300025949 Bacteria 5301
784 Ga0207667_10048358 3300025949 Bacteria 4497
785 Ga0207667_10076782 3300025949 Bacteria 3466
786 Ga0207667_10221021 3300025949 Bacteria 1941
787 Ga0207667_10278629 3300025949 Bacteria 1709
788 Ga0207667_10348052 3300025949 Bacteria 1511
789 Ga0207667_10456775 3300025949 Bacteria 1298
790 Ga0207667_10756632 3300025949 Bacteria 971
791 Ga0207651_10007626 3300025960 Bacteria 5776
792 Ga0207651_10060059 3300025960 Bacteria 2637
793 Ga0207651_10282192 3300025960 Bacteria 1373
794 Ga0207712_10000165 3300025961 Bacteria 68118
795 Ga0207712_10000972 3300025961 Bacteria 20638
796 Ga0207712_10014962 3300025961 Bacteria 4998
797 Ga0207712_10048446 3300025961 Bacteria 2956
798 Ga0207712_10142187 3300025961 Bacteria 1843
799 Ga0207712_10171475 3300025961 Bacteria 1696
800 Ga0207712_10184634 3300025961 Bacteria 1641
801 Ga0207712_10246538 3300025961 Bacteria 1442
802 Ga0207712_10256931 3300025961 Bacteria 1415
803 Ga0207712_10371497 3300025961 Bacteria 1194
804 Ga0207668_10013613 3300025972 Bacteria 5017
805 Ga0207668_10054891 3300025972 Bacteria 2767
806 Ga0207668_10089493 3300025972 Unclassified 2257
807 Ga0207668_10110279 3300025972 Bacteria 2063
808 Ga0207640_10029061 3300025981 Bacteria 3388
809 Ga0207640_10047088 3300025981 Bacteria 2779
810 Ga0207640_10052415 3300025981 Bacteria 2657
811 Ga0207640_11162751 3300025981 Bacteria 685
812 Ga0207658_10000050 3300025986 Bacteria 129714
813 Ga0207658_10002710 3300025986 Bacteria 12781
814 Ga0207658_10016117 3300025986 Bacteria 5134
815 Ga0207658_10027943 3300025986 Bacteria 3969
816 Ga0207658_10053636 3300025986 Bacteria 2980
817 Ga0207658_10119689 3300025986 Bacteria 2097
818 Ga0207658_10153264 3300025986 Bacteria 1880
819 Ga0207658_10855159 3300025986 Bacteria 827
820 Ga0207677_10015266 3300026023 Bacteria 4511
821 Ga0207677_10020816 3300026023 Bacteria 3993
822 Ga0207677_10025825 3300026023 Bacteria 3671
823 Ga0207677_10120175 3300026023 Bacteria 1975
824 Ga0207703_10000553 3300026035 Bacteria 38426
825 Ga0207703_10000656 3300026035 Bacteria 34663
826 Ga0207703_10004421 3300026035 Bacteria 11550
827 Ga0207703_10007882 3300026035 Bacteria 8423
828 Ga0207703_10014926 3300026035 Bacteria 6062
829 Ga0207703_10016871 3300026035 Bacteria 5695
830 Ga0207703_10020516 3300026035 Bacteria 5168
831 Ga0207703_10130337 3300026035 Bacteria 2171
832 Ga0207703_10346221 3300026035 Bacteria 1367
833 Ga0207639_10000217 3300026041 Bacteria 42907
834 Ga0207639_10044273 3300026041 Bacteria 3347
835 Ga0207639_10047814 3300026041 Bacteria 3235
836 Ga0207639_10427727 3300026041 Bacteria 1198
837 Ga0207639_10573374 3300026041 Bacteria 1038
838 Ga0207678_10000336 3300026067 Bacteria 42278
839 Ga0207678_10005262 3300026067 Bacteria 11593
840 Ga0207678_10064348 3300026067 Bacteria 3151
841 Ga0207678_10113347 3300026067 Bacteria 2313
842 Ga0207678_10132131 3300026067 Bacteria 2130
843 Ga0207678_10136455 3300026067 Bacteria 2093
844 Ga0207678_10181403 3300026067 Bacteria 1798
845 Ga0207678_10309617 3300026067 Bacteria 1358
846 Ga0207708_10000163 3300026075 Bacteria 52435
847 Ga0207708_10000658 3300026075 Bacteria 26457
848 Ga0207708_10008456 3300026075 Bacteria 7620
849 Ga0207708_10014206 3300026075 Bacteria 5954
850 Ga0207708_10106733 3300026075 Bacteria 2172
851 Ga0207708_10265054 3300026075 Bacteria 1388
852 Ga0207702_10053927 3300026078 Bacteria 3405
853 Ga0207702_10058231 3300026078 Bacteria 3287
854 Ga0207702_10060529 3300026078 Bacteria 3228
855 Ga0207702_10131771 3300026078 Bacteria 2250
856 Ga0207702_10235342 3300026078 Bacteria 1713
857 Ga0207702_10874391 3300026078 Bacteria 890
858 Ga0207702_10925117 3300026078 Bacteria 864
859 Ga0207641_10000702 3300026088 Bacteria 36039
860 Ga0207641_10007075 3300026088 Bacteria 9369
861 Ga0207641_10008590 3300026088 Bacteria 8431
862 Ga0207641_10086190 3300026088 Bacteria 2738
863 Ga0207641_10445228 3300026088 Bacteria 1251
864 Ga0207641_10576549 3300026088 Bacteria 1099
865 Ga0207648_10000059 3300026089 Bacteria 103580
866 Ga0207648_10000691 3300026089 Bacteria 37799
867 Ga0207648_10007470 3300026089 Bacteria 10741
868 Ga0207648_10010090 3300026089 Bacteria 8980
869 Ga0207648_10018374 3300026089 Bacteria 6333
870 Ga0207648_10046516 3300026089 Bacteria 3804
871 Ga0207648_10074652 3300026089 Bacteria 2955
872 Ga0207648_10379155 3300026089 Bacteria 1278
873 Ga0207648_10462034 3300026089 Bacteria 1157
874 Ga0207648_10590508 3300026089 Bacteria 1023
875 Ga0207676_10005378 3300026095 Bacteria 9070
876 Ga0207676_10023693 3300026095 Bacteria 4534
877 Ga0207676_10109549 3300026095 Unclassified 2308
878 Ga0207676_10203460 3300026095 Bacteria 1751
879 Ga0207674_10010048 3300026116 Bacteria 10767
880 Ga0207674_10018650 3300026116 Bacteria 7537
881 Ga0207674_10120788 3300026116 Bacteria 2588
882 Ga0207674_10299578 3300026116 Bacteria 1557
883 Ga0207675_100000261 3300026118 Bacteria 50218
884 Ga0207675_100000611 3300026118 Bacteria 34846
885 Ga0207675_100000807 3300026118 Bacteria 31139
886 Ga0207675_100003851 3300026118 Bacteria 14586
887 Ga0207675_100012946 3300026118 Bacteria 7790
888 Ga0207675_100048178 3300026118 Bacteria 3978
889 Ga0207675_100066601 3300026118 Bacteria 3367
890 Ga0207675_100114406 3300026118 Bacteria 2548
891 Ga0207675_100154326 3300026118 Bacteria 2187
892 Ga0207675_100184933 3300026118 Bacteria 1997
893 Ga0207675_101229372 3300026118 Unclassified 769
894 Ga0207683_10004313 3300026121 Bacteria 12281
895 Ga0207683_10023783 3300026121 Bacteria 5271
896 Ga0207683_10142466 3300026121 Bacteria 2160
897 Ga0207683_10410414 3300026121 Bacteria 1246
898 Ga0207683_10800093 3300026121 Bacteria 875
899 Ga0207698_10013791 3300026142 Bacteria 5347
900 Ga0207698_10119615 3300026142 Bacteria 2226
901 Ga0207698_10174781 3300026142 Bacteria 1895
902 Ga0207698_10474546 3300026142 Bacteria 1212
903 Ga0207698_10546618 3300026142 Bacteria 1134
904 Ga0207698_10799180 3300026142 Bacteria 945
905 Ga0207698_10946493 3300026142 Bacteria 870
906 Ga0209179_1006553 3300027512 Bacteria 1884
907 Ga0209982_1002287 3300027552 Bacteria 2683
908 Ga0210002_1000318 3300027617 Bacteria 6645
909 Ga0209983_1000873 3300027665 Bacteria 6650
910 Ga0209971_1001269 3300027682 Bacteria 6292
911 Ga0209998_10000961 3300027717 Bacteria 7302
912 Ga0209974_10002268 3300027876 Bacteria 6987
913 Ga0207428_10000517 3300027907 Bacteria 46100
914 Ga0207428_10081765 3300027907 Bacteria 2522
915 Ga0268266_10000001 3300028379 Bacteria 4040580
916 Ga0268266_10000006 3300028379 Bacteria 1410021
917 Ga0268266_10001002 3300028379 Bacteria 35603
918 Ga0268266_10028889 3300028379 Bacteria 4712
919 Ga0268266_10031780 3300028379 Bacteria 4485
920 Ga0268266_10048011 3300028379 Bacteria 3658
921 Ga0268266_10165290 3300028379 Bacteria 2004
922 Ga0268266_10179819 3300028379 Bacteria 1925
923 Ga0268266_10438189 3300028379 Bacteria 1241
924 Ga0268266_10517250 3300028379 Bacteria 1141
925 Ga0268266_10541511 3300028379 Bacteria 1114
926 Ga0268265_10001639 3300028380 Bacteria 18338
927 Ga0268265_10008585 3300028380 Bacteria 6904
928 Ga0268265_10013445 3300028380 Bacteria 5562
929 Ga0268265_10013683 3300028380 Bacteria 5519
930 Ga0268265_10083213 3300028380 Bacteria 2533
931 Ga0268265_10147457 3300028380 Bacteria 1979
932 Ga0268265_10238280 3300028380 Bacteria 1603
933 Ga0268265_10292016 3300028380 Unclassified 1464
934 Ga0268265_10442620 3300028380 Bacteria 1212
935 Ga0268265_10768888 3300028380 Bacteria 936
936 Ga0268265_11134001 3300028380 Bacteria 777
937 Ga0268264_10000375 3300028381 Bacteria 65683
938 Ga0268264_10012057 3300028381 Bacteria 7117
939 Ga0268264_10015602 3300028381 Bacteria 6226
940 Ga0268264_10020180 3300028381 Bacteria 5446
941 Ga0268264_10038908 3300028381 Bacteria 3927
942 Ga0268264_10054472 3300028381 Bacteria 3340
943 Ga0268264_10054578 3300028381 Bacteria 3337
944 Ga0268264_10096304 3300028381 Unclassified 2563
945 Ga0268264_10288160 3300028381 Bacteria 1541
946 Ga0268264_10434502 3300028381 Bacteria 1268
947 Ga0268264_10512885 3300028381 Bacteria 1171
948 Ga0268264_10561114 3300028381 Bacteria 1121
949 Ga0265334_10027203 3300028573 Unclassified 2305
950 Ga0307515_10063509 3300028794 Bacteria 5185
951 Ga0265338_10125188 3300028800 Bacteria 2040
952 Ga0307511_10000448 3300030521 Bacteria 44274
953 Ga0307511_10016444 3300030521 Bacteria 7130
954 Ga0316181_1238965 3300030744 Bacteria 1562
955 Ga0265760_10009905 3300031090 Bacteria 2720
956 Ga0265328_10000002 3300031239 Bacteria 275819
957 Ga0265328_10000206 3300031239 Bacteria 27479
958 Ga0265328_10010275 3300031239 Bacteria 3773
959 Ga0265325_10020273 3300031241 Bacteria 3665
960 Ga0265340_10023312 3300031247 Bacteria 3157
961 Ga0265340_10082764 3300031247 Bacteria 1509
962 Ga0265339_10093059 3300031249 Bacteria 1578
963 Ga0265331_10000044 3300031250 Bacteria 186644
964 Ga0265331_10003459 3300031250 Bacteria 10191
965 Ga0265331_10005137 3300031250 Bacteria 7972
966 Ga0265331_10022810 3300031250 Bacteria 3189
967 Ga0265331_10102320 3300031250 Bacteria 1317
968 Ga0265327_10000102 3300031251 Bacteria 186668
969 Ga0265327_10001179 3300031251 Bacteria 35436
970 Ga0265327_10001663 3300031251 Bacteria 26735
971 Ga0265327_10003154 3300031251 Bacteria 16176
972 Ga0265327_10022118 3300031251 Bacteria 3815
973 Ga0265327_10168569 3300031251 Bacteria 1007
974 Ga0307513_10088265 3300031456 Bacteria 3170
975 Ga0307513_10493001 3300031456 Bacteria 943
976 Ga0307509_10000003 3300031507 Bacteria 577578
977 Ga0307408_100088700 3300031548 Bacteria 2330
978 Ga0307408_100364640 3300031548 Bacteria 1230
979 Ga0307508_10387883 3300031616 Bacteria 988
980 Ga0307516_10000050 3300031730 Bacteria 129848
981 Ga0307516_10031976 3300031730 Bacteria 5302
982 Ga0307516_10034540 3300031730 Bacteria 5079
983 Ga0307413_10327979 3300031824 Unclassified 1172
984 Ga0307410_10596066 3300031852 Unclassified 921
985 Ga0307407_10574433 3300031903 Unclassified 836
986 Ga0307412_10014886 3300031911 Bacteria 4598
987 Ga0307412_10025599 3300031911 Bacteria 3656
988 Ga0307412_10121269 3300031911 Bacteria 1883
989 Ga0307409_100265157 3300031995 Unclassified 1579
990 Ga0307409_100274195 3300031995 Unclassified 1555
991 Ga0307409_100680862 3300031995 Bacteria 1026
992 Ga0307416_100073249 3300032002 Bacteria 2855
993 Ga0307414_10026588 3300032004 Bacteria 3727
994 Ga0307411_10142869 3300032005 Unclassified 1767
995 Ga0307411_11165891 3300032005 Bacteria 697
996 Ga0307507_10099365 3300033179 Bacteria 2445
997 Ga0307507_10290945 3300033179 Bacteria 1011
998 Ga0307510_10000001 3300033180 Bacteria 1172244
999 Ga0307510_10002034 3300033180 Bacteria 22852
1000 Ga0307510_10264651 3300033180 Bacteria 1199
1001 Ga0373948_0002595 3300034817 Bacteria 2688
1002 Ga0373938_0018408 3300034957 Bacteria 1385
1003 Ga0373926_0025722 3300035083 Bacteria 2055
1004 Ga0373929_0016925 3300035085 Bacteria 1435
1005 Ga0373934_0110224 3300035086 Bacteria 1116
1006 Ga0373940_0001743 3300035088 Bacteria 4039
1007 Ga0373944_0063706 3300035089 Bacteria 1187
1008 Ga0373949_0029291 3300035090 Bacteria 1303
1009 Ga0373923_0161931 3300035111 Unclassified 1021
1010 Ga0373932_0002612 3300035112 Bacteria 4493
1011 Ga0373939_0006299 3300035114 Bacteria 2855
1012 Ga0373956_0058965 3300035119 Bacteria 1736
1013 Ga0373943_0335919 3300035170 Bacteria 863
1014 Ga0373946_0093277 3300035171 Bacteria 1337
1015 Ga0373955_0342833 3300035172 Bacteria 904
1016 Ga0373942_0005432 3300035207 Bacteria 2955
1017 Ga0373961_0015744 3300035241 Bacteria 1938
1018 Ga0373962_0029033 3300035242 Bacteria 1505
1019 Ga0373924_0076261 3300035410 Bacteria 1420
1020 Ga0373924_0180955 3300035410 Bacteria 928
1021 Ga0373931_0003258 3300035691 Bacteria 7261
1022 Ga0373931_0015354 3300035691 Bacteria 3754
1023 Ga0373935_0046162 3300035692 Bacteria 2750
1024 Ga0373935_0058000 3300035692 Bacteria 2472
1025 Ga0373927_0014409 3300035695 Bacteria 5234
1026 Ga0373927_0040503 3300035695 Bacteria 3022
1027 Ga0373927_0577955 3300035695 Bacteria 743
1028 Ga0373933_0182207 3300035724 Bacteria 1340
1029 Ga0373933_0358181 3300035724 Bacteria 948
1030 Ga0373947_0011471 3300035725 Bacteria 5083
1031 Ga0373937_0009590 3300036401 Bacteria 8427
1032 Ga0373937_0038257 3300036401 Bacteria 4372
1033 Ga0373937_0051456 3300036401 Bacteria 3775
1034 Ga0373937_0305271 3300036401 Unclassified 1505
1035 Ga0373937_0431367 3300036401 Bacteria 1251
1036 Ga0373937_0530734 3300036401 Bacteria 1118
1037 Ga0373925_0058899 3300037068 Bacteria 2880
1038 Ga0373925_0066446 3300037068 Bacteria 2718
1039 Ga0395900_0122060 3300037418 Bacteria 2673
1040 Ga0395900_0783733 3300037418 Bacteria 882
1041 Ga0395900_0915953 3300037418 Bacteria 799
1042 Ga0395898_0004595 3300037466 Bacteria 15066
1043 Ga0395898_0040027 3300037466 Bacteria 4637
1044 Ga0395898_0600773 3300037466 Bacteria 1043
1045 Ga0395905_0564357 3300037471 Bacteria 1039
1046 Ga0395901_0069083 3300038443 Bacteria 3679
1047 Ga0395901_0647809 3300038443 Bacteria 1060
1048 Ga0400490_33220 3300038726 Bacteria 6130
1049 Ga0400489_08172 3300039093 Unclassified 1202
1050 Ga0436365_0156685 3300039437 Bacteria 3714
1051 Ga0436365_1114791 3300039437 Bacteria 2348
1052 Ga0436365_1381219 3300039437 Bacteria 2155
1053 Ga0436361_1141223 3300039447 Bacteria 1726
1054 Ga0436363_0928702 3300039450 Bacteria 16814
1055 Ga0436363_1474853 3300039450 Bacteria 914
1056 Ga0436362_0154352 3300039453 Unclassified 947
1057 Ga0451793_0431789 3300041452 Bacteria 2845
1058 Ga0451833_1277587 3300041491 Bacteria 806
1059 Ga0439449_0070955 3300042007 Bacteria 1283
1060 Ga0439454_045807 3300042011 Bacteria 727
1061 Ga0450898_008425 3300042134 Bacteria 1627
1062 Ga0450898_012876 3300042134 Bacteria 1388
1063 Ga0450899_002045 3300042135 Bacteria 2206
1064 Ga0451577_0037823 3300042876 Bacteria 4343
1065 Ga0451577_0114001 3300042876 Bacteria 2420
1066 Ga0451577_0328375 3300042876 Bacteria 1387
1067 Ga0466969_0003588 3300044656 Bacteria 8258
1068 Ga0466969_0023342 3300044656 Bacteria 3188
1069 Ga0466969_0180061 3300044656 Bacteria 967
1070 Ga0466969_0439084 3300044656 Bacteria 593
1071 Ga0466972_0396462 3300044658 Unclassified 647
1072 Ga0466966_0004679 3300044684 Bacteria 9007
1073 Ga0466966_0203258 3300044684 Bacteria 1198
1074 Ga0466961_0001475 3300044693 Bacteria 14616
1075 Ga0466961_0409039 3300044693 Unclassified 823
1076 Ga0466963_0124996 3300044694 Bacteria 1773
1077 Ga0466963_0521274 3300044694 Bacteria 839
1078 Ga0466964_0201810 3300044706 Bacteria 955
1079 Ga0453684_0870244 3300044712 Bacteria 967
1080 Ga0466968_0047446 3300044735 Bacteria 1826
1081 Ga0466968_0280150 3300044735 Bacteria 798
1082 Ga0466970_0002321 3300044765 Bacteria 9201
1083 Ga0466970_0095419 3300044765 Bacteria 1617
1084 Ga0466957_0007878 3300044842 Bacteria 6041
1085 Ga0466960_0024148 3300044901 Unclassified 2740
1086 Ga0466959_0001315 3300045049 Bacteria 15080
1087 Ga0466959_0002720 3300045049 Bacteria 11365
1088 Ga0466959_0010842 3300045049 Bacteria 6534
1089 Ga0466959_0178889 3300045049 Bacteria 1484
1090 Ga0451576_0000591 3300045051 Bacteria 76735
1091 Ga0451576_0013581 3300045051 Bacteria 9103
1092 Ga0451576_0018342 3300045051 Bacteria 7673
1093 Ga0451576_0030006 3300045051 Bacteria 5815
1094 Ga0451576_0033083 3300045051 Bacteria 5498
1095 Ga0451576_0163308 3300045051 Bacteria 2324
1096 Ga0451576_0199268 3300045051 Bacteria 2091
1097 Ga0466958_0298518 3300045836 Bacteria 1034
1098 Ga0466967_0091590 3300045976 Bacteria 2763
1099 Ga0495603_0060321 3300046455 Bacteria 2241
1100 Ga0495629_0353060 3300046459 Bacteria 1003
1101 Ga0495650_0011479 3300046471 Bacteria 4848
1102 Ga0495580_0002401 3300046472 Bacteria 16370
1103 Ga0495580_0108946 3300046472 Bacteria 1923
1104 Ga0495580_0125935 3300046472 Bacteria 1778
1105 Ga0495582_0002681 3300046473 Bacteria 9941
1106 Ga0495605_0005593 3300046474 Bacteria 7304
1107 Ga0495639_0010818 3300046475 Bacteria 3929
1108 Ga0495630_0162589 3300046517 Bacteria 1700
1109 Ga0495630_0241906 3300046517 Bacteria 1379
1110 Ga0495632_0021443 3300046519 Bacteria 3481
1111 Ga0495632_0113877 3300046519 Bacteria 1268
1112 Ga0495637_0189779 3300046520 Bacteria 759
1113 Ga0495643_0075120 3300046522 Bacteria 1769
1114 Ga0495663_0037546 3300046525 Bacteria 1461
1115 Ga0495666_0140253 3300046526 Bacteria 1127
1116 Ga0495642_0010583 3300046528 Bacteria 3531
1117 Ga0495642_0190245 3300046528 Bacteria 894
1118 Ga0495652_0419272 3300046529 Bacteria 944
1119 Ga0495654_0054129 3300046530 Bacteria 1947
1120 Ga0495665_0062581 3300046531 Bacteria 1964
1121 Ga0495586_0116243 3300046535 Bacteria 1492
1122 Ga0495587_0029063 3300046536 Bacteria 3358
1123 Ga0495609_0011815 3300046538 Bacteria 4151
1124 Ga0495597_0003397 3300046542 Bacteria 9325
1125 Ga0495645_0167346 3300046543 Bacteria 1515
1126 Ga0495667_0282411 3300046559 Bacteria 1054
1127 Ga0495668_0015861 3300046616 Bacteria 4389
1128 Ga0495588_0153073 3300046674 Bacteria 1219
1129 Ga0495657_0213861 3300046675 Bacteria 1171
1130 Ga0495647_0000294 3300046681 Bacteria 13945
1131 Ga0495647_0044897 3300046681 Unclassified 1696
1132 Ga0495658_0001291 3300046683 Bacteria 13127
1133 Ga0495658_0027053 3300046683 Unclassified 3081
1134 Ga0495613_0337883 3300046689 Bacteria 1037
1135 Ga0495660_0002717 3300046810 Bacteria 11176
1136 Ga0495672_0000005 3300047320 Bacteria 593294
1137 Ga0495672_0001899 3300047320 Bacteria 19877
1138 Ga0495672_0042277 3300047320 Bacteria 2749
1139 Ga0495687_082136 3300047443 Bacteria 1259
1140 Ga0495673_0254598 3300047469 Bacteria 640
1141 Ga0495684_0860086 3300047471 Bacteria 587
1142 Ga0495686_0003885 3300047472 Bacteria 12612
1143 Ga0495602_0033497 3300048088 Bacteria 4819
1144 Ga0496100_0105239 3300048903 Unclassified 1951
1145 Ga0496100_0275956 3300048903 Unclassified 1252
1146 Ga0496100_0447117 3300048903 Bacteria 990
1147 Ga0496101_0100364 3300048904 Bacteria 2165
1148 Ga0496101_0147189 3300048904 Unclassified 1799
1149 Ga0496102_0002718 3300048905 Bacteria 15055
1150 Ga0496102_0051658 3300048905 Bacteria 3745
1151 Ga0496102_0098098 3300048905 Bacteria 2719
1152 Ga0496102_0205073 3300048905 Bacteria 1859
1153 Ga0496102_0590860 3300048905 Bacteria 1033
1154 Ga0496103_0574953 3300048906 Bacteria 719
1155 Ga0496104_0000057 3300048907 Bacteria 119211
1156 Ga0496104_0020259 3300048907 Bacteria 6094
1157 Ga0496104_0089411 3300048907 Unclassified 2942
1158 Ga0496104_0230594 3300048907 Unclassified 1763
1159 Ga0496105_0000037 3300048908 Bacteria 119355
1160 Ga0496105_0016608 3300048908 Bacteria 5878
1161 Ga0496105_0182731 3300048908 Unclassified 1717
1162 Ga0496106_0156225 3300048909 Bacteria 1801
1163 Ga0496107_0029643 3300048910 Bacteria 3895
1164 Ga0496107_0138031 3300048910 Bacteria 1802
1165 Ga0496107_0275915 3300048910 Bacteria 1251
1166 Ga0496108_0162165 3300048911 Bacteria 1933
1167 Ga0496110_0099276 3300048913 Bacteria 2610
1168 Ga0496110_0498904 3300048913 Unclassified 1108
1169 Ga0496112_0069044 3300048915 Bacteria 3491
1170 Ga0496112_0933676 3300048915 Bacteria 789
1171 Ga0496113_0056503 3300048916 Bacteria 2947
1172 Ga0496113_0241312 3300048916 Bacteria 1442
1173 Ga0496114_0002741 3300048917 Bacteria 13470
1174 Ga0496114_0082700 3300048917 Bacteria 2714
1175 Ga0496114_0135184 3300048917 Bacteria 2132
1176 Ga0496115_0001447 3300048918 Bacteria 17021
1177 Ga0496115_0029891 3300048918 Bacteria 4283
1178 Ga0496115_0168120 3300048918 Bacteria 1813
1179 Ga0496116_0071859 3300048919 Unclassified 2189
1180 Ga0496117_0000341 3300048920 Bacteria 82537
1181 Ga0496117_0043096 3300048920 Bacteria 3286
1182 Ga0496118_0000040 3300048921 Bacteria 304516
1183 Ga0496118_0000177 3300048921 Bacteria 114183
1184 Ga0496118_0212822 3300048921 Bacteria 1133
1185 Ga0496119_0007132 3300048922 Bacteria 10145
1186 Ga0496119_0014164 3300048922 Bacteria 6266
1187 Ga0496119_0039068 3300048922 Bacteria 3054
1188 Ga0496120_0000104 3300048923 Bacteria 140731
1189 Ga0496120_0034285 3300048923 Unclassified 3042
1190 Ga0496121_0000461 3300048924 Bacteria 79954
1191 Ga0496121_0260493 3300048924 Unclassified 1197
1192 Ga0496121_0303877 3300048924 Bacteria 1081
1193 Ga0496122_0003660 3300048925 Bacteria 19965
1194 Ga0496123_0002907 3300048926 Bacteria 20040
1195 Ga0496124_0026681 3300048927 Bacteria 5205
1196 Ga0496125_0003262 3300048928 Bacteria 19974
1197 Ga0496125_0026201 3300048928 Bacteria 5319
1198 Ga0496125_0127104 3300048928 Unclassified 1804
1199 Ga0496126_0000033 3300048929 Bacteria 368851
1200 Ga0496126_0003314 3300048929 Bacteria 20493
1201 Ga0496126_0316066 3300048929 Bacteria 1285
1202 Ga0496126_0341246 3300048929 Unclassified 1227
1203 Ga0496126_0697206 3300048929 Bacteria 789
1204 Ga0501031_0052525 3300049568 Bacteria 2655
1205 Ga0501032_0027287 3300049569 Bacteria 3924
1206 Ga0501032_0055635 3300049569 Bacteria 2661
1207 Ga0501032_0189705 3300049569 Bacteria 1344
1208 Ga0501033_0000452 3300049570 Bacteria 38998
1209 Ga0501033_0120582 3300049570 Bacteria 1903
1210 Ga0501034_0000271 3300049571 Bacteria 93642
1211 Ga0501034_0001616 3300049571 Bacteria 29285
1212 Ga0501034_0014776 3300049571 Bacteria 8034
1213 Ga0501034_0029300 3300049571 Bacteria 5594
1214 Ga0501036_0020074 3300049572 Bacteria 5610
1215 Ga0501036_0066062 3300049572 Bacteria 3060
1216 Ga0501036_0086385 3300049572 Bacteria 2651
1217 Ga0501037_0037467 3300049573 Bacteria 3575
1218 Ga0501037_0138728 3300049573 Bacteria 1741
1219 Ga0501037_0197579 3300049573 Bacteria 1422
1220 Ga0501037_0276150 3300049573 Bacteria 1171
1221 Ga0501038_0018576 3300049574 Bacteria 6279
1222 Ga0501038_0051770 3300049574 Bacteria 3541
1223 Ga0501038_0190088 3300049574 Bacteria 1652
1224 Ga0501039_0009617 3300049575 Bacteria 7369
1225 Ga0501039_0055363 3300049575 Bacteria 3071
1226 Ga0501039_0065098 3300049575 Bacteria 2827
1227 Ga0501039_0117745 3300049575 Bacteria 2080
1228 Ga0501040_0009597 3300049576 Bacteria 6313
1229 Ga0501040_0028892 3300049576 Bacteria 3739
1230 Ga0501040_0059125 3300049576 Bacteria 2633
1231 Ga0501041_0000050 3300049577 Bacteria 41953
1232 Ga0501041_0029732 3300049577 Bacteria 3296
1233 Ga0501041_0107750 3300049577 Bacteria 1728
1234 Ga0501042_0006907 3300049578 Bacteria 7406
1235 Ga0501042_0049862 3300049578 Bacteria 2987
1236 Ga0501043_0027263 3300049579 Bacteria 4486
1237 Ga0501043_0072306 3300049579 Unclassified 2709
1238 Ga0501043_0074971 3300049579 Bacteria 2657
1239 Ga0501043_0176979 3300049579 Bacteria 1663
1240 Ga0501046_0007806 3300049580 Bacteria 9388
1241 Ga0501046_0018878 3300049580 Bacteria 5726
1242 Ga0501046_0048360 3300049580 Bacteria 3368
1243 Ga0501046_0088394 3300049580 Bacteria 2386
1244 Ga0501046_0149207 3300049580 Bacteria 1764
1245 Ga0501046_0172910 3300049580 Bacteria 1619
1246 Ga0501047_0040904 3300049581 Bacteria 4481
1247 Ga0501048_0001673 3300049582 Bacteria 16880
1248 Ga0501048_0027659 3300049582 Bacteria 4118
1249 Ga0501048_0371118 3300049582 Bacteria 1021
1250 Ga0501067_0031052 3300049583 Bacteria 2964
1251 Ga0501067_0057595 3300049583 Bacteria 2152
1252 Ga0501067_0108625 3300049583 Bacteria 1542
1253 Ga0501068_0002836 3300049584 Bacteria 9217
1254 Ga0501068_0010590 3300049584 Bacteria 5184
1255 Ga0501068_0225231 3300049584 Bacteria 1192
1256 Ga0501069_0013919 3300049585 Bacteria 4295
1257 Ga0501069_0060034 3300049585 Bacteria 2123
1258 Ga0501069_0366525 3300049585 Bacteria 850
1259 Ga0501070_0005864 3300049586 Bacteria 10472
1260 Ga0501070_0011077 3300049586 Bacteria 7612
1261 Ga0501070_0057789 3300049586 Bacteria 3216
1262 Ga0501070_0065445 3300049586 Bacteria 3009
1263 Ga0501071_0010917 3300049587 Bacteria 6096
1264 Ga0501071_0021306 3300049587 Bacteria 4512
1265 Ga0501071_0280770 3300049587 Bacteria 1260
1266 Ga0501072_0007002 3300049588 Bacteria 8559
1267 Ga0501072_0015532 3300049588 Bacteria 5833
1268 Ga0501072_0024479 3300049588 Bacteria 4696
1269 Ga0501072_0033288 3300049588 Bacteria 4038
1270 Ga0501073_0002525 3300049589 Bacteria 13676
1271 Ga0501073_0010355 3300049589 Bacteria 6840
1272 Ga0501073_0086470 3300049589 Bacteria 2180
1273 Ga0501073_0091287 3300049589 Bacteria 2117
1274 Ga0501073_0234581 3300049589 Bacteria 1267
1275 Ga0501073_0358313 3300049589 Bacteria 1007
1276 Ga0501074_0003899 3300049590 Bacteria 10631
1277 Ga0501074_0010393 3300049590 Bacteria 6752
1278 Ga0501074_0015179 3300049590 Bacteria 5600
1279 Ga0501074_0026691 3300049590 Bacteria 4187
1280 Ga0501074_0031193 3300049590 Bacteria 3861
1281 Ga0501075_0040580 3300049591 Bacteria 3486
1282 Ga0501075_0642298 3300049591 Bacteria 809
1283 Ga0501076_0001007 3300049592 Bacteria 18491
1284 Ga0501076_0036252 3300049592 Bacteria 3863
1285 Ga0501077_0030407 3300049593 Bacteria 3436
1286 Ga0501077_0037274 3300049593 Bacteria 3097
1287 Ga0501079_0013126 3300049741 Bacteria 6315
1288 Ga0501079_0022356 3300049741 Bacteria 4848
1289 Ga0501079_0041104 3300049741 Bacteria 3568
1290 Ga0501079_0524046 3300049741 Bacteria 932
1291 Ga0501080_0001341 3300049742 Bacteria 20533
1292 Ga0501080_0032728 3300049742 Bacteria 4850
1293 Ga0501080_0081356 3300049742 Bacteria 3009
1294 Ga0501080_0139579 3300049742 Bacteria 2241
1295 Ga0501080_0227520 3300049742 Bacteria 1705
1296 Ga0501080_0311510 3300049742 Bacteria 1426
1297 Ga0501080_0643012 3300049742 Bacteria 939
1298 Ga0501081_0020917 3300049743 Bacteria 4366
1299 Ga0501081_0030309 3300049743 Bacteria 3661
1300 Ga0501081_0061427 3300049743 Bacteria 2605
1301 Ga0501083_0029797 3300049744 Bacteria 3750
1302 Ga0501083_0070793 3300049744 Bacteria 2319
1303 Ga0501083_0074059 3300049744 Bacteria 2263
1304 Ga0501083_0230586 3300049744 Unclassified 1206
1305 Ga0501280_000177 3300049776 Bacteria 16204
1306 Ga0501035_0046239 3300049822 Bacteria 3915
1307 Ga0501035_0061276 3300049822 Bacteria 3348
1308 Ga0501035_0067300 3300049822 Bacteria 3179
1309 Ga0501035_0816944 3300049822 Bacteria 744
1310 Ga0501044_0007685 3300049823 Bacteria 11854
1311 Ga0501044_0031221 3300049823 Bacteria 5608
1312 Ga0501044_0032246 3300049823 Bacteria 5509
1313 Ga0501044_0090191 3300049823 Bacteria 3093
1314 Ga0501044_0231457 3300049823 Bacteria 1795
1315 Ga0501044_0235564 3300049823 Bacteria 1776
1316 Ga0501044_0404166 3300049823 Bacteria 1278
1317 Ga0501045_0005762 3300049824 Bacteria 8572
1318 Ga0501045_0010833 3300049824 Bacteria 6391
1319 nmdc:mga03n38_311336_c1 3300050490 Bacteria 848
1320 nmdc:mga00v17_647481_c1 3300050491 Bacteria 680
1321 nmdc:mga05p37_1125_c1 3300050507 Bacteria 30729
1322 nmdc:mga09592_14474_c1 3300050508 Bacteria 6438
1323 nmdc:mga09592_569_c1 3300050508 Bacteria 27993
1324 nmdc:mga0qj67_103247_c1 3300050509 Bacteria 2299
1325 nmdc:mga0qj67_13748_c1 3300050509 Bacteria 6110
1326 nmdc:mga0qj67_280501_c1 3300050509 Bacteria 1350
1327 nmdc:mga0qj67_42867_c1 3300050509 Bacteria 3563
1328 nmdc:mga06r32_2566_c2 3300050510 Bacteria 10511
1329 nmdc:mga06r32_29616_c1 3300050510 Bacteria 5133
1330 nmdc:mga08y16_65452_c1 3300050511 Bacteria 3795
1331 nmdc:mga08y16_9655_c1 3300050511 Bacteria 10133
1332 nmdc:mga0n895_1048_c1 3300050512 Bacteria 20116
1333 nmdc:mga0n895_1110381_c1 3300050512 Unclassified 768
1334 nmdc:mga0n895_624176_c1 3300050512 Bacteria 1078
1335 nmdc:mga0rr50_231_c1 3300050513 Bacteria 30232
1336 nmdc:mga0rr50_247089_c1 3300050513 Bacteria 1480
1337 nmdc:mga08x19_12588_c1 3300050514 Bacteria 5101
1338 nmdc:mga08x19_53809_c1 3300050514 Bacteria 1802
1339 nmdc:mga08x19_613902_c1 3300050514 Unclassified 771
1340 nmdc:mga0a205_1314_c1 3300050515 Bacteria 20915
1341 nmdc:mga0a205_191945_c1 3300050515 Bacteria 1934
1342 nmdc:mga0a205_259261_c1 3300050515 Bacteria 1616
1343 Ga0495612_0047775 3300053078 Bacteria 1754
1344 Ga0500635_0058213 3300053080 Bacteria 1341
1345 Ga0500643_000888 3300053087 Bacteria 18939
1346 Ga0500646_0069217 3300053090 Unclassified 1055
1347 Ga0500583_0006623 3300053092 Bacteria 4003
1348 Ga0500583_0062470 3300053092 Archaea 1761
1349 Ga0500583_0350760 3300053092 Bacteria 715
1350 Ga0500651_0266820 3300053093 Bacteria 991
1351 Ga0500651_0271844 3300053093 Unclassified 980
1352 Ga0500566_0199167 3300053094 Bacteria 1013
1353 Ga0500640_180125 3300053095 Bacteria 767
1354 Ga0500641_0015545 3300053096 Bacteria 2828
1355 Ga0500641_0024813 3300053096 Bacteria 2314
1356 Ga0500641_0124551 3300053096 Unclassified 1111
1357 Ga0500556_0089753 3300053104 Bacteria 1172
1358 Ga0500562_077998 3300053108 Bacteria 896
1359 Ga0500594_0014629 3300053118 Bacteria 1882
1360 Ga0500597_000045 3300053120 Bacteria 23880
1361 Ga0500608_146414 3300053122 Bacteria 1041
1362 Ga0500642_0067380 3300053130 Bacteria 1622
1363 Ga0500658_0157713 3300053134 Bacteria 1026
1364 Ga0500658_0203293 3300053134 Unclassified 906
1365 Ga0500559_0004817 3300053136 Bacteria 6306
1366 Ga0500559_0102263 3300053136 Bacteria 1321
1367 Ga0500559_0158397 3300053136 Bacteria 1064
1368 Ga0500564_087245 3300053138 Bacteria 1393
1369 Ga0500568_0001101 3300053139 Bacteria 18206
1370 Ga0500568_0006248 3300053139 Bacteria 6013
1371 Ga0500568_0024339 3300053139 Bacteria 2565
1372 Ga0500588_0008394 3300053146 Bacteria 2410
1373 Ga0500588_0012580 3300053146 Bacteria 2102
1374 Ga0500616_0000042 3300053153 Bacteria 351293
1375 Ga0500616_0086876 3300053153 Bacteria 1558
1376 Ga0500619_241971 3300053154 Bacteria 596
1377 Ga0500620_088140 3300053155 Bacteria 1080
1378 Ga0500622_0000001 3300053156 Bacteria 657715
1379 Ga0500622_0003346 3300053156 Bacteria 10802
1380 Ga0500622_0012222 3300053156 Bacteria 4656
1381 Ga0500622_0027408 3300053156 Bacteria 3003
1382 Ga0500627_0048857 3300053158 Bacteria 1839
1383 Ga0500630_062394 3300053159 Bacteria 1779
1384 Ga0500637_0008617 3300053178 Bacteria 5156
1385 Ga0500637_0009768 3300053178 Bacteria 4899
1386 Ga0500637_0225699 3300053178 Bacteria 1057
1387 Ga0501084_0014889 3300054114 Bacteria 6449
1388 Ga0501084_0030772 3300054114 Bacteria 4488
1389 Ga0501084_0080593 3300054114 Bacteria 2730
1390 Ga0501084_0099388 3300054114 Unclassified 2443
1391 Ga0501084_0231826 3300054114 Bacteria 1558
1392 Ga0501082_0000960 3300060353 Bacteria 25510
1393 Ga0501082_0004924 3300060353 Bacteria 11652
1394 Ga0501082_0040179 3300060353 Bacteria 4035
1395 Ga0501082_0143325 3300060353 Bacteria 2073
1396 Ga0501082_0383691 3300060353 Bacteria 1226
1397 Ga0466962_0003791 3300061719 Bacteria 7218
1398 Ga0530510_0004144 3300061734 Bacteria 10010
1399 Ga0530510_0044737 3300061734 Bacteria 3199

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0439084 Ga0466969_0439084_27_578 183
2 3300044658 Ga0466972_0396462 Ga0466972_0396462_78_629 183
3 3300047471 Ga0495684_0860086 Ga0495684_0860086_18_572 184
4 3300048907 Ga0496104_0089411 Ga0496104_0089411_2323_2880 185
5 3300048918 Ga0496115_0168120 Ga0496115_0168120_1207_1764 185
6 3300026121 Ga0207683_10142466 Ga0207683_101424663 188
7 3300049573 Ga0501037_0276150 Ga0501037_0276150_575_1144 189
8 3300046528 Ga0495642_0190245 Ga0495642_0190245_11_586 191
9 3300047469 Ga0495673_0254598 Ga0495673_0254598_12_587 191
10 3300053080 Ga0500635_0058213 Ga0500635_0058213_12_587 191
11 3300053154 Ga0500619_241971 Ga0500619_241971_11_586 191
12 3300044735 Ga0466968_0280150 Ga0466968_0280150_22_663 192
13 3300046559 Ga0495667_0282411 Ga0495667_0282411_447_1025 192
14 3300005536 Ga0070697_100001052 Ga0070697_1000010525 193
15 3300025910 Ga0207684_10306741 Ga0207684_103067412 193
16 3300005367 Ga0070667_100306634 Ga0070667_1003066342 195
17 3300009174 Ga0105241_10393632 Ga0105241_103936322 195
18 3300025911 Ga0207654_10017918 Ga0207654_100179182 195
19 3300042007 Ga0439449_0070955 Ga0439449_0070955_18_605 195
20 3300042011 Ga0439454_045807 Ga0439454_045807_124_711 195
21 3300048906 Ga0496103_0574953 Ga0496103_0574953_110_697 195
22 3300050490 nmdc:mga03n38_311336_c1 nmdc:mga03n38_311336_c1_10_597 195
23 3300050491 nmdc:mga00v17_647481_c1 nmdc:mga00v17_647481_c1_19_606 195
24 3300031911 Ga0307412_10121269 Ga0307412_101212692 197
25 3300053178 Ga0500637_0008617 Ga0500637_0008617_45_638 197
26 3300037418 Ga0395900_0783733 Ga0395900_0783733_264_866 200
27 3300025913 Ga0207695_10034290 Ga0207695_100342906 202
28 3300005295 Ga0065707_10003345 Ga0065707_100033454 204
29 3300005330 Ga0070690_100001163 Ga0070690_10000116311 204
30 3300005334 Ga0068869_100006160 Ga0068869_1000061603 204
31 3300005335 Ga0070666_10050785 Ga0070666_100507852 204
32 3300005336 Ga0070680_100000328 Ga0070680_10000032828 204
33 3300005338 Ga0068868_100004838 Ga0068868_1000048383 204
34 3300005340 Ga0070689_100000808 Ga0070689_10000080814 204
35 3300005343 Ga0070687_100006496 Ga0070687_1000064963 204
36 3300005345 Ga0070692_10003532 Ga0070692_100035322 204
37 3300005355 Ga0070671_100175490 Ga0070671_1001754902 204
38 3300005438 Ga0070701_10001734 Ga0070701_100017343 204
39 3300005440 Ga0070705_100003056 Ga0070705_1000030567 204
40 3300005441 Ga0070700_100009709 Ga0070700_1000097094 204
41 3300005444 Ga0070694_100007336 Ga0070694_1000073366 204
42 3300005445 Ga0070708_100382496 Ga0070708_1003824962 204
43 3300005456 Ga0070678_100193876 Ga0070678_1001938762 204
44 3300005458 Ga0070681_10294324 Ga0070681_102943243 204
45 3300005459 Ga0068867_100004294 Ga0068867_1000042947 204
46 3300005530 Ga0070679_100034771 Ga0070679_1000347716 204
47 3300005536 Ga0070697_100155183 Ga0070697_1001551833 204
48 3300005543 Ga0070672_100508041 Ga0070672_1005080411 204
49 3300005544 Ga0070686_100003546 Ga0070686_1000035463 204
50 3300005545 Ga0070695_100003361 Ga0070695_1000033617 204
51 3300005546 Ga0070696_100001008 Ga0070696_1000010086 204
52 3300005546 Ga0070696_100002669 Ga0070696_1000026697 204
53 3300005547 Ga0070693_100000825 Ga0070693_1000008253 204
54 3300005549 Ga0070704_100002536 Ga0070704_1000025366 204
55 3300005563 Ga0068855_100002124 Ga0068855_10000212423 204
56 3300005578 Ga0068854_100010253 Ga0068854_1000102533 204
57 3300005614 Ga0068856_100072866 Ga0068856_1000728663 204
58 3300005617 Ga0068859_100010070 Ga0068859_1000100707 204
59 3300005718 Ga0068866_10000333 Ga0068866_1000033310 204
60 3300005719 Ga0068861_100004296 Ga0068861_1000042963 204
61 3300005840 Ga0068870_10121700 Ga0068870_101217002 204
62 3300005842 Ga0068858_100013550 Ga0068858_1000135507 204
63 3300005843 Ga0068860_100010441 Ga0068860_1000104413 204
64 3300005844 Ga0068862_100009147 Ga0068862_1000091473 204
65 3300006237 Ga0097621_100007088 Ga0097621_1000070887 204
66 3300006358 Ga0068871_100000969 Ga0068871_10000096911 204
67 3300006844 Ga0075428_100000333 Ga0075428_10000033318 204
68 3300006871 Ga0075434_100936425 Ga0075434_1009364252 204
69 3300006880 Ga0075429_100000477 Ga0075429_10000047715 204
70 3300006881 Ga0068865_100003778 Ga0068865_1000037783 204
71 3300006931 Ga0097620_100010069 Ga0097620_1000100697 204
72 3300025885 Ga0207653_10006095 Ga0207653_100060953 204
73 3300025899 Ga0207642_10008464 Ga0207642_100084642 204
74 3300025911 Ga0207654_10368781 Ga0207654_103687812 204
75 3300025912 Ga0207707_10211547 Ga0207707_102115472 204
76 3300025917 Ga0207660_10003459 Ga0207660_1000345911 204
77 3300025918 Ga0207662_10000272 Ga0207662_1000027216 204
78 3300025921 Ga0207652_10024110 Ga0207652_100241106 204
79 3300025927 Ga0207687_10006587 Ga0207687_100065873 204
80 3300025931 Ga0207644_10371924 Ga0207644_103719242 204
81 3300025934 Ga0207686_10032683 Ga0207686_100326834 204
82 3300025935 Ga0207709_10002912 Ga0207709_100029127 204
83 3300025936 Ga0207670_10009145 Ga0207670_100091452 204
84 3300025938 Ga0207704_10040831 Ga0207704_100408313 204
85 3300025941 Ga0207711_10438297 Ga0207711_104382972 204
86 3300025942 Ga0207689_10000500 Ga0207689_1000050029 204
87 3300025949 Ga0207667_10036094 Ga0207667_100360942 204
88 3300025961 Ga0207712_10256931 Ga0207712_102569312 204
89 3300025981 Ga0207640_10029061 Ga0207640_100290614 204
90 3300026023 Ga0207677_10020816 Ga0207677_100208164 204
91 3300026035 Ga0207703_10007882 Ga0207703_100078824 204
92 3300026075 Ga0207708_10000658 Ga0207708_1000065816 204
93 3300026078 Ga0207702_10053927 Ga0207702_100539273 204
94 3300026088 Ga0207641_10086190 Ga0207641_100861904 204
95 3300026089 Ga0207648_10000691 Ga0207648_1000069110 204
96 3300026118 Ga0207675_100000807 Ga0207675_10000080724 204
97 3300026121 Ga0207683_10800093 Ga0207683_108000931 204
98 3300026142 Ga0207698_10174781 Ga0207698_101747812 204
99 3300027907 Ga0207428_10000517 Ga0207428_1000051741 204
100 3300028380 Ga0268265_10008585 Ga0268265_100085856 204
101 3300028381 Ga0268264_10012057 Ga0268264_100120576 204
102 3300035088 Ga0373940_0001743 Ga0373940_0001743_1990_2604 204
103 3300035171 Ga0373946_0093277 Ga0373946_0093277_15_629 204
104 3300046531 Ga0495665_0062581 Ga0495665_0062581_1338_1952 204
105 3300050512 nmdc:mga0n895_1110381_c1 nmdc:mga0n895_1110381_c1_68_682 204
106 3300035695 Ga0373927_0040503 Ga0373927_0040503_1470_2087 205
107 3300044656 Ga0466969_0180061 Ga0466969_0180061_152_769 205
108 3300005328 Ga0070676_10066124 Ga0070676_100661242 206
109 3300005336 Ga0070680_100747050 Ga0070680_1007470502 206
110 3300005340 Ga0070689_100010778 Ga0070689_1000107782 206
111 3300005341 Ga0070691_10108121 Ga0070691_101081212 206
112 3300005356 Ga0070674_100248966 Ga0070674_1002489662 206
113 3300005440 Ga0070705_100086646 Ga0070705_1000866462 206
114 3300005441 Ga0070700_100000639 Ga0070700_10000063914 206
115 3300005441 Ga0070700_100007562 Ga0070700_1000075626 206
116 3300005444 Ga0070694_100010030 Ga0070694_1000100304 206
117 3300005457 Ga0070662_100008490 Ga0070662_1000084905 206
118 3300005459 Ga0068867_100001914 Ga0068867_1000019143 206
119 3300005459 Ga0068867_100304702 Ga0068867_1003047022 206
120 3300005467 Ga0070706_100020626 Ga0070706_1000206262 206
121 3300005468 Ga0070707_100013162 Ga0070707_1000131627 206
122 3300005546 Ga0070696_100067218 Ga0070696_1000672182 206
123 3300005547 Ga0070693_100116822 Ga0070693_1001168221 206
124 3300005548 Ga0070665_100238398 Ga0070665_1002383983 206
125 3300005615 Ga0070702_100000314 Ga0070702_10000031410 206
126 3300005617 Ga0068859_100011465 Ga0068859_1000114651 206
127 3300005719 Ga0068861_100004393 Ga0068861_10000439310 206
128 3300005719 Ga0068861_100832208 Ga0068861_1008322081 206
129 3300006237 Ga0097621_100290405 Ga0097621_1002904052 206
130 3300006846 Ga0075430_100340961 Ga0075430_1003409612 206
131 3300006931 Ga0097620_100011465 Ga0097620_10001146510 206
132 3300007265 Ga0099794_10013916 Ga0099794_100139163 206
133 3300007265 Ga0099794_10162671 Ga0099794_101626711 206
134 3300009098 Ga0105245_10203016 Ga0105245_102030162 206
135 3300009176 Ga0105242_10111092 Ga0105242_101110924 206
136 3300009177 Ga0105248_10029394 Ga0105248_100293942 206
137 3300009553 Ga0105249_10025839 Ga0105249_100258393 206
138 3300013105 Ga0157369_11187569 Ga0157369_111875691 206
139 3300013296 Ga0157374_10142473 Ga0157374_101424732 206
140 3300013297 Ga0157378_10182022 Ga0157378_101820221 206
141 3300013308 Ga0157375_10040107 Ga0157375_100401072 206
142 3300014325 Ga0163163_11457579 Ga0163163_114575791 206
143 3300014326 Ga0157380_10142946 Ga0157380_101429462 206
144 3300014968 Ga0157379_10168163 Ga0157379_101681632 206
145 3300014969 Ga0157376_10124591 Ga0157376_101245912 206
146 3300025899 Ga0207642_10106494 Ga0207642_101064941 206
147 3300025922 Ga0207646_10010165 Ga0207646_100101653 206
148 3300025934 Ga0207686_10024104 Ga0207686_100241042 206
149 3300025981 Ga0207640_11162751 Ga0207640_111627511 206
150 3300026067 Ga0207678_10113347 Ga0207678_101133472 206
151 3300026089 Ga0207648_10074652 Ga0207648_100746523 206
152 3300028380 Ga0268265_10083213 Ga0268265_100832133 206
153 3300028800 Ga0265338_10125188 Ga0265338_101251882 206
154 3300031247 Ga0265340_10023312 Ga0265340_100233122 206
155 3300031250 Ga0265331_10022810 Ga0265331_100228102 206
156 3300036401 Ga0373937_0305271 Ga0373937_0305271_675_1295 206
157 3300044712 Ga0453684_0870244 Ga0453684_0870244_103_723 206
158 3300045051 Ga0451576_0000591 Ga0451576_0000591_58317_58937 206
159 3300047472 Ga0495686_0003885 Ga0495686_0003885_6835_7455 206
160 3300005333 Ga0070677_10117647 Ga0070677_101176471 207
161 3300005334 Ga0068869_100331895 Ga0068869_1003318951 207
162 3300005356 Ga0070674_100509188 Ga0070674_1005091881 207
163 3300005441 Ga0070700_100225789 Ga0070700_1002257892 207
164 3300005459 Ga0068867_100000215 Ga0068867_10000021517 207
165 3300005543 Ga0070672_100307253 Ga0070672_1003072532 207
166 3300005718 Ga0068866_10390896 Ga0068866_103908962 207
167 3300005719 Ga0068861_100003357 Ga0068861_1000033572 207
168 3300005842 Ga0068858_100052211 Ga0068858_1000522113 207
169 3300005843 Ga0068860_100001625 Ga0068860_1000016259 207
170 3300005844 Ga0068862_100360679 Ga0068862_1003606791 207
171 3300006881 Ga0068865_100018214 Ga0068865_1000182145 207
172 3300009553 Ga0105249_10600045 Ga0105249_106000451 207
173 3300013296 Ga0157374_10390390 Ga0157374_103903902 207
174 3300013297 Ga0157378_10018683 Ga0157378_100186831 207
175 3300013306 Ga0163162_10000655 Ga0163162_1000065516 207
176 3300013308 Ga0157375_10059781 Ga0157375_100597811 207
177 3300014326 Ga0157380_10221542 Ga0157380_102215422 207
178 3300014968 Ga0157379_10152569 Ga0157379_101525692 207
179 3300014969 Ga0157376_10432823 Ga0157376_104328232 207
180 3300017792 Ga0163161_10147642 Ga0163161_101476421 207
181 3300025937 Ga0207669_10120086 Ga0207669_101200861 207
182 3300025938 Ga0207704_10002779 Ga0207704_100027795 207
183 3300025940 Ga0207691_10051522 Ga0207691_100515221 207
184 3300025961 Ga0207712_10184634 Ga0207712_101846341 207
185 3300026035 Ga0207703_10130337 Ga0207703_101303372 207
186 3300026067 Ga0207678_10132131 Ga0207678_101321312 207
187 3300026075 Ga0207708_10265054 Ga0207708_102650541 207
188 3300026089 Ga0207648_10010090 Ga0207648_100100908 207
189 3300026118 Ga0207675_100012946 Ga0207675_1000129461 207
190 3300028381 Ga0268264_10054472 Ga0268264_100544723 207
191 3300045051 Ga0451576_0030006 Ga0451576_0030006_5156_5785 207
192 3300049568 Ga0501031_0052525 Ga0501031_0052525_1715_2371 207
193 3300049569 Ga0501032_0027287 Ga0501032_0027287_2594_3250 207
194 3300049569 Ga0501032_0055635 Ga0501032_0055635_1358_1999 207
195 3300049570 Ga0501033_0000452 Ga0501033_0000452_25115_25756 207
196 3300049570 Ga0501033_0120582 Ga0501033_0120582_1014_1670 207
197 3300049571 Ga0501034_0001616 Ga0501034_0001616_24836_25477 207
198 3300049571 Ga0501034_0029300 Ga0501034_0029300_486_1142 207
199 3300049572 Ga0501036_0020074 Ga0501036_0020074_3099_3740 207
200 3300049572 Ga0501036_0086385 Ga0501036_0086385_234_890 207
201 3300049573 Ga0501037_0037467 Ga0501037_0037467_1759_2400 207
202 3300049574 Ga0501038_0051770 Ga0501038_0051770_1860_2501 207
203 3300049574 Ga0501038_0190088 Ga0501038_0190088_511_1167 207
204 3300049575 Ga0501039_0055363 Ga0501039_0055363_933_1589 207
205 3300049575 Ga0501039_0117745 Ga0501039_0117745_1267_1908 207
206 3300049576 Ga0501040_0059125 Ga0501040_0059125_1395_2051 207
207 3300049579 Ga0501043_0074971 Ga0501043_0074971_240_896 207
208 3300049580 Ga0501046_0007806 Ga0501046_0007806_7718_8374 207
209 3300049580 Ga0501046_0018878 Ga0501046_0018878_1069_1710 207
210 3300049581 Ga0501047_0040904 Ga0501047_0040904_1648_2304 207
211 3300049582 Ga0501048_0001673 Ga0501048_0001673_11147_11803 207
212 3300049583 Ga0501067_0031052 Ga0501067_0031052_233_889 207
213 3300049583 Ga0501067_0057595 Ga0501067_0057595_895_1536 207
214 3300049584 Ga0501068_0010590 Ga0501068_0010590_2594_3250 207
215 3300049585 Ga0501069_0013919 Ga0501069_0013919_3007_3663 207
216 3300049585 Ga0501069_0060034 Ga0501069_0060034_324_965 207
217 3300049586 Ga0501070_0005864 Ga0501070_0005864_684_1325 207
218 3300049586 Ga0501070_0065445 Ga0501070_0065445_1551_2207 207
219 3300049587 Ga0501071_0280770 Ga0501071_0280770_34_675 207
220 3300049588 Ga0501072_0024479 Ga0501072_0024479_2593_3249 207
221 3300049589 Ga0501073_0010355 Ga0501073_0010355_2108_2749 207
222 3300049589 Ga0501073_0086470 Ga0501073_0086470_511_1167 207
223 3300049590 Ga0501074_0010393 Ga0501074_0010393_4861_5517 207
224 3300049590 Ga0501074_0026691 Ga0501074_0026691_1827_2468 207
225 3300049591 Ga0501075_0642298 Ga0501075_0642298_32_688 207
226 3300049741 Ga0501079_0022356 Ga0501079_0022356_1236_1892 207
227 3300049742 Ga0501080_0032728 Ga0501080_0032728_2904_3545 207
228 3300049742 Ga0501080_0311510 Ga0501080_0311510_285_941 207
229 3300049743 Ga0501081_0061427 Ga0501081_0061427_1608_2264 207
230 3300049744 Ga0501083_0029797 Ga0501083_0029797_2522_3178 207
231 3300049744 Ga0501083_0230586 Ga0501083_0230586_64_687 207
232 3300049822 Ga0501035_0061276 Ga0501035_0061276_1045_1701 207
233 3300049823 Ga0501044_0007685 Ga0501044_0007685_10529_11170 207
234 3300049823 Ga0501044_0031221 Ga0501044_0031221_568_1224 207
235 3300049823 Ga0501044_0032246 Ga0501044_0032246_3212_3853 207
236 3300049823 Ga0501044_0235564 Ga0501044_0235564_263_898 207
237 3300054114 Ga0501084_0231826 Ga0501084_0231826_908_1543 207
238 3300060353 Ga0501082_0143325 Ga0501082_0143325_1384_2040 207
239 3300060353 Ga0501082_0383691 Ga0501082_0383691_293_934 207
240 3300005334 Ga0068869_100226422 Ga0068869_1002264222 208
241 3300005337 Ga0070682_100041903 Ga0070682_1000419032 208
242 3300005337 Ga0070682_100453223 Ga0070682_1004532232 208
243 3300005341 Ga0070691_10372584 Ga0070691_103725841 208
244 3300005444 Ga0070694_100417947 Ga0070694_1004179472 208
245 3300005539 Ga0068853_100734729 Ga0068853_1007347291 208
246 3300005615 Ga0070702_100000566 Ga0070702_1000005667 208
247 3300005617 Ga0068859_100040261 Ga0068859_1000402613 208
248 3300005618 Ga0068864_100031075 Ga0068864_1000310752 208
249 3300005842 Ga0068858_100054276 Ga0068858_1000542764 208
250 3300005843 Ga0068860_100339493 Ga0068860_1003394932 208
251 3300006852 Ga0075433_10029610 Ga0075433_100296104 208
252 3300006871 Ga0075434_100000495 Ga0075434_10000049527 208
253 3300006914 Ga0075436_100002774 Ga0075436_1000027745 208
254 3300006931 Ga0097620_100040259 Ga0097620_1000402594 208
255 3300007076 Ga0075435_100000068 Ga0075435_10000006834 208
256 3300009094 Ga0111539_10045784 Ga0111539_100457844 208
257 3300009098 Ga0105245_10004310 Ga0105245_100043109 208
258 3300009147 Ga0114129_10001303 Ga0114129_1000130320 208
259 3300009148 Ga0105243_10001971 Ga0105243_1000197111 208
260 3300009174 Ga0105241_10116442 Ga0105241_101164422 208
261 3300009176 Ga0105242_10003377 Ga0105242_100033774 208
262 3300009177 Ga0105248_10369011 Ga0105248_103690113 208
263 3300009553 Ga0105249_10005746 Ga0105249_100057468 208
264 3300010375 Ga0105239_10061287 Ga0105239_100612873 208
265 3300013297 Ga0157378_10004986 Ga0157378_1000498610 208
266 3300013306 Ga0163162_10055888 Ga0163162_100558883 208
267 3300014326 Ga0157380_10030105 Ga0157380_100301054 208
268 3300014968 Ga0157379_10138037 Ga0157379_101380374 208
269 3300014969 Ga0157376_10028411 Ga0157376_100284112 208
270 3300025315 Ga0207697_10196894 Ga0207697_101968941 208
271 3300025918 Ga0207662_10244702 Ga0207662_102447022 208
272 3300025939 Ga0207665_10048364 Ga0207665_100483641 208
273 3300025960 Ga0207651_10060059 Ga0207651_100600592 208
274 3300026035 Ga0207703_10016871 Ga0207703_100168714 208
275 3300026095 Ga0207676_10023693 Ga0207676_100236931 208
276 3300027512 Ga0209179_1006553 Ga0209179_10065532 208
277 3300027907 Ga0207428_10081765 Ga0207428_100817653 208
278 3300028381 Ga0268264_10054578 Ga0268264_100545782 208
279 3300034817 Ga0373948_0002595 Ga0373948_0002595_1080_1718 208
280 3300034957 Ga0373938_0018408 Ga0373938_0018408_260_898 208
281 3300035083 Ga0373926_0025722 Ga0373926_0025722_1044_1682 208
282 3300035085 Ga0373929_0016925 Ga0373929_0016925_584_1222 208
283 3300035089 Ga0373944_0063706 Ga0373944_0063706_387_1025 208
284 3300035090 Ga0373949_0029291 Ga0373949_0029291_527_1165 208
285 3300035112 Ga0373932_0002612 Ga0373932_0002612_873_1511 208
286 3300035114 Ga0373939_0006299 Ga0373939_0006299_120_758 208
287 3300035170 Ga0373943_0335919 Ga0373943_0335919_41_679 208
288 3300035207 Ga0373942_0005432 Ga0373942_0005432_784_1422 208
289 3300035241 Ga0373961_0015744 Ga0373961_0015744_24_662 208
290 3300035410 Ga0373924_0076261 Ga0373924_0076261_171_809 208
291 3300035691 Ga0373931_0003258 Ga0373931_0003258_4674_5312 208
292 3300035691 Ga0373931_0015354 Ga0373931_0015354_88_726 208
293 3300035692 Ga0373935_0046162 Ga0373935_0046162_1976_2614 208
294 3300035695 Ga0373927_0014409 Ga0373927_0014409_3788_4426 208
295 3300035725 Ga0373947_0011471 Ga0373947_0011471_1636_2274 208
296 3300037068 Ga0373925_0066446 Ga0373925_0066446_265_903 208
297 3300042876 Ga0451577_0328375 Ga0451577_0328375_156_794 208
298 3300045051 Ga0451576_0013581 Ga0451576_0013581_523_1161 208
299 3300045051 Ga0451576_0018342 Ga0451576_0018342_4096_4734 208
300 3300045051 Ga0451576_0163308 Ga0451576_0163308_929_1567 208
301 3300045051 Ga0451576_0199268 Ga0451576_0199268_1247_1885 208
302 3300046455 Ga0495603_0060321 Ga0495603_0060321_704_1342 208
303 3300046472 Ga0495580_0002401 Ga0495580_0002401_8876_9514 208
304 3300046473 Ga0495582_0002681 Ga0495582_0002681_1966_2604 208
305 3300046475 Ga0495639_0010818 Ga0495639_0010818_3165_3803 208
306 3300046517 Ga0495630_0162589 Ga0495630_0162589_734_1372 208
307 3300046525 Ga0495663_0037546 Ga0495663_0037546_213_851 208
308 3300046526 Ga0495666_0140253 Ga0495666_0140253_387_1025 208
309 3300046681 Ga0495647_0000294 Ga0495647_0000294_4377_5015 208
310 3300046683 Ga0495658_0001291 Ga0495658_0001291_11388_12026 208
311 3300050507 nmdc:mga05p37_1125_c1 nmdc:mga05p37_1125_c1_16150_16788 208
312 3300050508 nmdc:mga09592_569_c1 nmdc:mga09592_569_c1_27281_27919 208
313 3300050511 nmdc:mga08y16_65452_c1 nmdc:mga08y16_65452_c1_1518_2156 208
314 3300050511 nmdc:mga08y16_9655_c1 nmdc:mga08y16_9655_c1_8144_8782 208
315 3300050512 nmdc:mga0n895_1048_c1 nmdc:mga0n895_1048_c1_6941_7579 208
316 3300050513 nmdc:mga0rr50_231_c1 nmdc:mga0rr50_231_c1_2501_3139 208
317 3300050514 nmdc:mga08x19_12588_c1 nmdc:mga08x19_12588_c1_1241_1879 208
318 3300050515 nmdc:mga0a205_1314_c1 nmdc:mga0a205_1314_c1_18891_19529 208
319 3300050515 nmdc:mga0a205_259261_c1 nmdc:mga0a205_259261_c1_261_899 208
320 3300002773 JGI25152J39213_1004771 JGI25152J39213_10047712 209
321 3300005336 Ga0070680_100073856 Ga0070680_1000738562 209
322 3300005347 Ga0070668_100004999 Ga0070668_1000049996 209
323 3300005434 Ga0070709_10030183 Ga0070709_100301833 209
324 3300005435 Ga0070714_100288211 Ga0070714_1002882112 209
325 3300005439 Ga0070711_100219328 Ga0070711_1002193282 209
326 3300005458 Ga0070681_10019844 Ga0070681_100198442 209
327 3300005518 Ga0070699_100150335 Ga0070699_1001503352 209
328 3300005530 Ga0070679_100119594 Ga0070679_1001195942 209
329 3300005548 Ga0070665_100002532 Ga0070665_10000253216 209
330 3300005548 Ga0070665_100117630 Ga0070665_1001176302 209
331 3300005617 Ga0068859_100034444 Ga0068859_1000344442 209
332 3300005617 Ga0068859_100222828 Ga0068859_1002228282 209
333 3300005841 Ga0068863_100613344 Ga0068863_1006133442 209
334 3300005842 Ga0068858_100307749 Ga0068858_1003077492 209
335 3300005843 Ga0068860_100652988 Ga0068860_1006529882 209
336 3300005844 Ga0068862_100000047 Ga0068862_10000004743 209
337 3300005844 Ga0068862_100450900 Ga0068862_1004509002 209
338 3300006931 Ga0097620_100034444 Ga0097620_1000344442 209
339 3300006931 Ga0097620_100222829 Ga0097620_1002228292 209
340 3300009176 Ga0105242_10002390 Ga0105242_1000239016 209
341 3300009545 Ga0105237_10180192 Ga0105237_101801921 209
342 3300010375 Ga0105239_10062131 Ga0105239_100621315 209
343 3300014968 Ga0157379_10809862 Ga0157379_108098622 209
344 3300025906 Ga0207699_10030107 Ga0207699_100301073 209
345 3300025909 Ga0207705_10228576 Ga0207705_102285762 209
346 3300025912 Ga0207707_10015018 Ga0207707_100150188 209
347 3300025916 Ga0207663_10097806 Ga0207663_100978063 209
348 3300025917 Ga0207660_10067866 Ga0207660_100678662 209
349 3300025929 Ga0207664_10055342 Ga0207664_100553423 209
350 3300025934 Ga0207686_10018285 Ga0207686_100182853 209
351 3300025986 Ga0207658_10855159 Ga0207658_108551591 209
352 3300026035 Ga0207703_10346221 Ga0207703_103462212 209
353 3300026089 Ga0207648_10462034 Ga0207648_104620341 209
354 3300028379 Ga0268266_10028889 Ga0268266_100288897 209
355 3300028379 Ga0268266_10517250 Ga0268266_105172501 209
356 3300028380 Ga0268265_10001639 Ga0268265_100016395 209
357 3300028381 Ga0268264_10038908 Ga0268264_100389082 209
358 3300028381 Ga0268264_10561114 Ga0268264_105611142 209
359 3300030744 Ga0316181_1238965 Ga0316181_12389652 209
360 3300037418 Ga0395900_0122060 Ga0395900_0122060_1401_2036 209
361 3300037418 Ga0395900_0915953 Ga0395900_0915953_137_766 209
362 3300037471 Ga0395905_0564357 Ga0395905_0564357_206_835 209
363 3300038443 Ga0395901_0069083 Ga0395901_0069083_1751_2386 209
364 3300038443 Ga0395901_0647809 Ga0395901_0647809_242_871 209
365 3300041491 Ga0451833_1277587 Ga0451833_1277587_136_765 209
366 3300042134 Ga0450898_012876 Ga0450898_012876_370_999 209
367 3300042135 Ga0450899_002045 Ga0450899_002045_821_1450 209
368 3300049744 Ga0501083_0070793 Ga0501083_0070793_593_1222 209
369 3300053078 Ga0495612_0047775 Ga0495612_0047775_615_1244 209
370 3300053122 Ga0500608_146414 Ga0500608_146414_83_721 209
371 3300053136 Ga0500559_0004817 Ga0500559_0004817_2947_3576 209
372 3300053138 Ga0500564_087245 Ga0500564_087245_195_824 209
373 3300053153 Ga0500616_0086876 Ga0500616_0086876_371_1000 209
374 3300005293 Ga0065715_10132582 Ga0065715_101325822 210
375 3300005327 Ga0070658_10566646 Ga0070658_105666461 210
376 3300005329 Ga0070683_100241146 Ga0070683_1002411463 210
377 3300005330 Ga0070690_100002453 Ga0070690_1000024534 210
378 3300005331 Ga0070670_100003232 Ga0070670_10000323213 210
379 3300005334 Ga0068869_100000413 Ga0068869_10000041316 210
380 3300005334 Ga0068869_100138782 Ga0068869_1001387821 210
381 3300005335 Ga0070666_10021006 Ga0070666_100210062 210
382 3300005337 Ga0070682_100431152 Ga0070682_1004311521 210
383 3300005338 Ga0068868_100055054 Ga0068868_1000550543 210
384 3300005338 Ga0068868_100087858 Ga0068868_1000878584 210
385 3300005338 Ga0068868_100146683 Ga0068868_1001466831 210
386 3300005338 Ga0068868_100307108 Ga0068868_1003071081 210
387 3300005339 Ga0070660_100276766 Ga0070660_1002767662 210
388 3300005340 Ga0070689_100050579 Ga0070689_1000505792 210
389 3300005340 Ga0070689_100318636 Ga0070689_1003186362 210
390 3300005344 Ga0070661_100026423 Ga0070661_1000264232 210
391 3300005344 Ga0070661_100028573 Ga0070661_1000285732 210
392 3300005344 Ga0070661_100437490 Ga0070661_1004374902 210
393 3300005345 Ga0070692_10066941 Ga0070692_100669412 210
394 3300005353 Ga0070669_100612518 Ga0070669_1006125182 210
395 3300005356 Ga0070674_100032815 Ga0070674_1000328152 210
396 3300005356 Ga0070674_100225680 Ga0070674_1002256802 210
397 3300005366 Ga0070659_100066915 Ga0070659_1000669152 210
398 3300005367 Ga0070667_100000125 Ga0070667_10000012559 210
399 3300005367 Ga0070667_100010921 Ga0070667_1000109212 210
400 3300005367 Ga0070667_100077330 Ga0070667_1000773302 210
401 3300005367 Ga0070667_100101495 Ga0070667_1001014953 210
402 3300005367 Ga0070667_100258541 Ga0070667_1002585412 210
403 3300005367 Ga0070667_100292182 Ga0070667_1002921822 210
404 3300005434 Ga0070709_10137316 Ga0070709_101373162 210
405 3300005436 Ga0070713_100214398 Ga0070713_1002143982 210
406 3300005438 Ga0070701_10000305 Ga0070701_100003058 210
407 3300005439 Ga0070711_100077155 Ga0070711_1000771552 210
408 3300005439 Ga0070711_100256580 Ga0070711_1002565801 210
409 3300005441 Ga0070700_100283650 Ga0070700_1002836502 210
410 3300005445 Ga0070708_100530653 Ga0070708_1005306532 210
411 3300005455 Ga0070663_100000058 Ga0070663_10000005812 210
412 3300005455 Ga0070663_100004878 Ga0070663_1000048785 210
413 3300005455 Ga0070663_100024628 Ga0070663_1000246281 210
414 3300005456 Ga0070678_100004422 Ga0070678_1000044224 210
415 3300005458 Ga0070681_10001021 Ga0070681_1000102117 210
416 3300005458 Ga0070681_10041337 Ga0070681_100413374 210
417 3300005458 Ga0070681_10076832 Ga0070681_100768323 210
418 3300005459 Ga0068867_100348490 Ga0068867_1003484902 210
419 3300005466 Ga0070685_10003480 Ga0070685_100034808 210
420 3300005466 Ga0070685_10037479 Ga0070685_100374791 210
421 3300005471 Ga0070698_100162444 Ga0070698_1001624442 210
422 3300005530 Ga0070679_100249922 Ga0070679_1002499222 210
423 3300005535 Ga0070684_100209374 Ga0070684_1002093741 210
424 3300005536 Ga0070697_100546010 Ga0070697_1005460102 210
425 3300005539 Ga0068853_100000693 Ga0068853_10000069317 210
426 3300005539 Ga0068853_100016591 Ga0068853_1000165914 210
427 3300005539 Ga0068853_100136353 Ga0068853_1001363532 210
428 3300005543 Ga0070672_100331601 Ga0070672_1003316012 210
429 3300005544 Ga0070686_100000567 Ga0070686_1000005675 210
430 3300005547 Ga0070693_100009595 Ga0070693_1000095952 210
431 3300005547 Ga0070693_100012126 Ga0070693_1000121264 210
432 3300005548 Ga0070665_100000108 Ga0070665_10000010810 210
433 3300005548 Ga0070665_100001482 Ga0070665_1000014825 210
434 3300005548 Ga0070665_100436606 Ga0070665_1004366062 210
435 3300005548 Ga0070665_100451796 Ga0070665_1004517962 210
436 3300005548 Ga0070665_100924215 Ga0070665_1009242152 210
437 3300005563 Ga0068855_100050449 Ga0068855_1000504496 210
438 3300005563 Ga0068855_100155182 Ga0068855_1001551823 210
439 3300005563 Ga0068855_100246680 Ga0068855_1002466802 210
440 3300005563 Ga0068855_100369041 Ga0068855_1003690411 210
441 3300005564 Ga0070664_100013749 Ga0070664_1000137498 210
442 3300005577 Ga0068857_100026375 Ga0068857_1000263753 210
443 3300005577 Ga0068857_100080275 Ga0068857_1000802752 210
444 3300005577 Ga0068857_100232515 Ga0068857_1002325151 210
445 3300005577 Ga0068857_100252505 Ga0068857_1002525052 210
446 3300005578 Ga0068854_100009719 Ga0068854_1000097194 210
447 3300005614 Ga0068856_100149751 Ga0068856_1001497512 210
448 3300005614 Ga0068856_100803593 Ga0068856_1008035932 210
449 3300005616 Ga0068852_100005452 Ga0068852_1000054526 210
450 3300005616 Ga0068852_100035762 Ga0068852_1000357621 210
451 3300005616 Ga0068852_100124687 Ga0068852_1001246872 210
452 3300005617 Ga0068859_100896348 Ga0068859_1008963481 210
453 3300005618 Ga0068864_100118817 Ga0068864_1001188172 210
454 3300005618 Ga0068864_100132657 Ga0068864_1001326572 210
455 3300005718 Ga0068866_10000974 Ga0068866_100009745 210
456 3300005834 Ga0068851_10000982 Ga0068851_100009827 210
457 3300005840 Ga0068870_10008535 Ga0068870_100085354 210
458 3300005840 Ga0068870_10088680 Ga0068870_100886801 210
459 3300005841 Ga0068863_100367282 Ga0068863_1003672822 210
460 3300005842 Ga0068858_100001325 Ga0068858_10000132514 210
461 3300005842 Ga0068858_100029017 Ga0068858_1000290171 210
462 3300005842 Ga0068858_100071203 Ga0068858_1000712031 210
463 3300005842 Ga0068858_100132503 Ga0068858_1001325032 210
464 3300005842 Ga0068858_100345751 Ga0068858_1003457512 210
465 3300005843 Ga0068860_100027640 Ga0068860_1000276404 210
466 3300005843 Ga0068860_100161469 Ga0068860_1001614692 210
467 3300005843 Ga0068860_100163602 Ga0068860_1001636022 210
468 3300005843 Ga0068860_100563722 Ga0068860_1005637222 210
469 3300005844 Ga0068862_100028994 Ga0068862_1000289943 210
470 3300005844 Ga0068862_100074583 Ga0068862_1000745835 210
471 3300005844 Ga0068862_100107621 Ga0068862_1001076214 210
472 3300005937 Ga0081455_10190045 Ga0081455_101900452 210
473 3300005983 Ga0081540_1065880 Ga0081540_10658802 210
474 3300006175 Ga0070712_100077127 Ga0070712_1000771272 210
475 3300006175 Ga0070712_100151496 Ga0070712_1001514962 210
476 3300006237 Ga0097621_100002218 Ga0097621_1000022184 210
477 3300006237 Ga0097621_100166131 Ga0097621_1001661312 210
478 3300006237 Ga0097621_100964467 Ga0097621_1009644672 210
479 3300006358 Ga0068871_100004832 Ga0068871_1000048322 210
480 3300006358 Ga0068871_100006522 Ga0068871_1000065229 210
481 3300006358 Ga0068871_100197865 Ga0068871_1001978651 210
482 3300006358 Ga0068871_100286067 Ga0068871_1002860672 210
483 3300006844 Ga0075428_100093192 Ga0075428_1000931924 210
484 3300006846 Ga0075430_100111521 Ga0075430_1001115212 210
485 3300006847 Ga0075431_100217208 Ga0075431_1002172082 210
486 3300006871 Ga0075434_100334352 Ga0075434_1003343522 210
487 3300006880 Ga0075429_100586378 Ga0075429_1005863782 210
488 3300006881 Ga0068865_100002291 Ga0068865_1000022912 210
489 3300006881 Ga0068865_100051283 Ga0068865_1000512832 210
490 3300006881 Ga0068865_100107831 Ga0068865_1001078312 210
491 3300006914 Ga0075436_100029310 Ga0075436_1000293102 210
492 3300006931 Ga0097620_100303407 Ga0097620_1003034072 210
493 3300006931 Ga0097620_100896385 Ga0097620_1008963851 210
494 3300006948 Ga0099826_10049432 Ga0099826_100494322 210
495 3300007076 Ga0075435_100259239 Ga0075435_1002592392 210
496 3300009093 Ga0105240_10001278 Ga0105240_100012786 210
497 3300009093 Ga0105240_10146293 Ga0105240_101462933 210
498 3300009093 Ga0105240_10249057 Ga0105240_102490573 210
499 3300009093 Ga0105240_11321165 Ga0105240_113211651 210
500 3300009098 Ga0105245_10000182 Ga0105245_1000018243 210
501 3300009148 Ga0105243_10001035 Ga0105243_1000103522 210
502 3300009174 Ga0105241_10007691 Ga0105241_100076916 210
503 3300009174 Ga0105241_10017197 Ga0105241_100171972 210
504 3300009176 Ga0105242_10000907 Ga0105242_100009079 210
505 3300009176 Ga0105242_10011646 Ga0105242_100116462 210
506 3300009176 Ga0105242_10199222 Ga0105242_101992222 210
507 3300009177 Ga0105248_10004329 Ga0105248_100043294 210
508 3300009177 Ga0105248_10054720 Ga0105248_100547202 210
509 3300009177 Ga0105248_10993144 Ga0105248_109931441 210
510 3300009545 Ga0105237_10003176 Ga0105237_1000317617 210
511 3300009545 Ga0105237_10047664 Ga0105237_100476643 210
512 3300009545 Ga0105237_10290539 Ga0105237_102905392 210
513 3300009545 Ga0105237_10319673 Ga0105237_103196732 210
514 3300009551 Ga0105238_10000785 Ga0105238_1000078514 210
515 3300009551 Ga0105238_10032728 Ga0105238_100327285 210
516 3300009551 Ga0105238_10055319 Ga0105238_100553192 210
517 3300009551 Ga0105238_10247258 Ga0105238_102472582 210
518 3300009553 Ga0105249_10000648 Ga0105249_1000064831 210
519 3300009553 Ga0105249_10006096 Ga0105249_100060967 210
520 3300009553 Ga0105249_10350065 Ga0105249_103500652 210
521 3300009553 Ga0105249_10534141 Ga0105249_105341412 210
522 3300010375 Ga0105239_10008370 Ga0105239_100083703 210
523 3300010375 Ga0105239_10010816 Ga0105239_100108166 210
524 3300010375 Ga0105239_10034090 Ga0105239_100340902 210
525 3300010375 Ga0105239_10735161 Ga0105239_107351611 210
526 3300011119 Ga0105246_10070670 Ga0105246_100706702 210
527 3300013105 Ga0157369_10000463 Ga0157369_1000046324 210
528 3300013105 Ga0157369_10340343 Ga0157369_103403431 210
529 3300013296 Ga0157374_10005459 Ga0157374_100054592 210
530 3300013296 Ga0157374_10206770 Ga0157374_102067702 210
531 3300013296 Ga0157374_10311935 Ga0157374_103119352 210
532 3300013296 Ga0157374_10600132 Ga0157374_106001322 210
533 3300013297 Ga0157378_10013646 Ga0157378_100136464 210
534 3300013297 Ga0157378_10223018 Ga0157378_102230183 210
535 3300013306 Ga0163162_10078684 Ga0163162_100786842 210
536 3300013306 Ga0163162_10206757 Ga0163162_102067572 210
537 3300013306 Ga0163162_10253767 Ga0163162_102537672 210
538 3300013307 Ga0157372_10088473 Ga0157372_100884733 210
539 3300013307 Ga0157372_10123362 Ga0157372_101233624 210
540 3300013307 Ga0157372_10151453 Ga0157372_101514533 210
541 3300013307 Ga0157372_10285620 Ga0157372_102856202 210
542 3300013307 Ga0157372_10308655 Ga0157372_103086551 210
543 3300013307 Ga0157372_10496608 Ga0157372_104966082 210
544 3300013308 Ga0157375_10000702 Ga0157375_1000070218 210
545 3300014497 Ga0182008_10063136 Ga0182008_100631362 210
546 3300014968 Ga0157379_10056253 Ga0157379_100562532 210
547 3300014968 Ga0157379_10078689 Ga0157379_100786892 210
548 3300014968 Ga0157379_10345698 Ga0157379_103456982 210
549 3300014969 Ga0157376_10985537 Ga0157376_109855371 210
550 3300017792 Ga0163161_10166753 Ga0163161_101667532 210
551 3300025261 Ga0209233_1008257 Ga0209233_10082574 210
552 3300025321 Ga0207656_10004335 Ga0207656_100043353 210
553 3300025321 Ga0207656_10120861 Ga0207656_101208611 210
554 3300025899 Ga0207642_10006422 Ga0207642_100064221 210
555 3300025899 Ga0207642_10158482 Ga0207642_101584822 210
556 3300025901 Ga0207688_10163660 Ga0207688_101636601 210
557 3300025901 Ga0207688_10439916 Ga0207688_104399162 210
558 3300025903 Ga0207680_10003078 Ga0207680_100030787 210
559 3300025903 Ga0207680_10058406 Ga0207680_100584064 210
560 3300025904 Ga0207647_10002915 Ga0207647_1000291511 210
561 3300025906 Ga0207699_10473271 Ga0207699_104732712 210
562 3300025907 Ga0207645_10024898 Ga0207645_100248983 210
563 3300025908 Ga0207643_10071126 Ga0207643_100711262 210
564 3300025908 Ga0207643_10088987 Ga0207643_100889871 210
565 3300025911 Ga0207654_10034353 Ga0207654_100343532 210
566 3300025912 Ga0207707_10020159 Ga0207707_100201594 210
567 3300025912 Ga0207707_10021490 Ga0207707_100214907 210
568 3300025912 Ga0207707_10048203 Ga0207707_100482033 210
569 3300025913 Ga0207695_10000033 Ga0207695_10000033365 210
570 3300025913 Ga0207695_10001393 Ga0207695_1000139315 210
571 3300025913 Ga0207695_10005921 Ga0207695_100059215 210
572 3300025913 Ga0207695_10088396 Ga0207695_100883964 210
573 3300025913 Ga0207695_10090031 Ga0207695_100900312 210
574 3300025914 Ga0207671_10000363 Ga0207671_1000036338 210
575 3300025914 Ga0207671_10007676 Ga0207671_100076762 210
576 3300025914 Ga0207671_10026162 Ga0207671_100261623 210
577 3300025914 Ga0207671_10034031 Ga0207671_100340315 210
578 3300025915 Ga0207693_10234635 Ga0207693_102346351 210
579 3300025916 Ga0207663_10098857 Ga0207663_100988572 210
580 3300025916 Ga0207663_10547479 Ga0207663_105474792 210
581 3300025917 Ga0207660_10088676 Ga0207660_100886762 210
582 3300025920 Ga0207649_10036204 Ga0207649_100362042 210
583 3300025920 Ga0207649_10041331 Ga0207649_100413312 210
584 3300025920 Ga0207649_10249268 Ga0207649_102492682 210
585 3300025921 Ga0207652_10136359 Ga0207652_101363592 210
586 3300025924 Ga0207694_10000460 Ga0207694_1000046012 210
587 3300025924 Ga0207694_10002668 Ga0207694_1000266811 210
588 3300025924 Ga0207694_10003738 Ga0207694_100037389 210
589 3300025924 Ga0207694_10212590 Ga0207694_102125902 210
590 3300025924 Ga0207694_10216251 Ga0207694_102162512 210
591 3300025924 Ga0207694_10388954 Ga0207694_103889543 210
592 3300025925 Ga0207650_10009991 Ga0207650_100099912 210
593 3300025927 Ga0207687_10001796 Ga0207687_100017968 210
594 3300025932 Ga0207690_10083834 Ga0207690_100838342 210
595 3300025932 Ga0207690_10221107 Ga0207690_102211071 210
596 3300025933 Ga0207706_10052916 Ga0207706_100529162 210
597 3300025934 Ga0207686_10000437 Ga0207686_100004379 210
598 3300025934 Ga0207686_10256350 Ga0207686_102563502 210
599 3300025934 Ga0207686_10576788 Ga0207686_105767882 210
600 3300025936 Ga0207670_10014761 Ga0207670_100147612 210
601 3300025937 Ga0207669_10258130 Ga0207669_102581302 210
602 3300025938 Ga0207704_10017876 Ga0207704_100178762 210
603 3300025940 Ga0207691_10065302 Ga0207691_100653023 210
604 3300025941 Ga0207711_10004901 Ga0207711_1000490110 210
605 3300025941 Ga0207711_10013075 Ga0207711_100130755 210
606 3300025941 Ga0207711_10171916 Ga0207711_101719162 210
607 3300025941 Ga0207711_10203674 Ga0207711_102036742 210
608 3300025942 Ga0207689_10000269 Ga0207689_1000026944 210
609 3300025942 Ga0207689_10006515 Ga0207689_100065156 210
610 3300025942 Ga0207689_10058057 Ga0207689_100580572 210
611 3300025942 Ga0207689_10158405 Ga0207689_101584052 210
612 3300025944 Ga0207661_10144587 Ga0207661_101445872 210
613 3300025945 Ga0207679_10009993 Ga0207679_100099933 210
614 3300025945 Ga0207679_10062681 Ga0207679_100626813 210
615 3300025949 Ga0207667_10076782 Ga0207667_100767822 210
616 3300025949 Ga0207667_10278629 Ga0207667_102786292 210
617 3300025960 Ga0207651_10282192 Ga0207651_102821922 210
618 3300025961 Ga0207712_10000165 Ga0207712_1000016526 210
619 3300025961 Ga0207712_10000972 Ga0207712_100009723 210
620 3300025961 Ga0207712_10371497 Ga0207712_103714972 210
621 3300025972 Ga0207668_10054891 Ga0207668_100548913 210
622 3300025972 Ga0207668_10089493 Ga0207668_100894932 210
623 3300025981 Ga0207640_10052415 Ga0207640_100524151 210
624 3300025986 Ga0207658_10000050 Ga0207658_1000005068 210
625 3300025986 Ga0207658_10016117 Ga0207658_100161175 210
626 3300025986 Ga0207658_10027943 Ga0207658_100279432 210
627 3300025986 Ga0207658_10119689 Ga0207658_101196893 210
628 3300026023 Ga0207677_10015266 Ga0207677_100152662 210
629 3300026023 Ga0207677_10120175 Ga0207677_101201752 210
630 3300026035 Ga0207703_10000553 Ga0207703_1000055310 210
631 3300026035 Ga0207703_10020516 Ga0207703_100205162 210
632 3300026041 Ga0207639_10000217 Ga0207639_1000021723 210
633 3300026041 Ga0207639_10044273 Ga0207639_100442732 210
634 3300026041 Ga0207639_10047814 Ga0207639_100478143 210
635 3300026067 Ga0207678_10000336 Ga0207678_100003363 210
636 3300026067 Ga0207678_10005262 Ga0207678_1000526210 210
637 3300026067 Ga0207678_10136455 Ga0207678_101364552 210
638 3300026075 Ga0207708_10000163 Ga0207708_1000016317 210
639 3300026075 Ga0207708_10014206 Ga0207708_100142062 210
640 3300026078 Ga0207702_10060529 Ga0207702_100605292 210
641 3300026078 Ga0207702_10131771 Ga0207702_101317713 210
642 3300026078 Ga0207702_10235342 Ga0207702_102353422 210
643 3300026078 Ga0207702_10874391 Ga0207702_108743911 210
644 3300026078 Ga0207702_10925117 Ga0207702_109251172 210
645 3300026088 Ga0207641_10445228 Ga0207641_104452282 210
646 3300026088 Ga0207641_10576549 Ga0207641_105765492 210
647 3300026089 Ga0207648_10000059 Ga0207648_1000005946 210
648 3300026089 Ga0207648_10046516 Ga0207648_100465162 210
649 3300026089 Ga0207648_10379155 Ga0207648_103791552 210
650 3300026089 Ga0207648_10590508 Ga0207648_105905082 210
651 3300026095 Ga0207676_10203460 Ga0207676_102034601 210
652 3300026116 Ga0207674_10299578 Ga0207674_102995781 210
653 3300026118 Ga0207675_100000261 Ga0207675_10000026138 210
654 3300026118 Ga0207675_100048178 Ga0207675_1000481784 210
655 3300026118 Ga0207675_100184933 Ga0207675_1001849332 210
656 3300026121 Ga0207683_10023783 Ga0207683_100237832 210
657 3300026142 Ga0207698_10013791 Ga0207698_100137915 210
658 3300026142 Ga0207698_10119615 Ga0207698_101196152 210
659 3300026142 Ga0207698_10474546 Ga0207698_104745462 210
660 3300026142 Ga0207698_10799180 Ga0207698_107991801 210
661 3300028379 Ga0268266_10000001 Ga0268266_100000012024 210
662 3300028379 Ga0268266_10000006 Ga0268266_100000061159 210
663 3300028379 Ga0268266_10165290 Ga0268266_101652902 210
664 3300028379 Ga0268266_10179819 Ga0268266_101798192 210
665 3300028379 Ga0268266_10438189 Ga0268266_104381892 210
666 3300028380 Ga0268265_10013445 Ga0268265_100134452 210
667 3300028380 Ga0268265_10768888 Ga0268265_107688881 210
668 3300028381 Ga0268264_10015602 Ga0268264_100156022 210
669 3300028381 Ga0268264_10020180 Ga0268264_100201802 210
670 3300028381 Ga0268264_10096304 Ga0268264_100963042 210
671 3300028381 Ga0268264_10434502 Ga0268264_104345021 210
672 3300028381 Ga0268264_10512885 Ga0268264_105128852 210
673 3300031239 Ga0265328_10000002 Ga0265328_10000002192 210
674 3300031239 Ga0265328_10000206 Ga0265328_1000020626 210
675 3300031239 Ga0265328_10010275 Ga0265328_100102752 210
676 3300031241 Ga0265325_10020273 Ga0265325_100202732 210
677 3300031247 Ga0265340_10082764 Ga0265340_100827641 210
678 3300031250 Ga0265331_10000044 Ga0265331_10000044174 210
679 3300031250 Ga0265331_10003459 Ga0265331_100034593 210
680 3300031250 Ga0265331_10005137 Ga0265331_100051375 210
681 3300031251 Ga0265327_10000102 Ga0265327_1000010221 210
682 3300031251 Ga0265327_10001179 Ga0265327_1000117928 210
683 3300031251 Ga0265327_10001663 Ga0265327_1000166330 210
684 3300031251 Ga0265327_10003154 Ga0265327_1000315418 210
685 3300031251 Ga0265327_10022118 Ga0265327_100221182 210
686 3300031251 Ga0265327_10168569 Ga0265327_101685692 210
687 3300031456 Ga0307513_10493001 Ga0307513_104930011 210
688 3300031548 Ga0307408_100364640 Ga0307408_1003646402 210
689 3300031730 Ga0307516_10031976 Ga0307516_100319763 210
690 3300031730 Ga0307516_10034540 Ga0307516_100345402 210
691 3300031911 Ga0307412_10014886 Ga0307412_100148862 210
692 3300031911 Ga0307412_10025599 Ga0307412_100255995 210
693 3300031995 Ga0307409_100265157 Ga0307409_1002651572 210
694 3300032004 Ga0307414_10026588 Ga0307414_100265883 210
695 3300032005 Ga0307411_10142869 Ga0307411_101428692 210
696 3300032005 Ga0307411_11165891 Ga0307411_111658911 210
697 3300033179 Ga0307507_10099365 Ga0307507_100993652 210
698 3300035086 Ga0373934_0110224 Ga0373934_0110224_56_694 210
699 3300035410 Ga0373924_0180955 Ga0373924_0180955_240_872 210
700 3300035724 Ga0373933_0182207 Ga0373933_0182207_473_1117 210
701 3300036401 Ga0373937_0051456 Ga0373937_0051456_2095_2733 210
702 3300036401 Ga0373937_0530734 Ga0373937_0530734_449_1093 210
703 3300037068 Ga0373925_0058899 Ga0373925_0058899_1366_2004 210
704 3300038726 Ga0400490_33220 Ga0400490_33220_4469_5107 210
705 3300039093 Ga0400489_08172 Ga0400489_08172_333_971 210
706 3300039437 Ga0436365_1381219 Ga0436365_1381219_242_889 210
707 3300039447 Ga0436361_1141223 Ga0436361_1141223_580_1230 210
708 3300041452 Ga0451793_0431789 Ga0451793_0431789_1684_2346 210
709 3300042876 Ga0451577_0037823 Ga0451577_0037823_1119_1760 210
710 3300044694 Ga0466963_0124996 Ga0466963_0124996_926_1564 210
711 3300044694 Ga0466963_0521274 Ga0466963_0521274_104_742 210
712 3300045051 Ga0451576_0033083 Ga0451576_0033083_2409_3047 210
713 3300045976 Ga0466967_0091590 Ga0466967_0091590_784_1425 210
714 3300046459 Ga0495629_0353060 Ga0495629_0353060_75_713 210
715 3300046472 Ga0495580_0125935 Ga0495580_0125935_944_1582 210
716 3300046474 Ga0495605_0005593 Ga0495605_0005593_5982_6626 210
717 3300046517 Ga0495630_0241906 Ga0495630_0241906_64_711 210
718 3300046519 Ga0495632_0113877 Ga0495632_0113877_570_1214 210
719 3300046528 Ga0495642_0010583 Ga0495642_0010583_2206_2850 210
720 3300046529 Ga0495652_0419272 Ga0495652_0419272_266_907 210
721 3300046530 Ga0495654_0054129 Ga0495654_0054129_14_658 210
722 3300046535 Ga0495586_0116243 Ga0495586_0116243_661_1299 210
723 3300046538 Ga0495609_0011815 Ga0495609_0011815_3401_4045 210
724 3300046542 Ga0495597_0003397 Ga0495597_0003397_5772_6416 210
725 3300046543 Ga0495645_0167346 Ga0495645_0167346_832_1470 210
726 3300046616 Ga0495668_0015861 Ga0495668_0015861_654_1298 210
727 3300046674 Ga0495588_0153073 Ga0495588_0153073_238_876 210
728 3300046681 Ga0495647_0044897 Ga0495647_0044897_17_655 210
729 3300046683 Ga0495658_0027053 Ga0495658_0027053_2055_2693 210
730 3300046810 Ga0495660_0002717 Ga0495660_0002717_7770_8414 210
731 3300047320 Ga0495672_0000005 Ga0495672_0000005_29142_29786 210
732 3300047320 Ga0495672_0001899 Ga0495672_0001899_460_1104 210
733 3300048905 Ga0496102_0051658 Ga0496102_0051658_312_959 210
734 3300048905 Ga0496102_0205073 Ga0496102_0205073_242_886 210
735 3300048905 Ga0496102_0590860 Ga0496102_0590860_36_680 210
736 3300048907 Ga0496104_0000057 Ga0496104_0000057_107482_108120 210
737 3300048907 Ga0496104_0020259 Ga0496104_0020259_3174_3812 210
738 3300048908 Ga0496105_0000037 Ga0496105_0000037_107622_108260 210
739 3300048913 Ga0496110_0099276 Ga0496110_0099276_1681_2319 210
740 3300048916 Ga0496113_0241312 Ga0496113_0241312_389_1030 210
741 3300048917 Ga0496114_0135184 Ga0496114_0135184_820_1467 210
742 3300048918 Ga0496115_0001447 Ga0496115_0001447_7736_8383 210
743 3300048920 Ga0496117_0043096 Ga0496117_0043096_1234_1875 210
744 3300048921 Ga0496118_0000177 Ga0496118_0000177_24898_25539 210
745 3300048925 Ga0496122_0003660 Ga0496122_0003660_13056_13697 210
746 3300048926 Ga0496123_0002907 Ga0496123_0002907_6274_6915 210
747 3300048929 Ga0496126_0000033 Ga0496126_0000033_78606_79253 210
748 3300049571 Ga0501034_0000271 Ga0501034_0000271_16815_17459 210
749 3300049571 Ga0501034_0014776 Ga0501034_0014776_6495_7139 210
750 3300049573 Ga0501037_0197579 Ga0501037_0197579_413_1057 210
751 3300049579 Ga0501043_0176979 Ga0501043_0176979_868_1518 210
752 3300049580 Ga0501046_0048360 Ga0501046_0048360_433_1083 210
753 3300049580 Ga0501046_0172910 Ga0501046_0172910_966_1598 210
754 3300049582 Ga0501048_0371118 Ga0501048_0371118_287_931 210
755 3300049583 Ga0501067_0108625 Ga0501067_0108625_573_1217 210
756 3300049584 Ga0501068_0002836 Ga0501068_0002836_1873_2517 210
757 3300049586 Ga0501070_0011077 Ga0501070_0011077_6694_7338 210
758 3300049586 Ga0501070_0057789 Ga0501070_0057789_1432_2067 210
759 3300049588 Ga0501072_0015532 Ga0501072_0015532_1983_2627 210
760 3300049589 Ga0501073_0002525 Ga0501073_0002525_4499_5143 210
761 3300049589 Ga0501073_0091287 Ga0501073_0091287_1383_2033 210
762 3300049589 Ga0501073_0358313 Ga0501073_0358313_277_927 210
763 3300049590 Ga0501074_0003899 Ga0501074_0003899_5652_6287 210
764 3300049590 Ga0501074_0015179 Ga0501074_0015179_1047_1691 210
765 3300049741 Ga0501079_0524046 Ga0501079_0524046_141_785 210
766 3300049742 Ga0501080_0001341 Ga0501080_0001341_139_783 210
767 3300049742 Ga0501080_0139579 Ga0501080_0139579_580_1215 210
768 3300049742 Ga0501080_0643012 Ga0501080_0643012_100_744 210
769 3300049776 Ga0501280_000177 Ga0501280_000177_13316_13954 210
770 3300049822 Ga0501035_0816944 Ga0501035_0816944_10_693 210
771 3300049823 Ga0501044_0090191 Ga0501044_0090191_1067_1714 210
772 3300049823 Ga0501044_0231457 Ga0501044_0231457_77_727 210
773 3300049823 Ga0501044_0404166 Ga0501044_0404166_53_703 210
774 3300050509 nmdc:mga0qj67_103247_c1 nmdc:mga0qj67_103247_c1_434_1078 210
775 3300050509 nmdc:mga0qj67_280501_c1 nmdc:mga0qj67_280501_c1_300_944 210
776 3300050514 nmdc:mga08x19_613902_c1 nmdc:mga08x19_613902_c1_28_669 210
777 3300053087 Ga0500643_000888 Ga0500643_000888_13076_13717 210
778 3300053094 Ga0500566_0199167 Ga0500566_0199167_188_826 210
779 3300053095 Ga0500640_180125 Ga0500640_180125_28_675 210
780 3300053104 Ga0500556_0089753 Ga0500556_0089753_262_927 210
781 3300053120 Ga0500597_000045 Ga0500597_000045_4970_5611 210
782 3300053134 Ga0500658_0157713 Ga0500658_0157713_94_726 210
783 3300053134 Ga0500658_0203293 Ga0500658_0203293_129_764 210
784 3300053136 Ga0500559_0102263 Ga0500559_0102263_107_754 210
785 3300053139 Ga0500568_0001101 Ga0500568_0001101_12200_12844 210
786 3300053139 Ga0500568_0006248 Ga0500568_0006248_567_1199 210
787 3300053155 Ga0500620_088140 Ga0500620_088140_210_860 210
788 3300053156 Ga0500622_0000001 Ga0500622_0000001_570355_570996 210
789 3300053156 Ga0500622_0003346 Ga0500622_0003346_1437_2069 210
790 3300053156 Ga0500622_0027408 Ga0500622_0027408_1745_2377 210
791 3300053158 Ga0500627_0048857 Ga0500627_0048857_761_1396 210
792 3300054114 Ga0501084_0080593 Ga0501084_0080593_1218_1862 210
793 3300054114 Ga0501084_0099388 Ga0501084_0099388_59_709 210
794 3300060353 Ga0501082_0000960 Ga0501082_0000960_3837_4487 210
795 3300000546 LJNas_1014378 LJNas_10143781 211
796 3300003203 JGI25406J46586_10037638 JGI25406J46586_100376382 211
797 3300003323 rootH1_10060596 rootH1_100605962 211
798 3300005290 Ga0065712_10069674 Ga0065712_100696743 211
799 3300005295 Ga0065707_10032085 Ga0065707_100320851 211
800 3300005295 Ga0065707_10115899 Ga0065707_101158992 211
801 3300005328 Ga0070676_10015473 Ga0070676_100154733 211
802 3300005329 Ga0070683_100094324 Ga0070683_1000943242 211
803 3300005330 Ga0070690_100000463 Ga0070690_10000046313 211
804 3300005331 Ga0070670_100011499 Ga0070670_1000114993 211
805 3300005331 Ga0070670_100084458 Ga0070670_1000844583 211
806 3300005331 Ga0070670_100102724 Ga0070670_1001027241 211
807 3300005333 Ga0070677_10226881 Ga0070677_102268811 211
808 3300005334 Ga0068869_100002150 Ga0068869_10000215012 211
809 3300005334 Ga0068869_100097450 Ga0068869_1000974502 211
810 3300005335 Ga0070666_10284602 Ga0070666_102846022 211
811 3300005335 Ga0070666_10309623 Ga0070666_103096232 211
812 3300005336 Ga0070680_100034112 Ga0070680_1000341122 211
813 3300005336 Ga0070680_100043549 Ga0070680_1000435492 211
814 3300005336 Ga0070680_100075179 Ga0070680_1000751792 211
815 3300005336 Ga0070680_100096907 Ga0070680_1000969072 211
816 3300005336 Ga0070680_100867436 Ga0070680_1008674361 211
817 3300005337 Ga0070682_100032450 Ga0070682_1000324504 211
818 3300005337 Ga0070682_100099358 Ga0070682_1000993582 211
819 3300005337 Ga0070682_100483663 Ga0070682_1004836631 211
820 3300005338 Ga0068868_100004564 Ga0068868_1000045648 211
821 3300005338 Ga0068868_100270071 Ga0068868_1002700712 211
822 3300005339 Ga0070660_100168921 Ga0070660_1001689212 211
823 3300005341 Ga0070691_10118108 Ga0070691_101181082 211
824 3300005344 Ga0070661_100003991 Ga0070661_1000039919 211
825 3300005344 Ga0070661_100335280 Ga0070661_1003352802 211
826 3300005345 Ga0070692_10254546 Ga0070692_102545462 211
827 3300005347 Ga0070668_100003501 Ga0070668_1000035012 211
828 3300005347 Ga0070668_100059691 Ga0070668_1000596913 211
829 3300005347 Ga0070668_100590941 Ga0070668_1005909411 211
830 3300005353 Ga0070669_100036698 Ga0070669_1000366983 211
831 3300005353 Ga0070669_100083269 Ga0070669_1000832692 211
832 3300005353 Ga0070669_100794685 Ga0070669_1007946851 211
833 3300005354 Ga0070675_100000822 Ga0070675_10000082210 211
834 3300005355 Ga0070671_100000211 Ga0070671_10000021113 211
835 3300005355 Ga0070671_100080314 Ga0070671_1000803142 211
836 3300005356 Ga0070674_100040003 Ga0070674_1000400032 211
837 3300005356 Ga0070674_100067519 Ga0070674_1000675192 211
838 3300005356 Ga0070674_100097019 Ga0070674_1000970192 211
839 3300005356 Ga0070674_100272703 Ga0070674_1002727031 211
840 3300005364 Ga0070673_100006208 Ga0070673_1000062085 211
841 3300005364 Ga0070673_100912400 Ga0070673_1009124001 211
842 3300005365 Ga0070688_100215603 Ga0070688_1002156031 211
843 3300005366 Ga0070659_100102052 Ga0070659_1001020523 211
844 3300005366 Ga0070659_100195821 Ga0070659_1001958212 211
845 3300005367 Ga0070667_100008132 Ga0070667_1000081329 211
846 3300005367 Ga0070667_100087859 Ga0070667_1000878592 211
847 3300005367 Ga0070667_100185096 Ga0070667_1001850961 211
848 3300005367 Ga0070667_100371071 Ga0070667_1003710712 211
849 3300005434 Ga0070709_10012320 Ga0070709_100123201 211
850 3300005434 Ga0070709_10112553 Ga0070709_101125533 211
851 3300005435 Ga0070714_100008318 Ga0070714_1000083185 211
852 3300005435 Ga0070714_100124930 Ga0070714_1001249303 211
853 3300005436 Ga0070713_100008434 Ga0070713_1000084345 211
854 3300005436 Ga0070713_100166820 Ga0070713_1001668203 211
855 3300005438 Ga0070701_10004877 Ga0070701_100048773 211
856 3300005439 Ga0070711_100079985 Ga0070711_1000799852 211
857 3300005439 Ga0070711_100126002 Ga0070711_1001260023 211
858 3300005441 Ga0070700_100089135 Ga0070700_1000891351 211
859 3300005441 Ga0070700_100139112 Ga0070700_1001391122 211
860 3300005444 Ga0070694_100048587 Ga0070694_1000485872 211
861 3300005455 Ga0070663_100102339 Ga0070663_1001023392 211
862 3300005455 Ga0070663_100181534 Ga0070663_1001815341 211
863 3300005455 Ga0070663_100502548 Ga0070663_1005025482 211
864 3300005456 Ga0070678_100004444 Ga0070678_1000044449 211
865 3300005456 Ga0070678_100069094 Ga0070678_1000690942 211
866 3300005456 Ga0070678_100233718 Ga0070678_1002337181 211
867 3300005457 Ga0070662_100002374 Ga0070662_1000023742 211
868 3300005457 Ga0070662_100089288 Ga0070662_1000892882 211
869 3300005457 Ga0070662_100102948 Ga0070662_1001029482 211
870 3300005458 Ga0070681_10003391 Ga0070681_100033911 211
871 3300005458 Ga0070681_10013324 Ga0070681_1001332410 211
872 3300005458 Ga0070681_10020138 Ga0070681_100201385 211
873 3300005458 Ga0070681_10074761 Ga0070681_100747613 211
874 3300005458 Ga0070681_10081688 Ga0070681_100816881 211
875 3300005458 Ga0070681_10082052 Ga0070681_100820521 211
876 3300005458 Ga0070681_10113932 Ga0070681_101139323 211
877 3300005458 Ga0070681_10313819 Ga0070681_103138192 211
878 3300005458 Ga0070681_10852414 Ga0070681_108524142 211
879 3300005459 Ga0068867_100015192 Ga0068867_1000151923 211
880 3300005459 Ga0068867_100016558 Ga0068867_1000165583 211
881 3300005466 Ga0070685_10033285 Ga0070685_100332853 211
882 3300005466 Ga0070685_10195610 Ga0070685_101956102 211
883 3300005530 Ga0070679_100000441 Ga0070679_1000004411 211
884 3300005530 Ga0070679_100010966 Ga0070679_1000109663 211
885 3300005530 Ga0070679_100047579 Ga0070679_1000475794 211
886 3300005530 Ga0070679_100067018 Ga0070679_1000670183 211
887 3300005530 Ga0070679_100075091 Ga0070679_1000750914 211
888 3300005530 Ga0070679_100105098 Ga0070679_1001050981 211
889 3300005530 Ga0070679_100455353 Ga0070679_1004553531 211
890 3300005535 Ga0070684_100002164 Ga0070684_1000021648 211
891 3300005535 Ga0070684_100051273 Ga0070684_1000512733 211
892 3300005539 Ga0068853_100208629 Ga0068853_1002086292 211
893 3300005539 Ga0068853_100299613 Ga0068853_1002996131 211
894 3300005543 Ga0070672_100063309 Ga0070672_1000633092 211
895 3300005543 Ga0070672_100089741 Ga0070672_1000897413 211
896 3300005544 Ga0070686_100003157 Ga0070686_1000031577 211
897 3300005544 Ga0070686_100058746 Ga0070686_1000587462 211
898 3300005544 Ga0070686_100458343 Ga0070686_1004583432 211
899 3300005546 Ga0070696_100000493 Ga0070696_10000049322 211
900 3300005547 Ga0070693_100085738 Ga0070693_1000857382 211
901 3300005547 Ga0070693_100237456 Ga0070693_1002374562 211
902 3300005548 Ga0070665_100004735 Ga0070665_10000473511 211
903 3300005548 Ga0070665_100009077 Ga0070665_1000090772 211
904 3300005548 Ga0070665_100012741 Ga0070665_1000127412 211
905 3300005548 Ga0070665_100026353 Ga0070665_1000263532 211
906 3300005563 Ga0068855_100003238 Ga0068855_1000032388 211
907 3300005563 Ga0068855_100003301 Ga0068855_1000033011 211
908 3300005563 Ga0068855_100014199 Ga0068855_1000141994 211
909 3300005563 Ga0068855_100543596 Ga0068855_1005435962 211
910 3300005563 Ga0068855_100606250 Ga0068855_1006062502 211
911 3300005564 Ga0070664_100000193 Ga0070664_10000019340 211
912 3300005564 Ga0070664_100065621 Ga0070664_1000656214 211
913 3300005564 Ga0070664_100244697 Ga0070664_1002446972 211
914 3300005577 Ga0068857_100005651 Ga0068857_10000565112 211
915 3300005577 Ga0068857_100082067 Ga0068857_1000820672 211
916 3300005578 Ga0068854_100301104 Ga0068854_1003011042 211
917 3300005614 Ga0068856_100035930 Ga0068856_1000359303 211
918 3300005614 Ga0068856_100552691 Ga0068856_1005526912 211
919 3300005614 Ga0068856_100808496 Ga0068856_1008084962 211
920 3300005614 Ga0068856_100826541 Ga0068856_1008265412 211
921 3300005615 Ga0070702_100037595 Ga0070702_1000375953 211
922 3300005615 Ga0070702_100048245 Ga0070702_1000482452 211
923 3300005616 Ga0068852_100060808 Ga0068852_1000608082 211
924 3300005616 Ga0068852_100352069 Ga0068852_1003520691 211
925 3300005616 Ga0068852_100712289 Ga0068852_1007122891 211
926 3300005616 Ga0068852_100725082 Ga0068852_1007250822 211
927 3300005617 Ga0068859_100000206 Ga0068859_1000002062 211
928 3300005617 Ga0068859_100003093 Ga0068859_10000309317 211
929 3300005617 Ga0068859_100003111 Ga0068859_1000031115 211
930 3300005618 Ga0068864_100003617 Ga0068864_1000036178 211
931 3300005618 Ga0068864_100062235 Ga0068864_1000622353 211
932 3300005618 Ga0068864_100204997 Ga0068864_1002049972 211
933 3300005618 Ga0068864_100988995 Ga0068864_1009889951 211
934 3300005718 Ga0068866_10002162 Ga0068866_100021623 211
935 3300005719 Ga0068861_100003978 Ga0068861_1000039788 211
936 3300005719 Ga0068861_100057277 Ga0068861_1000572774 211
937 3300005719 Ga0068861_100085822 Ga0068861_1000858223 211
938 3300005719 Ga0068861_100871489 Ga0068861_1008714892 211
939 3300005834 Ga0068851_10087425 Ga0068851_100874252 211
940 3300005840 Ga0068870_10079335 Ga0068870_100793352 211
941 3300005840 Ga0068870_10091485 Ga0068870_100914852 211
942 3300005840 Ga0068870_10221067 Ga0068870_102210671 211
943 3300005841 Ga0068863_100002905 Ga0068863_10000290511 211
944 3300005841 Ga0068863_100007199 Ga0068863_1000071999 211
945 3300005841 Ga0068863_100021228 Ga0068863_1000212282 211
946 3300005841 Ga0068863_100239111 Ga0068863_1002391112 211
947 3300005842 Ga0068858_100006062 Ga0068858_1000060629 211
948 3300005842 Ga0068858_100015676 Ga0068858_1000156763 211
949 3300005842 Ga0068858_100022852 Ga0068858_1000228526 211
950 3300005842 Ga0068858_100759294 Ga0068858_1007592941 211
951 3300005843 Ga0068860_100022321 Ga0068860_1000223215 211
952 3300005843 Ga0068860_100101266 Ga0068860_1001012662 211
953 3300005843 Ga0068860_100340381 Ga0068860_1003403811 211
954 3300005843 Ga0068860_100358427 Ga0068860_1003584272 211
955 3300005844 Ga0068862_100003040 Ga0068862_1000030408 211
956 3300005844 Ga0068862_100011101 Ga0068862_1000111018 211
957 3300005844 Ga0068862_100079394 Ga0068862_1000793943 211
958 3300005844 Ga0068862_100127471 Ga0068862_1001274712 211
959 3300005937 Ga0081455_10000337 Ga0081455_1000033710 211
960 3300005985 Ga0081539_10000011 Ga0081539_10000011329 211
961 3300006028 Ga0070717_10027818 Ga0070717_100278183 211
962 3300006028 Ga0070717_10193075 Ga0070717_101930753 211
963 3300006175 Ga0070712_100040652 Ga0070712_1000406526 211
964 3300006175 Ga0070712_100061050 Ga0070712_1000610504 211
965 3300006237 Ga0097621_100018756 Ga0097621_1000187563 211
966 3300006358 Ga0068871_100062644 Ga0068871_1000626443 211
967 3300006358 Ga0068871_100109329 Ga0068871_1001093292 211
968 3300006358 Ga0068871_100212610 Ga0068871_1002126102 211
969 3300006358 Ga0068871_100241864 Ga0068871_1002418641 211
970 3300006358 Ga0068871_100393168 Ga0068871_1003931681 211
971 3300006844 Ga0075428_100013405 Ga0075428_1000134054 211
972 3300006846 Ga0075430_100003144 Ga0075430_10000314416 211
973 3300006846 Ga0075430_100043043 Ga0075430_1000430434 211
974 3300006847 Ga0075431_100005132 Ga0075431_1000051328 211
975 3300006852 Ga0075433_10445630 Ga0075433_104456303 211
976 3300006871 Ga0075434_100268609 Ga0075434_1002686092 211
977 3300006871 Ga0075434_100361765 Ga0075434_1003617652 211
978 3300006871 Ga0075434_100460070 Ga0075434_1004600702 211
979 3300006880 Ga0075429_100058440 Ga0075429_1000584402 211
980 3300006880 Ga0075429_100107387 Ga0075429_1001073872 211
981 3300006881 Ga0068865_100026617 Ga0068865_1000266173 211
982 3300006881 Ga0068865_100136358 Ga0068865_1001363582 211
983 3300006881 Ga0068865_100354960 Ga0068865_1003549602 211
984 3300006914 Ga0075436_100158456 Ga0075436_1001584562 211
985 3300006931 Ga0097620_100000206 Ga0097620_10000020650 211
986 3300006931 Ga0097620_100003093 Ga0097620_10000309317 211
987 3300006931 Ga0097620_100003111 Ga0097620_1000031115 211
988 3300007076 Ga0075435_100380878 Ga0075435_1003808782 211
989 3300007788 Ga0099795_10140662 Ga0099795_101406622 211
990 3300009093 Ga0105240_10002400 Ga0105240_1000240011 211
991 3300009093 Ga0105240_10003765 Ga0105240_1000376510 211
992 3300009093 Ga0105240_10008454 Ga0105240_1000845411 211
993 3300009093 Ga0105240_10008473 Ga0105240_1000847317 211
994 3300009093 Ga0105240_10024998 Ga0105240_100249987 211
995 3300009093 Ga0105240_10049373 Ga0105240_100493733 211
996 3300009093 Ga0105240_10122444 Ga0105240_101224445 211
997 3300009093 Ga0105240_10257427 Ga0105240_102574272 211
998 3300009093 Ga0105240_10262783 Ga0105240_102627833 211
999 3300009101 Ga0105247_10000088 Ga0105247_1000008869 211
1000 3300009148 Ga0105243_10064151 Ga0105243_100641513 211
1001 3300009148 Ga0105243_11501330 Ga0105243_115013301 211
1002 3300009174 Ga0105241_10211445 Ga0105241_102114452 211
1003 3300009174 Ga0105241_10318283 Ga0105241_103182832 211
1004 3300009176 Ga0105242_10027916 Ga0105242_100279163 211
1005 3300009176 Ga0105242_10099477 Ga0105242_100994772 211
1006 3300009177 Ga0105248_10000741 Ga0105248_1000074137 211
1007 3300009545 Ga0105237_10091600 Ga0105237_100916004 211
1008 3300009545 Ga0105237_10379963 Ga0105237_103799631 211
1009 3300009545 Ga0105237_10744978 Ga0105237_107449782 211
1010 3300009551 Ga0105238_10000393 Ga0105238_1000039314 211
1011 3300009551 Ga0105238_10110596 Ga0105238_101105964 211
1012 3300009551 Ga0105238_10151173 Ga0105238_101511733 211
1013 3300009553 Ga0105249_10007359 Ga0105249_1000735910 211
1014 3300009553 Ga0105249_10016154 Ga0105249_100161547 211
1015 3300009553 Ga0105249_10112873 Ga0105249_101128733 211
1016 3300009553 Ga0105249_10155119 Ga0105249_101551192 211
1017 3300009553 Ga0105249_10278402 Ga0105249_102784022 211
1018 3300009553 Ga0105249_11098700 Ga0105249_110987002 211
1019 3300010159 Ga0099796_10004434 Ga0099796_100044344 211
1020 3300010375 Ga0105239_10146697 Ga0105239_101466972 211
1021 3300010375 Ga0105239_10564154 Ga0105239_105641542 211
1022 3300011119 Ga0105246_10022423 Ga0105246_100224232 211
1023 3300011119 Ga0105246_10023781 Ga0105246_100237812 211
1024 3300013100 Ga0157373_10221451 Ga0157373_102214512 211
1025 3300013104 Ga0157370_10001131 Ga0157370_1000113119 211
1026 3300013105 Ga0157369_10002625 Ga0157369_1000262515 211
1027 3300013105 Ga0157369_10013410 Ga0157369_100134103 211
1028 3300013105 Ga0157369_10031832 Ga0157369_100318321 211
1029 3300013296 Ga0157374_10213686 Ga0157374_102136862 211
1030 3300013296 Ga0157374_11118343 Ga0157374_111183431 211
1031 3300013297 Ga0157378_11345778 Ga0157378_113457781 211
1032 3300013306 Ga0163162_10022358 Ga0163162_100223587 211
1033 3300013306 Ga0163162_10045208 Ga0163162_100452083 211
1034 3300013306 Ga0163162_10134104 Ga0163162_101341043 211
1035 3300013306 Ga0163162_10191813 Ga0163162_101918132 211
1036 3300013308 Ga0157375_10081810 Ga0157375_100818103 211
1037 3300013308 Ga0157375_10323338 Ga0157375_103233381 211
1038 3300014325 Ga0163163_10000534 Ga0163163_1000053432 211
1039 3300014325 Ga0163163_10046158 Ga0163163_100461585 211
1040 3300014325 Ga0163163_10078500 Ga0163163_100785002 211
1041 3300014325 Ga0163163_10157786 Ga0163163_101577863 211
1042 3300014325 Ga0163163_10184306 Ga0163163_101843061 211
1043 3300014326 Ga0157380_10133687 Ga0157380_101336872 211
1044 3300014326 Ga0157380_10201929 Ga0157380_102019292 211
1045 3300014968 Ga0157379_10020766 Ga0157379_100207663 211
1046 3300014968 Ga0157379_10026025 Ga0157379_100260252 211
1047 3300014968 Ga0157379_10158578 Ga0157379_101585783 211
1048 3300014968 Ga0157379_10188676 Ga0157379_101886762 211
1049 3300014968 Ga0157379_10230513 Ga0157379_102305132 211
1050 3300014969 Ga0157376_10001346 Ga0157376_100013463 211
1051 3300014969 Ga0157376_10440818 Ga0157376_104408181 211
1052 3300014969 Ga0157376_10449540 Ga0157376_104495402 211
1053 3300014969 Ga0157376_10679833 Ga0157376_106798332 211
1054 3300014969 Ga0157376_10857784 Ga0157376_108577841 211
1055 3300017792 Ga0163161_10367183 Ga0163161_103671831 211
1056 3300020082 Ga0206353_11580351 Ga0206353_115803512 211
1057 3300021377 Ga0213874_10018633 Ga0213874_100186333 211
1058 3300021441 Ga0213871_10039296 Ga0213871_100392962 211
1059 3300022467 Ga0224712_10116728 Ga0224712_101167282 211
1060 3300022467 Ga0224712_10125131 Ga0224712_101251312 211
1061 3300025893 Ga0207682_10036934 Ga0207682_100369343 211
1062 3300025899 Ga0207642_10003615 Ga0207642_100036153 211
1063 3300025900 Ga0207710_10000205 Ga0207710_1000020548 211
1064 3300025901 Ga0207688_10028124 Ga0207688_100281244 211
1065 3300025901 Ga0207688_10031488 Ga0207688_100314882 211
1066 3300025903 Ga0207680_10274869 Ga0207680_102748692 211
1067 3300025906 Ga0207699_10271939 Ga0207699_102719392 211
1068 3300025907 Ga0207645_10001076 Ga0207645_1000107622 211
1069 3300025907 Ga0207645_10039892 Ga0207645_100398921 211
1070 3300025907 Ga0207645_10276164 Ga0207645_102761642 211
1071 3300025908 Ga0207643_10022275 Ga0207643_100222755 211
1072 3300025908 Ga0207643_10055703 Ga0207643_100557032 211
1073 3300025911 Ga0207654_10311359 Ga0207654_103113592 211
1074 3300025911 Ga0207654_10365186 Ga0207654_103651862 211
1075 3300025912 Ga0207707_10000123 Ga0207707_1000012339 211
1076 3300025912 Ga0207707_10091789 Ga0207707_100917893 211
1077 3300025912 Ga0207707_10114736 Ga0207707_101147363 211
1078 3300025912 Ga0207707_10126956 Ga0207707_101269561 211
1079 3300025912 Ga0207707_10130761 Ga0207707_101307611 211
1080 3300025912 Ga0207707_10410048 Ga0207707_104100482 211
1081 3300025913 Ga0207695_10003645 Ga0207695_1000364512 211
1082 3300025913 Ga0207695_10010979 Ga0207695_100109795 211
1083 3300025913 Ga0207695_10011168 Ga0207695_100111682 211
1084 3300025913 Ga0207695_10024319 Ga0207695_100243197 211
1085 3300025913 Ga0207695_10036698 Ga0207695_100366984 211
1086 3300025914 Ga0207671_10066759 Ga0207671_100667592 211
1087 3300025914 Ga0207671_10181814 Ga0207671_101818142 211
1088 3300025915 Ga0207693_10031565 Ga0207693_100315654 211
1089 3300025915 Ga0207693_10032059 Ga0207693_100320595 211
1090 3300025916 Ga0207663_10014293 Ga0207663_100142932 211
1091 3300025916 Ga0207663_10203623 Ga0207663_102036232 211
1092 3300025917 Ga0207660_10048812 Ga0207660_100488122 211
1093 3300025917 Ga0207660_10051918 Ga0207660_100519183 211
1094 3300025917 Ga0207660_10065281 Ga0207660_100652812 211
1095 3300025917 Ga0207660_10426172 Ga0207660_104261722 211
1096 3300025918 Ga0207662_10384844 Ga0207662_103848442 211
1097 3300025919 Ga0207657_10191762 Ga0207657_101917622 211
1098 3300025920 Ga0207649_10038023 Ga0207649_100380233 211
1099 3300025920 Ga0207649_10503750 Ga0207649_105037502 211
1100 3300025921 Ga0207652_10003226 Ga0207652_100032267 211
1101 3300025921 Ga0207652_10028076 Ga0207652_100280762 211
1102 3300025921 Ga0207652_10161992 Ga0207652_101619922 211
1103 3300025921 Ga0207652_10568336 Ga0207652_105683362 211
1104 3300025923 Ga0207681_10035199 Ga0207681_100351991 211
1105 3300025923 Ga0207681_10153469 Ga0207681_101534692 211
1106 3300025924 Ga0207694_10006970 Ga0207694_100069703 211
1107 3300025924 Ga0207694_10677527 Ga0207694_106775272 211
1108 3300025925 Ga0207650_10016649 Ga0207650_100166495 211
1109 3300025925 Ga0207650_10073520 Ga0207650_100735201 211
1110 3300025926 Ga0207659_10013387 Ga0207659_100133872 211
1111 3300025928 Ga0207700_10417092 Ga0207700_104170921 211
1112 3300025931 Ga0207644_10001766 Ga0207644_100017666 211
1113 3300025931 Ga0207644_10059157 Ga0207644_100591572 211
1114 3300025931 Ga0207644_10362187 Ga0207644_103621871 211
1115 3300025932 Ga0207690_10081435 Ga0207690_100814353 211
1116 3300025933 Ga0207706_10005911 Ga0207706_1000591111 211
1117 3300025933 Ga0207706_10010504 Ga0207706_100105042 211
1118 3300025933 Ga0207706_10111853 Ga0207706_101118532 211
1119 3300025934 Ga0207686_10091125 Ga0207686_100911252 211
1120 3300025935 Ga0207709_10202443 Ga0207709_102024432 211
1121 3300025936 Ga0207670_10023234 Ga0207670_100232345 211
1122 3300025937 Ga0207669_10171002 Ga0207669_101710022 211
1123 3300025938 Ga0207704_10042853 Ga0207704_100428531 211
1124 3300025938 Ga0207704_10147739 Ga0207704_101477391 211
1125 3300025938 Ga0207704_10634075 Ga0207704_106340751 211
1126 3300025940 Ga0207691_10001926 Ga0207691_100019263 211
1127 3300025940 Ga0207691_10064713 Ga0207691_100647133 211
1128 3300025940 Ga0207691_10107043 Ga0207691_101070432 211
1129 3300025941 Ga0207711_10009454 Ga0207711_100094543 211
1130 3300025941 Ga0207711_10083997 Ga0207711_100839973 211
1131 3300025941 Ga0207711_10152426 Ga0207711_101524262 211
1132 3300025941 Ga0207711_10780177 Ga0207711_107801772 211
1133 3300025942 Ga0207689_10003291 Ga0207689_100032912 211
1134 3300025942 Ga0207689_10011249 Ga0207689_100112492 211
1135 3300025942 Ga0207689_10164619 Ga0207689_101646191 211
1136 3300025944 Ga0207661_10163717 Ga0207661_101637172 211
1137 3300025944 Ga0207661_10485474 Ga0207661_104854741 211
1138 3300025945 Ga0207679_10011318 Ga0207679_100113187 211
1139 3300025949 Ga0207667_10002092 Ga0207667_100020928 211
1140 3300025949 Ga0207667_10006403 Ga0207667_100064034 211
1141 3300025949 Ga0207667_10014833 Ga0207667_100148333 211
1142 3300025949 Ga0207667_10048358 Ga0207667_100483584 211
1143 3300025949 Ga0207667_10221021 Ga0207667_102210212 211
1144 3300025949 Ga0207667_10348052 Ga0207667_103480522 211
1145 3300025949 Ga0207667_10456775 Ga0207667_104567752 211
1146 3300025949 Ga0207667_10756632 Ga0207667_107566322 211
1147 3300025960 Ga0207651_10007626 Ga0207651_100076265 211
1148 3300025961 Ga0207712_10014962 Ga0207712_100149626 211
1149 3300025961 Ga0207712_10048446 Ga0207712_100484463 211
1150 3300025961 Ga0207712_10142187 Ga0207712_101421872 211
1151 3300025961 Ga0207712_10171475 Ga0207712_101714752 211
1152 3300025961 Ga0207712_10246538 Ga0207712_102465382 211
1153 3300025972 Ga0207668_10013613 Ga0207668_100136132 211
1154 3300025972 Ga0207668_10110279 Ga0207668_101102791 211
1155 3300025981 Ga0207640_10047088 Ga0207640_100470882 211
1156 3300025986 Ga0207658_10002710 Ga0207658_100027109 211
1157 3300025986 Ga0207658_10053636 Ga0207658_100536362 211
1158 3300025986 Ga0207658_10153264 Ga0207658_101532641 211
1159 3300026023 Ga0207677_10025825 Ga0207677_100258253 211
1160 3300026035 Ga0207703_10000656 Ga0207703_1000065617 211
1161 3300026035 Ga0207703_10004421 Ga0207703_1000442111 211
1162 3300026035 Ga0207703_10014926 Ga0207703_100149266 211
1163 3300026041 Ga0207639_10427727 Ga0207639_104277272 211
1164 3300026041 Ga0207639_10573374 Ga0207639_105733741 211
1165 3300026067 Ga0207678_10064348 Ga0207678_100643483 211
1166 3300026067 Ga0207678_10181403 Ga0207678_101814032 211
1167 3300026067 Ga0207678_10309617 Ga0207678_103096172 211
1168 3300026075 Ga0207708_10008456 Ga0207708_100084562 211
1169 3300026075 Ga0207708_10106733 Ga0207708_101067332 211
1170 3300026078 Ga0207702_10058231 Ga0207702_100582313 211
1171 3300026088 Ga0207641_10000702 Ga0207641_1000070212 211
1172 3300026088 Ga0207641_10007075 Ga0207641_1000707510 211
1173 3300026088 Ga0207641_10008590 Ga0207641_100085909 211
1174 3300026089 Ga0207648_10007470 Ga0207648_100074702 211
1175 3300026089 Ga0207648_10018374 Ga0207648_100183743 211
1176 3300026095 Ga0207676_10005378 Ga0207676_100053789 211
1177 3300026095 Ga0207676_10109549 Ga0207676_101095491 211
1178 3300026116 Ga0207674_10010048 Ga0207674_1001004811 211
1179 3300026116 Ga0207674_10018650 Ga0207674_100186501 211
1180 3300026116 Ga0207674_10120788 Ga0207674_101207883 211
1181 3300026118 Ga0207675_100000611 Ga0207675_10000061112 211
1182 3300026118 Ga0207675_100003851 Ga0207675_10000385111 211
1183 3300026118 Ga0207675_100066601 Ga0207675_1000666012 211
1184 3300026118 Ga0207675_100114406 Ga0207675_1001144062 211
1185 3300026118 Ga0207675_100154326 Ga0207675_1001543263 211
1186 3300026118 Ga0207675_101229372 Ga0207675_1012293722 211
1187 3300026121 Ga0207683_10004313 Ga0207683_1000431313 211
1188 3300026121 Ga0207683_10410414 Ga0207683_104104142 211
1189 3300026142 Ga0207698_10546618 Ga0207698_105466181 211
1190 3300026142 Ga0207698_10946493 Ga0207698_109464932 211
1191 3300027552 Ga0209982_1002287 Ga0209982_10022873 211
1192 3300027617 Ga0210002_1000318 Ga0210002_10003184 211
1193 3300027665 Ga0209983_1000873 Ga0209983_10008735 211
1194 3300027682 Ga0209971_1001269 Ga0209971_10012695 211
1195 3300027717 Ga0209998_10000961 Ga0209998_100009612 211
1196 3300027876 Ga0209974_10002268 Ga0209974_100022682 211
1197 3300028379 Ga0268266_10001002 Ga0268266_1000100215 211
1198 3300028379 Ga0268266_10031780 Ga0268266_100317804 211
1199 3300028379 Ga0268266_10048011 Ga0268266_100480113 211
1200 3300028379 Ga0268266_10541511 Ga0268266_105415112 211
1201 3300028380 Ga0268265_10013683 Ga0268265_100136836 211
1202 3300028380 Ga0268265_10147457 Ga0268265_101474573 211
1203 3300028380 Ga0268265_10238280 Ga0268265_102382802 211
1204 3300028380 Ga0268265_10292016 Ga0268265_102920161 211
1205 3300028380 Ga0268265_10442620 Ga0268265_104426202 211
1206 3300028380 Ga0268265_11134001 Ga0268265_111340011 211
1207 3300028381 Ga0268264_10000375 Ga0268264_1000037548 211
1208 3300028381 Ga0268264_10288160 Ga0268264_102881602 211
1209 3300028573 Ga0265334_10027203 Ga0265334_100272032 211
1210 3300028794 Ga0307515_10063509 Ga0307515_100635092 211
1211 3300030521 Ga0307511_10000448 Ga0307511_1000044835 211
1212 3300030521 Ga0307511_10016444 Ga0307511_100164446 211
1213 3300031090 Ga0265760_10009905 Ga0265760_100099054 211
1214 3300031249 Ga0265339_10093059 Ga0265339_100930593 211
1215 3300031250 Ga0265331_10102320 Ga0265331_101023202 211
1216 3300031456 Ga0307513_10088265 Ga0307513_100882652 211
1217 3300031507 Ga0307509_10000003 Ga0307509_10000003150 211
1218 3300031548 Ga0307408_100088700 Ga0307408_1000887003 211
1219 3300031616 Ga0307508_10387883 Ga0307508_103878831 211
1220 3300031730 Ga0307516_10000050 Ga0307516_1000005010 211
1221 3300031824 Ga0307413_10327979 Ga0307413_103279792 211
1222 3300031852 Ga0307410_10596066 Ga0307410_105960661 211
1223 3300031903 Ga0307407_10574433 Ga0307407_105744332 211
1224 3300031995 Ga0307409_100274195 Ga0307409_1002741951 211
1225 3300031995 Ga0307409_100680862 Ga0307409_1006808622 211
1226 3300032002 Ga0307416_100073249 Ga0307416_1000732491 211
1227 3300033179 Ga0307507_10290945 Ga0307507_102909452 211
1228 3300033180 Ga0307510_10000001 Ga0307510_10000001902 211
1229 3300033180 Ga0307510_10002034 Ga0307510_1000203411 211
1230 3300033180 Ga0307510_10264651 Ga0307510_102646511 211
1231 3300035111 Ga0373923_0161931 Ga0373923_0161931_308_943 211
1232 3300035119 Ga0373956_0058965 Ga0373956_0058965_889_1524 211
1233 3300035172 Ga0373955_0342833 Ga0373955_0342833_37_672 211
1234 3300035242 Ga0373962_0029033 Ga0373962_0029033_609_1244 211
1235 3300035692 Ga0373935_0058000 Ga0373935_0058000_1410_2045 211
1236 3300035695 Ga0373927_0577955 Ga0373927_0577955_27_662 211
1237 3300035724 Ga0373933_0358181 Ga0373933_0358181_215_850 211
1238 3300036401 Ga0373937_0009590 Ga0373937_0009590_6248_6883 211
1239 3300036401 Ga0373937_0038257 Ga0373937_0038257_2972_3607 211
1240 3300036401 Ga0373937_0431367 Ga0373937_0431367_123_758 211
1241 3300037466 Ga0395898_0004595 Ga0395898_0004595_7864_8499 211
1242 3300037466 Ga0395898_0040027 Ga0395898_0040027_1479_2114 211
1243 3300037466 Ga0395898_0600773 Ga0395898_0600773_241_876 211
1244 3300039437 Ga0436365_0156685 Ga0436365_0156685_2705_3340 211
1245 3300039437 Ga0436365_1114791 Ga0436365_1114791_697_1332 211
1246 3300039450 Ga0436363_0928702 Ga0436363_0928702_8124_8759 211
1247 3300039450 Ga0436363_1474853 Ga0436363_1474853_157_792 211
1248 3300039453 Ga0436362_0154352 Ga0436362_0154352_176_811 211
1249 3300042134 Ga0450898_008425 Ga0450898_008425_341_976 211
1250 3300042876 Ga0451577_0114001 Ga0451577_0114001_126_761 211
1251 3300044656 Ga0466969_0003588 Ga0466969_0003588_343_978 211
1252 3300044656 Ga0466969_0023342 Ga0466969_0023342_2440_3075 211
1253 3300044684 Ga0466966_0004679 Ga0466966_0004679_3662_4297 211
1254 3300044684 Ga0466966_0203258 Ga0466966_0203258_21_656 211
1255 3300044693 Ga0466961_0001475 Ga0466961_0001475_7921_8556 211
1256 3300044693 Ga0466961_0409039 Ga0466961_0409039_111_746 211
1257 3300044706 Ga0466964_0201810 Ga0466964_0201810_204_839 211
1258 3300044735 Ga0466968_0047446 Ga0466968_0047446_649_1284 211
1259 3300044765 Ga0466970_0002321 Ga0466970_0002321_1803_2438 211
1260 3300044765 Ga0466970_0095419 Ga0466970_0095419_675_1310 211
1261 3300044842 Ga0466957_0007878 Ga0466957_0007878_2689_3324 211
1262 3300044901 Ga0466960_0024148 Ga0466960_0024148_784_1419 211
1263 3300045049 Ga0466959_0001315 Ga0466959_0001315_13209_13844 211
1264 3300045049 Ga0466959_0002720 Ga0466959_0002720_10541_11176 211
1265 3300045049 Ga0466959_0010842 Ga0466959_0010842_526_1161 211
1266 3300045049 Ga0466959_0178889 Ga0466959_0178889_724_1359 211
1267 3300045836 Ga0466958_0298518 Ga0466958_0298518_293_928 211
1268 3300046471 Ga0495650_0011479 Ga0495650_0011479_2940_3575 211
1269 3300046472 Ga0495580_0108946 Ga0495580_0108946_742_1377 211
1270 3300046519 Ga0495632_0021443 Ga0495632_0021443_839_1474 211
1271 3300046520 Ga0495637_0189779 Ga0495637_0189779_44_679 211
1272 3300046522 Ga0495643_0075120 Ga0495643_0075120_442_1077 211
1273 3300046536 Ga0495587_0029063 Ga0495587_0029063_1883_2518 211
1274 3300046675 Ga0495657_0213861 Ga0495657_0213861_487_1122 211
1275 3300046689 Ga0495613_0337883 Ga0495613_0337883_253_888 211
1276 3300047320 Ga0495672_0042277 Ga0495672_0042277_22_666 211
1277 3300047443 Ga0495687_082136 Ga0495687_082136_19_654 211
1278 3300048088 Ga0495602_0033497 Ga0495602_0033497_2546_3181 211
1279 3300048903 Ga0496100_0105239 Ga0496100_0105239_651_1286 211
1280 3300048903 Ga0496100_0275956 Ga0496100_0275956_496_1131 211
1281 3300048903 Ga0496100_0447117 Ga0496100_0447117_52_687 211
1282 3300048904 Ga0496101_0100364 Ga0496101_0100364_25_660 211
1283 3300048904 Ga0496101_0147189 Ga0496101_0147189_646_1281 211
1284 3300048905 Ga0496102_0002718 Ga0496102_0002718_12538_13173 211
1285 3300048905 Ga0496102_0098098 Ga0496102_0098098_243_878 211
1286 3300048907 Ga0496104_0230594 Ga0496104_0230594_19_654 211
1287 3300048908 Ga0496105_0016608 Ga0496105_0016608_2480_3115 211
1288 3300048908 Ga0496105_0182731 Ga0496105_0182731_767_1402 211
1289 3300048909 Ga0496106_0156225 Ga0496106_0156225_480_1115 211
1290 3300048910 Ga0496107_0029643 Ga0496107_0029643_103_738 211
1291 3300048910 Ga0496107_0138031 Ga0496107_0138031_853_1488 211
1292 3300048910 Ga0496107_0275915 Ga0496107_0275915_509_1144 211
1293 3300048911 Ga0496108_0162165 Ga0496108_0162165_143_778 211
1294 3300048913 Ga0496110_0498904 Ga0496110_0498904_408_1043 211
1295 3300048915 Ga0496112_0069044 Ga0496112_0069044_1156_1791 211
1296 3300048915 Ga0496112_0933676 Ga0496112_0933676_61_696 211
1297 3300048916 Ga0496113_0056503 Ga0496113_0056503_31_666 211
1298 3300048917 Ga0496114_0002741 Ga0496114_0002741_4907_5542 211
1299 3300048917 Ga0496114_0082700 Ga0496114_0082700_1673_2308 211
1300 3300048918 Ga0496115_0029891 Ga0496115_0029891_2024_2659 211
1301 3300048919 Ga0496116_0071859 Ga0496116_0071859_1343_1978 211
1302 3300048920 Ga0496117_0000341 Ga0496117_0000341_45089_45724 211
1303 3300048921 Ga0496118_0000040 Ga0496118_0000040_86976_87611 211
1304 3300048921 Ga0496118_0212822 Ga0496118_0212822_475_1110 211
1305 3300048922 Ga0496119_0007132 Ga0496119_0007132_9495_10130 211
1306 3300048922 Ga0496119_0014164 Ga0496119_0014164_1788_2423 211
1307 3300048922 Ga0496119_0039068 Ga0496119_0039068_252_887 211
1308 3300048923 Ga0496120_0000104 Ga0496120_0000104_2500_3135 211
1309 3300048923 Ga0496120_0034285 Ga0496120_0034285_1554_2189 211
1310 3300048924 Ga0496121_0000461 Ga0496121_0000461_36138_36773 211
1311 3300048924 Ga0496121_0260493 Ga0496121_0260493_141_776 211
1312 3300048924 Ga0496121_0303877 Ga0496121_0303877_422_1057 211
1313 3300048927 Ga0496124_0026681 Ga0496124_0026681_3144_3779 211
1314 3300048928 Ga0496125_0003262 Ga0496125_0003262_5832_6467 211
1315 3300048928 Ga0496125_0026201 Ga0496125_0026201_4106_4741 211
1316 3300048928 Ga0496125_0127104 Ga0496125_0127104_125_760 211
1317 3300048929 Ga0496126_0003314 Ga0496126_0003314_12170_12805 211
1318 3300048929 Ga0496126_0316066 Ga0496126_0316066_611_1246 211
1319 3300048929 Ga0496126_0341246 Ga0496126_0341246_166_801 211
1320 3300048929 Ga0496126_0697206 Ga0496126_0697206_55_690 211
1321 3300049569 Ga0501032_0189705 Ga0501032_0189705_404_1039 211
1322 3300049572 Ga0501036_0066062 Ga0501036_0066062_966_1601 211
1323 3300049573 Ga0501037_0138728 Ga0501037_0138728_915_1550 211
1324 3300049574 Ga0501038_0018576 Ga0501038_0018576_5545_6180 211
1325 3300049575 Ga0501039_0009617 Ga0501039_0009617_4401_5036 211
1326 3300049575 Ga0501039_0065098 Ga0501039_0065098_583_1218 211
1327 3300049576 Ga0501040_0009597 Ga0501040_0009597_4458_5093 211
1328 3300049576 Ga0501040_0028892 Ga0501040_0028892_2738_3373 211
1329 3300049577 Ga0501041_0000050 Ga0501041_0000050_2792_3427 211
1330 3300049577 Ga0501041_0029732 Ga0501041_0029732_1458_2093 211
1331 3300049577 Ga0501041_0107750 Ga0501041_0107750_486_1121 211
1332 3300049578 Ga0501042_0006907 Ga0501042_0006907_4164_4799 211
1333 3300049578 Ga0501042_0049862 Ga0501042_0049862_925_1560 211
1334 3300049579 Ga0501043_0027263 Ga0501043_0027263_3473_4108 211
1335 3300049579 Ga0501043_0072306 Ga0501043_0072306_542_1177 211
1336 3300049580 Ga0501046_0088394 Ga0501046_0088394_11_646 211
1337 3300049580 Ga0501046_0149207 Ga0501046_0149207_361_996 211
1338 3300049582 Ga0501048_0027659 Ga0501048_0027659_566_1201 211
1339 3300049584 Ga0501068_0225231 Ga0501068_0225231_82_717 211
1340 3300049585 Ga0501069_0366525 Ga0501069_0366525_23_658 211
1341 3300049587 Ga0501071_0010917 Ga0501071_0010917_1840_2475 211
1342 3300049587 Ga0501071_0021306 Ga0501071_0021306_1764_2399 211
1343 3300049588 Ga0501072_0007002 Ga0501072_0007002_5736_6371 211
1344 3300049588 Ga0501072_0033288 Ga0501072_0033288_854_1489 211
1345 3300049589 Ga0501073_0234581 Ga0501073_0234581_410_1045 211
1346 3300049590 Ga0501074_0031193 Ga0501074_0031193_1726_2361 211
1347 3300049591 Ga0501075_0040580 Ga0501075_0040580_619_1254 211
1348 3300049592 Ga0501076_0001007 Ga0501076_0001007_2949_3584 211
1349 3300049592 Ga0501076_0036252 Ga0501076_0036252_209_844 211
1350 3300049593 Ga0501077_0030407 Ga0501077_0030407_651_1286 211
1351 3300049593 Ga0501077_0037274 Ga0501077_0037274_1943_2578 211
1352 3300049741 Ga0501079_0013126 Ga0501079_0013126_3720_4355 211
1353 3300049741 Ga0501079_0041104 Ga0501079_0041104_1783_2418 211
1354 3300049742 Ga0501080_0081356 Ga0501080_0081356_890_1525 211
1355 3300049742 Ga0501080_0227520 Ga0501080_0227520_763_1398 211
1356 3300049743 Ga0501081_0020917 Ga0501081_0020917_2513_3148 211
1357 3300049743 Ga0501081_0030309 Ga0501081_0030309_2459_3094 211
1358 3300049744 Ga0501083_0074059 Ga0501083_0074059_767_1402 211
1359 3300049822 Ga0501035_0046239 Ga0501035_0046239_1894_2529 211
1360 3300049822 Ga0501035_0067300 Ga0501035_0067300_1193_1828 211
1361 3300049824 Ga0501045_0005762 Ga0501045_0005762_4954_5589 211
1362 3300049824 Ga0501045_0010833 Ga0501045_0010833_3377_4012 211
1363 3300050508 nmdc:mga09592_14474_c1 nmdc:mga09592_14474_c1_2719_3354 211
1364 3300050509 nmdc:mga0qj67_13748_c1 nmdc:mga0qj67_13748_c1_1812_2447 211
1365 3300050509 nmdc:mga0qj67_42867_c1 nmdc:mga0qj67_42867_c1_2715_3350 211
1366 3300050510 nmdc:mga06r32_2566_c2 nmdc:mga06r32_2566_c2_7274_7909 211
1367 3300050510 nmdc:mga06r32_29616_c1 nmdc:mga06r32_29616_c1_683_1318 211
1368 3300050512 nmdc:mga0n895_624176_c1 nmdc:mga0n895_624176_c1_351_986 211
1369 3300050513 nmdc:mga0rr50_247089_c1 nmdc:mga0rr50_247089_c1_554_1189 211
1370 3300050514 nmdc:mga08x19_53809_c1 nmdc:mga08x19_53809_c1_509_1144 211
1371 3300050515 nmdc:mga0a205_191945_c1 nmdc:mga0a205_191945_c1_1034_1669 211
1372 3300053090 Ga0500646_0069217 Ga0500646_0069217_260_895 211
1373 3300053092 Ga0500583_0006623 Ga0500583_0006623_2799_3434 211
1374 3300053092 Ga0500583_0062470 Ga0500583_0062470_949_1584 211
1375 3300053092 Ga0500583_0350760 Ga0500583_0350760_25_660 211
1376 3300053093 Ga0500651_0266820 Ga0500651_0266820_64_699 211
1377 3300053093 Ga0500651_0271844 Ga0500651_0271844_332_967 211
1378 3300053096 Ga0500641_0015545 Ga0500641_0015545_2164_2799 211
1379 3300053096 Ga0500641_0024813 Ga0500641_0024813_128_763 211
1380 3300053096 Ga0500641_0124551 Ga0500641_0124551_265_900 211
1381 3300053108 Ga0500562_077998 Ga0500562_077998_63_698 211
1382 3300053118 Ga0500594_0014629 Ga0500594_0014629_434_1069 211
1383 3300053130 Ga0500642_0067380 Ga0500642_0067380_624_1259 211
1384 3300053136 Ga0500559_0158397 Ga0500559_0158397_130_765 211
1385 3300053139 Ga0500568_0024339 Ga0500568_0024339_1402_2037 211
1386 3300053146 Ga0500588_0008394 Ga0500588_0008394_755_1390 211
1387 3300053146 Ga0500588_0012580 Ga0500588_0012580_1277_1912 211
1388 3300053153 Ga0500616_0000042 Ga0500616_0000042_91477_92112 211
1389 3300053156 Ga0500622_0012222 Ga0500622_0012222_3160_3795 211
1390 3300053159 Ga0500630_062394 Ga0500630_062394_985_1620 211
1391 3300053178 Ga0500637_0009768 Ga0500637_0009768_4070_4705 211
1392 3300053178 Ga0500637_0225699 Ga0500637_0225699_361_996 211
1393 3300054114 Ga0501084_0014889 Ga0501084_0014889_1896_2531 211
1394 3300054114 Ga0501084_0030772 Ga0501084_0030772_2579_3214 211
1395 3300060353 Ga0501082_0004924 Ga0501082_0004924_7945_8580 211
1396 3300060353 Ga0501082_0040179 Ga0501082_0040179_1342_1977 211
1397 3300061719 Ga0466962_0003791 Ga0466962_0003791_3535_4170 211
1398 3300061734 Ga0530510_0004144 Ga0530510_0004144_7201_7836 211
1399 3300061734 Ga0530510_0044737 Ga0530510_0044737_736_1371 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

21

133

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

163

219

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

162

207

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cz5-assembly2.cif.gz_B crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1 0.9609 3 136
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9588 1 111
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9557 145 207
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9511 143 207
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9505 144 203
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9767 146 203 1.10.10.10
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9609 3 136 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9588 1 111 3.40.50.2300
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9555 147 203 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9539 147 203 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1A9SZP6-F1-model_v4 DNA-binding response regulator 0.9618 2 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A6S6XQ24-F1-model_v4 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain 0.9557 2 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A1E4KAB5-F1-model_v4 DNA-binding response regulator 0.9538 1 208 GO:0000160
GO:0003677
GO:0006355
AF-A1WT06-F1-model_v4 Two component transcriptional regulator, LuxR family 0.953 1 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A3N5YNW8-F1-model_v4 Two-component system response regulator UvrY 0.9496 1 209 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
91.75 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map