F493675

General Info

Members Datasets Scaffolds Average Seq Length
1400 410 1400 113

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0320462|Ga0500635_0320462_99_521
Length 140
Sequence MSTCPDAGRRAAAEPSSGRSTVAGYRARMKLVTAIIKPHQLDRVKDALKQAGLHGMTVDEVKGFGRQGGHTETYRGAEYVVDLLPKVKVETVVPDELADQVADIIVNAARTGNIGDGKVWISSIDKVIRIRTGELDGDAV

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
112 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
115 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
220 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
237 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
238 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
259 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
262 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
267 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
270 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
271 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
272 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
273 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
279 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
387 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 0.07
Rhizoplane 6.43
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1020459 3300001904 Bacteria 1040
2 JGI25151J46595_10020691 3300003187 Bacteria 2769
3 JGI25153J46596_10142022 3300003215 Bacteria 523
4 Ga0007409J51694_1091639 3300003575 Bacteria 740
5 Ga0055524_1013072 3300003775 Bacteria 3152
6 Ga0055524_1016559 3300003775 Bacteria 2638
7 Ga0055536_1001953 3300003781 Bacteria 11878
8 Ga0055536_1021661 3300003781 Bacteria 1942
9 Ga0055536_1022461 3300003781 Bacteria 1882
10 Ga0055534_1008037 3300003784 Bacteria 2435
11 Ga0055534_1014588 3300003784 Bacteria 1466
12 Ga0055530_10000578 3300003791 Bacteria 31757
13 Ga0055540_1059529 3300003792 Bacteria 766
14 Ga0055531_10005972 3300003794 Bacteria 6996
15 Ga0055531_10076138 3300003794 Bacteria 755
16 Ga0055531_10083302 3300003794 Bacteria 698
17 Ga0058860_11886216 3300004801 Bacteria 513
18 Ga0070658_10230542 3300005327 Bacteria 1568
19 Ga0070658_10271818 3300005327 Bacteria 1441
20 Ga0070658_10320468 3300005327 Bacteria 1324
21 Ga0070676_10035996 3300005328 Bacteria 2850
22 Ga0070683_100009342 3300005329 Bacteria 8380
23 Ga0070683_100164501 3300005329 Bacteria 2105
24 Ga0070683_100193432 3300005329 Bacteria 1932
25 Ga0070683_100702525 3300005329 Bacteria 968
26 Ga0070683_100841158 3300005329 Bacteria 880
27 Ga0070683_101019396 3300005329 Bacteria 795
28 Ga0070690_100152737 3300005330 Bacteria 1577
29 Ga0070690_100561832 3300005330 Bacteria 862
30 Ga0070670_100008384 3300005331 Bacteria 8810
31 Ga0070670_100020647 3300005331 Bacteria 5666
32 Ga0070670_100301931 3300005331 Bacteria 1401
33 Ga0070670_100879245 3300005331 Bacteria 812
34 Ga0070677_10585781 3300005333 Bacteria 616
35 Ga0068869_100082842 3300005334 Bacteria 2398
36 Ga0068869_100089544 3300005334 Bacteria 2311
37 Ga0068869_101175118 3300005334 Bacteria 673
38 Ga0068869_101456232 3300005334 Bacteria 607
39 Ga0070666_10001853 3300005335 Bacteria 12883
40 Ga0070666_10001858 3300005335 Bacteria 12867
41 Ga0070666_10104933 3300005335 Bacteria 1951
42 Ga0070666_10106699 3300005335 Bacteria 1935
43 Ga0070666_10152584 3300005335 Bacteria 1612
44 Ga0070666_10313345 3300005335 Bacteria 1118
45 Ga0070666_11518868 3300005335 Bacteria 501
46 Ga0070680_100168007 3300005336 Bacteria 1845
47 Ga0070680_100783916 3300005336 Bacteria 821
48 Ga0070680_101370827 3300005336 Bacteria 612
49 Ga0070682_100702611 3300005337 Bacteria 811
50 Ga0068868_100002892 3300005338 Bacteria 11916
51 Ga0068868_100023407 3300005338 Bacteria 4675
52 Ga0068868_100052388 3300005338 Bacteria 3213
53 Ga0068868_100073533 3300005338 Bacteria 2730
54 Ga0068868_100245090 3300005338 Bacteria 1507
55 Ga0068868_100917469 3300005338 Bacteria 797
56 Ga0070660_100309699 3300005339 Bacteria 1295
57 Ga0070660_100526478 3300005339 Bacteria 985
58 Ga0070689_100062330 3300005340 Bacteria 2901
59 Ga0070689_100118587 3300005340 Bacteria 2112
60 Ga0070691_10437858 3300005341 Bacteria 744
61 Ga0070661_100317167 3300005344 Bacteria 1217
62 Ga0070661_100744294 3300005344 Bacteria 801
63 Ga0070661_100797306 3300005344 Bacteria 775
64 Ga0070661_101488612 3300005344 Bacteria 571
65 Ga0070692_11101637 3300005345 Bacteria 561
66 Ga0070668_100061913 3300005347 Bacteria 2899
67 Ga0070668_100123105 3300005347 Bacteria 2075
68 Ga0070668_100158266 3300005347 Bacteria 1836
69 Ga0070668_100470118 3300005347 Bacteria 1084
70 Ga0070668_101156304 3300005347 Bacteria 700
71 Ga0070675_100131501 3300005354 Bacteria 2133
72 Ga0070675_100580587 3300005354 Unclassified 1016
73 Ga0070675_102075178 3300005354 Bacteria 524
74 Ga0070671_100216956 3300005355 Bacteria 1623
75 Ga0070671_100478445 3300005355 Bacteria 1070
76 Ga0070671_100555740 3300005355 Unclassified 990
77 Ga0070671_100594802 3300005355 Bacteria 956
78 Ga0070671_100623307 3300005355 Bacteria 933
79 Ga0070671_100651630 3300005355 Bacteria 912
80 Ga0070671_100794062 3300005355 Bacteria 824
81 Ga0070671_101128638 3300005355 Bacteria 689
82 Ga0070674_100055299 3300005356 Bacteria 2748
83 Ga0070674_100096952 3300005356 Bacteria 2141
84 Ga0070674_100242595 3300005356 Bacteria 1411
85 Ga0070674_101047912 3300005356 Bacteria 718
86 Ga0070674_101842572 3300005356 Bacteria 549
87 Ga0070673_100200402 3300005364 Bacteria 1719
88 Ga0070673_100229682 3300005364 Bacteria 1609
89 Ga0070673_100243952 3300005364 Bacteria 1563
90 Ga0070688_100035680 3300005365 Bacteria 3021
91 Ga0070659_100070335 3300005366 Bacteria 2780
92 Ga0070659_100396649 3300005366 Unclassified 1164
93 Ga0070667_100012108 3300005367 Bacteria 7140
94 Ga0070667_100050487 3300005367 Bacteria 3506
95 Ga0070667_100168848 3300005367 Bacteria 1930
96 Ga0070667_100239742 3300005367 Bacteria 1619
97 Ga0070667_100601514 3300005367 Bacteria 1013
98 Ga0070667_101972865 3300005367 Bacteria 550
99 Ga0070709_10040805 3300005434 Bacteria 2856
100 Ga0070709_10190549 3300005434 Bacteria 1446
101 Ga0070709_10250424 3300005434 Bacteria 1276
102 Ga0070714_100222825 3300005435 Bacteria 1734
103 Ga0070713_100398392 3300005436 Bacteria 1285
104 Ga0070713_101274783 3300005436 Bacteria 712
105 Ga0070710_11204827 3300005437 Bacteria 560
106 Ga0070701_11217311 3300005438 Bacteria 535
107 Ga0070711_100502744 3300005439 Bacteria 1000
108 Ga0070711_100646771 3300005439 Bacteria 886
109 Ga0070705_100606260 3300005440 Bacteria 848
110 Ga0070700_100090819 3300005441 Bacteria 1992
111 Ga0070700_100356404 3300005441 Bacteria 1086
112 Ga0070700_101307374 3300005441 Bacteria 609
113 Ga0070700_101810937 3300005441 Bacteria 526
114 Ga0070694_100356639 3300005444 Bacteria 1134
115 Ga0070694_100888618 3300005444 Bacteria 735
116 Ga0070708_100790466 3300005445 Bacteria 892
117 Ga0070663_100006966 3300005455 Bacteria 6844
118 Ga0070663_100431874 3300005455 Bacteria 1082
119 Ga0070663_100600003 3300005455 Bacteria 926
120 Ga0070663_100839526 3300005455 Bacteria 790
121 Ga0070663_101834212 3300005455 Bacteria 544
122 Ga0070678_100184141 3300005456 Bacteria 1712
123 Ga0070678_100185081 3300005456 Bacteria 1708
124 Ga0070678_100251181 3300005456 Bacteria 1483
125 Ga0070678_100264027 3300005456 Bacteria 1449
126 Ga0070678_100837154 3300005456 Bacteria 837
127 Ga0070662_100089159 3300005457 Unclassified 2313
128 Ga0070662_100191719 3300005457 Bacteria 1617
129 Ga0070662_100235573 3300005457 Bacteria 1466
130 Ga0070662_100598881 3300005457 Bacteria 927
131 Ga0070662_101272128 3300005457 Bacteria 633
132 Ga0070662_101306613 3300005457 Unclassified 624
133 Ga0070681_10032389 3300005458 Bacteria 5246
134 Ga0070681_10434936 3300005458 Bacteria 1224
135 Ga0070681_10844164 3300005458 Bacteria 834
136 Ga0068867_100009183 3300005459 Bacteria 6980
137 Ga0068867_100025867 3300005459 Bacteria 4210
138 Ga0068867_100084237 3300005459 Bacteria 2401
139 Ga0068867_100376064 3300005459 Bacteria 1192
140 Ga0068867_102387584 3300005459 Bacteria 503
141 Ga0070685_10000451 3300005466 Bacteria 23864
142 Ga0070685_10513131 3300005466 Bacteria 850
143 Ga0070685_11574634 3300005466 Bacteria 508
144 Ga0070698_101333024 3300005471 Bacteria 668
145 Ga0070679_100097653 3300005530 Bacteria 2925
146 Ga0070679_100466649 3300005530 Bacteria 1207
147 Ga0070679_100682259 3300005530 Bacteria 970
148 Ga0070679_101148126 3300005530 Bacteria 722
149 Ga0070684_100116954 3300005535 Bacteria 2395
150 Ga0070684_100175239 3300005535 Bacteria 1949
151 Ga0070684_100559071 3300005535 Bacteria 1062
152 Ga0070684_100756026 3300005535 Bacteria 907
153 Ga0070684_101091014 3300005535 Bacteria 750
154 Ga0070684_101526321 3300005535 Bacteria 630
155 Ga0068853_100071363 3300005539 Bacteria 3024
156 Ga0068853_100100623 3300005539 Bacteria 2555
157 Ga0068853_100136744 3300005539 Bacteria 2197
158 Ga0068853_100371171 3300005539 Bacteria 1335
159 Ga0068853_100411923 3300005539 Bacteria 1266
160 Ga0068853_100464408 3300005539 Bacteria 1192
161 Ga0068853_100562116 3300005539 Bacteria 1081
162 Ga0068853_100624342 3300005539 Bacteria 1024
163 Ga0068853_100734184 3300005539 Bacteria 943
164 Ga0068853_101527667 3300005539 Bacteria 647
165 Ga0070672_100001795 3300005543 Bacteria 13422
166 Ga0070672_100146908 3300005543 Bacteria 1948
167 Ga0070672_100191976 3300005543 Bacteria 1705
168 Ga0070672_100683935 3300005543 Bacteria 898
169 Ga0070686_100011927 3300005544 Bacteria 4941
170 Ga0070686_100048036 3300005544 Bacteria 2702
171 Ga0070686_100525036 3300005544 Bacteria 922
172 Ga0070686_100596289 3300005544 Bacteria 870
173 Ga0070693_100100982 3300005547 Bacteria 1757
174 Ga0070693_100121565 3300005547 Bacteria 1620
175 Ga0070693_100357862 3300005547 Bacteria 1001
176 Ga0070693_100536104 3300005547 Bacteria 836
177 Ga0070693_100542601 3300005547 Bacteria 831
178 Ga0070665_100004571 3300005548 Bacteria 14495
179 Ga0070665_100103330 3300005548 Bacteria 2853
180 Ga0070665_100223338 3300005548 Bacteria 1884
181 Ga0070665_100685398 3300005548 Bacteria 1038
182 Ga0070665_101429234 3300005548 Bacteria 701
183 Ga0070704_101360420 3300005549 Bacteria 651
184 Ga0068855_100000432 3300005563 Bacteria 51912
185 Ga0068855_100002034 3300005563 Bacteria 25069
186 Ga0068855_100132552 3300005563 Bacteria 2845
187 Ga0068855_100238567 3300005563 Bacteria 2032
188 Ga0068855_100672786 3300005563 Bacteria 1110
189 Ga0068855_100777737 3300005563 Bacteria 1019
190 Ga0068855_100823119 3300005563 Bacteria 985
191 Ga0068855_102299715 3300005563 Bacteria 539
192 Ga0068855_102359364 3300005563 Bacteria 531
193 Ga0070664_100000726 3300005564 Bacteria 25332
194 Ga0070664_100114705 3300005564 Bacteria 2354
195 Ga0070664_100403208 3300005564 Bacteria 1251
196 Ga0070664_100463468 3300005564 Bacteria 1164
197 Ga0070664_100567162 3300005564 Bacteria 1051
198 Ga0068857_100000096 3300005577 Bacteria 51376
199 Ga0068857_100047219 3300005577 Bacteria 3822
200 Ga0068857_100060204 3300005577 Bacteria 3373
201 Ga0068857_100133139 3300005577 Bacteria 2243
202 Ga0068857_100386761 3300005577 Bacteria 1300
203 Ga0068857_100407995 3300005577 Archaea 1265
204 Ga0068857_100698433 3300005577 Bacteria 964
205 Ga0068857_102017329 3300005577 Bacteria 566
206 Ga0068854_100000554 3300005578 Bacteria 22552
207 Ga0068854_100024664 3300005578 Bacteria 4120
208 Ga0068854_100045641 3300005578 Bacteria 3117
209 Ga0068854_100223761 3300005578 Bacteria 1490
210 Ga0068854_100464268 3300005578 Bacteria 1060
211 Ga0068854_101042823 3300005578 Bacteria 726
212 Ga0068856_100000179 3300005614 Bacteria 66149
213 Ga0068856_100002175 3300005614 Bacteria 20318
214 Ga0068856_100193004 3300005614 Bacteria 2050
215 Ga0068856_100386850 3300005614 Bacteria 1418
216 Ga0068856_100539649 3300005614 Bacteria 1187
217 Ga0070702_100024290 3300005615 Bacteria 3232
218 Ga0070702_100055642 3300005615 Bacteria 2282
219 Ga0070702_100122007 3300005615 Bacteria 1633
220 Ga0070702_100167315 3300005615 Bacteria 1427
221 Ga0070702_100520411 3300005615 Unclassified 877
222 Ga0068852_100010460 3300005616 Bacteria 6937
223 Ga0068852_100035832 3300005616 Bacteria 4144
224 Ga0068852_100209869 3300005616 Bacteria 1847
225 Ga0068852_100400190 3300005616 Bacteria 1350
226 Ga0068852_100627068 3300005616 Bacteria 1081
227 Ga0068859_100010599 3300005617 Bacteria 9278
228 Ga0068859_100136484 3300005617 Bacteria 2526
229 Ga0068859_100237623 3300005617 Bacteria 1911
230 Ga0068859_101049795 3300005617 Bacteria 896
231 Ga0068859_101855626 3300005617 Bacteria 666
232 Ga0068864_100000129 3300005618 Bacteria 73206
233 Ga0068864_100011149 3300005618 Bacteria 7430
234 Ga0068864_100227870 3300005618 Bacteria 1722
235 Ga0068864_100602769 3300005618 Bacteria 1066
236 Ga0068864_101270974 3300005618 Unclassified 736
237 Ga0068866_10007138 3300005718 Bacteria 4671
238 Ga0068866_10010050 3300005718 Unclassified 4045
239 Ga0068866_10064147 3300005718 Bacteria 1917
240 Ga0068866_10343585 3300005718 Bacteria 946
241 Ga0068861_100038831 3300005719 Unclassified 3550
242 Ga0068861_100039875 3300005719 Bacteria 3508
243 Ga0068861_100153483 3300005719 Bacteria 1892
244 Ga0068861_100244554 3300005719 Bacteria 1528
245 Ga0068861_100647643 3300005719 Bacteria 976
246 Ga0068851_10003554 3300005834 Bacteria 6940
247 Ga0068870_10045752 3300005840 Bacteria 2293
248 Ga0068870_10089992 3300005840 Bacteria 1714
249 Ga0068870_10448127 3300005840 Bacteria 850
250 Ga0068863_100005116 3300005841 Bacteria 12931
251 Ga0068863_100026366 3300005841 Bacteria 5545
252 Ga0068863_100090500 3300005841 Bacteria 2901
253 Ga0068863_100170884 3300005841 Bacteria 2085
254 Ga0068863_100183012 3300005841 Bacteria 2011
255 Ga0068863_100243488 3300005841 Bacteria 1736
256 Ga0068863_100423207 3300005841 Bacteria 1305
257 Ga0068863_100458082 3300005841 Unclassified 1252
258 Ga0068863_100595675 3300005841 Bacteria 1094
259 Ga0068863_100870858 3300005841 Bacteria 900
260 Ga0068863_101287007 3300005841 Bacteria 738
261 Ga0068858_100025071 3300005842 Bacteria 5550
262 Ga0068858_100030716 3300005842 Unclassified 4989
263 Ga0068858_100124922 3300005842 Bacteria 2408
264 Ga0068858_100213797 3300005842 Bacteria 1825
265 Ga0068858_100255257 3300005842 Bacteria 1666
266 Ga0068858_100627282 3300005842 Bacteria 1044
267 Ga0068858_100635556 3300005842 Bacteria 1037
268 Ga0068858_100725982 3300005842 Bacteria 967
269 Ga0068858_100744839 3300005842 Bacteria 954
270 Ga0068858_100828650 3300005842 Bacteria 903
271 Ga0068858_102369603 3300005842 Bacteria 524
272 Ga0068860_100004438 3300005843 Bacteria 14325
273 Ga0068860_100027327 3300005843 Bacteria 5497
274 Ga0068860_100091037 3300005843 Bacteria 2906
275 Ga0068860_100365661 3300005843 Bacteria 1422
276 Ga0068860_100510384 3300005843 Bacteria 1201
277 Ga0068860_100603674 3300005843 Bacteria 1103
278 Ga0068860_102397800 3300005843 Bacteria 548
279 Ga0068862_101456482 3300005844 Bacteria 689
280 Ga0068862_101952538 3300005844 Bacteria 597
281 Ga0081455_10799957 3300005937 Bacteria 592
282 Ga0081540_1001046 3300005983 Bacteria 24692
283 Ga0081540_1117627 3300005983 Bacteria 1110
284 Ga0075365_10009641 3300006038 Bacteria 5571
285 Ga0075365_10021278 3300006038 Bacteria 4043
286 Ga0075365_10042348 3300006038 Bacteria 2977
287 Ga0075365_10066208 3300006038 Bacteria 2423
288 Ga0075365_10081217 3300006038 Bacteria 2196
289 Ga0075365_10171080 3300006038 Bacteria 1516
290 Ga0075365_10195685 3300006038 Bacteria 1415
291 Ga0075365_10209985 3300006038 Bacteria 1365
292 Ga0075365_10229439 3300006038 Bacteria 1303
293 Ga0075365_10239001 3300006038 Bacteria 1276
294 Ga0075365_10271012 3300006038 Bacteria 1194
295 Ga0075365_10273148 3300006038 Bacteria 1189
296 Ga0075365_11035369 3300006038 Bacteria 578
297 Ga0075368_10018412 3300006042 Bacteria 2624
298 Ga0075368_10274749 3300006042 Bacteria 723
299 Ga0075368_10329156 3300006042 Bacteria 663
300 Ga0075368_10342364 3300006042 Bacteria 650
301 Ga0075368_10398090 3300006042 Bacteria 604
302 Ga0075363_100024237 3300006048 Bacteria 3083
303 Ga0075363_100071908 3300006048 Bacteria 1881
304 Ga0075363_100347545 3300006048 Bacteria 866
305 Ga0075364_10001125 3300006051 Bacteria 14277
306 Ga0075364_10018799 3300006051 Bacteria 4332
307 Ga0075364_10086675 3300006051 Bacteria 2075
308 Ga0075364_10181730 3300006051 Bacteria 1423
309 Ga0075364_10387297 3300006051 Bacteria 954
310 Ga0075364_10402584 3300006051 Bacteria 934
311 Ga0075364_10493870 3300006051 Bacteria 837
312 Ga0075364_11249850 3300006051 Bacteria 503
313 Ga0070715_10154698 3300006163 Bacteria 1127
314 Ga0070712_100264735 3300006175 Bacteria 1379
315 Ga0075367_10017493 3300006178 Bacteria 3935
316 Ga0075367_10032975 3300006178 Bacteria 2983
317 Ga0075367_10067400 3300006178 Bacteria 2146
318 Ga0075367_10088617 3300006178 Bacteria 1881
319 Ga0075367_10210472 3300006178 Bacteria 1216
320 Ga0075367_10243957 3300006178 Bacteria 1126
321 Ga0075367_10515075 3300006178 Bacteria 759
322 Ga0075367_10697495 3300006178 Bacteria 646
323 Ga0075366_10711803 3300006195 Bacteria 623
324 Ga0097621_100000196 3300006237 Bacteria 39296
325 Ga0097621_100002114 3300006237 Bacteria 13601
326 Ga0097621_100019556 3300006237 Bacteria 5200
327 Ga0097621_100159978 3300006237 Bacteria 1935
328 Ga0097621_100288304 3300006237 Bacteria 1447
329 Ga0097621_100385197 3300006237 Bacteria 1253
330 Ga0097621_100407750 3300006237 Unclassified 1218
331 Ga0075370_10623732 3300006353 Bacteria 654
332 Ga0068871_100000049 3300006358 Bacteria 65954
333 Ga0068871_100027217 3300006358 Unclassified 4469
334 Ga0068871_100047305 3300006358 Bacteria 3469
335 Ga0068871_100071763 3300006358 Bacteria 2849
336 Ga0068871_100133563 3300006358 Bacteria 2106
337 Ga0068871_100138395 3300006358 Bacteria 2069
338 Ga0068871_100227044 3300006358 Bacteria 1619
339 Ga0068871_100338812 3300006358 Bacteria 1327
340 Ga0075428_100101055 3300006844 Bacteria 3144
341 Ga0075431_101115607 3300006847 Bacteria 753
342 Ga0075429_100456305 3300006880 Bacteria 1120
343 Ga0075429_100756886 3300006880 Bacteria 851
344 Ga0068865_100016213 3300006881 Bacteria 4763
345 Ga0068865_100070890 3300006881 Bacteria 2470
346 Ga0068865_100077435 3300006881 Bacteria 2376
347 Ga0068865_100179459 3300006881 Bacteria 1630
348 Ga0068865_100188845 3300006881 Bacteria 1592
349 Ga0068865_100398524 3300006881 Bacteria 1127
350 Ga0068865_100742490 3300006881 Bacteria 842
351 Ga0068865_100750310 3300006881 Bacteria 838
352 Ga0097620_100010599 3300006931 Bacteria 9278
353 Ga0097620_100136488 3300006931 Bacteria 2526
354 Ga0097620_100237623 3300006931 Bacteria 1911
355 Ga0097620_101049746 3300006931 Bacteria 896
356 Ga0097620_101855547 3300006931 Bacteria 666
357 Ga0099824_1019323 3300006942 Bacteria 5344
358 Ga0105240_10000906 3300009093 Bacteria 52979
359 Ga0105240_10004993 3300009093 Bacteria 19922
360 Ga0105240_10027081 3300009093 Bacteria 7512
361 Ga0105240_10027316 3300009093 Bacteria 7473
362 Ga0105240_10088014 3300009093 Bacteria 3801
363 Ga0105240_10155563 3300009093 Bacteria 2719
364 Ga0105240_10251728 3300009093 Bacteria 2042
365 Ga0105240_10265229 3300009093 Bacteria 1980
366 Ga0105240_10279530 3300009093 Bacteria 1918
367 Ga0105240_11861069 3300009093 Bacteria 627
368 Ga0105240_12426867 3300009093 Bacteria 543
369 Ga0111539_10175933 3300009094 Bacteria 2500
370 Ga0111539_10371110 3300009094 Bacteria 1665
371 Ga0111539_11274521 3300009094 Bacteria 853
372 Ga0105245_10187338 3300009098 Bacteria 1980
373 Ga0105245_10188072 3300009098 Bacteria 1976
374 Ga0105245_10896004 3300009098 Unclassified 929
375 Ga0105245_11019902 3300009098 Bacteria 872
376 Ga0105247_10288387 3300009101 Bacteria 1134
377 Ga0105247_10778532 3300009101 Bacteria 728
378 Ga0105247_11601429 3300009101 Bacteria 535
379 Ga0114129_10604548 3300009147 Bacteria 1420
380 Ga0105243_10041324 3300009148 Bacteria 3606
381 Ga0105243_10042566 3300009148 Bacteria 3555
382 Ga0105243_10090932 3300009148 Bacteria 2512
383 Ga0105243_10408280 3300009148 Bacteria 1263
384 Ga0105243_10501008 3300009148 Bacteria 1151
385 Ga0105243_10657632 3300009148 Unclassified 1016
386 Ga0105243_11165715 3300009148 Bacteria 782
387 Ga0105243_11231758 3300009148 Bacteria 763
388 Ga0105241_10032759 3300009174 Bacteria 3899
389 Ga0105241_10120160 3300009174 Bacteria 2114
390 Ga0105241_10431342 3300009174 Bacteria 1162
391 Ga0105241_10644028 3300009174 Bacteria 962
392 Ga0105241_11338911 3300009174 Bacteria 683
393 Ga0105241_12560117 3300009174 Bacteria 512
394 Ga0105242_10012056 3300009176 Bacteria 6653
395 Ga0105242_10042305 3300009176 Bacteria 3678
396 Ga0105242_10423519 3300009176 Bacteria 1248
397 Ga0105242_10886616 3300009176 Bacteria 891
398 Ga0105242_11228100 3300009176 Unclassified 770
399 Ga0105242_11832603 3300009176 Archaea 646
400 Ga0105242_12312340 3300009176 Bacteria 584
401 Ga0105248_10010283 3300009177 Bacteria 10301
402 Ga0105248_10017949 3300009177 Bacteria 7809
403 Ga0105248_10081498 3300009177 Bacteria 3637
404 Ga0105248_10164087 3300009177 Bacteria 2505
405 Ga0105248_10242008 3300009177 Bacteria 2031
406 Ga0105248_10310979 3300009177 Bacteria 1774
407 Ga0105248_10415691 3300009177 Bacteria 1514
408 Ga0105248_10640126 3300009177 Bacteria 1200
409 Ga0105248_10992361 3300009177 Bacteria 949
410 Ga0105237_10009430 3300009545 Bacteria 10456
411 Ga0105237_10066651 3300009545 Bacteria 3595
412 Ga0105237_10333521 3300009545 Bacteria 1521
413 Ga0105237_10628663 3300009545 Bacteria 1080
414 Ga0105237_10672051 3300009545 Bacteria 1042
415 Ga0105237_10898148 3300009545 Bacteria 893
416 Ga0105237_11075995 3300009545 Bacteria 811
417 Ga0105238_10009376 3300009551 Bacteria 9795
418 Ga0105238_10023690 3300009551 Bacteria 6256
419 Ga0105238_10036707 3300009551 Bacteria 4982
420 Ga0105238_10052956 3300009551 Bacteria 4079
421 Ga0105238_10082010 3300009551 Bacteria 3215
422 Ga0105238_10097773 3300009551 Bacteria 2920
423 Ga0105238_10327534 3300009551 Bacteria 1518
424 Ga0105238_10452257 3300009551 Bacteria 1281
425 Ga0105238_10495788 3300009551 Bacteria 1222
426 Ga0105238_10790803 3300009551 Bacteria 964
427 Ga0105249_10048096 3300009553 Bacteria 3889
428 Ga0105249_10159404 3300009553 Bacteria 2179
429 Ga0105249_10179568 3300009553 Bacteria 2058
430 Ga0105249_10279928 3300009553 Bacteria 1665
431 Ga0105249_10300706 3300009553 Bacteria 1609
432 Ga0105249_10594681 3300009553 Bacteria 1160
433 Ga0105239_10038937 3300010375 Bacteria 5208
434 Ga0105239_10049542 3300010375 Bacteria 4606
435 Ga0105239_10134538 3300010375 Bacteria 2752
436 Ga0105239_10134956 3300010375 Bacteria 2747
437 Ga0105239_10150239 3300010375 Bacteria 2600
438 Ga0105239_10275935 3300010375 Bacteria 1891
439 Ga0105239_11043199 3300010375 Bacteria 940
440 Ga0105239_11424567 3300010375 Bacteria 800
441 Ga0105246_10016866 3300011119 Bacteria 4633
442 Ga0105246_10077748 3300011119 Bacteria 2355
443 Ga0105246_10121355 3300011119 Bacteria 1937
444 Ga0105246_10767720 3300011119 Bacteria 852
445 Ga0105246_11133405 3300011119 Bacteria 716
446 Ga0105246_11474086 3300011119 Bacteria 638
447 Ga0157318_1007034 3300012482 Bacteria 757
448 Ga0157339_1003561 3300012505 Bacteria 1132
449 Ga0157316_1050929 3300012510 Bacteria 571
450 Ga0157327_1005852 3300012512 Bacteria 1012
451 Ga0157338_1007600 3300012515 Bacteria 1032
452 Ga0157373_10130661 3300013100 Bacteria 1766
453 Ga0157371_10163129 3300013102 Bacteria 1592
454 Ga0157371_10189802 3300013102 Bacteria 1471
455 Ga0157371_10695988 3300013102 Unclassified 761
456 Ga0157371_10790493 3300013102 Bacteria 715
457 Ga0157370_10110028 3300013104 Bacteria 2575
458 Ga0157370_10617216 3300013104 Bacteria 992
459 Ga0157370_11946286 3300013104 Bacteria 527
460 Ga0157369_10019968 3300013105 Bacteria 7491
461 Ga0157369_10075339 3300013105 Bacteria 3618
462 Ga0157369_10360373 3300013105 Bacteria 1510
463 Ga0157369_10425283 3300013105 Bacteria 1377
464 Ga0157369_10431777 3300013105 Bacteria 1365
465 Ga0157369_10442977 3300013105 Bacteria 1345
466 Ga0157369_10599162 3300013105 Bacteria 1137
467 Ga0157374_10000062 3300013296 Bacteria 112028
468 Ga0157374_10021722 3300013296 Bacteria 5715
469 Ga0157374_10106725 3300013296 Bacteria 2691
470 Ga0157374_10150309 3300013296 Bacteria 2264
471 Ga0157374_10253738 3300013296 Bacteria 1731
472 Ga0157374_10518609 3300013296 Bacteria 1197
473 Ga0157374_10816210 3300013296 Bacteria 949
474 Ga0157378_10000009 3300013297 Bacteria 161557
475 Ga0157378_10000366 3300013297 Bacteria 44698
476 Ga0157378_10002258 3300013297 Bacteria 17116
477 Ga0157378_10025295 3300013297 Bacteria 5228
478 Ga0157378_10106770 3300013297 Bacteria 2562
479 Ga0157378_10245045 3300013297 Bacteria 1714
480 Ga0157378_10818152 3300013297 Bacteria 958
481 Ga0157378_10997973 3300013297 Bacteria 871
482 Ga0163162_10000028 3300013306 Bacteria 175501
483 Ga0163162_10071763 3300013306 Bacteria 3516
484 Ga0163162_10082672 3300013306 Bacteria 3284
485 Ga0163162_10151115 3300013306 Bacteria 2440
486 Ga0163162_10329599 3300013306 Bacteria 1659
487 Ga0163162_10605705 3300013306 Bacteria 1221
488 Ga0163162_10651778 3300013306 Bacteria 1177
489 Ga0163162_11730171 3300013306 Bacteria 714
490 Ga0163162_11925388 3300013306 Bacteria 677
491 Ga0163162_12515910 3300013306 Bacteria 592
492 Ga0163162_12811305 3300013306 Unclassified 560
493 Ga0157372_10001184 3300013307 Bacteria 28212
494 Ga0157372_10002204 3300013307 Bacteria 21156
495 Ga0157372_10008186 3300013307 Bacteria 11112
496 Ga0157372_10111977 3300013307 Bacteria 3127
497 Ga0157372_10292790 3300013307 Bacteria 1893
498 Ga0157372_10303986 3300013307 Bacteria 1856
499 Ga0157372_10307674 3300013307 Bacteria 1844
500 Ga0157372_10334834 3300013307 Bacteria 1763
501 Ga0157375_10001583 3300013308 Bacteria 19576
502 Ga0157375_10031568 3300013308 Bacteria 5010
503 Ga0157375_10072749 3300013308 Bacteria 3455
504 Ga0157375_10084786 3300013308 Bacteria 3217
505 Ga0157375_10213455 3300013308 Bacteria 2087
506 Ga0157375_10730150 3300013308 Bacteria 1143
507 Ga0157375_11076585 3300013308 Bacteria 940
508 Ga0157375_12341202 3300013308 Bacteria 637
509 Ga0157375_13165977 3300013308 Bacteria 549
510 Ga0163163_10001955 3300014325 Bacteria 17429
511 Ga0163163_10004520 3300014325 Bacteria 11868
512 Ga0163163_10103355 3300014325 Bacteria 2874
513 Ga0163163_10270330 3300014325 Bacteria 1751
514 Ga0163163_10495605 3300014325 Bacteria 1283
515 Ga0163163_12569231 3300014325 Bacteria 567
516 Ga0157380_10020607 3300014326 Bacteria 4931
517 Ga0157380_10269114 3300014326 Bacteria 1552
518 Ga0157380_10505670 3300014326 Bacteria 1175
519 Ga0157380_10770206 3300014326 Bacteria 976
520 Ga0157380_11276160 3300014326 Bacteria 781
521 Ga0182008_10049225 3300014497 Bacteria 2092
522 Ga0182008_10481120 3300014497 Bacteria 680
523 Ga0182008_10525419 3300014497 Bacteria 654
524 Ga0157377_10151536 3300014745 Bacteria 1434
525 Ga0157377_10279058 3300014745 Bacteria 1094
526 Ga0157379_10000319 3300014968 Bacteria 38313
527 Ga0157379_10030697 3300014968 Bacteria 4786
528 Ga0157379_10245833 3300014968 Bacteria 1623
529 Ga0157379_10365956 3300014968 Bacteria 1322
530 Ga0157379_10548003 3300014968 Bacteria 1076
531 Ga0157379_11033142 3300014968 Bacteria 785
532 Ga0157379_11298238 3300014968 Bacteria 703
533 Ga0157376_10082837 3300014969 Bacteria 2758
534 Ga0157376_10093047 3300014969 Bacteria 2616
535 Ga0157376_10105381 3300014969 Bacteria 2472
536 Ga0157376_10122466 3300014969 Bacteria 2307
537 Ga0157376_10189556 3300014969 Bacteria 1885
538 Ga0157376_10258581 3300014969 Bacteria 1630
539 Ga0157376_10260700 3300014969 Bacteria 1624
540 Ga0157376_10484450 3300014969 Bacteria 1213
541 Ga0157376_10508205 3300014969 Bacteria 1185
542 Ga0157376_11043313 3300014969 Bacteria 842
543 Ga0157376_11139105 3300014969 Bacteria 807
544 Ga0163161_10005516 3300017792 Bacteria 8769
545 Ga0163161_10015892 3300017792 Bacteria 5251
546 Ga0163161_10201622 3300017792 Bacteria 1534
547 Ga0163161_10203088 3300017792 Bacteria 1528
548 Ga0163161_10363611 3300017792 Bacteria 1153
549 Ga0163161_10554401 3300017792 Bacteria 942
550 Ga0163161_11628128 3300017792 Bacteria 570
551 Ga0163161_11943241 3300017792 Bacteria 523
552 Ga0206356_11689876 3300020070 Bacteria 952
553 Ga0206349_1714749 3300020075 Bacteria 502
554 Ga0206353_11171569 3300020082 Bacteria 818
555 Ga0206353_11366746 3300020082 Bacteria 1196
556 Ga0206353_11586967 3300020082 Bacteria 1761
557 Ga0209673_1007174 3300025273 Bacteria 5202
558 Ga0209673_1072312 3300025273 Bacteria 816
559 Ga0209130_1011708 3300025284 Bacteria 2334
560 Ga0209675_1004813 3300025291 Bacteria 5859
561 Ga0209675_1004817 3300025291 Bacteria 5855
562 Ga0209676_1001568 3300025292 Bacteria 20438
563 Ga0209676_1002588 3300025292 Bacteria 12442
564 Ga0209676_1002747 3300025292 Bacteria 11792
565 Ga0209676_1003093 3300025292 Bacteria 10710
566 Ga0209676_1033031 3300025292 Bacteria 1547
567 Ga0209676_1068054 3300025292 Bacteria 857
568 Ga0209025_1000454 3300025294 Bacteria 80042
569 Ga0209025_1011745 3300025294 Bacteria 5716
570 Ga0209025_1020449 3300025294 Bacteria 3622
571 Ga0209025_1033207 3300025294 Bacteria 2391
572 Ga0209025_1067527 3300025294 Bacteria 1291
573 Ga0209025_1191523 3300025294 Bacteria 513
574 Ga0209564_1003082 3300025295 Bacteria 11815
575 Ga0209758_1053082 3300025297 Bacteria 1395
576 Ga0209758_1112180 3300025297 Bacteria 752
577 Ga0209050_1000865 3300025298 Bacteria 40908
578 Ga0209050_1008800 3300025298 Bacteria 5302
579 Ga0209256_1005269 3300025299 Bacteria 7545
580 Ga0209256_1006382 3300025299 Bacteria 6275
581 Ga0209051_1029660 3300025303 Bacteria 2137
582 Ga0209257_1000154 3300025304 Bacteria 185887
583 Ga0209257_1001025 3300025304 Bacteria 37552
584 Ga0209257_1001296 3300025304 Bacteria 30463
585 Ga0209257_1015047 3300025304 Bacteria 3258
586 Ga0207697_10157211 3300025315 Bacteria 991
587 Ga0207656_10001724 3300025321 Bacteria 7270
588 Ga0207656_10112803 3300025321 Bacteria 1258
589 Ga0207682_10143516 3300025893 Bacteria 1073
590 Ga0207682_10171017 3300025893 Bacteria 988
591 Ga0207692_10969175 3300025898 Bacteria 561
592 Ga0207642_10007476 3300025899 Bacteria 3694
593 Ga0207642_10118473 3300025899 Bacteria 1361
594 Ga0207642_10741856 3300025899 Bacteria 621
595 Ga0207688_10044138 3300025901 Bacteria 2484
596 Ga0207680_10001162 3300025903 Bacteria 12407
597 Ga0207680_10007152 3300025903 Bacteria 5427
598 Ga0207680_10359870 3300025903 Bacteria 1023
599 Ga0207680_10456999 3300025903 Bacteria 907
600 Ga0207680_10704104 3300025903 Bacteria 724
601 Ga0207647_10000024 3300025904 Bacteria 115153
602 Ga0207647_10002046 3300025904 Bacteria 15407
603 Ga0207647_10063045 3300025904 Bacteria 2256
604 Ga0207647_10487124 3300025904 Bacteria 688
605 Ga0207647_10548242 3300025904 Bacteria 641
606 Ga0207647_10801934 3300025904 Bacteria 506
607 Ga0207699_10070829 3300025906 Bacteria 2130
608 Ga0207699_10341074 3300025906 Bacteria 1056
609 Ga0207699_10429108 3300025906 Bacteria 945
610 Ga0207645_10025001 3300025907 Bacteria 3868
611 Ga0207643_10125350 3300025908 Bacteria 1525
612 Ga0207643_10127157 3300025908 Bacteria 1513
613 Ga0207643_10380027 3300025908 Bacteria 890
614 Ga0207705_10149766 3300025909 Bacteria 1748
615 Ga0207705_10373572 3300025909 Bacteria 1101
616 Ga0207705_10634513 3300025909 Bacteria 831
617 Ga0207705_11074411 3300025909 Bacteria 620
618 Ga0207654_10006477 3300025911 Bacteria 5893
619 Ga0207654_10015692 3300025911 Bacteria 3935
620 Ga0207654_10065026 3300025911 Bacteria 2146
621 Ga0207654_10100463 3300025911 Bacteria 1782
622 Ga0207654_10266358 3300025911 Bacteria 1154
623 Ga0207707_10001452 3300025912 Bacteria 21916
624 Ga0207707_10052277 3300025912 Unclassified 3558
625 Ga0207695_10000040 3300025913 Bacteria 452787
626 Ga0207695_10002176 3300025913 Bacteria 29640
627 Ga0207695_10006210 3300025913 Bacteria 15563
628 Ga0207695_10016274 3300025913 Bacteria 8712
629 Ga0207695_10022021 3300025913 Bacteria 7252
630 Ga0207695_10025623 3300025913 Bacteria 6597
631 Ga0207695_10038774 3300025913 Bacteria 5125
632 Ga0207695_10040956 3300025913 Unclassified 4961
633 Ga0207695_10533362 3300025913 Bacteria 1055
634 Ga0207695_10827735 3300025913 Bacteria 806
635 Ga0207671_10002984 3300025914 Bacteria 17350
636 Ga0207671_10009442 3300025914 Bacteria 8155
637 Ga0207671_10018841 3300025914 Bacteria 5290
638 Ga0207671_10405775 3300025914 Bacteria 1084
639 Ga0207671_10496425 3300025914 Bacteria 973
640 Ga0207671_10577850 3300025914 Bacteria 896
641 Ga0207671_11167927 3300025914 Bacteria 603
642 Ga0207693_10286913 3300025915 Bacteria 1290
643 Ga0207663_10152669 3300025916 Bacteria 1622
644 Ga0207663_11091975 3300025916 Bacteria 641
645 Ga0207660_10416195 3300025917 Bacteria 1084
646 Ga0207660_10722308 3300025917 Bacteria 813
647 Ga0207660_11349006 3300025917 Unclassified 579
648 Ga0207662_10040240 3300025918 Bacteria 2747
649 Ga0207657_10000326 3300025919 Bacteria 50694
650 Ga0207657_10511310 3300025919 Bacteria 940
651 Ga0207657_11111319 3300025919 Bacteria 604
652 Ga0207649_10004643 3300025920 Bacteria 7437
653 Ga0207649_10159208 3300025920 Bacteria 1563
654 Ga0207649_10270891 3300025920 Unclassified 1231
655 Ga0207649_10532696 3300025920 Bacteria 897
656 Ga0207649_10585098 3300025920 Bacteria 857
657 Ga0207649_10788992 3300025920 Bacteria 741
658 Ga0207649_10869496 3300025920 Bacteria 706
659 Ga0207652_10016784 3300025921 Bacteria 5983
660 Ga0207652_10203273 3300025921 Bacteria 1783
661 Ga0207652_11194063 3300025921 Bacteria 662
662 Ga0207652_11427174 3300025921 Bacteria 596
663 Ga0207652_11478752 3300025921 Bacteria 583
664 Ga0207681_10137587 3300025923 Bacteria 1815
665 Ga0207681_10552603 3300025923 Bacteria 948
666 Ga0207681_11511191 3300025923 Unclassified 563
667 Ga0207694_10001319 3300025924 Bacteria 21340
668 Ga0207694_10006000 3300025924 Bacteria 9302
669 Ga0207694_10010865 3300025924 Bacteria 6874
670 Ga0207694_10040794 3300025924 Bacteria 3576
671 Ga0207694_10041105 3300025924 Unclassified 3562
672 Ga0207694_10143818 3300025924 Bacteria 1919
673 Ga0207694_10358811 3300025924 Bacteria 1207
674 Ga0207694_10591577 3300025924 Unclassified 933
675 Ga0207694_11250158 3300025924 Bacteria 628
676 Ga0207650_10003597 3300025925 Bacteria 10636
677 Ga0207650_10007026 3300025925 Bacteria 7676
678 Ga0207650_10150236 3300025925 Bacteria 1838
679 Ga0207650_10162989 3300025925 Bacteria 1768
680 Ga0207659_10277557 3300025926 Bacteria 1369
681 Ga0207659_10518814 3300025926 Bacteria 1010
682 Ga0207659_10995151 3300025926 Bacteria 721
683 Ga0207659_11649400 3300025926 Bacteria 547
684 Ga0207687_10140730 3300025927 Bacteria 1830
685 Ga0207687_10158132 3300025927 Bacteria 1736
686 Ga0207687_10583760 3300025927 Bacteria 940
687 Ga0207687_10584936 3300025927 Bacteria 939
688 Ga0207687_10676723 3300025927 Bacteria 874
689 Ga0207687_10888147 3300025927 Bacteria 762
690 Ga0207700_10353069 3300025928 Bacteria 1281
691 Ga0207700_10595647 3300025928 Bacteria 983
692 Ga0207644_10174600 3300025931 Bacteria 1680
693 Ga0207644_10251177 3300025931 Bacteria 1411
694 Ga0207644_10344765 3300025931 Bacteria 1209
695 Ga0207644_10873267 3300025931 Bacteria 753
696 Ga0207690_10833288 3300025932 Bacteria 763
697 Ga0207690_10838427 3300025932 Bacteria 761
698 Ga0207690_10909924 3300025932 Unclassified 730
699 Ga0207706_10006512 3300025933 Bacteria 10832
700 Ga0207706_10113646 3300025933 Bacteria 2381
701 Ga0207706_10261519 3300025933 Bacteria 1511
702 Ga0207706_10400407 3300025933 Bacteria 1190
703 Ga0207706_11139690 3300025933 Bacteria 650
704 Ga0207706_11167617 3300025933 Unclassified 641
705 Ga0207706_11392604 3300025933 Bacteria 576
706 Ga0207686_10015548 3300025934 Bacteria 4256
707 Ga0207686_10138086 3300025934 Bacteria 1681
708 Ga0207686_10416366 3300025934 Bacteria 1027
709 Ga0207686_10450316 3300025934 Bacteria 990
710 Ga0207686_10767744 3300025934 Unclassified 771
711 Ga0207686_11279916 3300025934 Bacteria 602
712 Ga0207686_11737595 3300025934 Bacteria 516
713 Ga0207709_10027510 3300025935 Bacteria 3278
714 Ga0207709_10213470 3300025935 Bacteria 1387
715 Ga0207670_10293221 3300025936 Bacteria 1271
716 Ga0207669_10025336 3300025937 Bacteria 3204
717 Ga0207669_10159282 3300025937 Bacteria 1592
718 Ga0207669_10258036 3300025937 Bacteria 1302
719 Ga0207704_10018725 3300025938 Bacteria 3621
720 Ga0207704_10021380 3300025938 Bacteria 3444
721 Ga0207704_10064222 3300025938 Bacteria 2292
722 Ga0207704_10096787 3300025938 Bacteria 1955
723 Ga0207704_10381941 3300025938 Bacteria 1106
724 Ga0207704_10741225 3300025938 Bacteria 816
725 Ga0207704_11001374 3300025938 Unclassified 707
726 Ga0207704_11484772 3300025938 Unclassified 581
727 Ga0207704_11852943 3300025938 Unclassified 519
728 Ga0207665_11018767 3300025939 Bacteria 659
729 Ga0207691_10027848 3300025940 Bacteria 5296
730 Ga0207691_10062400 3300025940 Bacteria 3382
731 Ga0207691_10101776 3300025940 Bacteria 2563
732 Ga0207691_10300986 3300025940 Bacteria 1378
733 Ga0207691_10345714 3300025940 Bacteria 1273
734 Ga0207691_10437193 3300025940 Bacteria 1114
735 Ga0207691_10612968 3300025940 Bacteria 921
736 Ga0207711_10001544 3300025941 Bacteria 21341
737 Ga0207711_10006123 3300025941 Bacteria 10160
738 Ga0207711_10009684 3300025941 Bacteria 8027
739 Ga0207711_10019526 3300025941 Bacteria 5641
740 Ga0207711_10203021 3300025941 Bacteria 1809
741 Ga0207711_10261515 3300025941 Bacteria 1591
742 Ga0207711_10328735 3300025941 Bacteria 1414
743 Ga0207711_10721443 3300025941 Bacteria 930
744 Ga0207689_10169299 3300025942 Bacteria 1800
745 Ga0207689_10192430 3300025942 Bacteria 1683
746 Ga0207689_11024129 3300025942 Unclassified 696
747 Ga0207689_11253393 3300025942 Bacteria 624
748 Ga0207661_10059158 3300025944 Bacteria 3087
749 Ga0207661_10059225 3300025944 Unclassified 3085
750 Ga0207661_10115744 3300025944 Bacteria 2275
751 Ga0207661_10992832 3300025944 Bacteria 773
752 Ga0207661_11739692 3300025944 Bacteria 569
753 Ga0207679_10001856 3300025945 Bacteria 13125
754 Ga0207679_10204991 3300025945 Bacteria 1650
755 Ga0207679_10290784 3300025945 Bacteria 1405
756 Ga0207679_10447035 3300025945 Bacteria 1145
757 Ga0207679_11688830 3300025945 Bacteria 580
758 Ga0207667_10000465 3300025949 Bacteria 54509
759 Ga0207667_10001399 3300025949 Bacteria 30243
760 Ga0207667_10027253 3300025949 Bacteria 6224
761 Ga0207667_10080008 3300025949 Bacteria 3386
762 Ga0207667_10141308 3300025949 Bacteria 2478
763 Ga0207667_10373465 3300025949 Bacteria 1453
764 Ga0207667_11036637 3300025949 Bacteria 806
765 Ga0207667_11127458 3300025949 Bacteria 767
766 Ga0207651_10320214 3300025960 Bacteria 1296
767 Ga0207651_10334158 3300025960 Bacteria 1271
768 Ga0207651_10485762 3300025960 Bacteria 1065
769 Ga0207651_10882676 3300025960 Bacteria 796
770 Ga0207651_11719631 3300025960 Bacteria 565
771 Ga0207712_10000275 3300025961 Bacteria 49090
772 Ga0207712_10030485 3300025961 Bacteria 3626
773 Ga0207712_10040634 3300025961 Bacteria 3194
774 Ga0207712_10177825 3300025961 Bacteria 1669
775 Ga0207712_10688910 3300025961 Bacteria 891
776 Ga0207712_10882859 3300025961 Bacteria 789
777 Ga0207668_10072961 3300025972 Bacteria 2458
778 Ga0207668_10316378 3300025972 Bacteria 1294
779 Ga0207668_10461821 3300025972 Bacteria 1086
780 Ga0207640_10003205 3300025981 Bacteria 8813
781 Ga0207640_10018145 3300025981 Bacteria 4129
782 Ga0207640_10030688 3300025981 Bacteria 3313
783 Ga0207640_10056429 3300025981 Bacteria 2578
784 Ga0207640_10065293 3300025981 Bacteria 2428
785 Ga0207640_10098411 3300025981 Bacteria 2045
786 Ga0207640_10212413 3300025981 Unclassified 1475
787 Ga0207658_10011118 3300025986 Bacteria 6130
788 Ga0207658_10097209 3300025986 Bacteria 2298
789 Ga0207658_10200064 3300025986 Bacteria 1667
790 Ga0207658_10511296 3300025986 Bacteria 1071
791 Ga0207658_10788387 3300025986 Bacteria 862
792 Ga0207658_11393045 3300025986 Bacteria 641
793 Ga0207658_11677120 3300025986 Bacteria 581
794 Ga0207677_10010569 3300026023 Bacteria 5231
795 Ga0207677_10096166 3300026023 Bacteria 2166
796 Ga0207677_10096831 3300026023 Bacteria 2160
797 Ga0207677_10207950 3300026023 Bacteria 1560
798 Ga0207677_10460226 3300026023 Bacteria 1092
799 Ga0207677_10486879 3300026023 Bacteria 1064
800 Ga0207677_10871921 3300026023 Unclassified 810
801 Ga0207703_10001612 3300026035 Bacteria 20384
802 Ga0207703_10013731 3300026035 Bacteria 6313
803 Ga0207703_10022458 3300026035 Bacteria 4949
804 Ga0207703_10026541 3300026035 Bacteria 4560
805 Ga0207703_10068511 3300026035 Bacteria 2924
806 Ga0207703_10413352 3300026035 Bacteria 1254
807 Ga0207703_10426585 3300026035 Bacteria 1235
808 Ga0207703_10536610 3300026035 Bacteria 1102
809 Ga0207703_10546625 3300026035 Bacteria 1092
810 Ga0207703_11229443 3300026035 Bacteria 720
811 Ga0207639_10000116 3300026041 Bacteria 61688
812 Ga0207639_10001494 3300026041 Bacteria 15734
813 Ga0207639_10005911 3300026041 Bacteria 8292
814 Ga0207639_10050029 3300026041 Bacteria 3172
815 Ga0207639_10180619 3300026041 Bacteria 1795
816 Ga0207639_10330641 3300026041 Bacteria 1356
817 Ga0207639_11875370 3300026041 Bacteria 560
818 Ga0207678_10005905 3300026067 Bacteria 10906
819 Ga0207678_10223153 3300026067 Bacteria 1613
820 Ga0207678_10707280 3300026067 Bacteria 887
821 Ga0207678_11491716 3300026067 Bacteria 597
822 Ga0207678_11662131 3300026067 Unclassified 561
823 Ga0207708_10161011 3300026075 Bacteria 1772
824 Ga0207708_10294154 3300026075 Bacteria 1319
825 Ga0207702_10001051 3300026078 Bacteria 28280
826 Ga0207702_10008697 3300026078 Bacteria 8562
827 Ga0207702_10013885 3300026078 Bacteria 6690
828 Ga0207702_10036300 3300026078 Bacteria 4122
829 Ga0207702_10216397 3300026078 Bacteria 1783
830 Ga0207702_10549727 3300026078 Bacteria 1129
831 Ga0207641_10020771 3300026088 Bacteria 5397
832 Ga0207641_10022745 3300026088 Bacteria 5161
833 Ga0207641_10025422 3300026088 Bacteria 4882
834 Ga0207641_10073518 3300026088 Bacteria 2946
835 Ga0207641_10140241 3300026088 Bacteria 2180
836 Ga0207641_10529347 3300026088 Unclassified 1147
837 Ga0207641_10973412 3300026088 Bacteria 844
838 Ga0207641_11150095 3300026088 Bacteria 775
839 Ga0207641_11827313 3300026088 Bacteria 609
840 Ga0207641_11922758 3300026088 Bacteria 593
841 Ga0207648_10028264 3300026089 Bacteria 4974
842 Ga0207648_10071363 3300026089 Bacteria 3026
843 Ga0207648_10092387 3300026089 Bacteria 2646
844 Ga0207648_10141728 3300026089 Bacteria 2119
845 Ga0207648_10161034 3300026089 Bacteria 1982
846 Ga0207648_10958181 3300026089 Bacteria 800
847 Ga0207648_11640543 3300026089 Bacteria 604
848 Ga0207676_10015306 3300026095 Bacteria 5531
849 Ga0207676_10020158 3300026095 Bacteria 4874
850 Ga0207676_10084369 3300026095 Bacteria 2589
851 Ga0207676_10095677 3300026095 Bacteria 2450
852 Ga0207676_10230810 3300026095 Bacteria 1654
853 Ga0207676_10472482 3300026095 Bacteria 1186
854 Ga0207676_11236738 3300026095 Bacteria 741
855 Ga0207676_11707682 3300026095 Unclassified 628
856 Ga0207676_12201449 3300026095 Bacteria 549
857 Ga0207676_12594716 3300026095 Bacteria 503
858 Ga0207674_10002111 3300026116 Bacteria 25147
859 Ga0207674_10003692 3300026116 Bacteria 18684
860 Ga0207674_10180643 3300026116 Bacteria 2061
861 Ga0207674_10181195 3300026116 Bacteria 2058
862 Ga0207674_10186230 3300026116 Bacteria 2026
863 Ga0207674_10390820 3300026116 Bacteria 1345
864 Ga0207674_10532582 3300026116 Bacteria 1135
865 Ga0207674_10938633 3300026116 Bacteria 834
866 Ga0207674_11210336 3300026116 Bacteria 725
867 Ga0207674_11655389 3300026116 Bacteria 608
868 Ga0207674_11848943 3300026116 Bacteria 570
869 Ga0207675_100010284 3300026118 Bacteria 8766
870 Ga0207675_100069455 3300026118 Bacteria 3293
871 Ga0207675_100080251 3300026118 Unclassified 3059
872 Ga0207675_100797267 3300026118 Unclassified 958
873 Ga0207675_100975801 3300026118 Bacteria 865
874 Ga0207683_10041514 3300026121 Bacteria 4017
875 Ga0207683_10174299 3300026121 Bacteria 1949
876 Ga0207683_10224289 3300026121 Bacteria 1713
877 Ga0207683_10245372 3300026121 Bacteria 1634
878 Ga0207683_10353144 3300026121 Bacteria 1349
879 Ga0207683_10460767 3300026121 Bacteria 1172
880 Ga0207683_10934410 3300026121 Bacteria 805
881 Ga0207683_11450479 3300026121 Bacteria 634
882 Ga0207698_10025790 3300026142 Bacteria 4148
883 Ga0207698_10189561 3300026142 Bacteria 1830
884 Ga0207698_10296992 3300026142 Bacteria 1502
885 Ga0207698_10369316 3300026142 Bacteria 1361
886 Ga0207698_10387578 3300026142 Bacteria 1331
887 Ga0207698_10668990 3300026142 Bacteria 1030
888 Ga0207698_11360110 3300026142 Bacteria 725
889 Ga0207698_12368509 3300026142 Bacteria 542
890 Ga0209971_1180016 3300027682 Bacteria 521
891 Ga0209813_10144077 3300027866 Bacteria 848
892 Ga0209813_10254670 3300027866 Bacteria 668
893 Ga0209813_10271466 3300027866 Bacteria 650
894 Ga0209813_10345713 3300027866 Bacteria 588
895 Ga0209974_10066110 3300027876 Bacteria 1228
896 Ga0209974_10251929 3300027876 Bacteria 665
897 Ga0207428_10499733 3300027907 Bacteria 883
898 Ga0268266_10000008 3300028379 Bacteria 1161875
899 Ga0268266_10048529 3300028379 Bacteria 3640
900 Ga0268266_10144893 3300028379 Bacteria 2135
901 Ga0268266_10221390 3300028379 Bacteria 1740
902 Ga0268265_10143946 3300028380 Bacteria 2000
903 Ga0268265_12096315 3300028380 Bacteria 573
904 Ga0268264_10017059 3300028381 Bacteria 5946
905 Ga0268264_10035419 3300028381 Bacteria 4110
906 Ga0268264_10050247 3300028381 Bacteria 3471
907 Ga0268264_10065648 3300028381 Bacteria 3058
908 Ga0268264_10278908 3300028381 Unclassified 1564
909 Ga0268264_10601297 3300028381 Bacteria 1084
910 Ga0268264_11809743 3300028381 Bacteria 621
911 Ga0268264_12478561 3300028381 Bacteria 524
912 Ga0265766_1022650 3300030863 Bacteria 526
913 Ga0307513_11103177 3300031456 Bacteria 506
914 Ga0307408_100078352 3300031548 Bacteria 2463
915 Ga0307408_100503230 3300031548 Bacteria 1061
916 Ga0307508_10009148 3300031616 Bacteria 9123
917 Ga0316575_10067027 3300031665 Bacteria 1438
918 Ga0316575_10145067 3300031665 Bacteria 978
919 Ga0316575_10177475 3300031665 Bacteria 884
920 Ga0316579_10035148 3300031691 Bacteria 2309
921 Ga0316579_10042354 3300031691 Bacteria 2115
922 Ga0316579_10391337 3300031691 Bacteria 672
923 Ga0316576_10005896 3300031727 Bacteria 7563
924 Ga0316576_10006214 3300031727 Bacteria 7410
925 Ga0316576_10035004 3300031727 Bacteria 3582
926 Ga0316576_10097808 3300031727 Bacteria 2191
927 Ga0316576_10097962 3300031727 Bacteria 2190
928 Ga0316576_10101454 3300031727 Bacteria 2151
929 Ga0316576_10623041 3300031727 Bacteria 786
930 Ga0316578_10000785 3300031728 Bacteria 11729
931 Ga0316578_10031889 3300031728 Bacteria 3006
932 Ga0316578_10035472 3300031728 Bacteria 2867
933 Ga0316578_10036064 3300031728 Bacteria 2846
934 Ga0316578_10050639 3300031728 Bacteria 2430
935 Ga0316578_10401498 3300031728 Bacteria 812
936 Ga0316578_10462580 3300031728 Bacteria 749
937 Ga0307516_10045126 3300031730 Bacteria 4355
938 Ga0307405_10011566 3300031731 Bacteria 4634
939 Ga0307405_10085176 3300031731 Bacteria 2077
940 Ga0307405_10414640 3300031731 Bacteria 1058
941 Ga0307405_10432868 3300031731 Bacteria 1038
942 Ga0307405_11405812 3300031731 Bacteria 610
943 Ga0316577_10023857 3300031733 Bacteria 3396
944 Ga0316577_10070727 3300031733 Bacteria 1947
945 Ga0316577_10567628 3300031733 Bacteria 645
946 Ga0307413_10005154 3300031824 Bacteria 5793
947 Ga0307410_10003872 3300031852 Bacteria 7613
948 Ga0307410_10050867 3300031852 Bacteria 2789
949 Ga0307410_10822939 3300031852 Bacteria 791
950 Ga0307410_11283329 3300031852 Bacteria 640
951 Ga0307406_10004191 3300031901 Bacteria 7847
952 Ga0307406_10145381 3300031901 Bacteria 1684
953 Ga0307406_10303100 3300031901 Bacteria 1228
954 Ga0307407_10716221 3300031903 Bacteria 755
955 Ga0307412_10269682 3300031911 Bacteria 1331
956 Ga0307409_100001007 3300031995 Bacteria 13200
957 Ga0307409_100673996 3300031995 Bacteria 1030
958 Ga0307409_101468556 3300031995 Bacteria 709
959 Ga0307416_100019061 3300032002 Bacteria 4854
960 Ga0307416_100056399 3300032002 Bacteria 3170
961 Ga0307416_100367485 3300032002 Bacteria 1463
962 Ga0307416_101019506 3300032002 Bacteria 931
963 Ga0307414_11040822 3300032004 Bacteria 754
964 Ga0307411_10377180 3300032005 Bacteria 1165
965 Ga0307411_10731470 3300032005 Bacteria 865
966 Ga0307415_100000190 3300032126 Bacteria 27293
967 Ga0307415_100131400 3300032126 Bacteria 1896
968 Ga0307415_100318770 3300032126 Bacteria 1295
969 Ga0307415_100363344 3300032126 Bacteria 1223
970 Ga0307415_101520076 3300032126 Bacteria 641
971 Ga0307415_101814762 3300032126 Bacteria 590
972 Ga0316585_10005493 3300032137 Bacteria 3580
973 Ga0316580_10001392 3300032139 Bacteria 6309
974 Ga0316592_1031132 3300033524 Bacteria 1161
975 Ga0316596_1012403 3300033541 Bacteria 2095
976 Ga0373938_0122376 3300034957 Bacteria 672
977 Ga0373928_0001559 3300035084 Bacteria 4444
978 Ga0373929_0005769 3300035085 Bacteria 2235
979 Ga0373944_0040699 3300035089 Bacteria 1435
980 Ga0373949_0106882 3300035090 Bacteria 772
981 Ga0373932_0012957 3300035112 Bacteria 2063
982 Ga0373956_0576659 3300035119 Bacteria 537
983 Ga0373943_0365343 3300035170 Bacteria 829
984 Ga0373943_0610319 3300035170 Bacteria 643
985 Ga0373946_0328855 3300035171 Bacteria 761
986 Ga0316574_0009298 3300035398 Bacteria 5499
987 Ga0316574_0012164 3300035398 Bacteria 4917
988 Ga0316574_0028980 3300035398 Bacteria 3342
989 Ga0316574_0043707 3300035398 Bacteria 2769
990 Ga0316574_0044640 3300035398 Bacteria 2742
991 Ga0316574_0068255 3300035398 Bacteria 2242
992 Ga0316574_0104517 3300035398 Bacteria 1813
993 Ga0316574_0166127 3300035398 Bacteria 1421
994 Ga0316574_0252697 3300035398 Bacteria 1126
995 Ga0316574_0296427 3300035398 Bacteria 1029
996 Ga0316574_0771780 3300035398 Bacteria 586
997 Ga0316574_0777003 3300035398 Bacteria 584
998 Ga0316574_0796423 3300035398 Bacteria 575
999 Ga0373931_0000006 3300035691 Bacteria 437006
1000 Ga0373931_0012253 3300035691 Bacteria 4153
1001 Ga0373931_0452825 3300035691 Bacteria 821
1002 Ga0373931_0732471 3300035691 Unclassified 655
1003 Ga0373933_0009250 3300035724 Bacteria 5379
1004 Ga0373937_0139768 3300036401 Bacteria 2265
1005 Ga0373937_1280912 3300036401 Bacteria 681
1006 Ga0373937_1528419 3300036401 Unclassified 615
1007 Ga0316582_0013632 3300036647 Bacteria 4582
1008 Ga0316582_0016194 3300036647 Bacteria 4284
1009 Ga0316582_0209094 3300036647 Bacteria 1333
1010 Ga0316584_0005439 3300036712 Bacteria 8547
1011 Ga0316584_0017406 3300036712 Bacteria 5165
1012 Ga0316584_0023461 3300036712 Bacteria 4507
1013 Ga0316584_0024065 3300036712 Bacteria 4453
1014 Ga0316584_0076261 3300036712 Bacteria 2512
1015 Ga0316584_0086520 3300036712 Bacteria 2346
1016 Ga0316584_0112103 3300036712 Bacteria 2041
1017 Ga0316584_0146323 3300036712 Bacteria 1760
1018 Ga0395900_0155816 3300037418 Bacteria 2333
1019 Ga0395898_0002525 3300037466 Bacteria 21479
1020 Ga0395901_0047958 3300038443 Bacteria 4435
1021 Ga0395901_0079626 3300038443 Bacteria 3421
1022 Ga0395901_0607616 3300038443 Bacteria 1102
1023 Ga0400485_10787 3300038735 Bacteria 3970
1024 Ga0400483_017383 3300039062 Bacteria 3271
1025 Ga0400483_035347 3300039062 Bacteria 5529
1026 Ga0400483_088865 3300039062 Bacteria 1740
1027 Ga0400483_136168 3300039062 Bacteria 1367
1028 Ga0400483_136484 3300039062 Bacteria 6669
1029 Ga0400483_182325 3300039062 Bacteria 71334
1030 Ga0400483_190738 3300039062 Bacteria 1016
1031 Ga0400483_259065 3300039062 Bacteria 8084
1032 Ga0436363_1130565 3300039450 Bacteria 3870
1033 Ga0439439_0022419 3300041406 Bacteria 1577
1034 Ga0439439_0058660 3300041406 Bacteria 1019
1035 Ga0439447_001969 3300041407 Bacteria 7533
1036 Ga0439465_0013327 3300041413 Bacteria 2565
1037 Ga0451789_0048425 3300041443 Bacteria 563
1038 Ga0451793_0938620 3300041452 Bacteria 546
1039 Ga0451795_0181400 3300041456 Bacteria 603
1040 Ga0451795_0262903 3300041456 Bacteria 595
1041 Ga0451802_0012644 3300041460 Bacteria 924
1042 Ga0451802_1786781 3300041460 Bacteria 553
1043 Ga0451807_1450121 3300041486 Bacteria 958
1044 Ga0451837_0416935 3300041494 Bacteria 753
1045 Ga0451839_0458029 3300041496 Bacteria 600
1046 Ga0451841_0462125 3300041498 Bacteria 584
1047 Ga0451841_0883188 3300041498 Bacteria 774
1048 Ga0451843_0500007 3300041509 Bacteria 2246
1049 Ga0451855_1137734 3300041511 Bacteria 565
1050 Ga0451853_1377382 3300041512 Bacteria 846
1051 Ga0451853_2288329 3300041512 Bacteria 1102
1052 Ga0439445_0014698 3300042004 Bacteria 1909
1053 Ga0439432_007407 3300042006 Bacteria 3890
1054 Ga0439449_0017784 3300042007 Bacteria 2669
1055 Ga0439449_0057595 3300042007 Bacteria 1434
1056 Ga0439452_037293 3300042010 Bacteria 1160
1057 Ga0439457_006216 3300042014 Bacteria 2938
1058 Ga0439462_0001718 3300042015 Bacteria 4948
1059 Ga0439462_0057892 3300042015 Bacteria 1047
1060 Ga0439434_0068503 3300042435 Bacteria 1115
1061 Ga0439459_0223947 3300042438 Bacteria 522
1062 Ga0451577_0192413 3300042876 Bacteria 1840
1063 Ga0453684_0066899 3300044712 Bacteria 4573
1064 Ga0466960_0008210 3300044901 Bacteria 4270
1065 Ga0451576_2035645 3300045051 Bacteria 591
1066 Ga0466967_0272865 3300045976 Bacteria 1621
1067 Ga0466967_0606373 3300045976 Bacteria 1081
1068 Ga0495603_0066211 3300046455 Bacteria 2128
1069 Ga0495603_0102592 3300046455 Bacteria 1670
1070 Ga0495603_0306184 3300046455 Bacteria 913
1071 Ga0495603_0499510 3300046455 Bacteria 697
1072 Ga0495629_0123477 3300046459 Bacteria 1804
1073 Ga0495629_0277441 3300046459 Bacteria 1151
1074 Ga0495638_0048881 3300046460 Bacteria 2646
1075 Ga0495641_0124434 3300046461 Bacteria 1150
1076 Ga0495641_0245869 3300046461 Bacteria 804
1077 Ga0495641_0276304 3300046461 Bacteria 756
1078 Ga0495641_0538751 3300046461 Bacteria 533
1079 Ga0495653_0607863 3300046463 Bacteria 671
1080 Ga0495580_0068995 3300046472 Bacteria 2471
1081 Ga0495580_0953227 3300046472 Bacteria 549
1082 Ga0495582_0238331 3300046473 Bacteria 1042
1083 Ga0495582_0390489 3300046473 Bacteria 802
1084 Ga0495582_0563126 3300046473 Bacteria 659
1085 Ga0495582_0774064 3300046473 Bacteria 555
1086 Ga0495639_0015183 3300046475 Bacteria 3338
1087 Ga0495639_0064913 3300046475 Bacteria 1679
1088 Ga0495639_0294519 3300046475 Bacteria 808
1089 Ga0495618_0297807 3300046514 Bacteria 1003
1090 Ga0495630_0342084 3300046517 Bacteria 1145
1091 Ga0495630_0531377 3300046517 Bacteria 902
1092 Ga0495630_0672644 3300046517 Bacteria 792
1093 Ga0495663_0018871 3300046525 Bacteria 1967
1094 Ga0495663_0090410 3300046525 Bacteria 997
1095 Ga0495640_0822817 3300046533 Bacteria 553
1096 Ga0495586_0316555 3300046535 Bacteria 895
1097 Ga0495645_0091479 3300046543 Bacteria 2173
1098 Ga0495656_0014399 3300046615 Bacteria 2964
1099 Ga0495656_0054619 3300046615 Bacteria 1719
1100 Ga0495668_0002220 3300046616 Bacteria 16493
1101 Ga0495635_0093830 3300046663 Bacteria 2052
1102 Ga0495635_0458871 3300046663 Bacteria 842
1103 Ga0495659_0078425 3300046664 Bacteria 1249
1104 Ga0495647_0004042 3300046681 Bacteria 4738
1105 Ga0495647_0093151 3300046681 Bacteria 1238
1106 Ga0495658_0017764 3300046683 Bacteria 3682
1107 Ga0495658_0121517 3300046683 Bacteria 1580
1108 Ga0495658_0512428 3300046683 Bacteria 768
1109 Ga0495658_0748182 3300046683 Bacteria 626
1110 Ga0495613_0149419 3300046689 Bacteria 1667
1111 Ga0495613_0442118 3300046689 Bacteria 882
1112 Ga0495624_0138992 3300046690 Bacteria 1488
1113 Ga0495600_0204295 3300046809 Bacteria 1268
1114 Ga0495600_0322823 3300046809 Bacteria 971
1115 Ga0495600_0755611 3300046809 Bacteria 582
1116 Ga0495581_0153104 3300047315 Bacteria 1347
1117 Ga0495636_0000737 3300047318 Bacteria 12026
1118 Ga0495674_0778352 3300047319 Bacteria 746
1119 Ga0495674_1192807 3300047319 Bacteria 576
1120 Ga0495676_0177492 3300047321 Bacteria 1495
1121 Ga0495680_0069330 3300047322 Bacteria 2691
1122 Ga0495680_0545177 3300047322 Bacteria 782
1123 Ga0495680_0699847 3300047322 Bacteria 669
1124 Ga0495680_0862077 3300047322 Bacteria 588
1125 Ga0495680_1039112 3300047322 Bacteria 521
1126 Ga0495677_0372904 3300047445 Bacteria 564
1127 Ga0495685_123213 3300047447 Bacteria 850
1128 Ga0495684_0404789 3300047471 Bacteria 957
1129 Ga0495615_0123734 3300048090 Bacteria 750
1130 Ga0496100_0017223 3300048903 Bacteria 4262
1131 Ga0496100_0112917 3300048903 Bacteria 1890
1132 Ga0496100_0454616 3300048903 Bacteria 982
1133 Ga0496100_0945288 3300048903 Bacteria 677
1134 Ga0496101_0022651 3300048904 Bacteria 4327
1135 Ga0496101_0101460 3300048904 Bacteria 2155
1136 Ga0496101_0118636 3300048904 Bacteria 1998
1137 Ga0496101_0467569 3300048904 Bacteria 995
1138 Ga0496101_0539321 3300048904 Bacteria 922
1139 Ga0496101_1003099 3300048904 Bacteria 657
1140 Ga0496102_0002523 3300048905 Bacteria 15633
1141 Ga0496102_0014211 3300048905 Bacteria 6917
1142 Ga0496102_0026145 3300048905 Bacteria 5203
1143 Ga0496102_0047874 3300048905 Bacteria 3887
1144 Ga0496102_0101380 3300048905 Bacteria 2674
1145 Ga0496102_0414857 3300048905 Bacteria 1265
1146 Ga0496102_1195471 3300048905 Bacteria 680
1147 Ga0496102_1898216 3300048905 Bacteria 512
1148 Ga0496103_0014389 3300048906 Bacteria 4699
1149 Ga0496103_0051737 3300048906 Bacteria 2543
1150 Ga0496103_0125082 3300048906 Bacteria 1639
1151 Ga0496104_0011522 3300048907 Bacteria 7922
1152 Ga0496104_0021521 3300048907 Bacteria 5921
1153 Ga0496104_0035075 3300048907 Bacteria 4682
1154 Ga0496104_0059896 3300048907 Bacteria 3605
1155 Ga0496104_0091472 3300048907 Bacteria 2908
1156 Ga0496104_0205045 3300048907 Bacteria 1883
1157 Ga0496104_0340483 3300048907 Bacteria 1413
1158 Ga0496104_0589094 3300048907 Bacteria 1022
1159 Ga0496104_1100843 3300048907 Bacteria 698
1160 Ga0496105_0000093 3300048908 Bacteria 61223
1161 Ga0496105_0011016 3300048908 Bacteria 7126
1162 Ga0496105_0065159 3300048908 Bacteria 3007
1163 Ga0496105_0079322 3300048908 Bacteria 2711
1164 Ga0496105_0160368 3300048908 Bacteria 1846
1165 Ga0496105_0184867 3300048908 Bacteria 1705
1166 Ga0496105_0429277 3300048908 Bacteria 1045
1167 Ga0496106_0037656 3300048909 Bacteria 3619
1168 Ga0496106_0535048 3300048909 Bacteria 941
1169 Ga0496106_0688249 3300048909 Bacteria 815
1170 Ga0496106_0884300 3300048909 Bacteria 706
1171 Ga0496106_1522924 3300048909 Bacteria 514
1172 Ga0496107_0061581 3300048910 Bacteria 2717
1173 Ga0496108_0092806 3300048911 Bacteria 2567
1174 Ga0496108_0115049 3300048911 Bacteria 2303
1175 Ga0496108_0145395 3300048911 Bacteria 2044
1176 Ga0496108_0986043 3300048911 Bacteria 720
1177 Ga0496108_1090210 3300048911 Bacteria 679
1178 Ga0496108_1165399 3300048911 Bacteria 653
1179 Ga0496109_0006477 3300048912 Bacteria 9858
1180 Ga0496109_0110257 3300048912 Bacteria 2559
1181 Ga0496109_0154790 3300048912 Bacteria 2147
1182 Ga0496109_0218292 3300048912 Bacteria 1793
1183 Ga0496109_0599588 3300048912 Bacteria 1038
1184 Ga0496109_0988008 3300048912 Archaea 779
1185 Ga0496109_0997018 3300048912 Bacteria 775
1186 Ga0496110_0019788 3300048913 Bacteria 5671
1187 Ga0496110_0087106 3300048913 Bacteria 2789
1188 Ga0496110_0123611 3300048913 Bacteria 2333
1189 Ga0496110_0257166 3300048913 Bacteria 1589
1190 Ga0496110_0457117 3300048913 Bacteria 1163
1191 Ga0496110_0582361 3300048913 Unclassified 1016
1192 Ga0496110_0828153 3300048913 Bacteria 830
1193 Ga0496110_1092236 3300048913 Bacteria 706
1194 Ga0496110_1113678 3300048913 Unclassified 698
1195 Ga0496111_0012225 3300048914 Bacteria 5807
1196 Ga0496111_0014093 3300048914 Bacteria 5453
1197 Ga0496112_0013357 3300048915 Bacteria 7580
1198 Ga0496112_0035217 3300048915 Unclassified 4874
1199 Ga0496112_0101325 3300048915 Bacteria 2850
1200 Ga0496113_0002034 3300048916 Bacteria 11613
1201 Ga0496113_0227730 3300048916 Bacteria 1486
1202 Ga0496114_0008479 3300048917 Bacteria 8145
1203 Ga0496114_0017914 3300048917 Bacteria 5724
1204 Ga0496114_0106393 3300048917 Bacteria 2400
1205 Ga0496114_0107510 3300048917 Bacteria 2387
1206 Ga0496114_0162541 3300048917 Bacteria 1942
1207 Ga0496114_0298336 3300048917 Bacteria 1422
1208 Ga0496114_0336745 3300048917 Bacteria 1334
1209 Ga0496114_0564554 3300048917 Bacteria 1005
1210 Ga0496114_0575057 3300048917 Bacteria 994
1211 Ga0496115_0258610 3300048918 Bacteria 1432
1212 Ga0496115_1123948 3300048918 Bacteria 594
1213 Ga0496118_0003924 3300048921 Bacteria 18203
1214 Ga0496126_0442804 3300048929 Bacteria 1047
1215 Ga0501314_028898 3300049530 Bacteria 609
1216 Ga0501315_059501 3300049531 Bacteria 615
1217 Ga0501031_0022036 3300049568 Bacteria 4152
1218 Ga0501031_0077430 3300049568 Bacteria 2166
1219 Ga0501031_0422046 3300049568 Bacteria 862
1220 Ga0501031_0786072 3300049568 Bacteria 610
1221 Ga0501031_0811625 3300049568 Bacteria 600
1222 Ga0501033_0069737 3300049570 Bacteria 2584
1223 Ga0501033_1101516 3300049570 Bacteria 528
1224 Ga0501034_0963015 3300049571 Bacteria 739
1225 Ga0501036_0033281 3300049572 Bacteria 4359
1226 Ga0501036_0066082 3300049572 Bacteria 3060
1227 Ga0501036_0087561 3300049572 Bacteria 2632
1228 Ga0501036_0129136 3300049572 Bacteria 2134
1229 Ga0501036_0189321 3300049572 Bacteria 1731
1230 Ga0501037_0096698 3300049573 Bacteria 2134
1231 Ga0501038_0671360 3300049574 Bacteria 779
1232 Ga0501039_0038137 3300049575 Bacteria 3712
1233 Ga0501039_0092526 3300049575 Bacteria 2357
1234 Ga0501039_0586062 3300049575 Bacteria 874
1235 Ga0501040_0025352 3300049576 Bacteria 3986
1236 Ga0501040_0052625 3300049576 Bacteria 2788
1237 Ga0501040_0189872 3300049576 Bacteria 1457
1238 Ga0501040_0880828 3300049576 Bacteria 648
1239 Ga0501040_1093674 3300049576 Bacteria 578
1240 Ga0501041_0017307 3300049577 Bacteria 4289
1241 Ga0501041_0034669 3300049577 Bacteria 3056
1242 Ga0501041_0585753 3300049577 Bacteria 712
1243 Ga0501042_0017993 3300049578 Bacteria 4888
1244 Ga0501042_0366331 3300049578 Bacteria 1043
1245 Ga0501042_0387232 3300049578 Bacteria 1012
1246 Ga0501042_1408528 3300049578 Bacteria 508
1247 Ga0501043_0002433 3300049579 Bacteria 15753
1248 Ga0501043_0446569 3300049579 Bacteria 972
1249 Ga0501046_0248181 3300049580 Bacteria 1311
1250 Ga0501046_0595739 3300049580 Bacteria 785
1251 Ga0501047_0056717 3300049581 Bacteria 3789
1252 Ga0501047_0080871 3300049581 Bacteria 3124
1253 Ga0501048_0021837 3300049582 Bacteria 4685
1254 Ga0501048_0023263 3300049582 Bacteria 4532
1255 Ga0501048_0126426 3300049582 Bacteria 1807
1256 Ga0501048_1221988 3300049582 Bacteria 540
1257 Ga0501067_0017974 3300049583 Bacteria 3915
1258 Ga0501067_0078234 3300049583 Bacteria 1833
1259 Ga0501067_0257350 3300049583 Bacteria 972
1260 Ga0501067_0802052 3300049583 Bacteria 530
1261 Ga0501068_0314003 3300049584 Bacteria 1004
1262 Ga0501069_0036372 3300049585 Bacteria 2715
1263 Ga0501071_0004493 3300049587 Bacteria 8848
1264 Ga0501071_0119000 3300049587 Bacteria 1957
1265 Ga0501071_0131328 3300049587 Bacteria 1861
1266 Ga0501071_0942044 3300049587 Bacteria 666
1267 Ga0501071_1436483 3300049587 Bacteria 532
1268 Ga0501071_1616005 3300049587 Bacteria 500
1269 Ga0501072_0015466 3300049588 Bacteria 5849
1270 Ga0501072_0020892 3300049588 Bacteria 5075
1271 Ga0501072_0021691 3300049588 Bacteria 4982
1272 Ga0501072_0095697 3300049588 Bacteria 2360
1273 Ga0501072_0805640 3300049588 Bacteria 735
1274 Ga0501072_1260303 3300049588 Bacteria 573
1275 Ga0501073_0266650 3300049589 Bacteria 1182
1276 Ga0501073_0867191 3300049589 Bacteria 622
1277 Ga0501074_0094434 3300049590 Bacteria 2142
1278 Ga0501074_0296706 3300049590 Bacteria 1148
1279 Ga0501074_0467167 3300049590 Bacteria 894
1280 Ga0501075_0040980 3300049591 Bacteria 3470
1281 Ga0501075_0063619 3300049591 Bacteria 2782
1282 Ga0501075_0283479 3300049591 Bacteria 1262
1283 Ga0501075_0617104 3300049591 Bacteria 827
1284 Ga0501076_0016244 3300049592 Bacteria 5640
1285 Ga0501076_0546443 3300049592 Bacteria 955
1286 Ga0501076_0564578 3300049592 Bacteria 938
1287 Ga0501077_0199150 3300049593 Bacteria 1272
1288 Ga0501077_0627696 3300049593 Bacteria 690
1289 Ga0501077_0680884 3300049593 Bacteria 661
1290 Ga0501233_131170 3300049668 Bacteria 685
1291 Ga0501079_0011823 3300049741 Bacteria 6664
1292 Ga0501079_0097220 3300049741 Bacteria 2283
1293 Ga0501079_0238445 3300049741 Bacteria 1421
1294 Ga0501079_0409211 3300049741 Bacteria 1064
1295 Ga0501079_0602016 3300049741 Bacteria 865
1296 Ga0501080_0249732 3300049742 Bacteria 1618
1297 Ga0501080_0532856 3300049742 Bacteria 1047
1298 Ga0501080_1769455 3300049742 Bacteria 520
1299 Ga0501081_0042676 3300049743 Bacteria 3109
1300 Ga0501081_0170953 3300049743 Bacteria 1569
1301 Ga0501035_0619261 3300049822 Bacteria 880
1302 Ga0501044_0004942 3300049823 Bacteria 14911
1303 Ga0501045_0047261 3300049824 Bacteria 3135
1304 Ga0501045_0051324 3300049824 Bacteria 3010
1305 Ga0501045_0088902 3300049824 Bacteria 2282
1306 Ga0501045_0976161 3300049824 Bacteria 621
1307 nmdc:mga03683_34547_c1 3300050489 Bacteria 2046
1308 nmdc:mga03683_89783_c1 3300050489 Bacteria 1338
1309 nmdc:mga03n38_441130_c1 3300050490 Bacteria 723
1310 nmdc:mga03n38_58928_c1 3300050490 Bacteria 1163
1311 nmdc:mga03n38_757860_c1 3300050490 Bacteria 563
1312 nmdc:mga03n38_9489_c1 3300050490 Bacteria 3543
1313 nmdc:mga03n38_962247_c1 3300050490 Bacteria 504
1314 nmdc:mga00v17_1029218_c1 3300050491 Bacteria 518
1315 nmdc:mga00v17_120558_c1 3300050491 Bacteria 1669
1316 nmdc:mga00v17_229031_c1 3300050491 Bacteria 1204
1317 nmdc:mga00v17_2601_c1 3300050491 Bacteria 9255
1318 nmdc:mga00v17_340293_c1 3300050491 Bacteria 975
1319 nmdc:mga00v17_390796_c1 3300050491 Bacteria 904
1320 nmdc:mga00v17_465849_c1 3300050491 Bacteria 820
1321 nmdc:mga00v17_665_c1 3300050491 Bacteria 18923
1322 nmdc:mga00v17_85970_c1 3300050491 Bacteria 1970
1323 nmdc:mga0yw44_100143_c1 3300050492 Bacteria 1845
1324 nmdc:mga0yw44_116064_c1 3300050492 Bacteria 1720
1325 nmdc:mga0yw44_136706_c2 3300050492 Bacteria 1063
1326 nmdc:mga0yw44_1398_c1 3300050492 Bacteria 9570
1327 nmdc:mga0yw44_20263_c1 3300050492 Bacteria 3687
1328 nmdc:mga0yw44_23801_c1 3300050492 Bacteria 3455
1329 nmdc:mga0yw44_264923_c1 3300050492 Bacteria 1146
1330 nmdc:mga0yw44_266490_c1 3300050492 Bacteria 1143
1331 nmdc:mga0yw44_266629_c1 3300050492 Bacteria 1142
1332 nmdc:mga0yw44_291750_c1 3300050492 Bacteria 1092
1333 nmdc:mga0yw44_30363_c1 3300050492 Bacteria 3130
1334 nmdc:mga0yw44_350254_c1 3300050492 Bacteria 994
1335 nmdc:mga0yw44_351579_c1 3300050492 Bacteria 992
1336 nmdc:mga0yw44_44_c1 3300050492 Bacteria 41809
1337 nmdc:mga0yw44_5924_c1 3300050492 Bacteria 5845
1338 nmdc:mga0yw44_671996_c1 3300050492 Bacteria 704
1339 nmdc:mga0yw44_78724_c1 3300050492 Bacteria 1242
1340 nmdc:mga0yw44_890002_c1 3300050492 Bacteria 604
1341 nmdc:mga0k408_128180_c1 3300050493 Bacteria 1505
1342 nmdc:mga06z11_243384_c1 3300050494 Bacteria 758
1343 nmdc:mga06z11_433103_c1 3300050494 Bacteria 793
1344 nmdc:mga06z11_5925_c1 3300050494 Bacteria 4938
1345 nmdc:mga06z11_87353_c1 3300050494 Bacteria 1686
1346 nmdc:mga04h51_10254_c1 3300050495 Bacteria 2568
1347 nmdc:mga04h51_162539_c1 3300050495 Bacteria 860
1348 nmdc:mga04h51_240725_c1 3300050495 Bacteria 722
1349 nmdc:mga04h51_305950_c1 3300050495 Bacteria 649
1350 nmdc:mga04h51_380778_c1 3300050495 Bacteria 588
1351 nmdc:mga05p37_1308842_c1 3300050507 Bacteria 738
1352 nmdc:mga05p37_557454_c1 3300050507 Bacteria 1303
1353 nmdc:mga09592_800048_c1 3300050508 Bacteria 797
1354 nmdc:mga08y16_393274_c1 3300050511 Bacteria 1420
1355 nmdc:mga08y16_880295_c1 3300050511 Bacteria 883
1356 nmdc:mga0rr50_1129583_c1 3300050513 Bacteria 666
1357 Ga0500635_0006792 3300053080 Bacteria 3070
1358 Ga0500635_0320462 3300053080 Bacteria 612
1359 Ga0495595_0279429 3300053084 Bacteria 838
1360 Ga0495595_0336813 3300053084 Bacteria 761
1361 Ga0495595_0705211 3300053084 Bacteria 517
1362 Ga0495619_0263881 3300053085 Bacteria 1193
1363 Ga0495619_0773339 3300053085 Bacteria 650
1364 Ga0500644_0375618 3300053088 Bacteria 617
1365 Ga0500646_0026544 3300053090 Bacteria 1571
1366 Ga0500646_0122618 3300053090 Bacteria 837
1367 Ga0500583_0139854 3300053092 Bacteria 1203
1368 Ga0500583_0197939 3300053092 Bacteria 999
1369 Ga0500566_0000532 3300053094 Bacteria 21366
1370 Ga0500566_0120764 3300053094 Bacteria 1413
1371 Ga0500628_210638 3300053129 Bacteria 563
1372 Ga0500655_036960 3300053133 Bacteria 952
1373 Ga0500620_031846 3300053155 Bacteria 1675
1374 Ga0501084_0271980 3300054114 Bacteria 1430
1375 Ga0501084_0326735 3300054114 Bacteria 1295
1376 Ga0501084_1328679 3300054114 Bacteria 602
1377 Ga0587066_108309 3300059490 Bacteria 641
1378 Ga0587077_171293 3300059493 Bacteria 582
1379 Ga0587082_033158 3300059504 Bacteria 911
1380 Ga0587082_037518 3300059504 Bacteria 874
1381 Ga0587083_0019282 3300059505 Bacteria 1244
1382 Ga0587086_020163 3300059507 Bacteria 903
1383 Ga0587088_133956 3300059508 Bacteria 585
1384 Ga0587098_077308 3300059604 Bacteria 549
1385 Ga0587106_136637 3300059605 Bacteria 534
1386 Ga0587101_081851 3300059623 Bacteria 613
1387 Ga0587128_097622 3300059630 Bacteria 611
1388 Ga0587068_037772 3300059641 Bacteria 863
1389 Ga0587068_090856 3300059641 Bacteria 629
1390 Ga0587072_044446 3300059643 Bacteria 873
1391 Ga0587076_189371 3300059645 Bacteria 523
1392 Ga0587079_088058 3300059647 Bacteria 722
1393 Ga0587079_176608 3300059647 Bacteria 569
1394 Ga0587107_022277 3300059652 Bacteria 895
1395 Ga0587110_009122 3300059654 Bacteria 969
1396 Ga0501082_0197947 3300060353 Bacteria 1748
1397 Ga0501082_0862328 3300060353 Bacteria 792
1398 Ga0530510_0008292 3300061734 Bacteria 7245
1399 Ga0530510_0298484 3300061734 Bacteria 1205
1400 Ga0530510_0937047 3300061734 Bacteria 662

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001904 JGI24736J21556_1020459 JGI24736J21556_10204592 112
2 3300003187 JGI25151J46595_10020691 JGI25151J46595_100206912 112
3 3300003215 JGI25153J46596_10142022 JGI25153J46596_101420221 112
4 3300003575 Ga0007409J51694_1091639 Ga0007409J51694_10916392 112
5 3300003775 Ga0055524_1013072 Ga0055524_10130724 112
6 3300003775 Ga0055524_1016559 Ga0055524_10165591 112
7 3300003781 Ga0055536_1001953 Ga0055536_10019534 112
8 3300003781 Ga0055536_1021661 Ga0055536_10216612 112
9 3300003781 Ga0055536_1022461 Ga0055536_10224613 112
10 3300003784 Ga0055534_1008037 Ga0055534_10080372 112
11 3300003784 Ga0055534_1014588 Ga0055534_10145883 112
12 3300003791 Ga0055530_10000578 Ga0055530_1000057824 112
13 3300003792 Ga0055540_1059529 Ga0055540_10595292 112
14 3300003794 Ga0055531_10005972 Ga0055531_100059727 112
15 3300003794 Ga0055531_10076138 Ga0055531_100761382 112
16 3300003794 Ga0055531_10083302 Ga0055531_100833022 112
17 3300004801 Ga0058860_11886216 Ga0058860_118862161 112
18 3300005327 Ga0070658_10230542 Ga0070658_102305421 112
19 3300005327 Ga0070658_10271818 Ga0070658_102718183 112
20 3300005327 Ga0070658_10320468 Ga0070658_103204682 112
21 3300005328 Ga0070676_10035996 Ga0070676_100359962 112
22 3300005329 Ga0070683_100009342 Ga0070683_1000093424 112
23 3300005329 Ga0070683_100164501 Ga0070683_1001645012 112
24 3300005329 Ga0070683_100193432 Ga0070683_1001934322 112
25 3300005329 Ga0070683_100702525 Ga0070683_1007025252 112
26 3300005329 Ga0070683_100841158 Ga0070683_1008411581 112
27 3300005329 Ga0070683_101019396 Ga0070683_1010193962 112
28 3300005330 Ga0070690_100152737 Ga0070690_1001527372 112
29 3300005330 Ga0070690_100561832 Ga0070690_1005618322 112
30 3300005331 Ga0070670_100008384 Ga0070670_1000083843 112
31 3300005331 Ga0070670_100020647 Ga0070670_1000206473 112
32 3300005331 Ga0070670_100301931 Ga0070670_1003019312 112
33 3300005331 Ga0070670_100879245 Ga0070670_1008792451 112
34 3300005333 Ga0070677_10585781 Ga0070677_105857811 112
35 3300005334 Ga0068869_100082842 Ga0068869_1000828422 112
36 3300005334 Ga0068869_100089544 Ga0068869_1000895443 112
37 3300005334 Ga0068869_101175118 Ga0068869_1011751182 112
38 3300005334 Ga0068869_101456232 Ga0068869_1014562322 112
39 3300005335 Ga0070666_10001853 Ga0070666_100018539 112
40 3300005335 Ga0070666_10001858 Ga0070666_1000185810 112
41 3300005335 Ga0070666_10104933 Ga0070666_101049332 112
42 3300005335 Ga0070666_10106699 Ga0070666_101066992 112
43 3300005335 Ga0070666_10152584 Ga0070666_101525842 112
44 3300005335 Ga0070666_10313345 Ga0070666_103133452 112
45 3300005335 Ga0070666_11518868 Ga0070666_115188681 112
46 3300005336 Ga0070680_100168007 Ga0070680_1001680073 112
47 3300005336 Ga0070680_100783916 Ga0070680_1007839161 112
48 3300005336 Ga0070680_101370827 Ga0070680_1013708271 112
49 3300005337 Ga0070682_100702611 Ga0070682_1007026112 112
50 3300005338 Ga0068868_100002892 Ga0068868_10000289213 112
51 3300005338 Ga0068868_100023407 Ga0068868_1000234073 112
52 3300005338 Ga0068868_100052388 Ga0068868_1000523881 112
53 3300005338 Ga0068868_100073533 Ga0068868_1000735333 112
54 3300005338 Ga0068868_100245090 Ga0068868_1002450902 112
55 3300005338 Ga0068868_100917469 Ga0068868_1009174692 112
56 3300005339 Ga0070660_100309699 Ga0070660_1003096992 112
57 3300005339 Ga0070660_100526478 Ga0070660_1005264781 112
58 3300005340 Ga0070689_100062330 Ga0070689_1000623303 112
59 3300005340 Ga0070689_100118587 Ga0070689_1001185872 112
60 3300005341 Ga0070691_10437858 Ga0070691_104378582 112
61 3300005344 Ga0070661_100317167 Ga0070661_1003171672 112
62 3300005344 Ga0070661_100744294 Ga0070661_1007442942 112
63 3300005344 Ga0070661_100797306 Ga0070661_1007973062 112
64 3300005344 Ga0070661_101488612 Ga0070661_1014886122 112
65 3300005345 Ga0070692_11101637 Ga0070692_111016372 112
66 3300005347 Ga0070668_100061913 Ga0070668_1000619132 112
67 3300005347 Ga0070668_100123105 Ga0070668_1001231052 112
68 3300005347 Ga0070668_100158266 Ga0070668_1001582662 112
69 3300005347 Ga0070668_100470118 Ga0070668_1004701182 112
70 3300005347 Ga0070668_101156304 Ga0070668_1011563042 112
71 3300005354 Ga0070675_100131501 Ga0070675_1001315013 112
72 3300005354 Ga0070675_100580587 Ga0070675_1005805871 112
73 3300005354 Ga0070675_102075178 Ga0070675_1020751781 112
74 3300005355 Ga0070671_100216956 Ga0070671_1002169562 112
75 3300005355 Ga0070671_100478445 Ga0070671_1004784452 112
76 3300005355 Ga0070671_100555740 Ga0070671_1005557402 112
77 3300005355 Ga0070671_100594802 Ga0070671_1005948022 112
78 3300005355 Ga0070671_100623307 Ga0070671_1006233072 112
79 3300005355 Ga0070671_100651630 Ga0070671_1006516301 112
80 3300005355 Ga0070671_100794062 Ga0070671_1007940621 112
81 3300005355 Ga0070671_101128638 Ga0070671_1011286382 112
82 3300005356 Ga0070674_100055299 Ga0070674_1000552992 112
83 3300005356 Ga0070674_100096952 Ga0070674_1000969522 112
84 3300005356 Ga0070674_100242595 Ga0070674_1002425951 112
85 3300005356 Ga0070674_101047912 Ga0070674_1010479122 112
86 3300005356 Ga0070674_101842572 Ga0070674_1018425721 112
87 3300005364 Ga0070673_100200402 Ga0070673_1002004022 112
88 3300005364 Ga0070673_100229682 Ga0070673_1002296821 112
89 3300005364 Ga0070673_100243952 Ga0070673_1002439522 112
90 3300005365 Ga0070688_100035680 Ga0070688_1000356802 112
91 3300005366 Ga0070659_100070335 Ga0070659_1000703353 112
92 3300005366 Ga0070659_100396649 Ga0070659_1003966492 112
93 3300005367 Ga0070667_100012108 Ga0070667_1000121082 112
94 3300005367 Ga0070667_100050487 Ga0070667_1000504873 112
95 3300005367 Ga0070667_100168848 Ga0070667_1001688482 112
96 3300005367 Ga0070667_100239742 Ga0070667_1002397422 112
97 3300005367 Ga0070667_100601514 Ga0070667_1006015141 112
98 3300005367 Ga0070667_101972865 Ga0070667_1019728651 112
99 3300005434 Ga0070709_10040805 Ga0070709_100408052 112
100 3300005434 Ga0070709_10190549 Ga0070709_101905492 112
101 3300005434 Ga0070709_10250424 Ga0070709_102504242 112
102 3300005435 Ga0070714_100222825 Ga0070714_1002228252 112
103 3300005436 Ga0070713_100398392 Ga0070713_1003983922 112
104 3300005436 Ga0070713_101274783 Ga0070713_1012747831 112
105 3300005437 Ga0070710_11204827 Ga0070710_112048271 112
106 3300005438 Ga0070701_11217311 Ga0070701_112173111 112
107 3300005439 Ga0070711_100502744 Ga0070711_1005027442 112
108 3300005439 Ga0070711_100646771 Ga0070711_1006467712 112
109 3300005440 Ga0070705_100606260 Ga0070705_1006062602 112
110 3300005441 Ga0070700_100090819 Ga0070700_1000908193 112
111 3300005441 Ga0070700_100356404 Ga0070700_1003564042 112
112 3300005441 Ga0070700_101307374 Ga0070700_1013073741 112
113 3300005441 Ga0070700_101810937 Ga0070700_1018109371 112
114 3300005444 Ga0070694_100356639 Ga0070694_1003566392 112
115 3300005444 Ga0070694_100888618 Ga0070694_1008886182 112
116 3300005445 Ga0070708_100790466 Ga0070708_1007904662 112
117 3300005455 Ga0070663_100006966 Ga0070663_1000069665 112
118 3300005455 Ga0070663_100431874 Ga0070663_1004318741 112
119 3300005455 Ga0070663_100600003 Ga0070663_1006000032 112
120 3300005455 Ga0070663_100839526 Ga0070663_1008395262 112
121 3300005455 Ga0070663_101834212 Ga0070663_1018342121 112
122 3300005456 Ga0070678_100184141 Ga0070678_1001841412 112
123 3300005456 Ga0070678_100185081 Ga0070678_1001850813 112
124 3300005456 Ga0070678_100251181 Ga0070678_1002511813 112
125 3300005456 Ga0070678_100264027 Ga0070678_1002640273 112
126 3300005456 Ga0070678_100837154 Ga0070678_1008371542 112
127 3300005457 Ga0070662_100089159 Ga0070662_1000891591 112
128 3300005457 Ga0070662_100191719 Ga0070662_1001917192 112
129 3300005457 Ga0070662_100235573 Ga0070662_1002355732 112
130 3300005457 Ga0070662_100598881 Ga0070662_1005988812 112
131 3300005457 Ga0070662_101272128 Ga0070662_1012721281 112
132 3300005457 Ga0070662_101306613 Ga0070662_1013066131 112
133 3300005458 Ga0070681_10032389 Ga0070681_100323894 112
134 3300005458 Ga0070681_10434936 Ga0070681_104349362 112
135 3300005458 Ga0070681_10844164 Ga0070681_108441642 112
136 3300005459 Ga0068867_100009183 Ga0068867_1000091833 112
137 3300005459 Ga0068867_100025867 Ga0068867_1000258675 112
138 3300005459 Ga0068867_100084237 Ga0068867_1000842372 112
139 3300005459 Ga0068867_100376064 Ga0068867_1003760642 112
140 3300005459 Ga0068867_102387584 Ga0068867_1023875841 112
141 3300005466 Ga0070685_10000451 Ga0070685_1000045124 112
142 3300005466 Ga0070685_10513131 Ga0070685_105131312 112
143 3300005466 Ga0070685_11574634 Ga0070685_115746341 112
144 3300005471 Ga0070698_101333024 Ga0070698_1013330242 112
145 3300005530 Ga0070679_100097653 Ga0070679_1000976532 112
146 3300005530 Ga0070679_100466649 Ga0070679_1004666491 112
147 3300005530 Ga0070679_100682259 Ga0070679_1006822592 112
148 3300005530 Ga0070679_101148126 Ga0070679_1011481261 112
149 3300005535 Ga0070684_100116954 Ga0070684_1001169543 112
150 3300005535 Ga0070684_100175239 Ga0070684_1001752392 112
151 3300005535 Ga0070684_100559071 Ga0070684_1005590712 112
152 3300005535 Ga0070684_100756026 Ga0070684_1007560262 112
153 3300005535 Ga0070684_101091014 Ga0070684_1010910142 112
154 3300005535 Ga0070684_101526321 Ga0070684_1015263211 112
155 3300005539 Ga0068853_100071363 Ga0068853_1000713633 112
156 3300005539 Ga0068853_100100623 Ga0068853_1001006234 112
157 3300005539 Ga0068853_100136744 Ga0068853_1001367442 112
158 3300005539 Ga0068853_100371171 Ga0068853_1003711712 112
159 3300005539 Ga0068853_100411923 Ga0068853_1004119232 112
160 3300005539 Ga0068853_100464408 Ga0068853_1004644082 112
161 3300005539 Ga0068853_100562116 Ga0068853_1005621162 112
162 3300005539 Ga0068853_100624342 Ga0068853_1006243422 112
163 3300005539 Ga0068853_100734184 Ga0068853_1007341841 112
164 3300005539 Ga0068853_101527667 Ga0068853_1015276672 112
165 3300005543 Ga0070672_100001795 Ga0070672_1000017957 112
166 3300005543 Ga0070672_100146908 Ga0070672_1001469084 112
167 3300005543 Ga0070672_100191976 Ga0070672_1001919762 112
168 3300005543 Ga0070672_100683935 Ga0070672_1006839351 112
169 3300005544 Ga0070686_100011927 Ga0070686_1000119273 112
170 3300005544 Ga0070686_100048036 Ga0070686_1000480362 112
171 3300005544 Ga0070686_100525036 Ga0070686_1005250362 112
172 3300005544 Ga0070686_100596289 Ga0070686_1005962892 112
173 3300005547 Ga0070693_100100982 Ga0070693_1001009822 112
174 3300005547 Ga0070693_100121565 Ga0070693_1001215652 112
175 3300005547 Ga0070693_100357862 Ga0070693_1003578622 112
176 3300005547 Ga0070693_100536104 Ga0070693_1005361042 112
177 3300005547 Ga0070693_100542601 Ga0070693_1005426012 112
178 3300005548 Ga0070665_100004571 Ga0070665_10000457114 112
179 3300005548 Ga0070665_100103330 Ga0070665_1001033303 112
180 3300005548 Ga0070665_100223338 Ga0070665_1002233381 112
181 3300005548 Ga0070665_100685398 Ga0070665_1006853982 112
182 3300005548 Ga0070665_101429234 Ga0070665_1014292342 112
183 3300005549 Ga0070704_101360420 Ga0070704_1013604201 112
184 3300005563 Ga0068855_100000432 Ga0068855_10000043231 112
185 3300005563 Ga0068855_100002034 Ga0068855_10000203416 112
186 3300005563 Ga0068855_100132552 Ga0068855_1001325522 112
187 3300005563 Ga0068855_100238567 Ga0068855_1002385672 112
188 3300005563 Ga0068855_100672786 Ga0068855_1006727862 112
189 3300005563 Ga0068855_100777737 Ga0068855_1007777372 112
190 3300005563 Ga0068855_100823119 Ga0068855_1008231192 112
191 3300005563 Ga0068855_102299715 Ga0068855_1022997152 112
192 3300005563 Ga0068855_102359364 Ga0068855_1023593642 112
193 3300005564 Ga0070664_100000726 Ga0070664_10000072620 112
194 3300005564 Ga0070664_100114705 Ga0070664_1001147052 112
195 3300005564 Ga0070664_100403208 Ga0070664_1004032082 112
196 3300005564 Ga0070664_100463468 Ga0070664_1004634682 112
197 3300005564 Ga0070664_100567162 Ga0070664_1005671621 112
198 3300005577 Ga0068857_100000096 Ga0068857_10000009622 112
199 3300005577 Ga0068857_100047219 Ga0068857_1000472193 112
200 3300005577 Ga0068857_100060204 Ga0068857_1000602042 112
201 3300005577 Ga0068857_100133139 Ga0068857_1001331392 112
202 3300005577 Ga0068857_100386761 Ga0068857_1003867612 112
203 3300005577 Ga0068857_100407995 Ga0068857_1004079952 112
204 3300005577 Ga0068857_100698433 Ga0068857_1006984332 112
205 3300005577 Ga0068857_102017329 Ga0068857_1020173292 112
206 3300005578 Ga0068854_100000554 Ga0068854_1000005546 112
207 3300005578 Ga0068854_100024664 Ga0068854_1000246644 112
208 3300005578 Ga0068854_100045641 Ga0068854_1000456412 112
209 3300005578 Ga0068854_100223761 Ga0068854_1002237612 112
210 3300005578 Ga0068854_100464268 Ga0068854_1004642682 112
211 3300005578 Ga0068854_101042823 Ga0068854_1010428232 112
212 3300005614 Ga0068856_100000179 Ga0068856_10000017945 112
213 3300005614 Ga0068856_100002175 Ga0068856_10000217512 112
214 3300005614 Ga0068856_100193004 Ga0068856_1001930043 112
215 3300005614 Ga0068856_100386850 Ga0068856_1003868502 112
216 3300005614 Ga0068856_100539649 Ga0068856_1005396492 112
217 3300005615 Ga0070702_100024290 Ga0070702_1000242903 112
218 3300005615 Ga0070702_100055642 Ga0070702_1000556422 112
219 3300005615 Ga0070702_100122007 Ga0070702_1001220071 112
220 3300005615 Ga0070702_100167315 Ga0070702_1001673151 112
221 3300005615 Ga0070702_100520411 Ga0070702_1005204112 112
222 3300005616 Ga0068852_100010460 Ga0068852_1000104605 112
223 3300005616 Ga0068852_100035832 Ga0068852_1000358323 112
224 3300005616 Ga0068852_100209869 Ga0068852_1002098692 112
225 3300005616 Ga0068852_100400190 Ga0068852_1004001903 112
226 3300005616 Ga0068852_100627068 Ga0068852_1006270682 112
227 3300005617 Ga0068859_100010599 Ga0068859_1000105994 112
228 3300005617 Ga0068859_100136484 Ga0068859_1001364842 112
229 3300005617 Ga0068859_100237623 Ga0068859_1002376231 112
230 3300005617 Ga0068859_101049795 Ga0068859_1010497952 112
231 3300005617 Ga0068859_101855626 Ga0068859_1018556262 112
232 3300005618 Ga0068864_100000129 Ga0068864_10000012926 112
233 3300005618 Ga0068864_100011149 Ga0068864_1000111494 112
234 3300005618 Ga0068864_100227870 Ga0068864_1002278702 112
235 3300005618 Ga0068864_100602769 Ga0068864_1006027692 112
236 3300005618 Ga0068864_101270974 Ga0068864_1012709741 112
237 3300005718 Ga0068866_10007138 Ga0068866_100071382 112
238 3300005718 Ga0068866_10010050 Ga0068866_100100503 112
239 3300005718 Ga0068866_10064147 Ga0068866_100641472 112
240 3300005718 Ga0068866_10343585 Ga0068866_103435851 112
241 3300005719 Ga0068861_100038831 Ga0068861_1000388315 112
242 3300005719 Ga0068861_100039875 Ga0068861_1000398752 112
243 3300005719 Ga0068861_100153483 Ga0068861_1001534831 112
244 3300005719 Ga0068861_100244554 Ga0068861_1002445542 112
245 3300005719 Ga0068861_100647643 Ga0068861_1006476432 112
246 3300005834 Ga0068851_10003554 Ga0068851_100035545 112
247 3300005840 Ga0068870_10045752 Ga0068870_100457522 112
248 3300005840 Ga0068870_10089992 Ga0068870_100899922 112
249 3300005840 Ga0068870_10448127 Ga0068870_104481272 112
250 3300005841 Ga0068863_100005116 Ga0068863_10000511611 112
251 3300005841 Ga0068863_100026366 Ga0068863_1000263664 112
252 3300005841 Ga0068863_100090500 Ga0068863_1000905004 112
253 3300005841 Ga0068863_100170884 Ga0068863_1001708842 112
254 3300005841 Ga0068863_100183012 Ga0068863_1001830123 112
255 3300005841 Ga0068863_100243488 Ga0068863_1002434882 112
256 3300005841 Ga0068863_100423207 Ga0068863_1004232072 112
257 3300005841 Ga0068863_100458082 Ga0068863_1004580822 112
258 3300005841 Ga0068863_100595675 Ga0068863_1005956752 112
259 3300005841 Ga0068863_100870858 Ga0068863_1008708582 112
260 3300005841 Ga0068863_101287007 Ga0068863_1012870072 112
261 3300005842 Ga0068858_100025071 Ga0068858_1000250714 112
262 3300005842 Ga0068858_100030716 Ga0068858_1000307163 112
263 3300005842 Ga0068858_100124922 Ga0068858_1001249223 112
264 3300005842 Ga0068858_100213797 Ga0068858_1002137972 112
265 3300005842 Ga0068858_100255257 Ga0068858_1002552572 112
266 3300005842 Ga0068858_100627282 Ga0068858_1006272822 112
267 3300005842 Ga0068858_100635556 Ga0068858_1006355562 112
268 3300005842 Ga0068858_100725982 Ga0068858_1007259822 112
269 3300005842 Ga0068858_100744839 Ga0068858_1007448392 112
270 3300005842 Ga0068858_100828650 Ga0068858_1008286502 112
271 3300005842 Ga0068858_102369603 Ga0068858_1023696032 112
272 3300005843 Ga0068860_100004438 Ga0068860_1000044389 112
273 3300005843 Ga0068860_100027327 Ga0068860_1000273272 112
274 3300005843 Ga0068860_100091037 Ga0068860_1000910372 112
275 3300005843 Ga0068860_100365661 Ga0068860_1003656612 112
276 3300005843 Ga0068860_100510384 Ga0068860_1005103841 112
277 3300005843 Ga0068860_100603674 Ga0068860_1006036742 112
278 3300005843 Ga0068860_102397800 Ga0068860_1023978002 112
279 3300005844 Ga0068862_101456482 Ga0068862_1014564822 112
280 3300005844 Ga0068862_101952538 Ga0068862_1019525382 112
281 3300005937 Ga0081455_10799957 Ga0081455_107999571 112
282 3300005983 Ga0081540_1001046 Ga0081540_100104614 112
283 3300005983 Ga0081540_1117627 Ga0081540_11176272 112
284 3300006038 Ga0075365_10009641 Ga0075365_100096413 112
285 3300006038 Ga0075365_10021278 Ga0075365_100212784 112
286 3300006038 Ga0075365_10042348 Ga0075365_100423486 112
287 3300006038 Ga0075365_10066208 Ga0075365_100662082 112
288 3300006038 Ga0075365_10081217 Ga0075365_100812172 112
289 3300006038 Ga0075365_10171080 Ga0075365_101710802 112
290 3300006038 Ga0075365_10195685 Ga0075365_101956852 112
291 3300006038 Ga0075365_10209985 Ga0075365_102099852 112
292 3300006038 Ga0075365_10229439 Ga0075365_102294392 112
293 3300006038 Ga0075365_10239001 Ga0075365_102390013 112
294 3300006038 Ga0075365_10271012 Ga0075365_102710122 112
295 3300006038 Ga0075365_10273148 Ga0075365_102731481 112
296 3300006038 Ga0075365_11035369 Ga0075365_110353692 112
297 3300006042 Ga0075368_10018412 Ga0075368_100184122 112
298 3300006042 Ga0075368_10274749 Ga0075368_102747492 112
299 3300006042 Ga0075368_10329156 Ga0075368_103291561 112
300 3300006042 Ga0075368_10342364 Ga0075368_103423642 112
301 3300006042 Ga0075368_10398090 Ga0075368_103980901 112
302 3300006048 Ga0075363_100024237 Ga0075363_1000242372 112
303 3300006048 Ga0075363_100071908 Ga0075363_1000719082 112
304 3300006048 Ga0075363_100347545 Ga0075363_1003475452 112
305 3300006051 Ga0075364_10001125 Ga0075364_1000112510 112
306 3300006051 Ga0075364_10018799 Ga0075364_100187994 112
307 3300006051 Ga0075364_10086675 Ga0075364_100866752 112
308 3300006051 Ga0075364_10181730 Ga0075364_101817302 112
309 3300006051 Ga0075364_10387297 Ga0075364_103872972 112
310 3300006051 Ga0075364_10402584 Ga0075364_104025841 112
311 3300006051 Ga0075364_10493870 Ga0075364_104938701 112
312 3300006051 Ga0075364_11249850 Ga0075364_112498501 112
313 3300006163 Ga0070715_10154698 Ga0070715_101546982 112
314 3300006175 Ga0070712_100264735 Ga0070712_1002647352 112
315 3300006178 Ga0075367_10017493 Ga0075367_100174932 112
316 3300006178 Ga0075367_10032975 Ga0075367_100329751 112
317 3300006178 Ga0075367_10067400 Ga0075367_100674004 112
318 3300006178 Ga0075367_10088617 Ga0075367_100886173 112
319 3300006178 Ga0075367_10210472 Ga0075367_102104722 112
320 3300006178 Ga0075367_10243957 Ga0075367_102439572 112
321 3300006178 Ga0075367_10515075 Ga0075367_105150752 112
322 3300006178 Ga0075367_10697495 Ga0075367_106974952 112
323 3300006195 Ga0075366_10711803 Ga0075366_107118031 112
324 3300006237 Ga0097621_100000196 Ga0097621_10000019637 112
325 3300006237 Ga0097621_100002114 Ga0097621_10000211413 112
326 3300006237 Ga0097621_100019556 Ga0097621_1000195563 112
327 3300006237 Ga0097621_100159978 Ga0097621_1001599782 112
328 3300006237 Ga0097621_100288304 Ga0097621_1002883042 112
329 3300006237 Ga0097621_100385197 Ga0097621_1003851971 112
330 3300006237 Ga0097621_100407750 Ga0097621_1004077502 112
331 3300006353 Ga0075370_10623732 Ga0075370_106237321 112
332 3300006358 Ga0068871_100000049 Ga0068871_10000004928 112
333 3300006358 Ga0068871_100027217 Ga0068871_1000272173 112
334 3300006358 Ga0068871_100047305 Ga0068871_1000473053 112
335 3300006358 Ga0068871_100071763 Ga0068871_1000717633 112
336 3300006358 Ga0068871_100133563 Ga0068871_1001335633 112
337 3300006358 Ga0068871_100138395 Ga0068871_1001383953 112
338 3300006358 Ga0068871_100227044 Ga0068871_1002270443 112
339 3300006358 Ga0068871_100338812 Ga0068871_1003388122 112
340 3300006844 Ga0075428_100101055 Ga0075428_1001010553 112
341 3300006847 Ga0075431_101115607 Ga0075431_1011156071 112
342 3300006880 Ga0075429_100456305 Ga0075429_1004563052 112
343 3300006880 Ga0075429_100756886 Ga0075429_1007568862 112
344 3300006881 Ga0068865_100016213 Ga0068865_1000162133 112
345 3300006881 Ga0068865_100070890 Ga0068865_1000708902 112
346 3300006881 Ga0068865_100077435 Ga0068865_1000774352 112
347 3300006881 Ga0068865_100179459 Ga0068865_1001794593 112
348 3300006881 Ga0068865_100188845 Ga0068865_1001888452 112
349 3300006881 Ga0068865_100398524 Ga0068865_1003985242 112
350 3300006881 Ga0068865_100742490 Ga0068865_1007424902 112
351 3300006881 Ga0068865_100750310 Ga0068865_1007503102 112
352 3300006931 Ga0097620_100010599 Ga0097620_1000105994 112
353 3300006931 Ga0097620_100136488 Ga0097620_1001364882 112
354 3300006931 Ga0097620_100237623 Ga0097620_1002376231 112
355 3300006931 Ga0097620_101049746 Ga0097620_1010497462 112
356 3300006931 Ga0097620_101855547 Ga0097620_1018555472 112
357 3300006942 Ga0099824_1019323 Ga0099824_10193234 112
358 3300009093 Ga0105240_10000906 Ga0105240_1000090645 112
359 3300009093 Ga0105240_10004993 Ga0105240_1000499312 112
360 3300009093 Ga0105240_10027081 Ga0105240_100270815 112
361 3300009093 Ga0105240_10027316 Ga0105240_100273165 112
362 3300009093 Ga0105240_10088014 Ga0105240_100880143 112
363 3300009093 Ga0105240_10155563 Ga0105240_101555632 112
364 3300009093 Ga0105240_10251728 Ga0105240_102517282 112
365 3300009093 Ga0105240_10265229 Ga0105240_102652293 112
366 3300009093 Ga0105240_10279530 Ga0105240_102795302 112
367 3300009093 Ga0105240_11861069 Ga0105240_118610691 112
368 3300009093 Ga0105240_12426867 Ga0105240_124268672 112
369 3300009094 Ga0111539_10175933 Ga0111539_101759333 112
370 3300009094 Ga0111539_10371110 Ga0111539_103711103 112
371 3300009094 Ga0111539_11274521 Ga0111539_112745212 112
372 3300009098 Ga0105245_10187338 Ga0105245_101873382 112
373 3300009098 Ga0105245_10188072 Ga0105245_101880724 112
374 3300009098 Ga0105245_10896004 Ga0105245_108960041 112
375 3300009098 Ga0105245_11019902 Ga0105245_110199022 112
376 3300009101 Ga0105247_10288387 Ga0105247_102883872 112
377 3300009101 Ga0105247_10778532 Ga0105247_107785322 112
378 3300009101 Ga0105247_11601429 Ga0105247_116014292 112
379 3300009147 Ga0114129_10604548 Ga0114129_106045482 112
380 3300009148 Ga0105243_10041324 Ga0105243_100413244 112
381 3300009148 Ga0105243_10042566 Ga0105243_100425662 112
382 3300009148 Ga0105243_10090932 Ga0105243_100909322 112
383 3300009148 Ga0105243_10408280 Ga0105243_104082802 112
384 3300009148 Ga0105243_10501008 Ga0105243_105010082 112
385 3300009148 Ga0105243_10657632 Ga0105243_106576322 112
386 3300009148 Ga0105243_11165715 Ga0105243_111657152 112
387 3300009148 Ga0105243_11231758 Ga0105243_112317581 112
388 3300009174 Ga0105241_10032759 Ga0105241_100327592 112
389 3300009174 Ga0105241_10120160 Ga0105241_101201602 112
390 3300009174 Ga0105241_10431342 Ga0105241_104313422 112
391 3300009174 Ga0105241_10644028 Ga0105241_106440282 112
392 3300009174 Ga0105241_11338911 Ga0105241_113389112 112
393 3300009174 Ga0105241_12560117 Ga0105241_125601172 112
394 3300009176 Ga0105242_10012056 Ga0105242_100120564 112
395 3300009176 Ga0105242_10042305 Ga0105242_100423053 112
396 3300009176 Ga0105242_10423519 Ga0105242_104235192 112
397 3300009176 Ga0105242_10886616 Ga0105242_108866162 112
398 3300009176 Ga0105242_11228100 Ga0105242_112281002 112
399 3300009176 Ga0105242_11832603 Ga0105242_118326031 112
400 3300009176 Ga0105242_12312340 Ga0105242_123123402 112
401 3300009177 Ga0105248_10010283 Ga0105248_1001028310 112
402 3300009177 Ga0105248_10017949 Ga0105248_100179493 112
403 3300009177 Ga0105248_10081498 Ga0105248_100814982 112
404 3300009177 Ga0105248_10164087 Ga0105248_101640873 112
405 3300009177 Ga0105248_10242008 Ga0105248_102420082 112
406 3300009177 Ga0105248_10310979 Ga0105248_103109792 112
407 3300009177 Ga0105248_10415691 Ga0105248_104156912 112
408 3300009177 Ga0105248_10640126 Ga0105248_106401262 112
409 3300009177 Ga0105248_10992361 Ga0105248_109923611 112
410 3300009545 Ga0105237_10009430 Ga0105237_100094302 112
411 3300009545 Ga0105237_10066651 Ga0105237_100666513 112
412 3300009545 Ga0105237_10333521 Ga0105237_103335212 112
413 3300009545 Ga0105237_10628663 Ga0105237_106286632 112
414 3300009545 Ga0105237_10672051 Ga0105237_106720511 112
415 3300009545 Ga0105237_10898148 Ga0105237_108981482 112
416 3300009545 Ga0105237_11075995 Ga0105237_110759952 112
417 3300009551 Ga0105238_10009376 Ga0105238_100093763 112
418 3300009551 Ga0105238_10023690 Ga0105238_100236903 112
419 3300009551 Ga0105238_10036707 Ga0105238_100367073 112
420 3300009551 Ga0105238_10052956 Ga0105238_100529564 112
421 3300009551 Ga0105238_10082010 Ga0105238_100820103 112
422 3300009551 Ga0105238_10097773 Ga0105238_100977733 112
423 3300009551 Ga0105238_10327534 Ga0105238_103275342 112
424 3300009551 Ga0105238_10452257 Ga0105238_104522572 112
425 3300009551 Ga0105238_10495788 Ga0105238_104957882 112
426 3300009551 Ga0105238_10790803 Ga0105238_107908032 112
427 3300009553 Ga0105249_10048096 Ga0105249_100480961 112
428 3300009553 Ga0105249_10159404 Ga0105249_101594042 112
429 3300009553 Ga0105249_10179568 Ga0105249_101795682 112
430 3300009553 Ga0105249_10279928 Ga0105249_102799282 112
431 3300009553 Ga0105249_10300706 Ga0105249_103007061 112
432 3300009553 Ga0105249_10594681 Ga0105249_105946812 112
433 3300010375 Ga0105239_10038937 Ga0105239_100389376 112
434 3300010375 Ga0105239_10049542 Ga0105239_100495423 112
435 3300010375 Ga0105239_10134538 Ga0105239_101345381 112
436 3300010375 Ga0105239_10134956 Ga0105239_101349562 112
437 3300010375 Ga0105239_10150239 Ga0105239_101502392 112
438 3300010375 Ga0105239_10275935 Ga0105239_102759352 112
439 3300010375 Ga0105239_11043199 Ga0105239_110431992 112
440 3300010375 Ga0105239_11424567 Ga0105239_114245672 112
441 3300011119 Ga0105246_10016866 Ga0105246_100168662 112
442 3300011119 Ga0105246_10077748 Ga0105246_100777483 112
443 3300011119 Ga0105246_10121355 Ga0105246_101213552 112
444 3300011119 Ga0105246_10767720 Ga0105246_107677202 112
445 3300011119 Ga0105246_11133405 Ga0105246_111334052 112
446 3300011119 Ga0105246_11474086 Ga0105246_114740862 112
447 3300012482 Ga0157318_1007034 Ga0157318_10070341 112
448 3300012505 Ga0157339_1003561 Ga0157339_10035612 112
449 3300012510 Ga0157316_1050929 Ga0157316_10509291 112
450 3300012512 Ga0157327_1005852 Ga0157327_10058522 112
451 3300012515 Ga0157338_1007600 Ga0157338_10076002 112
452 3300013100 Ga0157373_10130661 Ga0157373_101306612 112
453 3300013102 Ga0157371_10163129 Ga0157371_101631293 112
454 3300013102 Ga0157371_10189802 Ga0157371_101898022 112
455 3300013102 Ga0157371_10695988 Ga0157371_106959882 112
456 3300013102 Ga0157371_10790493 Ga0157371_107904932 112
457 3300013104 Ga0157370_10110028 Ga0157370_101100283 112
458 3300013104 Ga0157370_10617216 Ga0157370_106172162 112
459 3300013104 Ga0157370_11946286 Ga0157370_119462861 112
460 3300013105 Ga0157369_10019968 Ga0157369_100199688 112
461 3300013105 Ga0157369_10075339 Ga0157369_100753393 112
462 3300013105 Ga0157369_10360373 Ga0157369_103603732 112
463 3300013105 Ga0157369_10425283 Ga0157369_104252832 112
464 3300013105 Ga0157369_10431777 Ga0157369_104317772 112
465 3300013105 Ga0157369_10442977 Ga0157369_104429772 112
466 3300013105 Ga0157369_10599162 Ga0157369_105991622 112
467 3300013296 Ga0157374_10000062 Ga0157374_1000006248 112
468 3300013296 Ga0157374_10021722 Ga0157374_100217223 112
469 3300013296 Ga0157374_10106725 Ga0157374_101067253 112
470 3300013296 Ga0157374_10150309 Ga0157374_101503093 112
471 3300013296 Ga0157374_10253738 Ga0157374_102537382 112
472 3300013296 Ga0157374_10518609 Ga0157374_105186092 112
473 3300013296 Ga0157374_10816210 Ga0157374_108162102 112
474 3300013297 Ga0157378_10000009 Ga0157378_1000000960 112
475 3300013297 Ga0157378_10000366 Ga0157378_100003664 112
476 3300013297 Ga0157378_10002258 Ga0157378_1000225813 112
477 3300013297 Ga0157378_10025295 Ga0157378_100252953 112
478 3300013297 Ga0157378_10106770 Ga0157378_101067702 112
479 3300013297 Ga0157378_10245045 Ga0157378_102450452 112
480 3300013297 Ga0157378_10818152 Ga0157378_108181521 112
481 3300013297 Ga0157378_10997973 Ga0157378_109979732 112
482 3300013306 Ga0163162_10000028 Ga0163162_10000028119 112
483 3300013306 Ga0163162_10071763 Ga0163162_100717633 112
484 3300013306 Ga0163162_10082672 Ga0163162_100826723 112
485 3300013306 Ga0163162_10151115 Ga0163162_101511152 112
486 3300013306 Ga0163162_10329599 Ga0163162_103295992 112
487 3300013306 Ga0163162_10605705 Ga0163162_106057052 112
488 3300013306 Ga0163162_10651778 Ga0163162_106517782 112
489 3300013306 Ga0163162_11730171 Ga0163162_117301712 112
490 3300013306 Ga0163162_11925388 Ga0163162_119253882 112
491 3300013306 Ga0163162_12515910 Ga0163162_125159101 112
492 3300013306 Ga0163162_12811305 Ga0163162_128113051 112
493 3300013307 Ga0157372_10001184 Ga0157372_1000118421 112
494 3300013307 Ga0157372_10002204 Ga0157372_1000220422 112
495 3300013307 Ga0157372_10008186 Ga0157372_100081869 112
496 3300013307 Ga0157372_10111977 Ga0157372_101119773 112
497 3300013307 Ga0157372_10292790 Ga0157372_102927902 112
498 3300013307 Ga0157372_10303986 Ga0157372_103039862 112
499 3300013307 Ga0157372_10307674 Ga0157372_103076742 112
500 3300013307 Ga0157372_10334834 Ga0157372_103348342 112
501 3300013308 Ga0157375_10001583 Ga0157375_100015835 112
502 3300013308 Ga0157375_10031568 Ga0157375_100315683 112
503 3300013308 Ga0157375_10072749 Ga0157375_100727493 112
504 3300013308 Ga0157375_10084786 Ga0157375_100847863 112
505 3300013308 Ga0157375_10213455 Ga0157375_102134553 112
506 3300013308 Ga0157375_10730150 Ga0157375_107301502 112
507 3300013308 Ga0157375_11076585 Ga0157375_110765852 112
508 3300013308 Ga0157375_12341202 Ga0157375_123412021 112
509 3300013308 Ga0157375_13165977 Ga0157375_131659772 112
510 3300014325 Ga0163163_10001955 Ga0163163_1000195510 112
511 3300014325 Ga0163163_10004520 Ga0163163_100045208 112
512 3300014325 Ga0163163_10103355 Ga0163163_101033552 112
513 3300014325 Ga0163163_10270330 Ga0163163_102703302 112
514 3300014325 Ga0163163_10495605 Ga0163163_104956052 112
515 3300014325 Ga0163163_12569231 Ga0163163_125692312 112
516 3300014326 Ga0157380_10020607 Ga0157380_100206073 112
517 3300014326 Ga0157380_10269114 Ga0157380_102691142 112
518 3300014326 Ga0157380_10505670 Ga0157380_105056702 112
519 3300014326 Ga0157380_10770206 Ga0157380_107702062 112
520 3300014326 Ga0157380_11276160 Ga0157380_112761602 112
521 3300014497 Ga0182008_10049225 Ga0182008_100492253 112
522 3300014497 Ga0182008_10481120 Ga0182008_104811202 112
523 3300014497 Ga0182008_10525419 Ga0182008_105254191 112
524 3300014745 Ga0157377_10151536 Ga0157377_101515362 112
525 3300014745 Ga0157377_10279058 Ga0157377_102790582 112
526 3300014968 Ga0157379_10000319 Ga0157379_1000031937 112
527 3300014968 Ga0157379_10030697 Ga0157379_100306975 112
528 3300014968 Ga0157379_10245833 Ga0157379_102458332 112
529 3300014968 Ga0157379_10365956 Ga0157379_103659562 112
530 3300014968 Ga0157379_10548003 Ga0157379_105480032 112
531 3300014968 Ga0157379_11033142 Ga0157379_110331422 112
532 3300014968 Ga0157379_11298238 Ga0157379_112982382 112
533 3300014969 Ga0157376_10082837 Ga0157376_100828372 112
534 3300014969 Ga0157376_10093047 Ga0157376_100930472 112
535 3300014969 Ga0157376_10105381 Ga0157376_101053813 112
536 3300014969 Ga0157376_10122466 Ga0157376_101224661 112
537 3300014969 Ga0157376_10189556 Ga0157376_101895562 112
538 3300014969 Ga0157376_10258581 Ga0157376_102585812 112
539 3300014969 Ga0157376_10260700 Ga0157376_102607001 112
540 3300014969 Ga0157376_10484450 Ga0157376_104844502 112
541 3300014969 Ga0157376_10508205 Ga0157376_105082052 112
542 3300014969 Ga0157376_11043313 Ga0157376_110433132 112
543 3300014969 Ga0157376_11139105 Ga0157376_111391052 112
544 3300017792 Ga0163161_10005516 Ga0163161_100055168 112
545 3300017792 Ga0163161_10015892 Ga0163161_100158925 112
546 3300017792 Ga0163161_10201622 Ga0163161_102016222 112
547 3300017792 Ga0163161_10203088 Ga0163161_102030882 112
548 3300017792 Ga0163161_10363611 Ga0163161_103636111 112
549 3300017792 Ga0163161_10554401 Ga0163161_105544012 112
550 3300017792 Ga0163161_11628128 Ga0163161_116281281 112
551 3300017792 Ga0163161_11943241 Ga0163161_119432412 112
552 3300020070 Ga0206356_11689876 Ga0206356_116898762 112
553 3300020075 Ga0206349_1714749 Ga0206349_17147492 112
554 3300020082 Ga0206353_11171569 Ga0206353_111715691 112
555 3300020082 Ga0206353_11366746 Ga0206353_113667462 112
556 3300020082 Ga0206353_11586967 Ga0206353_115869672 112
557 3300025273 Ga0209673_1007174 Ga0209673_10071744 112
558 3300025273 Ga0209673_1072312 Ga0209673_10723121 112
559 3300025284 Ga0209130_1011708 Ga0209130_10117082 112
560 3300025291 Ga0209675_1004813 Ga0209675_10048133 112
561 3300025291 Ga0209675_1004817 Ga0209675_10048174 112
562 3300025292 Ga0209676_1001568 Ga0209676_10015685 112
563 3300025292 Ga0209676_1002588 Ga0209676_100258810 112
564 3300025292 Ga0209676_1002747 Ga0209676_10027474 112
565 3300025292 Ga0209676_1003093 Ga0209676_10030934 112
566 3300025292 Ga0209676_1033031 Ga0209676_10330312 112
567 3300025292 Ga0209676_1068054 Ga0209676_10680541 112
568 3300025294 Ga0209025_1000454 Ga0209025_100045466 112
569 3300025294 Ga0209025_1011745 Ga0209025_10117456 112
570 3300025294 Ga0209025_1020449 Ga0209025_10204494 112
571 3300025294 Ga0209025_1033207 Ga0209025_10332071 112
572 3300025294 Ga0209025_1067527 Ga0209025_10675272 112
573 3300025294 Ga0209025_1191523 Ga0209025_11915231 112
574 3300025295 Ga0209564_1003082 Ga0209564_100308211 112
575 3300025297 Ga0209758_1053082 Ga0209758_10530822 112
576 3300025297 Ga0209758_1112180 Ga0209758_11121801 112
577 3300025298 Ga0209050_1000865 Ga0209050_100086517 112
578 3300025298 Ga0209050_1008800 Ga0209050_10088005 112
579 3300025299 Ga0209256_1005269 Ga0209256_10052695 112
580 3300025299 Ga0209256_1006382 Ga0209256_10063824 112
581 3300025303 Ga0209051_1029660 Ga0209051_10296603 112
582 3300025304 Ga0209257_1000154 Ga0209257_1000154152 112
583 3300025304 Ga0209257_1001025 Ga0209257_100102512 112
584 3300025304 Ga0209257_1001296 Ga0209257_100129628 112
585 3300025304 Ga0209257_1015047 Ga0209257_10150471 112
586 3300025315 Ga0207697_10157211 Ga0207697_101572112 112
587 3300025321 Ga0207656_10001724 Ga0207656_100017245 112
588 3300025321 Ga0207656_10112803 Ga0207656_101128032 112
589 3300025893 Ga0207682_10143516 Ga0207682_101435162 112
590 3300025893 Ga0207682_10171017 Ga0207682_101710172 112
591 3300025898 Ga0207692_10969175 Ga0207692_109691751 112
592 3300025899 Ga0207642_10007476 Ga0207642_100074763 112
593 3300025899 Ga0207642_10118473 Ga0207642_101184732 112
594 3300025899 Ga0207642_10741856 Ga0207642_107418561 112
595 3300025901 Ga0207688_10044138 Ga0207688_100441381 112
596 3300025903 Ga0207680_10001162 Ga0207680_100011625 112
597 3300025903 Ga0207680_10007152 Ga0207680_100071525 112
598 3300025903 Ga0207680_10359870 Ga0207680_103598702 112
599 3300025903 Ga0207680_10456999 Ga0207680_104569992 112
600 3300025903 Ga0207680_10704104 Ga0207680_107041041 112
601 3300025904 Ga0207647_10000024 Ga0207647_1000002476 112
602 3300025904 Ga0207647_10002046 Ga0207647_100020466 112
603 3300025904 Ga0207647_10063045 Ga0207647_100630452 112
604 3300025904 Ga0207647_10487124 Ga0207647_104871242 112
605 3300025904 Ga0207647_10548242 Ga0207647_105482422 112
606 3300025904 Ga0207647_10801934 Ga0207647_108019342 112
607 3300025906 Ga0207699_10070829 Ga0207699_100708292 112
608 3300025906 Ga0207699_10341074 Ga0207699_103410742 112
609 3300025906 Ga0207699_10429108 Ga0207699_104291082 112
610 3300025907 Ga0207645_10025001 Ga0207645_100250012 112
611 3300025908 Ga0207643_10125350 Ga0207643_101253502 112
612 3300025908 Ga0207643_10127157 Ga0207643_101271572 112
613 3300025908 Ga0207643_10380027 Ga0207643_103800272 112
614 3300025909 Ga0207705_10149766 Ga0207705_101497662 112
615 3300025909 Ga0207705_10373572 Ga0207705_103735722 112
616 3300025909 Ga0207705_10634513 Ga0207705_106345131 112
617 3300025909 Ga0207705_11074411 Ga0207705_110744111 112
618 3300025911 Ga0207654_10006477 Ga0207654_100064772 112
619 3300025911 Ga0207654_10015692 Ga0207654_100156922 112
620 3300025911 Ga0207654_10065026 Ga0207654_100650262 112
621 3300025911 Ga0207654_10100463 Ga0207654_101004632 112
622 3300025911 Ga0207654_10266358 Ga0207654_102663582 112
623 3300025912 Ga0207707_10001452 Ga0207707_100014529 112
624 3300025912 Ga0207707_10052277 Ga0207707_100522772 112
625 3300025913 Ga0207695_10000040 Ga0207695_10000040114 112
626 3300025913 Ga0207695_10002176 Ga0207695_1000217616 112
627 3300025913 Ga0207695_10006210 Ga0207695_1000621012 112
628 3300025913 Ga0207695_10016274 Ga0207695_100162743 112
629 3300025913 Ga0207695_10022021 Ga0207695_100220213 112
630 3300025913 Ga0207695_10025623 Ga0207695_100256237 112
631 3300025913 Ga0207695_10038774 Ga0207695_100387742 112
632 3300025913 Ga0207695_10040956 Ga0207695_100409565 112
633 3300025913 Ga0207695_10533362 Ga0207695_105333622 112
634 3300025913 Ga0207695_10827735 Ga0207695_108277352 112
635 3300025914 Ga0207671_10002984 Ga0207671_100029849 112
636 3300025914 Ga0207671_10009442 Ga0207671_100094424 112
637 3300025914 Ga0207671_10018841 Ga0207671_100188412 112
638 3300025914 Ga0207671_10405775 Ga0207671_104057752 112
639 3300025914 Ga0207671_10496425 Ga0207671_104964252 112
640 3300025914 Ga0207671_10577850 Ga0207671_105778502 112
641 3300025914 Ga0207671_11167927 Ga0207671_111679272 112
642 3300025915 Ga0207693_10286913 Ga0207693_102869132 112
643 3300025916 Ga0207663_10152669 Ga0207663_101526692 112
644 3300025916 Ga0207663_11091975 Ga0207663_110919752 112
645 3300025917 Ga0207660_10416195 Ga0207660_104161952 112
646 3300025917 Ga0207660_10722308 Ga0207660_107223081 112
647 3300025917 Ga0207660_11349006 Ga0207660_113490061 112
648 3300025918 Ga0207662_10040240 Ga0207662_100402403 112
649 3300025919 Ga0207657_10000326 Ga0207657_1000032640 112
650 3300025919 Ga0207657_10511310 Ga0207657_105113102 112
651 3300025919 Ga0207657_11111319 Ga0207657_111113192 112
652 3300025920 Ga0207649_10004643 Ga0207649_100046433 112
653 3300025920 Ga0207649_10159208 Ga0207649_101592082 112
654 3300025920 Ga0207649_10270891 Ga0207649_102708913 112
655 3300025920 Ga0207649_10532696 Ga0207649_105326962 112
656 3300025920 Ga0207649_10585098 Ga0207649_105850982 112
657 3300025920 Ga0207649_10788992 Ga0207649_107889922 112
658 3300025920 Ga0207649_10869496 Ga0207649_108694961 112
659 3300025921 Ga0207652_10016784 Ga0207652_100167845 112
660 3300025921 Ga0207652_10203273 Ga0207652_102032733 112
661 3300025921 Ga0207652_11194063 Ga0207652_111940632 112
662 3300025921 Ga0207652_11427174 Ga0207652_114271741 112
663 3300025921 Ga0207652_11478752 Ga0207652_114787521 112
664 3300025923 Ga0207681_10137587 Ga0207681_101375872 112
665 3300025923 Ga0207681_10552603 Ga0207681_105526032 112
666 3300025923 Ga0207681_11511191 Ga0207681_115111911 112
667 3300025924 Ga0207694_10001319 Ga0207694_1000131919 112
668 3300025924 Ga0207694_10006000 Ga0207694_100060007 112
669 3300025924 Ga0207694_10010865 Ga0207694_100108654 112
670 3300025924 Ga0207694_10040794 Ga0207694_100407943 112
671 3300025924 Ga0207694_10041105 Ga0207694_100411055 112
672 3300025924 Ga0207694_10143818 Ga0207694_101438183 112
673 3300025924 Ga0207694_10358811 Ga0207694_103588111 112
674 3300025924 Ga0207694_10591577 Ga0207694_105915772 112
675 3300025924 Ga0207694_11250158 Ga0207694_112501582 112
676 3300025925 Ga0207650_10003597 Ga0207650_100035977 112
677 3300025925 Ga0207650_10007026 Ga0207650_100070264 112
678 3300025925 Ga0207650_10150236 Ga0207650_101502362 112
679 3300025925 Ga0207650_10162989 Ga0207650_101629892 112
680 3300025926 Ga0207659_10277557 Ga0207659_102775572 112
681 3300025926 Ga0207659_10518814 Ga0207659_105188142 112
682 3300025926 Ga0207659_10995151 Ga0207659_109951512 112
683 3300025926 Ga0207659_11649400 Ga0207659_116494001 112
684 3300025927 Ga0207687_10140730 Ga0207687_101407303 112
685 3300025927 Ga0207687_10158132 Ga0207687_101581322 112
686 3300025927 Ga0207687_10583760 Ga0207687_105837603 112
687 3300025927 Ga0207687_10584936 Ga0207687_105849362 112
688 3300025927 Ga0207687_10676723 Ga0207687_106767232 112
689 3300025927 Ga0207687_10888147 Ga0207687_108881471 112
690 3300025928 Ga0207700_10353069 Ga0207700_103530692 112
691 3300025928 Ga0207700_10595647 Ga0207700_105956471 112
692 3300025931 Ga0207644_10174600 Ga0207644_101746003 112
693 3300025931 Ga0207644_10251177 Ga0207644_102511772 112
694 3300025931 Ga0207644_10344765 Ga0207644_103447651 112
695 3300025931 Ga0207644_10873267 Ga0207644_108732672 112
696 3300025932 Ga0207690_10833288 Ga0207690_108332882 112
697 3300025932 Ga0207690_10838427 Ga0207690_108384272 112
698 3300025932 Ga0207690_10909924 Ga0207690_109099242 112
699 3300025933 Ga0207706_10006512 Ga0207706_100065121 112
700 3300025933 Ga0207706_10113646 Ga0207706_101136463 112
701 3300025933 Ga0207706_10261519 Ga0207706_102615192 112
702 3300025933 Ga0207706_10400407 Ga0207706_104004071 112
703 3300025933 Ga0207706_11139690 Ga0207706_111396902 112
704 3300025933 Ga0207706_11167617 Ga0207706_111676172 112
705 3300025933 Ga0207706_11392604 Ga0207706_113926042 112
706 3300025934 Ga0207686_10015548 Ga0207686_100155482 112
707 3300025934 Ga0207686_10138086 Ga0207686_101380863 112
708 3300025934 Ga0207686_10416366 Ga0207686_104163662 112
709 3300025934 Ga0207686_10450316 Ga0207686_104503162 112
710 3300025934 Ga0207686_10767744 Ga0207686_107677441 112
711 3300025934 Ga0207686_11279916 Ga0207686_112799162 112
712 3300025934 Ga0207686_11737595 Ga0207686_117375952 112
713 3300025935 Ga0207709_10027510 Ga0207709_100275104 112
714 3300025935 Ga0207709_10213470 Ga0207709_102134701 112
715 3300025936 Ga0207670_10293221 Ga0207670_102932213 112
716 3300025937 Ga0207669_10025336 Ga0207669_100253362 112
717 3300025937 Ga0207669_10159282 Ga0207669_101592822 112
718 3300025937 Ga0207669_10258036 Ga0207669_102580361 112
719 3300025938 Ga0207704_10018725 Ga0207704_100187254 112
720 3300025938 Ga0207704_10021380 Ga0207704_100213803 112
721 3300025938 Ga0207704_10064222 Ga0207704_100642222 112
722 3300025938 Ga0207704_10096787 Ga0207704_100967872 112
723 3300025938 Ga0207704_10381941 Ga0207704_103819412 112
724 3300025938 Ga0207704_10741225 Ga0207704_107412252 112
725 3300025938 Ga0207704_11001374 Ga0207704_110013742 112
726 3300025938 Ga0207704_11484772 Ga0207704_114847721 112
727 3300025938 Ga0207704_11852943 Ga0207704_118529432 112
728 3300025939 Ga0207665_11018767 Ga0207665_110187671 112
729 3300025940 Ga0207691_10027848 Ga0207691_100278483 112
730 3300025940 Ga0207691_10062400 Ga0207691_100624003 112
731 3300025940 Ga0207691_10101776 Ga0207691_101017762 112
732 3300025940 Ga0207691_10300986 Ga0207691_103009862 112
733 3300025940 Ga0207691_10345714 Ga0207691_103457142 112
734 3300025940 Ga0207691_10437193 Ga0207691_104371931 112
735 3300025940 Ga0207691_10612968 Ga0207691_106129681 112
736 3300025941 Ga0207711_10001544 Ga0207711_1000154416 112
737 3300025941 Ga0207711_10006123 Ga0207711_1000612311 112
738 3300025941 Ga0207711_10009684 Ga0207711_100096844 112
739 3300025941 Ga0207711_10019526 Ga0207711_100195265 112
740 3300025941 Ga0207711_10203021 Ga0207711_102030213 112
741 3300025941 Ga0207711_10261515 Ga0207711_102615152 112
742 3300025941 Ga0207711_10328735 Ga0207711_103287352 112
743 3300025941 Ga0207711_10721443 Ga0207711_107214432 112
744 3300025942 Ga0207689_10169299 Ga0207689_101692992 112
745 3300025942 Ga0207689_10192430 Ga0207689_101924302 112
746 3300025942 Ga0207689_11024129 Ga0207689_110241292 112
747 3300025942 Ga0207689_11253393 Ga0207689_112533932 112
748 3300025944 Ga0207661_10059158 Ga0207661_100591584 112
749 3300025944 Ga0207661_10059225 Ga0207661_100592252 112
750 3300025944 Ga0207661_10115744 Ga0207661_101157442 112
751 3300025944 Ga0207661_10992832 Ga0207661_109928321 112
752 3300025944 Ga0207661_11739692 Ga0207661_117396921 112
753 3300025945 Ga0207679_10001856 Ga0207679_100018566 112
754 3300025945 Ga0207679_10204991 Ga0207679_102049911 112
755 3300025945 Ga0207679_10290784 Ga0207679_102907842 112
756 3300025945 Ga0207679_10447035 Ga0207679_104470351 112
757 3300025945 Ga0207679_11688830 Ga0207679_116888302 112
758 3300025949 Ga0207667_10000465 Ga0207667_1000046528 112
759 3300025949 Ga0207667_10001399 Ga0207667_1000139924 112
760 3300025949 Ga0207667_10027253 Ga0207667_100272535 112
761 3300025949 Ga0207667_10080008 Ga0207667_100800082 112
762 3300025949 Ga0207667_10141308 Ga0207667_101413082 112
763 3300025949 Ga0207667_10373465 Ga0207667_103734652 112
764 3300025949 Ga0207667_11036637 Ga0207667_110366372 112
765 3300025949 Ga0207667_11127458 Ga0207667_111274582 112
766 3300025960 Ga0207651_10320214 Ga0207651_103202142 112
767 3300025960 Ga0207651_10334158 Ga0207651_103341583 112
768 3300025960 Ga0207651_10485762 Ga0207651_104857622 112
769 3300025960 Ga0207651_10882676 Ga0207651_108826762 112
770 3300025960 Ga0207651_11719631 Ga0207651_117196312 112
771 3300025961 Ga0207712_10000275 Ga0207712_100002752 112
772 3300025961 Ga0207712_10030485 Ga0207712_100304854 112
773 3300025961 Ga0207712_10040634 Ga0207712_100406343 112
774 3300025961 Ga0207712_10177825 Ga0207712_101778252 112
775 3300025961 Ga0207712_10688910 Ga0207712_106889102 112
776 3300025961 Ga0207712_10882859 Ga0207712_108828592 112
777 3300025972 Ga0207668_10072961 Ga0207668_100729613 112
778 3300025972 Ga0207668_10316378 Ga0207668_103163782 112
779 3300025972 Ga0207668_10461821 Ga0207668_104618211 112
780 3300025981 Ga0207640_10003205 Ga0207640_100032054 112
781 3300025981 Ga0207640_10018145 Ga0207640_100181452 112
782 3300025981 Ga0207640_10030688 Ga0207640_100306882 112
783 3300025981 Ga0207640_10056429 Ga0207640_100564292 112
784 3300025981 Ga0207640_10065293 Ga0207640_100652931 112
785 3300025981 Ga0207640_10098411 Ga0207640_100984113 112
786 3300025981 Ga0207640_10212413 Ga0207640_102124132 112
787 3300025986 Ga0207658_10011118 Ga0207658_100111183 112
788 3300025986 Ga0207658_10097209 Ga0207658_100972092 112
789 3300025986 Ga0207658_10200064 Ga0207658_102000642 112
790 3300025986 Ga0207658_10511296 Ga0207658_105112962 112
791 3300025986 Ga0207658_10788387 Ga0207658_107883872 112
792 3300025986 Ga0207658_11393045 Ga0207658_113930452 112
793 3300025986 Ga0207658_11677120 Ga0207658_116771202 112
794 3300026023 Ga0207677_10010569 Ga0207677_100105692 112
795 3300026023 Ga0207677_10096166 Ga0207677_100961662 112
796 3300026023 Ga0207677_10096831 Ga0207677_100968311 112
797 3300026023 Ga0207677_10207950 Ga0207677_102079502 112
798 3300026023 Ga0207677_10460226 Ga0207677_104602261 112
799 3300026023 Ga0207677_10486879 Ga0207677_104868792 112
800 3300026023 Ga0207677_10871921 Ga0207677_108719211 112
801 3300026035 Ga0207703_10001612 Ga0207703_1000161219 112
802 3300026035 Ga0207703_10013731 Ga0207703_100137317 112
803 3300026035 Ga0207703_10022458 Ga0207703_100224584 112
804 3300026035 Ga0207703_10026541 Ga0207703_100265413 112
805 3300026035 Ga0207703_10068511 Ga0207703_100685113 112
806 3300026035 Ga0207703_10413352 Ga0207703_104133522 112
807 3300026035 Ga0207703_10426585 Ga0207703_104265852 112
808 3300026035 Ga0207703_10536610 Ga0207703_105366102 112
809 3300026035 Ga0207703_10546625 Ga0207703_105466252 112
810 3300026035 Ga0207703_11229443 Ga0207703_112294432 112
811 3300026041 Ga0207639_10000116 Ga0207639_1000011631 112
812 3300026041 Ga0207639_10001494 Ga0207639_1000149413 112
813 3300026041 Ga0207639_10005911 Ga0207639_100059111 112
814 3300026041 Ga0207639_10050029 Ga0207639_100500291 112
815 3300026041 Ga0207639_10180619 Ga0207639_101806192 112
816 3300026041 Ga0207639_10330641 Ga0207639_103306412 112
817 3300026041 Ga0207639_11875370 Ga0207639_118753701 112
818 3300026067 Ga0207678_10005905 Ga0207678_100059055 112
819 3300026067 Ga0207678_10223153 Ga0207678_102231531 112
820 3300026067 Ga0207678_10707280 Ga0207678_107072802 112
821 3300026067 Ga0207678_11491716 Ga0207678_114917161 112
822 3300026067 Ga0207678_11662131 Ga0207678_116621312 112
823 3300026075 Ga0207708_10161011 Ga0207708_101610112 112
824 3300026075 Ga0207708_10294154 Ga0207708_102941542 112
825 3300026078 Ga0207702_10001051 Ga0207702_100010512 112
826 3300026078 Ga0207702_10008697 Ga0207702_100086975 112
827 3300026078 Ga0207702_10013885 Ga0207702_100138852 112
828 3300026078 Ga0207702_10036300 Ga0207702_100363002 112
829 3300026078 Ga0207702_10216397 Ga0207702_102163972 112
830 3300026078 Ga0207702_10549727 Ga0207702_105497272 112
831 3300026088 Ga0207641_10020771 Ga0207641_100207713 112
832 3300026088 Ga0207641_10022745 Ga0207641_100227455 112
833 3300026088 Ga0207641_10025422 Ga0207641_100254224 112
834 3300026088 Ga0207641_10073518 Ga0207641_100735183 112
835 3300026088 Ga0207641_10140241 Ga0207641_101402412 112
836 3300026088 Ga0207641_10529347 Ga0207641_105293472 112
837 3300026088 Ga0207641_10973412 Ga0207641_109734122 112
838 3300026088 Ga0207641_11150095 Ga0207641_111500952 112
839 3300026088 Ga0207641_11827313 Ga0207641_118273131 112
840 3300026088 Ga0207641_11922758 Ga0207641_119227582 112
841 3300026089 Ga0207648_10028264 Ga0207648_100282645 112
842 3300026089 Ga0207648_10071363 Ga0207648_100713632 112
843 3300026089 Ga0207648_10092387 Ga0207648_100923872 112
844 3300026089 Ga0207648_10141728 Ga0207648_101417282 112
845 3300026089 Ga0207648_10161034 Ga0207648_101610342 112
846 3300026089 Ga0207648_10958181 Ga0207648_109581811 112
847 3300026089 Ga0207648_11640543 Ga0207648_116405432 112
848 3300026095 Ga0207676_10015306 Ga0207676_100153062 112
849 3300026095 Ga0207676_10020158 Ga0207676_100201585 112
850 3300026095 Ga0207676_10084369 Ga0207676_100843692 112
851 3300026095 Ga0207676_10095677 Ga0207676_100956773 112
852 3300026095 Ga0207676_10230810 Ga0207676_102308102 112
853 3300026095 Ga0207676_10472482 Ga0207676_104724822 112
854 3300026095 Ga0207676_11236738 Ga0207676_112367382 112
855 3300026095 Ga0207676_11707682 Ga0207676_117076822 112
856 3300026095 Ga0207676_12201449 Ga0207676_122014491 112
857 3300026095 Ga0207676_12594716 Ga0207676_125947161 112
858 3300026116 Ga0207674_10002111 Ga0207674_100021117 112
859 3300026116 Ga0207674_10003692 Ga0207674_1000369217 112
860 3300026116 Ga0207674_10180643 Ga0207674_101806432 112
861 3300026116 Ga0207674_10181195 Ga0207674_101811952 112
862 3300026116 Ga0207674_10186230 Ga0207674_101862302 112
863 3300026116 Ga0207674_10390820 Ga0207674_103908202 112
864 3300026116 Ga0207674_10532582 Ga0207674_105325822 112
865 3300026116 Ga0207674_10938633 Ga0207674_109386331 112
866 3300026116 Ga0207674_11210336 Ga0207674_112103362 112
867 3300026116 Ga0207674_11655389 Ga0207674_116553891 112
868 3300026116 Ga0207674_11848943 Ga0207674_118489432 112
869 3300026118 Ga0207675_100010284 Ga0207675_1000102844 112
870 3300026118 Ga0207675_100069455 Ga0207675_1000694553 112
871 3300026118 Ga0207675_100080251 Ga0207675_1000802511 112
872 3300026118 Ga0207675_100797267 Ga0207675_1007972672 112
873 3300026118 Ga0207675_100975801 Ga0207675_1009758011 112
874 3300026121 Ga0207683_10041514 Ga0207683_100415144 112
875 3300026121 Ga0207683_10174299 Ga0207683_101742992 112
876 3300026121 Ga0207683_10224289 Ga0207683_102242892 112
877 3300026121 Ga0207683_10245372 Ga0207683_102453723 112
878 3300026121 Ga0207683_10353144 Ga0207683_103531441 112
879 3300026121 Ga0207683_10460767 Ga0207683_104607672 112
880 3300026121 Ga0207683_10934410 Ga0207683_109344102 112
881 3300026121 Ga0207683_11450479 Ga0207683_114504792 112
882 3300026142 Ga0207698_10025790 Ga0207698_100257903 112
883 3300026142 Ga0207698_10189561 Ga0207698_101895612 112
884 3300026142 Ga0207698_10296992 Ga0207698_102969922 112
885 3300026142 Ga0207698_10369316 Ga0207698_103693162 112
886 3300026142 Ga0207698_10387578 Ga0207698_103875782 112
887 3300026142 Ga0207698_10668990 Ga0207698_106689902 112
888 3300026142 Ga0207698_11360110 Ga0207698_113601102 112
889 3300026142 Ga0207698_12368509 Ga0207698_123685092 112
890 3300027682 Ga0209971_1180016 Ga0209971_11800162 112
891 3300027866 Ga0209813_10144077 Ga0209813_101440772 112
892 3300027866 Ga0209813_10254670 Ga0209813_102546701 112
893 3300027866 Ga0209813_10271466 Ga0209813_102714662 112
894 3300027866 Ga0209813_10345713 Ga0209813_103457131 112
895 3300027876 Ga0209974_10066110 Ga0209974_100661102 112
896 3300027876 Ga0209974_10251929 Ga0209974_102519292 112
897 3300027907 Ga0207428_10499733 Ga0207428_104997332 112
898 3300028379 Ga0268266_10000008 Ga0268266_10000008205 112
899 3300028379 Ga0268266_10048529 Ga0268266_100485294 112
900 3300028379 Ga0268266_10144893 Ga0268266_101448932 112
901 3300028379 Ga0268266_10221390 Ga0268266_102213902 112
902 3300028380 Ga0268265_10143946 Ga0268265_101439463 112
903 3300028380 Ga0268265_12096315 Ga0268265_120963151 112
904 3300028381 Ga0268264_10017059 Ga0268264_100170594 112
905 3300028381 Ga0268264_10035419 Ga0268264_100354193 112
906 3300028381 Ga0268264_10050247 Ga0268264_100502472 112
907 3300028381 Ga0268264_10065648 Ga0268264_100656483 112
908 3300028381 Ga0268264_10278908 Ga0268264_102789081 112
909 3300028381 Ga0268264_10601297 Ga0268264_106012971 112
910 3300028381 Ga0268264_11809743 Ga0268264_118097431 112
911 3300028381 Ga0268264_12478561 Ga0268264_124785611 112
912 3300030863 Ga0265766_1022650 Ga0265766_10226501 112
913 3300031456 Ga0307513_11103177 Ga0307513_111031771 112
914 3300031548 Ga0307408_100078352 Ga0307408_1000783522 112
915 3300031548 Ga0307408_100503230 Ga0307408_1005032301 112
916 3300031616 Ga0307508_10009148 Ga0307508_100091483 112
917 3300031665 Ga0316575_10067027 Ga0316575_100670272 112
918 3300031665 Ga0316575_10145067 Ga0316575_101450672 112
919 3300031665 Ga0316575_10177475 Ga0316575_101774752 112
920 3300031691 Ga0316579_10035148 Ga0316579_100351483 112
921 3300031691 Ga0316579_10042354 Ga0316579_100423542 112
922 3300031691 Ga0316579_10391337 Ga0316579_103913372 112
923 3300031727 Ga0316576_10005896 Ga0316576_100058963 112
924 3300031727 Ga0316576_10006214 Ga0316576_100062145 112
925 3300031727 Ga0316576_10035004 Ga0316576_100350042 112
926 3300031727 Ga0316576_10097808 Ga0316576_100978082 112
927 3300031727 Ga0316576_10097962 Ga0316576_100979622 112
928 3300031727 Ga0316576_10101454 Ga0316576_101014543 112
929 3300031727 Ga0316576_10623041 Ga0316576_106230412 112
930 3300031728 Ga0316578_10000785 Ga0316578_1000078512 112
931 3300031728 Ga0316578_10031889 Ga0316578_100318893 112
932 3300031728 Ga0316578_10035472 Ga0316578_100354722 112
933 3300031728 Ga0316578_10036064 Ga0316578_100360642 112
934 3300031728 Ga0316578_10050639 Ga0316578_100506392 112
935 3300031728 Ga0316578_10401498 Ga0316578_104014981 112
936 3300031728 Ga0316578_10462580 Ga0316578_104625801 112
937 3300031730 Ga0307516_10045126 Ga0307516_100451262 112
938 3300031731 Ga0307405_10011566 Ga0307405_100115662 112
939 3300031731 Ga0307405_10085176 Ga0307405_100851761 112
940 3300031731 Ga0307405_10414640 Ga0307405_104146403 112
941 3300031731 Ga0307405_10432868 Ga0307405_104328681 112
942 3300031731 Ga0307405_11405812 Ga0307405_114058121 112
943 3300031733 Ga0316577_10023857 Ga0316577_100238572 112
944 3300031733 Ga0316577_10070727 Ga0316577_100707272 112
945 3300031733 Ga0316577_10567628 Ga0316577_105676281 112
946 3300031824 Ga0307413_10005154 Ga0307413_100051543 112
947 3300031852 Ga0307410_10003872 Ga0307410_100038726 112
948 3300031852 Ga0307410_10050867 Ga0307410_100508672 112
949 3300031852 Ga0307410_10822939 Ga0307410_108229391 112
950 3300031852 Ga0307410_11283329 Ga0307410_112833292 112
951 3300031901 Ga0307406_10004191 Ga0307406_100041914 112
952 3300031901 Ga0307406_10145381 Ga0307406_101453812 112
953 3300031901 Ga0307406_10303100 Ga0307406_103031001 112
954 3300031903 Ga0307407_10716221 Ga0307407_107162211 112
955 3300031911 Ga0307412_10269682 Ga0307412_102696822 112
956 3300031995 Ga0307409_100001007 Ga0307409_1000010078 112
957 3300031995 Ga0307409_100673996 Ga0307409_1006739962 112
958 3300031995 Ga0307409_101468556 Ga0307409_1014685562 112
959 3300032002 Ga0307416_100019061 Ga0307416_1000190614 112
960 3300032002 Ga0307416_100056399 Ga0307416_1000563992 112
961 3300032002 Ga0307416_100367485 Ga0307416_1003674852 112
962 3300032002 Ga0307416_101019506 Ga0307416_1010195062 112
963 3300032004 Ga0307414_11040822 Ga0307414_110408221 112
964 3300032005 Ga0307411_10377180 Ga0307411_103771802 112
965 3300032005 Ga0307411_10731470 Ga0307411_107314702 112
966 3300032126 Ga0307415_100000190 Ga0307415_1000001903 112
967 3300032126 Ga0307415_100131400 Ga0307415_1001314002 112
968 3300032126 Ga0307415_100318770 Ga0307415_1003187702 112
969 3300032126 Ga0307415_100363344 Ga0307415_1003633442 112
970 3300032126 Ga0307415_101520076 Ga0307415_1015200761 112
971 3300032126 Ga0307415_101814762 Ga0307415_1018147621 112
972 3300032137 Ga0316585_10005493 Ga0316585_100054932 112
973 3300032139 Ga0316580_10001392 Ga0316580_100013924 112
974 3300033524 Ga0316592_1031132 Ga0316592_10311322 112
975 3300033541 Ga0316596_1012403 Ga0316596_10124032 112
976 3300034957 Ga0373938_0122376 Ga0373938_0122376_93_431 112
977 3300035084 Ga0373928_0001559 Ga0373928_0001559_946_1284 112
978 3300035085 Ga0373929_0005769 Ga0373929_0005769_726_1064 112
979 3300035089 Ga0373944_0040699 Ga0373944_0040699_815_1153 112
980 3300035090 Ga0373949_0106882 Ga0373949_0106882_91_429 112
981 3300035112 Ga0373932_0012957 Ga0373932_0012957_643_981 112
982 3300035119 Ga0373956_0576659 Ga0373956_0576659_147_485 112
983 3300035170 Ga0373943_0365343 Ga0373943_0365343_412_750 112
984 3300035170 Ga0373943_0610319 Ga0373943_0610319_176_514 112
985 3300035171 Ga0373946_0328855 Ga0373946_0328855_123_461 112
986 3300035398 Ga0316574_0009298 Ga0316574_0009298_2742_3080 112
987 3300035398 Ga0316574_0012164 Ga0316574_0012164_3011_3349 112
988 3300035398 Ga0316574_0028980 Ga0316574_0028980_419_757 112
989 3300035398 Ga0316574_0043707 Ga0316574_0043707_2179_2517 112
990 3300035398 Ga0316574_0044640 Ga0316574_0044640_1303_1641 112
991 3300035398 Ga0316574_0068255 Ga0316574_0068255_668_1006 112
992 3300035398 Ga0316574_0104517 Ga0316574_0104517_924_1265 112
993 3300035398 Ga0316574_0166127 Ga0316574_0166127_233_574 112
994 3300035398 Ga0316574_0252697 Ga0316574_0252697_31_369 112
995 3300035398 Ga0316574_0296427 Ga0316574_0296427_49_387 112
996 3300035398 Ga0316574_0771780 Ga0316574_0771780_47_388 112
997 3300035398 Ga0316574_0777003 Ga0316574_0777003_198_536 112
998 3300035398 Ga0316574_0796423 Ga0316574_0796423_92_430 112
999 3300035691 Ga0373931_0000006 Ga0373931_0000006_5534_5872 112
1000 3300035691 Ga0373931_0012253 Ga0373931_0012253_2458_2823 112
1001 3300035691 Ga0373931_0452825 Ga0373931_0452825_429_767 112
1002 3300035691 Ga0373931_0732471 Ga0373931_0732471_278_640 112
1003 3300035724 Ga0373933_0009250 Ga0373933_0009250_1723_2061 112
1004 3300036401 Ga0373937_0139768 Ga0373937_0139768_212_550 112
1005 3300036401 Ga0373937_1280912 Ga0373937_1280912_27_365 112
1006 3300036401 Ga0373937_1528419 Ga0373937_1528419_201_542 112
1007 3300036647 Ga0316582_0013632 Ga0316582_0013632_1359_1697 112
1008 3300036647 Ga0316582_0016194 Ga0316582_0016194_1102_1440 112
1009 3300036647 Ga0316582_0209094 Ga0316582_0209094_14_352 112
1010 3300036712 Ga0316584_0005439 Ga0316584_0005439_453_791 112
1011 3300036712 Ga0316584_0017406 Ga0316584_0017406_2731_3069 112
1012 3300036712 Ga0316584_0023461 Ga0316584_0023461_2656_2994 112
1013 3300036712 Ga0316584_0024065 Ga0316584_0024065_1048_1386 112
1014 3300036712 Ga0316584_0076261 Ga0316584_0076261_1540_1878 112
1015 3300036712 Ga0316584_0086520 Ga0316584_0086520_1582_1923 112
1016 3300036712 Ga0316584_0112103 Ga0316584_0112103_1647_1985 112
1017 3300036712 Ga0316584_0146323 Ga0316584_0146323_301_639 112
1018 3300037418 Ga0395900_0155816 Ga0395900_0155816_1692_2030 112
1019 3300037466 Ga0395898_0002525 Ga0395898_0002525_20130_20468 112
1020 3300038443 Ga0395901_0047958 Ga0395901_0047958_2533_2871 112
1021 3300038443 Ga0395901_0079626 Ga0395901_0079626_918_1256 112
1022 3300038443 Ga0395901_0607616 Ga0395901_0607616_748_1086 112
1023 3300038735 Ga0400485_10787 Ga0400485_10787_1798_2136 112
1024 3300039062 Ga0400483_017383 Ga0400483_017383_1526_1864 112
1025 3300039062 Ga0400483_035347 Ga0400483_035347_1661_1999 112
1026 3300039062 Ga0400483_088865 Ga0400483_088865_260_598 112
1027 3300039062 Ga0400483_136168 Ga0400483_136168_748_1086 112
1028 3300039062 Ga0400483_136484 Ga0400483_136484_4788_5126 112
1029 3300039062 Ga0400483_182325 Ga0400483_182325_15480_15818 112
1030 3300039062 Ga0400483_190738 Ga0400483_190738_380_718 112
1031 3300039062 Ga0400483_259065 Ga0400483_259065_4684_5022 112
1032 3300039450 Ga0436363_1130565 Ga0436363_1130565_2928_3266 112
1033 3300041406 Ga0439439_0022419 Ga0439439_0022419_947_1339 112
1034 3300041406 Ga0439439_0058660 Ga0439439_0058660_630_968 112
1035 3300041407 Ga0439447_001969 Ga0439447_001969_3702_4040 112
1036 3300041413 Ga0439465_0013327 Ga0439465_0013327_2167_2505 112
1037 3300041443 Ga0451789_0048425 Ga0451789_0048425_119_457 112
1038 3300041452 Ga0451793_0938620 Ga0451793_0938620_54_392 112
1039 3300041456 Ga0451795_0181400 Ga0451795_0181400_117_455 112
1040 3300041456 Ga0451795_0262903 Ga0451795_0262903_211_552 112
1041 3300041460 Ga0451802_0012644 Ga0451802_0012644_185_523 112
1042 3300041460 Ga0451802_1786781 Ga0451802_1786781_102_440 112
1043 3300041486 Ga0451807_1450121 Ga0451807_1450121_370_708 112
1044 3300041494 Ga0451837_0416935 Ga0451837_0416935_171_509 112
1045 3300041496 Ga0451839_0458029 Ga0451839_0458029_47_385 112
1046 3300041498 Ga0451841_0462125 Ga0451841_0462125_161_499 112
1047 3300041498 Ga0451841_0883188 Ga0451841_0883188_288_626 112
1048 3300041509 Ga0451843_0500007 Ga0451843_0500007_1804_2142 112
1049 3300041511 Ga0451855_1137734 Ga0451855_1137734_57_395 112
1050 3300041512 Ga0451853_1377382 Ga0451853_1377382_214_552 112
1051 3300041512 Ga0451853_2288329 Ga0451853_2288329_166_504 112
1052 3300042004 Ga0439445_0014698 Ga0439445_0014698_611_1003 112
1053 3300042006 Ga0439432_007407 Ga0439432_007407_619_957 112
1054 3300042007 Ga0439449_0017784 Ga0439449_0017784_704_1096 112
1055 3300042007 Ga0439449_0057595 Ga0439449_0057595_241_579 112
1056 3300042010 Ga0439452_037293 Ga0439452_037293_672_1010 112
1057 3300042014 Ga0439457_006216 Ga0439457_006216_1634_2026 112
1058 3300042015 Ga0439462_0001718 Ga0439462_0001718_1257_1649 112
1059 3300042015 Ga0439462_0057892 Ga0439462_0057892_268_606 112
1060 3300042435 Ga0439434_0068503 Ga0439434_0068503_753_1091 112
1061 3300042438 Ga0439459_0223947 Ga0439459_0223947_135_473 112
1062 3300042876 Ga0451577_0192413 Ga0451577_0192413_1223_1561 112
1063 3300044712 Ga0453684_0066899 Ga0453684_0066899_1321_1659 112
1064 3300044901 Ga0466960_0008210 Ga0466960_0008210_34_372 112
1065 3300045051 Ga0451576_2035645 Ga0451576_2035645_141_479 112
1066 3300045976 Ga0466967_0272865 Ga0466967_0272865_38_376 112
1067 3300045976 Ga0466967_0606373 Ga0466967_0606373_234_572 112
1068 3300046455 Ga0495603_0066211 Ga0495603_0066211_314_652 112
1069 3300046455 Ga0495603_0102592 Ga0495603_0102592_300_638 112
1070 3300046455 Ga0495603_0306184 Ga0495603_0306184_479_817 112
1071 3300046455 Ga0495603_0499510 Ga0495603_0499510_263_601 112
1072 3300046459 Ga0495629_0123477 Ga0495629_0123477_1377_1715 112
1073 3300046459 Ga0495629_0277441 Ga0495629_0277441_432_770 112
1074 3300046460 Ga0495638_0048881 Ga0495638_0048881_951_1289 112
1075 3300046461 Ga0495641_0124434 Ga0495641_0124434_778_1116 112
1076 3300046461 Ga0495641_0245869 Ga0495641_0245869_432_770 112
1077 3300046461 Ga0495641_0276304 Ga0495641_0276304_377_715 112
1078 3300046461 Ga0495641_0538751 Ga0495641_0538751_50_388 112
1079 3300046463 Ga0495653_0607863 Ga0495653_0607863_259_597 112
1080 3300046472 Ga0495580_0068995 Ga0495580_0068995_1849_2187 112
1081 3300046472 Ga0495580_0953227 Ga0495580_0953227_124_462 112
1082 3300046473 Ga0495582_0238331 Ga0495582_0238331_662_1000 112
1083 3300046473 Ga0495582_0390489 Ga0495582_0390489_451_789 112
1084 3300046473 Ga0495582_0563126 Ga0495582_0563126_82_420 112
1085 3300046473 Ga0495582_0774064 Ga0495582_0774064_168_506 112
1086 3300046475 Ga0495639_0015183 Ga0495639_0015183_1860_2198 112
1087 3300046475 Ga0495639_0064913 Ga0495639_0064913_820_1158 112
1088 3300046475 Ga0495639_0294519 Ga0495639_0294519_393_731 112
1089 3300046514 Ga0495618_0297807 Ga0495618_0297807_645_983 112
1090 3300046517 Ga0495630_0342084 Ga0495630_0342084_245_586 112
1091 3300046517 Ga0495630_0531377 Ga0495630_0531377_491_829 112
1092 3300046517 Ga0495630_0672644 Ga0495630_0672644_391_729 112
1093 3300046525 Ga0495663_0018871 Ga0495663_0018871_1539_1877 112
1094 3300046525 Ga0495663_0090410 Ga0495663_0090410_29_367 112
1095 3300046533 Ga0495640_0822817 Ga0495640_0822817_34_372 112
1096 3300046535 Ga0495586_0316555 Ga0495586_0316555_278_616 112
1097 3300046543 Ga0495645_0091479 Ga0495645_0091479_48_386 112
1098 3300046615 Ga0495656_0014399 Ga0495656_0014399_1803_2141 112
1099 3300046615 Ga0495656_0054619 Ga0495656_0054619_652_990 112
1100 3300046616 Ga0495668_0002220 Ga0495668_0002220_13619_13957 112
1101 3300046663 Ga0495635_0093830 Ga0495635_0093830_1413_1751 112
1102 3300046663 Ga0495635_0458871 Ga0495635_0458871_260_601 112
1103 3300046664 Ga0495659_0078425 Ga0495659_0078425_105_443 112
1104 3300046681 Ga0495647_0004042 Ga0495647_0004042_2800_3138 112
1105 3300046681 Ga0495647_0093151 Ga0495647_0093151_866_1204 112
1106 3300046683 Ga0495658_0017764 Ga0495658_0017764_1295_1633 112
1107 3300046683 Ga0495658_0121517 Ga0495658_0121517_738_1076 112
1108 3300046683 Ga0495658_0512428 Ga0495658_0512428_409_747 112
1109 3300046683 Ga0495658_0748182 Ga0495658_0748182_24_362 112
1110 3300046689 Ga0495613_0149419 Ga0495613_0149419_545_883 112
1111 3300046689 Ga0495613_0442118 Ga0495613_0442118_417_755 112
1112 3300046690 Ga0495624_0138992 Ga0495624_0138992_1138_1476 112
1113 3300046809 Ga0495600_0204295 Ga0495600_0204295_882_1220 112
1114 3300046809 Ga0495600_0322823 Ga0495600_0322823_12_350 112
1115 3300046809 Ga0495600_0755611 Ga0495600_0755611_220_558 112
1116 3300047315 Ga0495581_0153104 Ga0495581_0153104_931_1269 112
1117 3300047318 Ga0495636_0000737 Ga0495636_0000737_2941_3279 112
1118 3300047319 Ga0495674_0778352 Ga0495674_0778352_212_550 112
1119 3300047319 Ga0495674_1192807 Ga0495674_1192807_84_422 112
1120 3300047321 Ga0495676_0177492 Ga0495676_0177492_1139_1477 112
1121 3300047322 Ga0495680_0069330 Ga0495680_0069330_885_1223 112
1122 3300047322 Ga0495680_0545177 Ga0495680_0545177_405_743 112
1123 3300047322 Ga0495680_0699847 Ga0495680_0699847_249_587 112
1124 3300047322 Ga0495680_0862077 Ga0495680_0862077_111_452 112
1125 3300047322 Ga0495680_1039112 Ga0495680_1039112_54_395 112
1126 3300047445 Ga0495677_0372904 Ga0495677_0372904_195_533 112
1127 3300047447 Ga0495685_123213 Ga0495685_123213_73_411 112
1128 3300047471 Ga0495684_0404789 Ga0495684_0404789_486_824 112
1129 3300048090 Ga0495615_0123734 Ga0495615_0123734_227_565 112
1130 3300048903 Ga0496100_0017223 Ga0496100_0017223_2844_3182 112
1131 3300048903 Ga0496100_0112917 Ga0496100_0112917_1174_1512 112
1132 3300048903 Ga0496100_0454616 Ga0496100_0454616_224_562 112
1133 3300048903 Ga0496100_0945288 Ga0496100_0945288_21_359 112
1134 3300048904 Ga0496101_0022651 Ga0496101_0022651_1491_1829 112
1135 3300048904 Ga0496101_0101460 Ga0496101_0101460_600_962 112
1136 3300048904 Ga0496101_0118636 Ga0496101_0118636_461_799 112
1137 3300048904 Ga0496101_0467569 Ga0496101_0467569_609_947 112
1138 3300048904 Ga0496101_0539321 Ga0496101_0539321_116_454 112
1139 3300048904 Ga0496101_1003099 Ga0496101_1003099_76_414 112
1140 3300048905 Ga0496102_0002523 Ga0496102_0002523_119_457 112
1141 3300048905 Ga0496102_0014211 Ga0496102_0014211_2685_3023 112
1142 3300048905 Ga0496102_0026145 Ga0496102_0026145_2637_2975 112
1143 3300048905 Ga0496102_0047874 Ga0496102_0047874_3264_3602 112
1144 3300048905 Ga0496102_0101380 Ga0496102_0101380_83_421 112
1145 3300048905 Ga0496102_0414857 Ga0496102_0414857_137_502 112
1146 3300048905 Ga0496102_1195471 Ga0496102_1195471_303_641 112
1147 3300048905 Ga0496102_1898216 Ga0496102_1898216_112_450 112
1148 3300048906 Ga0496103_0014389 Ga0496103_0014389_3251_3646 112
1149 3300048906 Ga0496103_0051737 Ga0496103_0051737_491_829 112
1150 3300048906 Ga0496103_0125082 Ga0496103_0125082_1239_1577 112
1151 3300048907 Ga0496104_0011522 Ga0496104_0011522_5629_5982 112
1152 3300048907 Ga0496104_0021521 Ga0496104_0021521_4218_4556 112
1153 3300048907 Ga0496104_0035075 Ga0496104_0035075_1750_2088 112
1154 3300048907 Ga0496104_0059896 Ga0496104_0059896_1277_1615 112
1155 3300048907 Ga0496104_0091472 Ga0496104_0091472_2112_2450 112
1156 3300048907 Ga0496104_0205045 Ga0496104_0205045_1378_1716 112
1157 3300048907 Ga0496104_0340483 Ga0496104_0340483_100_462 112
1158 3300048907 Ga0496104_0589094 Ga0496104_0589094_512_850 112
1159 3300048907 Ga0496104_1100843 Ga0496104_1100843_156_494 112
1160 3300048908 Ga0496105_0000093 Ga0496105_0000093_1997_2335 112
1161 3300048908 Ga0496105_0011016 Ga0496105_0011016_3752_4090 112
1162 3300048908 Ga0496105_0065159 Ga0496105_0065159_80_433 112
1163 3300048908 Ga0496105_0079322 Ga0496105_0079322_870_1208 112
1164 3300048908 Ga0496105_0160368 Ga0496105_0160368_143_481 112
1165 3300048908 Ga0496105_0184867 Ga0496105_0184867_1216_1554 112
1166 3300048908 Ga0496105_0429277 Ga0496105_0429277_496_834 112
1167 3300048909 Ga0496106_0037656 Ga0496106_0037656_1546_1884 112
1168 3300048909 Ga0496106_0535048 Ga0496106_0535048_274_612 112
1169 3300048909 Ga0496106_0688249 Ga0496106_0688249_418_756 112
1170 3300048909 Ga0496106_0884300 Ga0496106_0884300_288_641 112
1171 3300048909 Ga0496106_1522924 Ga0496106_1522924_113_451 112
1172 3300048910 Ga0496107_0061581 Ga0496107_0061581_2367_2705 112
1173 3300048911 Ga0496108_0092806 Ga0496108_0092806_754_1092 112
1174 3300048911 Ga0496108_0115049 Ga0496108_0115049_886_1239 112
1175 3300048911 Ga0496108_0145395 Ga0496108_0145395_1243_1581 112
1176 3300048911 Ga0496108_0986043 Ga0496108_0986043_278_616 112
1177 3300048911 Ga0496108_1090210 Ga0496108_1090210_105_443 112
1178 3300048911 Ga0496108_1165399 Ga0496108_1165399_44_382 112
1179 3300048912 Ga0496109_0006477 Ga0496109_0006477_1170_1523 112
1180 3300048912 Ga0496109_0110257 Ga0496109_0110257_170_508 112
1181 3300048912 Ga0496109_0154790 Ga0496109_0154790_1234_1572 112
1182 3300048912 Ga0496109_0218292 Ga0496109_0218292_717_1055 112
1183 3300048912 Ga0496109_0599588 Ga0496109_0599588_79_417 112
1184 3300048912 Ga0496109_0988008 Ga0496109_0988008_258_623 112
1185 3300048912 Ga0496109_0997018 Ga0496109_0997018_349_687 112
1186 3300048913 Ga0496110_0019788 Ga0496110_0019788_472_810 112
1187 3300048913 Ga0496110_0087106 Ga0496110_0087106_1806_2144 112
1188 3300048913 Ga0496110_0123611 Ga0496110_0123611_1739_2077 112
1189 3300048913 Ga0496110_0257166 Ga0496110_0257166_133_471 112
1190 3300048913 Ga0496110_0457117 Ga0496110_0457117_145_483 112
1191 3300048913 Ga0496110_0582361 Ga0496110_0582361_535_897 112
1192 3300048913 Ga0496110_0828153 Ga0496110_0828153_301_639 112
1193 3300048913 Ga0496110_1092236 Ga0496110_1092236_56_394 112
1194 3300048913 Ga0496110_1113678 Ga0496110_1113678_298_639 112
1195 3300048914 Ga0496111_0012225 Ga0496111_0012225_2523_2861 112
1196 3300048914 Ga0496111_0014093 Ga0496111_0014093_2542_2880 112
1197 3300048915 Ga0496112_0013357 Ga0496112_0013357_3616_3969 112
1198 3300048915 Ga0496112_0035217 Ga0496112_0035217_2952_3314 112
1199 3300048915 Ga0496112_0101325 Ga0496112_0101325_935_1300 112
1200 3300048916 Ga0496113_0002034 Ga0496113_0002034_774_1127 112
1201 3300048916 Ga0496113_0227730 Ga0496113_0227730_1106_1444 112
1202 3300048917 Ga0496114_0008479 Ga0496114_0008479_5298_5636 112
1203 3300048917 Ga0496114_0017914 Ga0496114_0017914_2401_2739 112
1204 3300048917 Ga0496114_0106393 Ga0496114_0106393_1718_2056 112
1205 3300048917 Ga0496114_0107510 Ga0496114_0107510_862_1200 112
1206 3300048917 Ga0496114_0162541 Ga0496114_0162541_765_1103 112
1207 3300048917 Ga0496114_0298336 Ga0496114_0298336_1055_1393 112
1208 3300048917 Ga0496114_0336745 Ga0496114_0336745_749_1087 112
1209 3300048917 Ga0496114_0564554 Ga0496114_0564554_186_524 112
1210 3300048917 Ga0496114_0575057 Ga0496114_0575057_608_946 112
1211 3300048918 Ga0496115_0258610 Ga0496115_0258610_84_422 112
1212 3300048918 Ga0496115_1123948 Ga0496115_1123948_146_484 112
1213 3300048921 Ga0496118_0003924 Ga0496118_0003924_249_587 112
1214 3300048929 Ga0496126_0442804 Ga0496126_0442804_19_357 112
1215 3300049530 Ga0501314_028898 Ga0501314_028898_244_582 112
1216 3300049531 Ga0501315_059501 Ga0501315_059501_110_448 112
1217 3300049568 Ga0501031_0022036 Ga0501031_0022036_576_914 112
1218 3300049568 Ga0501031_0077430 Ga0501031_0077430_1647_1988 112
1219 3300049568 Ga0501031_0422046 Ga0501031_0422046_228_566 112
1220 3300049568 Ga0501031_0786072 Ga0501031_0786072_79_417 112
1221 3300049568 Ga0501031_0811625 Ga0501031_0811625_69_410 112
1222 3300049570 Ga0501033_0069737 Ga0501033_0069737_694_1035 112
1223 3300049570 Ga0501033_1101516 Ga0501033_1101516_71_409 112
1224 3300049571 Ga0501034_0963015 Ga0501034_0963015_10_348 112
1225 3300049572 Ga0501036_0033281 Ga0501036_0033281_2650_2988 112
1226 3300049572 Ga0501036_0066082 Ga0501036_0066082_130_468 112
1227 3300049572 Ga0501036_0087561 Ga0501036_0087561_1092_1430 112
1228 3300049572 Ga0501036_0129136 Ga0501036_0129136_625_966 112
1229 3300049572 Ga0501036_0189321 Ga0501036_0189321_105_443 112
1230 3300049573 Ga0501037_0096698 Ga0501037_0096698_1224_1562 112
1231 3300049574 Ga0501038_0671360 Ga0501038_0671360_136_474 112
1232 3300049575 Ga0501039_0038137 Ga0501039_0038137_2111_2452 112
1233 3300049575 Ga0501039_0092526 Ga0501039_0092526_1148_1486 112
1234 3300049575 Ga0501039_0586062 Ga0501039_0586062_67_405 112
1235 3300049576 Ga0501040_0025352 Ga0501040_0025352_1989_2327 112
1236 3300049576 Ga0501040_0052625 Ga0501040_0052625_1835_2176 112
1237 3300049576 Ga0501040_0189872 Ga0501040_0189872_10_348 112
1238 3300049576 Ga0501040_0880828 Ga0501040_0880828_247_585 112
1239 3300049576 Ga0501040_1093674 Ga0501040_1093674_71_409 112
1240 3300049577 Ga0501041_0017307 Ga0501041_0017307_958_1296 112
1241 3300049577 Ga0501041_0034669 Ga0501041_0034669_2497_2835 112
1242 3300049577 Ga0501041_0585753 Ga0501041_0585753_47_385 112
1243 3300049578 Ga0501042_0017993 Ga0501042_0017993_727_1068 112
1244 3300049578 Ga0501042_0366331 Ga0501042_0366331_684_1022 112
1245 3300049578 Ga0501042_0387232 Ga0501042_0387232_404_742 112
1246 3300049578 Ga0501042_1408528 Ga0501042_1408528_35_373 112
1247 3300049579 Ga0501043_0002433 Ga0501043_0002433_9855_10193 112
1248 3300049579 Ga0501043_0446569 Ga0501043_0446569_13_351 112
1249 3300049580 Ga0501046_0248181 Ga0501046_0248181_400_738 112
1250 3300049580 Ga0501046_0595739 Ga0501046_0595739_270_608 112
1251 3300049581 Ga0501047_0056717 Ga0501047_0056717_1582_1920 112
1252 3300049581 Ga0501047_0080871 Ga0501047_0080871_821_1162 112
1253 3300049582 Ga0501048_0021837 Ga0501048_0021837_1959_2297 112
1254 3300049582 Ga0501048_0023263 Ga0501048_0023263_1957_2298 112
1255 3300049582 Ga0501048_0126426 Ga0501048_0126426_148_486 112
1256 3300049582 Ga0501048_1221988 Ga0501048_1221988_79_417 112
1257 3300049583 Ga0501067_0017974 Ga0501067_0017974_45_386 112
1258 3300049583 Ga0501067_0078234 Ga0501067_0078234_65_403 112
1259 3300049583 Ga0501067_0257350 Ga0501067_0257350_582_920 112
1260 3300049583 Ga0501067_0802052 Ga0501067_0802052_114_452 112
1261 3300049584 Ga0501068_0314003 Ga0501068_0314003_284_625 112
1262 3300049585 Ga0501069_0036372 Ga0501069_0036372_1354_1692 112
1263 3300049587 Ga0501071_0004493 Ga0501071_0004493_6775_7116 112
1264 3300049587 Ga0501071_0119000 Ga0501071_0119000_659_997 112
1265 3300049587 Ga0501071_0131328 Ga0501071_0131328_43_381 112
1266 3300049587 Ga0501071_0942044 Ga0501071_0942044_209_547 112
1267 3300049587 Ga0501071_1436483 Ga0501071_1436483_183_521 112
1268 3300049587 Ga0501071_1616005 Ga0501071_1616005_120_458 112
1269 3300049588 Ga0501072_0015466 Ga0501072_0015466_1811_2152 112
1270 3300049588 Ga0501072_0020892 Ga0501072_0020892_481_819 112
1271 3300049588 Ga0501072_0021691 Ga0501072_0021691_2345_2683 112
1272 3300049588 Ga0501072_0095697 Ga0501072_0095697_954_1292 112
1273 3300049588 Ga0501072_0805640 Ga0501072_0805640_221_559 112
1274 3300049588 Ga0501072_1260303 Ga0501072_1260303_97_438 112
1275 3300049589 Ga0501073_0266650 Ga0501073_0266650_728_1066 112
1276 3300049589 Ga0501073_0867191 Ga0501073_0867191_106_444 112
1277 3300049590 Ga0501074_0094434 Ga0501074_0094434_1592_1930 112
1278 3300049590 Ga0501074_0296706 Ga0501074_0296706_157_495 112
1279 3300049590 Ga0501074_0467167 Ga0501074_0467167_169_507 112
1280 3300049591 Ga0501075_0040980 Ga0501075_0040980_725_1063 112
1281 3300049591 Ga0501075_0063619 Ga0501075_0063619_1570_1911 112
1282 3300049591 Ga0501075_0283479 Ga0501075_0283479_476_814 112
1283 3300049591 Ga0501075_0617104 Ga0501075_0617104_324_662 112
1284 3300049592 Ga0501076_0016244 Ga0501076_0016244_5061_5399 112
1285 3300049592 Ga0501076_0546443 Ga0501076_0546443_139_477 112
1286 3300049592 Ga0501076_0564578 Ga0501076_0564578_171_512 112
1287 3300049593 Ga0501077_0199150 Ga0501077_0199150_538_879 112
1288 3300049593 Ga0501077_0627696 Ga0501077_0627696_328_666 112
1289 3300049593 Ga0501077_0680884 Ga0501077_0680884_298_636 112
1290 3300049668 Ga0501233_131170 Ga0501233_131170_162_500 112
1291 3300049741 Ga0501079_0011823 Ga0501079_0011823_122_463 112
1292 3300049741 Ga0501079_0097220 Ga0501079_0097220_1492_1830 112
1293 3300049741 Ga0501079_0238445 Ga0501079_0238445_833_1171 112
1294 3300049741 Ga0501079_0409211 Ga0501079_0409211_36_377 112
1295 3300049741 Ga0501079_0602016 Ga0501079_0602016_339_677 112
1296 3300049742 Ga0501080_0249732 Ga0501080_0249732_757_1095 112
1297 3300049742 Ga0501080_0532856 Ga0501080_0532856_138_479 112
1298 3300049742 Ga0501080_1769455 Ga0501080_1769455_14_352 112
1299 3300049743 Ga0501081_0042676 Ga0501081_0042676_2645_2986 112
1300 3300049743 Ga0501081_0170953 Ga0501081_0170953_875_1213 112
1301 3300049822 Ga0501035_0619261 Ga0501035_0619261_22_360 112
1302 3300049823 Ga0501044_0004942 Ga0501044_0004942_14450_14788 112
1303 3300049824 Ga0501045_0047261 Ga0501045_0047261_2511_2852 112
1304 3300049824 Ga0501045_0051324 Ga0501045_0051324_1482_1820 112
1305 3300049824 Ga0501045_0088902 Ga0501045_0088902_164_502 112
1306 3300049824 Ga0501045_0976161 Ga0501045_0976161_33_371 112
1307 3300050489 nmdc:mga03683_34547_c1 nmdc:mga03683_34547_c1_1251_1589 112
1308 3300050489 nmdc:mga03683_89783_c1 nmdc:mga03683_89783_c1_28_369 112
1309 3300050490 nmdc:mga03n38_441130_c1 nmdc:mga03n38_441130_c1_370_708 112
1310 3300050490 nmdc:mga03n38_58928_c1 nmdc:mga03n38_58928_c1_656_997 112
1311 3300050490 nmdc:mga03n38_757860_c1 nmdc:mga03n38_757860_c1_158_511 112
1312 3300050490 nmdc:mga03n38_9489_c1 nmdc:mga03n38_9489_c1_2160_2498 112
1313 3300050490 nmdc:mga03n38_962247_c1 nmdc:mga03n38_962247_c1_68_406 112
1314 3300050491 nmdc:mga00v17_1029218_c1 nmdc:mga00v17_1029218_c1_158_496 112
1315 3300050491 nmdc:mga00v17_120558_c1 nmdc:mga00v17_120558_c1_926_1267 112
1316 3300050491 nmdc:mga00v17_229031_c1 nmdc:mga00v17_229031_c1_281_619 112
1317 3300050491 nmdc:mga00v17_2601_c1 nmdc:mga00v17_2601_c1_7695_8033 112
1318 3300050491 nmdc:mga00v17_340293_c1 nmdc:mga00v17_340293_c1_213_554 112
1319 3300050491 nmdc:mga00v17_390796_c1 nmdc:mga00v17_390796_c1_239_580 112
1320 3300050491 nmdc:mga00v17_465849_c1 nmdc:mga00v17_465849_c1_399_740 112
1321 3300050491 nmdc:mga00v17_665_c1 nmdc:mga00v17_665_c1_12504_12842 112
1322 3300050491 nmdc:mga00v17_85970_c1 nmdc:mga00v17_85970_c1_734_1072 112
1323 3300050492 nmdc:mga0yw44_100143_c1 nmdc:mga0yw44_100143_c1_969_1310 112
1324 3300050492 nmdc:mga0yw44_116064_c1 nmdc:mga0yw44_116064_c1_363_701 112
1325 3300050492 nmdc:mga0yw44_136706_c2 nmdc:mga0yw44_136706_c2_237_578 112
1326 3300050492 nmdc:mga0yw44_1398_c1 nmdc:mga0yw44_1398_c1_4859_5197 112
1327 3300050492 nmdc:mga0yw44_20263_c1 nmdc:mga0yw44_20263_c1_2156_2494 112
1328 3300050492 nmdc:mga0yw44_23801_c1 nmdc:mga0yw44_23801_c1_2436_2819 112
1329 3300050492 nmdc:mga0yw44_264923_c1 nmdc:mga0yw44_264923_c1_387_728 112
1330 3300050492 nmdc:mga0yw44_266490_c1 nmdc:mga0yw44_266490_c1_255_593 112
1331 3300050492 nmdc:mga0yw44_266629_c1 nmdc:mga0yw44_266629_c1_725_1063 112
1332 3300050492 nmdc:mga0yw44_291750_c1 nmdc:mga0yw44_291750_c1_285_626 112
1333 3300050492 nmdc:mga0yw44_30363_c1 nmdc:mga0yw44_30363_c1_73_411 112
1334 3300050492 nmdc:mga0yw44_350254_c1 nmdc:mga0yw44_350254_c1_597_938 112
1335 3300050492 nmdc:mga0yw44_351579_c1 nmdc:mga0yw44_351579_c1_444_785 112
1336 3300050492 nmdc:mga0yw44_44_c1 nmdc:mga0yw44_44_c1_40049_40387 112
1337 3300050492 nmdc:mga0yw44_5924_c1 nmdc:mga0yw44_5924_c1_2852_3190 112
1338 3300050492 nmdc:mga0yw44_671996_c1 nmdc:mga0yw44_671996_c1_307_645 112
1339 3300050492 nmdc:mga0yw44_78724_c1 nmdc:mga0yw44_78724_c1_805_1143 112
1340 3300050492 nmdc:mga0yw44_890002_c1 nmdc:mga0yw44_890002_c1_12_350 112
1341 3300050493 nmdc:mga0k408_128180_c1 nmdc:mga0k408_128180_c1_754_1092 112
1342 3300050494 nmdc:mga06z11_243384_c1 nmdc:mga06z11_243384_c1_218_556 112
1343 3300050494 nmdc:mga06z11_433103_c1 nmdc:mga06z11_433103_c1_438_779 112
1344 3300050494 nmdc:mga06z11_5925_c1 nmdc:mga06z11_5925_c1_702_1085 112
1345 3300050494 nmdc:mga06z11_87353_c1 nmdc:mga06z11_87353_c1_908_1249 112
1346 3300050495 nmdc:mga04h51_10254_c1 nmdc:mga04h51_10254_c1_2137_2475 112
1347 3300050495 nmdc:mga04h51_162539_c1 nmdc:mga04h51_162539_c1_196_537 112
1348 3300050495 nmdc:mga04h51_240725_c1 nmdc:mga04h51_240725_c1_262_600 112
1349 3300050495 nmdc:mga04h51_305950_c1 nmdc:mga04h51_305950_c1_180_521 112
1350 3300050495 nmdc:mga04h51_380778_c1 nmdc:mga04h51_380778_c1_178_555 112
1351 3300050507 nmdc:mga05p37_1308842_c1 nmdc:mga05p37_1308842_c1_176_514 112
1352 3300050507 nmdc:mga05p37_557454_c1 nmdc:mga05p37_557454_c1_472_810 112
1353 3300050508 nmdc:mga09592_800048_c1 nmdc:mga09592_800048_c1_114_452 112
1354 3300050511 nmdc:mga08y16_393274_c1 nmdc:mga08y16_393274_c1_502_840 112
1355 3300050511 nmdc:mga08y16_880295_c1 nmdc:mga08y16_880295_c1_523_864 112
1356 3300050513 nmdc:mga0rr50_1129583_c1 nmdc:mga0rr50_1129583_c1_69_407 112
1357 3300053080 Ga0500635_0006792 Ga0500635_0006792_396_737 112
1358 3300053080 Ga0500635_0320462 Ga0500635_0320462_99_521 112
1359 3300053084 Ga0495595_0279429 Ga0495595_0279429_187_525 112
1360 3300053084 Ga0495595_0336813 Ga0495595_0336813_343_681 112
1361 3300053084 Ga0495595_0705211 Ga0495595_0705211_139_477 112
1362 3300053085 Ga0495619_0263881 Ga0495619_0263881_623_961 112
1363 3300053085 Ga0495619_0773339 Ga0495619_0773339_43_381 112
1364 3300053088 Ga0500644_0375618 Ga0500644_0375618_223_564 112
1365 3300053090 Ga0500646_0026544 Ga0500646_0026544_813_1154 112
1366 3300053090 Ga0500646_0122618 Ga0500646_0122618_339_677 112
1367 3300053092 Ga0500583_0139854 Ga0500583_0139854_96_518 112
1368 3300053092 Ga0500583_0197939 Ga0500583_0197939_98_436 112
1369 3300053094 Ga0500566_0000532 Ga0500566_0000532_17649_17987 112
1370 3300053094 Ga0500566_0120764 Ga0500566_0120764_203_541 112
1371 3300053129 Ga0500628_210638 Ga0500628_210638_73_411 112
1372 3300053133 Ga0500655_036960 Ga0500655_036960_34_456 112
1373 3300053155 Ga0500620_031846 Ga0500620_031846_1158_1496 112
1374 3300054114 Ga0501084_0271980 Ga0501084_0271980_991_1329 112
1375 3300054114 Ga0501084_0326735 Ga0501084_0326735_875_1216 112
1376 3300054114 Ga0501084_1328679 Ga0501084_1328679_139_477 112
1377 3300059490 Ga0587066_108309 Ga0587066_108309_14_352 112
1378 3300059493 Ga0587077_171293 Ga0587077_171293_227_565 112
1379 3300059504 Ga0587082_033158 Ga0587082_033158_534_872 112
1380 3300059504 Ga0587082_037518 Ga0587082_037518_524_862 112
1381 3300059505 Ga0587083_0019282 Ga0587083_0019282_723_1061 112
1382 3300059507 Ga0587086_020163 Ga0587086_020163_106_444 112
1383 3300059508 Ga0587088_133956 Ga0587088_133956_233_571 112
1384 3300059604 Ga0587098_077308 Ga0587098_077308_199_537 112
1385 3300059605 Ga0587106_136637 Ga0587106_136637_147_485 112
1386 3300059623 Ga0587101_081851 Ga0587101_081851_241_579 112
1387 3300059630 Ga0587128_097622 Ga0587128_097622_241_579 112
1388 3300059641 Ga0587068_037772 Ga0587068_037772_513_851 112
1389 3300059641 Ga0587068_090856 Ga0587068_090856_259_597 112
1390 3300059643 Ga0587072_044446 Ga0587072_044446_41_379 112
1391 3300059645 Ga0587076_189371 Ga0587076_189371_144_482 112
1392 3300059647 Ga0587079_088058 Ga0587079_088058_22_360 112
1393 3300059647 Ga0587079_176608 Ga0587079_176608_24_362 112
1394 3300059652 Ga0587107_022277 Ga0587107_022277_516_854 112
1395 3300059654 Ga0587110_009122 Ga0587110_009122_18_356 112
1396 3300060353 Ga0501082_0197947 Ga0501082_0197947_962_1303 112
1397 3300060353 Ga0501082_0862328 Ga0501082_0862328_39_380 112
1398 3300061734 Ga0530510_0008292 Ga0530510_0008292_2166_2507 112
1399 3300061734 Ga0530510_0298484 Ga0530510_0298484_160_498 112
1400 3300061734 Ga0530510_0937047 Ga0530510_0937047_166_504 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

29

134

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9983 1 112
3lf0-assembly1.cif.gz_A crystal structure of the atp bound mycobacterium tuberculosis nitrogen regulatory pii protein 0.9899 2 112
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9876 1 112
2xzw-assembly2.cif.gz_E structure of pii from synechococcus elongatus in complex with 2- oxoglutarate at low 2-og concentrations 0.9835 1 111
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9829 1 112
ID Description Score Start End Superfamily
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9735 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9687 1 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.959 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9553 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9097 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A7Y8HQB2-F1-model_v4 P-II family nitrogen regulator 0.9768 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-W0I613-F1-model_v4 Putative Nitrogen regulatory protein P-II 0.976 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2N3F8I2-F1-model_v4 Transcriptional regulator 0.9757 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0009399
GO:0030234
AF-A0A181C720-F1-model_v4 deleted 0.9755 2 112
AF-A0A7G9KTM8-F1-model_v4 deleted 0.9745 2 112

Feature Viewer

pLDDT pTM Quality
89.41 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map