F493697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1403 | 517 | 2806 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0010414|Ga0501031_0010414_4927_5988 |
| Length | 344 |
| Sequence | LASRTREGIHHVVPAKAGTHFAFAETIRSKMDPGLRRDDDVVGFCANPESRIFSRMKLWSLQGNSQRLDGGAMFGNAPRAMWEKWIAPDEDNRIPLACRCLLAEGLNGQNVLFETGIGAFFEPKLRERYGVVESRHVLLDSLVEAGFSHEDIDAVVVSHLHFDHAGGLLAEWKEGSPPRLLFPNATYLVGEECWQRALNPHPRDRASFIPELQPLLEASGRLERVWGAHSPTLGECVRFSYSNGHTPGLMLSEISPEGGEGGIVFCADLIPGRPWVHLPVTMGYDRYPELLIDEKKAFLEDKLARGVRLFFTHDAGCAIAHVARDAKGRFSTTDERAELIGEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 146 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 147 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 244 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 245 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 246 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 252 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 263 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 277 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 278 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 279 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 287 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 288 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 296 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 299 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 307 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 308 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 309 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 373 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 374 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 375 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 376 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 377 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 378 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 379 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 382 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 384 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 407 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 408 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 410 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 431 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 435 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 441 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 442 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 443 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 444 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 445 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 446 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 447 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 448 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 449 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 450 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 451 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 452 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 453 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 454 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 455 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 456 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 457 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 458 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 459 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 460 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 461 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 462 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 463 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 464 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 465 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 466 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 467 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 468 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 469 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 470 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 471 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 472 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 473 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 474 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 475 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 476 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 477 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 478 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 479 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 480 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 481 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 482 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 483 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 484 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 485 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 486 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 487 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 488 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 489 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 490 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 491 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 492 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 493 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 494 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 495 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 496 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 497 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 498 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 499 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 500 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 501 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 502 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 503 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 504 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 505 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 506 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 507 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 508 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 509 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 510 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 511 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 512 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 513 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 514 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 515 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 516 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 517 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.16 |
| Metatranscriptomes | 0.36 |
| Isolates | 5.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.07 |
| Bulb | 0 |
| Endosphere | 13.54 |
| Nodule | 0.07 |
| Rhizoplane | 3.14 |
| Rhizosphere | 69.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0010414 | 3300049568 | Bacteria | 6055 |
| 2 | SwRhRL2b_contig_3686161 | 2162886007 | Bacteria | 4716 |
| 3 | JGI24736J21556_1011109 | 3300001904 | Bacteria | 1467 |
| 4 | JGI24741J21665_1000813 | 3300001915 | Bacteria | 9386 |
| 5 | JGI24741J21665_1006639 | 3300001915 | Bacteria | 2306 |
| 6 | JGI24740J21852_10000219 | 3300001979 | Bacteria | 24169 |
| 7 | JGI24739J22299_10000243 | 3300001989 | Bacteria | 18407 |
| 8 | JGI24737J22298_10000669 | 3300001990 | Bacteria | 12109 |
| 9 | JGI24737J22298_10013681 | 3300001990 | Bacteria | 2638 |
| 10 | JGI24738J21930_10000133 | 3300002075 | Bacteria | 18136 |
| 11 | JGI25156J39149_1004682 | 3300002705 | Bacteria | 4110 |
| 12 | JGI25156J39149_1019717 | 3300002705 | Bacteria | 1207 |
| 13 | JGI25156J39149_1019783 | 3300002705 | Bacteria | 1203 |
| 14 | JGI25162J39368_1000124 | 3300002737 | Bacteria | 84810 |
| 15 | JGI25162J39368_1001252 | 3300002737 | Bacteria | 14525 |
| 16 | JGI25162J39368_1002606 | 3300002737 | Bacteria | 6755 |
| 17 | JGI25162J39368_1002830 | 3300002737 | Bacteria | 6062 |
| 18 | JGI25154J39366_1004567 | 3300002738 | Bacteria | 2443 |
| 19 | JGI25157J39369_1000047 | 3300002741 | Bacteria | 118398 |
| 20 | JGI25157J39369_1000465 | 3300002741 | Bacteria | 25507 |
| 21 | JGI25157J39369_1000622 | 3300002741 | Bacteria | 20045 |
| 22 | JGI25157J39369_1001028 | 3300002741 | Bacteria | 12867 |
| 23 | JGI25157J39369_1010638 | 3300002741 | Bacteria | 1207 |
| 24 | JGI25157J39369_1010677 | 3300002741 | Bacteria | 1203 |
| 25 | JGI25163J39215_1000218 | 3300002771 | Bacteria | 21350 |
| 26 | JGI25164J39214_1000134 | 3300002772 | Bacteria | 71350 |
| 27 | JGI25164J39214_1000196 | 3300002772 | Bacteria | 51730 |
| 28 | JGI25164J39214_1000436 | 3300002772 | Bacteria | 22682 |
| 29 | JGI25164J39214_1000438 | 3300002772 | Bacteria | 22660 |
| 30 | JGI25164J39214_1000955 | 3300002772 | Bacteria | 9300 |
| 31 | JGI25164J39214_1001334 | 3300002772 | Bacteria | 6107 |
| 32 | JGI25152J39213_1002119 | 3300002773 | Bacteria | 7782 |
| 33 | JGI25150J39212_1001176 | 3300002774 | Bacteria | 7781 |
| 34 | JGI25151J46595_10000257 | 3300003187 | Bacteria | 62308 |
| 35 | JGI25151J46595_10000558 | 3300003187 | Bacteria | 33861 |
| 36 | JGI25151J46595_10035027 | 3300003187 | Bacteria | 1912 |
| 37 | JGI25151J46595_10067063 | 3300003187 | Bacteria | 1108 |
| 38 | JGI25165J46597_1000119 | 3300003214 | Bacteria | 137181 |
| 39 | JGI25165J46597_1000223 | 3300003214 | Bacteria | 79270 |
| 40 | JGI25165J46597_1000275 | 3300003214 | Bacteria | 66238 |
| 41 | JGI25165J46597_1002075 | 3300003214 | Bacteria | 7462 |
| 42 | JGI25153J46596_10000334 | 3300003215 | Bacteria | 33861 |
| 43 | rootH1_10057363 | 3300003316 | Bacteria | 3556 |
| 44 | rootH2_10023810 | 3300003320 | Bacteria | 18625 |
| 45 | rootH1_10187769 | 3300003323 | Bacteria | 2258 |
| 46 | Ga0006562J51391_1003759 | 3300003578 | Bacteria | 15850 |
| 47 | Ga0055538_1002063 | 3300003751 | Bacteria | 3231 |
| 48 | Ga0055539_1001661 | 3300003752 | Bacteria | 3965 |
| 49 | Ga0055533_1001179 | 3300003756 | Bacteria | 7374 |
| 50 | Ga0055533_1001398 | 3300003756 | Bacteria | 6405 |
| 51 | Ga0055525_1000111 | 3300003759 | Bacteria | 127836 |
| 52 | Ga0055527_1000053 | 3300003760 | Bacteria | 100725 |
| 53 | Ga0055527_1000114 | 3300003760 | Bacteria | 57775 |
| 54 | Ga0055535_1000313 | 3300003761 | Bacteria | 49116 |
| 55 | Ga0055535_1000340 | 3300003761 | Bacteria | 46611 |
| 56 | Ga0055535_1000362 | 3300003761 | Bacteria | 43772 |
| 57 | Ga0055535_1000440 | 3300003761 | Bacteria | 38420 |
| 58 | Ga0055535_1000825 | 3300003761 | Bacteria | 22228 |
| 59 | Ga0055535_1001942 | 3300003761 | Bacteria | 8607 |
| 60 | Ga0055542_1000160 | 3300003762 | Bacteria | 84810 |
| 61 | Ga0055542_1000240 | 3300003762 | Bacteria | 63139 |
| 62 | Ga0055542_1000274 | 3300003762 | Bacteria | 57775 |
| 63 | Ga0055542_1000371 | 3300003762 | Bacteria | 46425 |
| 64 | Ga0055542_1000418 | 3300003762 | Bacteria | 41465 |
| 65 | Ga0055542_1000825 | 3300003762 | Bacteria | 22228 |
| 66 | Ga0055529_1000024 | 3300003763 | Bacteria | 305218 |
| 67 | Ga0055529_1000161 | 3300003763 | Bacteria | 92257 |
| 68 | Ga0055529_1000264 | 3300003763 | Bacteria | 62197 |
| 69 | Ga0055529_1000296 | 3300003763 | Bacteria | 57775 |
| 70 | Ga0055526_1000008 | 3300003771 | Bacteria | 300059 |
| 71 | Ga0055526_1001264 | 3300003771 | Bacteria | 18153 |
| 72 | Ga0055537_1000145 | 3300003773 | Bacteria | 53262 |
| 73 | Ga0055537_1000338 | 3300003773 | Bacteria | 32024 |
| 74 | Ga0055524_1000087 | 3300003775 | Bacteria | 116388 |
| 75 | Ga0055524_1016305 | 3300003775 | Bacteria | 2671 |
| 76 | Ga0055536_1001416 | 3300003781 | Bacteria | 14495 |
| 77 | Ga0055536_1007159 | 3300003781 | Bacteria | 5042 |
| 78 | Ga0055536_1007642 | 3300003781 | Bacteria | 4795 |
| 79 | Ga0055536_1017277 | 3300003781 | Bacteria | 2370 |
| 80 | Ga0055534_1000003 | 3300003784 | Bacteria | 300063 |
| 81 | Ga0055534_1000039 | 3300003784 | Bacteria | 104863 |
| 82 | Ga0055528_1000004 | 3300003790 | Bacteria | 285772 |
| 83 | Ga0055528_1000212 | 3300003790 | Bacteria | 49305 |
| 84 | Ga0055530_10000544 | 3300003791 | Bacteria | 32692 |
| 85 | Ga0055530_10001029 | 3300003791 | Bacteria | 22199 |
| 86 | Ga0055530_10001078 | 3300003791 | Bacteria | 21484 |
| 87 | Ga0055531_10007594 | 3300003794 | Bacteria | 5878 |
| 88 | Ga0055531_10011798 | 3300003794 | Bacteria | 4172 |
| 89 | Ga0055531_10017155 | 3300003794 | Bacteria | 3073 |
| 90 | Ga0055531_10029813 | 3300003794 | Bacteria | 1849 |
| 91 | Ga0055531_10052738 | 3300003794 | Bacteria | 1057 |
| 92 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 93 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 94 | Ga0065165_1005309 | 3300005262 | Bacteria | 7330 |
| 95 | Ga0065704_10071155 | 3300005289 | Bacteria | 12813 |
| 96 | Ga0065704_10071748 | 3300005289 | Bacteria | 10022 |
| 97 | Ga0065704_10103241 | 3300005289 | Bacteria | 2178 |
| 98 | Ga0065704_10174745 | 3300005289 | Bacteria | 1270 |
| 99 | Ga0065704_10182412 | 3300005289 | Bacteria | 1230 |
| 100 | Ga0065704_10245209 | 3300005289 | Bacteria | 1004 |
| 101 | Ga0065715_10101077 | 3300005293 | Bacteria | 3239 |
| 102 | Ga0065715_10110041 | 3300005293 | Bacteria | 2632 |
| 103 | Ga0070658_10058881 | 3300005327 | Bacteria | 3128 |
| 104 | Ga0070658_10255056 | 3300005327 | Bacteria | 1488 |
| 105 | Ga0070676_10219546 | 3300005328 | Bacteria | 1255 |
| 106 | Ga0070683_100041294 | 3300005329 | Bacteria | 4243 |
| 107 | Ga0070683_100180314 | 3300005329 | Bacteria | 2004 |
| 108 | Ga0070690_100080808 | 3300005330 | Bacteria | 2126 |
| 109 | Ga0070670_100045095 | 3300005331 | Bacteria | 3790 |
| 110 | Ga0070670_100132792 | 3300005331 | Bacteria | 2150 |
| 111 | Ga0070670_100193136 | 3300005331 | Bacteria | 1768 |
| 112 | Ga0070670_100258478 | 3300005331 | Bacteria | 1518 |
| 113 | Ga0070670_100297996 | 3300005331 | Bacteria | 1410 |
| 114 | Ga0070680_100003486 | 3300005336 | Bacteria | 11748 |
| 115 | Ga0070680_100004486 | 3300005336 | Bacteria | 10514 |
| 116 | Ga0070680_100113856 | 3300005336 | Bacteria | 2253 |
| 117 | Ga0070680_100135659 | 3300005336 | Bacteria | 2061 |
| 118 | Ga0070680_100275610 | 3300005336 | Bacteria | 1425 |
| 119 | Ga0070682_100025405 | 3300005337 | Bacteria | 3534 |
| 120 | Ga0070682_100179334 | 3300005337 | Bacteria | 1478 |
| 121 | Ga0068868_100284710 | 3300005338 | Bacteria | 1400 |
| 122 | Ga0070660_100005329 | 3300005339 | Bacteria | 8899 |
| 123 | Ga0070660_100063795 | 3300005339 | Bacteria | 2864 |
| 124 | Ga0070660_100111749 | 3300005339 | Bacteria | 2174 |
| 125 | Ga0070660_100387323 | 3300005339 | Bacteria | 1154 |
| 126 | Ga0070689_100031318 | 3300005340 | Bacteria | 4042 |
| 127 | Ga0070689_100036392 | 3300005340 | Bacteria | 3765 |
| 128 | Ga0070689_100248488 | 3300005340 | Bacteria | 1467 |
| 129 | Ga0070691_10021483 | 3300005341 | Bacteria | 2987 |
| 130 | Ga0070661_100006947 | 3300005344 | Bacteria | 7814 |
| 131 | Ga0070661_100010502 | 3300005344 | Bacteria | 6439 |
| 132 | Ga0070661_100029576 | 3300005344 | Bacteria | 3955 |
| 133 | Ga0070661_100052266 | 3300005344 | Bacteria | 2990 |
| 134 | Ga0070661_100095325 | 3300005344 | Bacteria | 2207 |
| 135 | Ga0070661_100132831 | 3300005344 | Bacteria | 1871 |
| 136 | Ga0070692_10003447 | 3300005345 | Bacteria | 6415 |
| 137 | Ga0070692_10011702 | 3300005345 | Bacteria | 4036 |
| 138 | Ga0070668_100014917 | 3300005347 | Bacteria | 5809 |
| 139 | Ga0070668_100032294 | 3300005347 | Bacteria | 3984 |
| 140 | Ga0070668_100109256 | 3300005347 | Bacteria | 2200 |
| 141 | Ga0070669_100030652 | 3300005353 | Bacteria | 3882 |
| 142 | Ga0070671_100003371 | 3300005355 | Bacteria | 12463 |
| 143 | Ga0070671_100041811 | 3300005355 | Bacteria | 3809 |
| 144 | Ga0070671_100106270 | 3300005355 | Bacteria | 2356 |
| 145 | Ga0070673_100003011 | 3300005364 | Bacteria | 10407 |
| 146 | Ga0070688_100197255 | 3300005365 | Bacteria | 1406 |
| 147 | Ga0070659_100225731 | 3300005366 | Bacteria | 1547 |
| 148 | Ga0070659_100227371 | 3300005366 | Bacteria | 1541 |
| 149 | Ga0070667_100198567 | 3300005367 | Bacteria | 1779 |
| 150 | Ga0070667_100554360 | 3300005367 | Bacteria | 1057 |
| 151 | Ga0070703_10078108 | 3300005406 | Bacteria | 1121 |
| 152 | Ga0070714_100000306 | 3300005435 | Bacteria | 37332 |
| 153 | Ga0070714_100006767 | 3300005435 | Bacteria | 8886 |
| 154 | Ga0070714_100008435 | 3300005435 | Bacteria | 8046 |
| 155 | Ga0070713_100002668 | 3300005436 | Bacteria | 11627 |
| 156 | Ga0070711_100594880 | 3300005439 | Bacteria | 922 |
| 157 | Ga0070694_100360251 | 3300005444 | Bacteria | 1129 |
| 158 | Ga0070708_100087187 | 3300005445 | Bacteria | 2836 |
| 159 | Ga0070663_100004478 | 3300005455 | Bacteria | 8222 |
| 160 | Ga0070663_100005489 | 3300005455 | Bacteria | 7538 |
| 161 | Ga0070663_100006531 | 3300005455 | Bacteria | 7023 |
| 162 | Ga0070663_100046365 | 3300005455 | Bacteria | 3075 |
| 163 | Ga0070663_100100902 | 3300005455 | Bacteria | 2153 |
| 164 | Ga0070678_100013349 | 3300005456 | Bacteria | 5146 |
| 165 | Ga0070678_100031906 | 3300005456 | Bacteria | 3640 |
| 166 | Ga0070662_100037135 | 3300005457 | Bacteria | 3452 |
| 167 | Ga0070662_100112976 | 3300005457 | Bacteria | 2072 |
| 168 | Ga0070681_10000086 | 3300005458 | Bacteria | 70488 |
| 169 | Ga0070681_10000199 | 3300005458 | Bacteria | 46948 |
| 170 | Ga0070681_10003486 | 3300005458 | Bacteria | 14730 |
| 171 | Ga0070681_10028227 | 3300005458 | Bacteria | 5641 |
| 172 | Ga0070681_10031798 | 3300005458 | Bacteria | 5297 |
| 173 | Ga0070681_10039265 | 3300005458 | Bacteria | 4745 |
| 174 | Ga0068867_100042494 | 3300005459 | Bacteria | 3326 |
| 175 | Ga0068867_100046909 | 3300005459 | Bacteria | 3175 |
| 176 | Ga0068867_100182253 | 3300005459 | Bacteria | 1670 |
| 177 | Ga0070685_10003148 | 3300005466 | Bacteria | 8387 |
| 178 | Ga0070698_100000567 | 3300005471 | Bacteria | 39696 |
| 179 | Ga0070679_100000589 | 3300005530 | Bacteria | 30768 |
| 180 | Ga0070679_100000739 | 3300005530 | Bacteria | 28238 |
| 181 | Ga0070679_100013004 | 3300005530 | Bacteria | 7970 |
| 182 | Ga0070679_100027652 | 3300005530 | Bacteria | 5583 |
| 183 | Ga0070679_100033157 | 3300005530 | Bacteria | 5113 |
| 184 | Ga0070679_100117068 | 3300005530 | Bacteria | 2649 |
| 185 | Ga0070679_100453475 | 3300005530 | Bacteria | 1227 |
| 186 | Ga0070684_100010589 | 3300005535 | Bacteria | 7312 |
| 187 | Ga0070684_100018885 | 3300005535 | Bacteria | 5691 |
| 188 | Ga0070684_100129558 | 3300005535 | Bacteria | 2275 |
| 189 | Ga0070684_100432608 | 3300005535 | Bacteria | 1215 |
| 190 | Ga0068853_100008449 | 3300005539 | Bacteria | 8273 |
| 191 | Ga0068853_100014525 | 3300005539 | Bacteria | 6453 |
| 192 | Ga0068853_100036176 | 3300005539 | Bacteria | 4196 |
| 193 | Ga0068853_100043092 | 3300005539 | Bacteria | 3861 |
| 194 | Ga0068853_100197148 | 3300005539 | Bacteria | 1831 |
| 195 | Ga0070672_100034801 | 3300005543 | Bacteria | 3825 |
| 196 | Ga0070672_100059578 | 3300005543 | Bacteria | 3004 |
| 197 | Ga0070686_100027863 | 3300005544 | Bacteria | 3422 |
| 198 | Ga0070696_100003674 | 3300005546 | Bacteria | 10227 |
| 199 | Ga0070696_100007524 | 3300005546 | Bacteria | 7284 |
| 200 | Ga0070696_100026727 | 3300005546 | Bacteria | 3927 |
| 201 | Ga0070693_100008121 | 3300005547 | Bacteria | 5156 |
| 202 | Ga0070693_100016526 | 3300005547 | Bacteria | 3822 |
| 203 | Ga0070693_100020347 | 3300005547 | Bacteria | 3498 |
| 204 | Ga0070693_100022988 | 3300005547 | Bacteria | 3325 |
| 205 | Ga0070665_100000237 | 3300005548 | Bacteria | 91478 |
| 206 | Ga0070665_100015986 | 3300005548 | Bacteria | 7532 |
| 207 | Ga0070665_100055673 | 3300005548 | Bacteria | 3966 |
| 208 | Ga0070665_100116552 | 3300005548 | Bacteria | 2674 |
| 209 | Ga0070665_100129831 | 3300005548 | Unclassified | 2522 |
| 210 | Ga0070665_100181087 | 3300005548 | Bacteria | 2108 |
| 211 | Ga0070665_100200600 | 3300005548 | Bacteria | 1995 |
| 212 | Ga0070665_100254246 | 3300005548 | Bacteria | 1758 |
| 213 | Ga0070665_100262107 | 3300005548 | Bacteria | 1729 |
| 214 | Ga0070665_100285093 | 3300005548 | Bacteria | 1654 |
| 215 | Ga0070704_100023769 | 3300005549 | Bacteria | 4009 |
| 216 | Ga0068855_100003227 | 3300005563 | Bacteria | 19958 |
| 217 | Ga0068855_100015077 | 3300005563 | Bacteria | 9305 |
| 218 | Ga0068855_100016959 | 3300005563 | Bacteria | 8759 |
| 219 | Ga0068855_100022476 | 3300005563 | Bacteria | 7558 |
| 220 | Ga0068855_100037824 | 3300005563 | Bacteria | 5735 |
| 221 | Ga0068855_100094390 | 3300005563 | Bacteria | 3450 |
| 222 | Ga0068855_100210809 | 3300005563 | Bacteria | 2183 |
| 223 | Ga0068855_100468593 | 3300005563 | Bacteria | 1372 |
| 224 | Ga0068855_100485454 | 3300005563 | Bacteria | 1344 |
| 225 | Ga0068855_100492474 | 3300005563 | Bacteria | 1333 |
| 226 | Ga0068855_100670633 | 3300005563 | Bacteria | 1112 |
| 227 | Ga0070664_100291488 | 3300005564 | Bacteria | 1473 |
| 228 | Ga0068857_100000180 | 3300005577 | Bacteria | 40331 |
| 229 | Ga0068857_100005918 | 3300005577 | Bacteria | 10441 |
| 230 | Ga0068857_100111552 | 3300005577 | Bacteria | 2459 |
| 231 | Ga0068857_100291234 | 3300005577 | Bacteria | 1503 |
| 232 | Ga0068854_100003500 | 3300005578 | Bacteria | 9809 |
| 233 | Ga0068854_100014806 | 3300005578 | Bacteria | 5149 |
| 234 | Ga0068854_100014875 | 3300005578 | Bacteria | 5137 |
| 235 | Ga0068854_100015665 | 3300005578 | Bacteria | 5032 |
| 236 | Ga0068854_100016080 | 3300005578 | Bacteria | 4977 |
| 237 | Ga0068856_100000074 | 3300005614 | Bacteria | 94656 |
| 238 | Ga0068856_100001551 | 3300005614 | Bacteria | 24050 |
| 239 | Ga0068856_100012624 | 3300005614 | Bacteria | 8178 |
| 240 | Ga0068856_100021481 | 3300005614 | Bacteria | 6273 |
| 241 | Ga0068856_100130884 | 3300005614 | Bacteria | 2513 |
| 242 | Ga0068856_100137484 | 3300005614 | Bacteria | 2449 |
| 243 | Ga0068856_100153894 | 3300005614 | Bacteria | 2309 |
| 244 | Ga0068856_100194133 | 3300005614 | Bacteria | 2044 |
| 245 | Ga0068856_100400019 | 3300005614 | Bacteria | 1393 |
| 246 | Ga0068856_100508288 | 3300005614 | Bacteria | 1226 |
| 247 | Ga0070702_100036432 | 3300005615 | Bacteria | 2725 |
| 248 | Ga0068852_100002579 | 3300005616 | Bacteria | 12500 |
| 249 | Ga0068852_100007543 | 3300005616 | Bacteria | 7944 |
| 250 | Ga0068852_100085277 | 3300005616 | Bacteria | 2813 |
| 251 | Ga0068859_100119518 | 3300005617 | Bacteria | 2702 |
| 252 | Ga0068864_100012182 | 3300005618 | Bacteria | 7108 |
| 253 | Ga0068864_100028713 | 3300005618 | Bacteria | 4706 |
| 254 | Ga0068864_100062451 | 3300005618 | Bacteria | 3227 |
| 255 | Ga0068864_100110229 | 3300005618 | Bacteria | 2451 |
| 256 | Ga0068864_100215793 | 3300005618 | Bacteria | 1768 |
| 257 | Ga0068866_10039851 | 3300005718 | Bacteria | 2322 |
| 258 | Ga0068861_100013414 | 3300005719 | Bacteria | 5734 |
| 259 | Ga0068861_100232559 | 3300005719 | Bacteria | 1564 |
| 260 | Ga0068851_10001429 | 3300005834 | Bacteria | 10454 |
| 261 | Ga0068851_10023201 | 3300005834 | Bacteria | 3030 |
| 262 | Ga0068863_100009921 | 3300005841 | Bacteria | 9274 |
| 263 | Ga0068863_100383589 | 3300005841 | Bacteria | 1372 |
| 264 | Ga0068858_100025509 | 3300005842 | Bacteria | 5499 |
| 265 | Ga0068858_100055234 | 3300005842 | Bacteria | 3671 |
| 266 | Ga0068860_100027053 | 3300005843 | Bacteria | 5527 |
| 267 | Ga0068860_100106873 | 3300005843 | Bacteria | 2673 |
| 268 | Ga0068860_100694567 | 3300005843 | Bacteria | 1027 |
| 269 | Ga0068862_100063729 | 3300005844 | Bacteria | 3172 |
| 270 | Ga0068862_100242886 | 3300005844 | Bacteria | 1638 |
| 271 | Ga0081540_1007915 | 3300005983 | Bacteria | 7502 |
| 272 | Ga0070717_10644565 | 3300006028 | Bacteria | 961 |
| 273 | Ga0075363_100076865 | 3300006048 | Bacteria | 1821 |
| 274 | Ga0075364_10000156 | 3300006051 | Bacteria | 29962 |
| 275 | Ga0075364_10019911 | 3300006051 | Bacteria | 4217 |
| 276 | Ga0075367_10059460 | 3300006178 | Bacteria | 2276 |
| 277 | Ga0075369_10033668 | 3300006186 | Bacteria | 2172 |
| 278 | Ga0097621_100043633 | 3300006237 | Bacteria | 3615 |
| 279 | Ga0097621_100117910 | 3300006237 | Bacteria | 2249 |
| 280 | Ga0068871_100042261 | 3300006358 | Bacteria | 3658 |
| 281 | Ga0068871_100165152 | 3300006358 | Bacteria | 1895 |
| 282 | Ga0075428_100501872 | 3300006844 | Bacteria | 1298 |
| 283 | Ga0075430_100013708 | 3300006846 | Bacteria | 6911 |
| 284 | Ga0075430_100031816 | 3300006846 | Bacteria | 4478 |
| 285 | Ga0075430_100054394 | 3300006846 | Bacteria | 3368 |
| 286 | Ga0075430_100214799 | 3300006846 | Bacteria | 1596 |
| 287 | Ga0075429_100010231 | 3300006880 | Bacteria | 8121 |
| 288 | Ga0075429_100015423 | 3300006880 | Bacteria | 6621 |
| 289 | Ga0075429_100061688 | 3300006880 | Bacteria | 3267 |
| 290 | Ga0075429_100076760 | 3300006880 | Bacteria | 2910 |
| 291 | Ga0068865_100104168 | 3300006881 | Bacteria | 2082 |
| 292 | Ga0097620_100119518 | 3300006931 | Bacteria | 2702 |
| 293 | Ga0075435_100418708 | 3300007076 | Bacteria | 1153 |
| 294 | Ga0105251_10000597 | 3300009011 | Bacteria | 33077 |
| 295 | Ga0105251_10002239 | 3300009011 | Bacteria | 15416 |
| 296 | Ga0105240_10010415 | 3300009093 | Bacteria | 13068 |
| 297 | Ga0105240_10014636 | 3300009093 | Bacteria | 10704 |
| 298 | Ga0105240_10015324 | 3300009093 | Bacteria | 10429 |
| 299 | Ga0105240_10016233 | 3300009093 | Bacteria | 10092 |
| 300 | Ga0105240_10018380 | 3300009093 | Bacteria | 9388 |
| 301 | Ga0105240_10033449 | 3300009093 | Bacteria | 6642 |
| 302 | Ga0105240_10054441 | 3300009093 | Bacteria | 5014 |
| 303 | Ga0105240_10070725 | 3300009093 | Bacteria | 4316 |
| 304 | Ga0105240_10071884 | 3300009093 | Bacteria | 4277 |
| 305 | Ga0105240_10071908 | 3300009093 | Bacteria | 4277 |
| 306 | Ga0105240_10117179 | 3300009093 | Bacteria | 3212 |
| 307 | Ga0111539_10158205 | 3300009094 | Bacteria | 2651 |
| 308 | Ga0105245_10000070 | 3300009098 | Bacteria | 106666 |
| 309 | Ga0105245_10083402 | 3300009098 | Bacteria | 2926 |
| 310 | Ga0105243_10006063 | 3300009148 | Bacteria | 9346 |
| 311 | Ga0105243_10032254 | 3300009148 | Bacteria | 4046 |
| 312 | Ga0105243_10337839 | 3300009148 | Bacteria | 1378 |
| 313 | Ga0105241_10002770 | 3300009174 | Bacteria | 13130 |
| 314 | Ga0105241_10003714 | 3300009174 | Bacteria | 11334 |
| 315 | Ga0105241_10058772 | 3300009174 | Bacteria | 2953 |
| 316 | Ga0105242_10507439 | 3300009176 | Bacteria | 1148 |
| 317 | Ga0105248_10007576 | 3300009177 | Bacteria | 11925 |
| 318 | Ga0105248_10015012 | 3300009177 | Bacteria | 8526 |
| 319 | Ga0105248_10052738 | 3300009177 | Bacteria | 4564 |
| 320 | Ga0105237_10000214 | 3300009545 | Bacteria | 82061 |
| 321 | Ga0105237_10002033 | 3300009545 | Bacteria | 25718 |
| 322 | Ga0105237_10009902 | 3300009545 | Bacteria | 10175 |
| 323 | Ga0105237_10013212 | 3300009545 | Bacteria | 8660 |
| 324 | Ga0105237_10078674 | 3300009545 | Bacteria | 3287 |
| 325 | Ga0105237_10107835 | 3300009545 | Bacteria | 2777 |
| 326 | Ga0105237_10140310 | 3300009545 | Bacteria | 2411 |
| 327 | Ga0105237_10482908 | 3300009545 | Bacteria | 1245 |
| 328 | Ga0105238_10006412 | 3300009551 | Bacteria | 11707 |
| 329 | Ga0105238_10018096 | 3300009551 | Bacteria | 7164 |
| 330 | Ga0105238_10022371 | 3300009551 | Bacteria | 6443 |
| 331 | Ga0105238_10110718 | 3300009551 | Bacteria | 2726 |
| 332 | Ga0105238_10166892 | 3300009551 | Bacteria | 2177 |
| 333 | Ga0105249_10001773 | 3300009553 | Bacteria | 18808 |
| 334 | Ga0105239_10000390 | 3300010375 | Bacteria | 64410 |
| 335 | Ga0105239_10005287 | 3300010375 | Bacteria | 15171 |
| 336 | Ga0105239_10014113 | 3300010375 | Bacteria | 8868 |
| 337 | Ga0105239_10015740 | 3300010375 | Bacteria | 8371 |
| 338 | Ga0105239_10017459 | 3300010375 | Bacteria | 7936 |
| 339 | Ga0105239_10017493 | 3300010375 | Bacteria | 7928 |
| 340 | Ga0105239_10068068 | 3300010375 | Bacteria | 3913 |
| 341 | Ga0105239_10090965 | 3300010375 | Bacteria | 3367 |
| 342 | Ga0105239_10112753 | 3300010375 | Bacteria | 3015 |
| 343 | Ga0105239_10278980 | 3300010375 | Bacteria | 1881 |
| 344 | Ga0105239_10317488 | 3300010375 | Bacteria | 1756 |
| 345 | Ga0105246_10006015 | 3300011119 | Bacteria | 7409 |
| 346 | Ga0157314_1000578 | 3300012500 | Bacteria | 3382 |
| 347 | Ga0157373_10008009 | 3300013100 | Bacteria | 7857 |
| 348 | Ga0157373_10326188 | 3300013100 | Bacteria | 1093 |
| 349 | Ga0157371_10000487 | 3300013102 | Bacteria | 48309 |
| 350 | Ga0157371_10004532 | 3300013102 | Bacteria | 12102 |
| 351 | Ga0157371_10020289 | 3300013102 | Bacteria | 4892 |
| 352 | Ga0157371_10033680 | 3300013102 | Bacteria | 3679 |
| 353 | Ga0157371_10067563 | 3300013102 | Bacteria | 2530 |
| 354 | Ga0157371_10096244 | 3300013102 | Bacteria | 2098 |
| 355 | Ga0157371_10191613 | 3300013102 | Bacteria | 1464 |
| 356 | Ga0157371_10240522 | 3300013102 | Bacteria | 1302 |
| 357 | Ga0157370_10002080 | 3300013104 | Bacteria | 24511 |
| 358 | Ga0157370_10004104 | 3300013104 | Bacteria | 16885 |
| 359 | Ga0157370_10007609 | 3300013104 | Bacteria | 11764 |
| 360 | Ga0157370_10015272 | 3300013104 | Bacteria | 7813 |
| 361 | Ga0157370_10096201 | 3300013104 | Bacteria | 2778 |
| 362 | Ga0157370_10200547 | 3300013104 | Bacteria | 1851 |
| 363 | Ga0157370_10271467 | 3300013104 | Bacteria | 1567 |
| 364 | Ga0157369_10000030 | 3300013105 | Bacteria | 203569 |
| 365 | Ga0157369_10002243 | 3300013105 | Bacteria | 23244 |
| 366 | Ga0157369_10004626 | 3300013105 | Bacteria | 16172 |
| 367 | Ga0157369_10007366 | 3300013105 | Bacteria | 12667 |
| 368 | Ga0157369_10023335 | 3300013105 | Bacteria | 6891 |
| 369 | Ga0157369_10028763 | 3300013105 | Bacteria | 6147 |
| 370 | Ga0157369_10118046 | 3300013105 | Bacteria | 2816 |
| 371 | Ga0157374_10011293 | 3300013296 | Bacteria | 7724 |
| 372 | Ga0157374_10023184 | 3300013296 | Bacteria | 5546 |
| 373 | Ga0157374_10029499 | 3300013296 | Bacteria | 4969 |
| 374 | Ga0157374_10057421 | 3300013296 | Bacteria | 3635 |
| 375 | Ga0157378_10000158 | 3300013297 | Bacteria | 64291 |
| 376 | Ga0157378_10030642 | 3300013297 | Bacteria | 4752 |
| 377 | Ga0163162_10005297 | 3300013306 | Bacteria | 12452 |
| 378 | Ga0163162_10029820 | 3300013306 | Bacteria | 5401 |
| 379 | Ga0163162_10669708 | 3300013306 | Bacteria | 1161 |
| 380 | Ga0157372_10001156 | 3300013307 | Bacteria | 28529 |
| 381 | Ga0157372_10001163 | 3300013307 | Bacteria | 28496 |
| 382 | Ga0157372_10009901 | 3300013307 | Bacteria | 10139 |
| 383 | Ga0157372_10027403 | 3300013307 | Bacteria | 6204 |
| 384 | Ga0157372_10030221 | 3300013307 | Bacteria | 5924 |
| 385 | Ga0157372_10074640 | 3300013307 | Bacteria | 3824 |
| 386 | Ga0157372_10192432 | 3300013307 | Bacteria | 2363 |
| 387 | Ga0157372_10237659 | 3300013307 | Bacteria | 2113 |
| 388 | Ga0157372_10684087 | 3300013307 | Bacteria | 1194 |
| 389 | Ga0157372_10684788 | 3300013307 | Bacteria | 1193 |
| 390 | Ga0157375_10002329 | 3300013308 | Bacteria | 16411 |
| 391 | Ga0157375_10055851 | 3300013308 | Bacteria | 3895 |
| 392 | Ga0157380_10042102 | 3300014326 | Bacteria | 3568 |
| 393 | Ga0182008_10000143 | 3300014497 | Bacteria | 55118 |
| 394 | Ga0182008_10001870 | 3300014497 | Bacteria | 13704 |
| 395 | Ga0182008_10015447 | 3300014497 | Bacteria | 3984 |
| 396 | Ga0182008_10016411 | 3300014497 | Bacteria | 3847 |
| 397 | Ga0182008_10031878 | 3300014497 | Bacteria | 2650 |
| 398 | Ga0182008_10079886 | 3300014497 | Bacteria | 1609 |
| 399 | Ga0182008_10123506 | 3300014497 | Bacteria | 1288 |
| 400 | Ga0157376_10005593 | 3300014969 | Bacteria | 8795 |
| 401 | Ga0157376_10013924 | 3300014969 | Bacteria | 6015 |
| 402 | Ga0157376_10132292 | 3300014969 | Bacteria | 2228 |
| 403 | Ga0157376_10328088 | 3300014969 | Bacteria | 1457 |
| 404 | Ga0157376_10486794 | 3300014969 | Bacteria | 1210 |
| 405 | Ga0182006_1000148 | 3300015261 | Bacteria | 74813 |
| 406 | Ga0182006_1000208 | 3300015261 | Bacteria | 58504 |
| 407 | Ga0182006_1015497 | 3300015261 | Bacteria | 3267 |
| 408 | Ga0182006_1019226 | 3300015261 | Bacteria | 2877 |
| 409 | Ga0182006_1022687 | 3300015261 | Bacteria | 2606 |
| 410 | Ga0182006_1025756 | 3300015261 | Bacteria | 2414 |
| 411 | Ga0182006_1054130 | 3300015261 | Bacteria | 1536 |
| 412 | Ga0182006_1090498 | 3300015261 | Bacteria | 1102 |
| 413 | Ga0182007_10000043 | 3300015262 | Bacteria | 107693 |
| 414 | Ga0182005_1000225 | 3300015265 | Bacteria | 37383 |
| 415 | Ga0182005_1006372 | 3300015265 | Bacteria | 3617 |
| 416 | Ga0182005_1007922 | 3300015265 | Bacteria | 3157 |
| 417 | Ga0182005_1023059 | 3300015265 | Bacteria | 1703 |
| 418 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 419 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 420 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 421 | Ga0163161_10002976 | 3300017792 | Bacteria | 11996 |
| 422 | Ga0163161_10005305 | 3300017792 | Bacteria | 8973 |
| 423 | Ga0163161_10027657 | 3300017792 | Bacteria | 4024 |
| 424 | Ga0163161_10049683 | 3300017792 | Bacteria | 3032 |
| 425 | Ga0206356_11596253 | 3300020070 | Bacteria | 4188 |
| 426 | Ga0206354_10472637 | 3300020081 | Bacteria | 6882 |
| 427 | Ga0206353_11520292 | 3300020082 | Bacteria | 1127 |
| 428 | Ga0206353_11892459 | 3300020082 | Bacteria | 3841 |
| 429 | Ga0209760_100270 | 3300025207 | Bacteria | 19113 |
| 430 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 431 | Ga0209566_105937 | 3300025225 | Bacteria | 1483 |
| 432 | Ga0209674_100061 | 3300025226 | Bacteria | 280844 |
| 433 | Ga0209674_100077 | 3300025226 | Bacteria | 206312 |
| 434 | Ga0209674_101778 | 3300025226 | Bacteria | 5225 |
| 435 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 436 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 437 | Ga0209672_100167 | 3300025228 | Bacteria | 55641 |
| 438 | Ga0209672_100729 | 3300025228 | Bacteria | 16177 |
| 439 | Ga0209672_101194 | 3300025228 | Bacteria | 10554 |
| 440 | Ga0209147_106714 | 3300025229 | Bacteria | 1571 |
| 441 | Ga0209563_100103 | 3300025230 | Bacteria | 151835 |
| 442 | Ga0209563_111997 | 3300025230 | Bacteria | 1203 |
| 443 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 444 | Ga0207427_100086 | 3300025231 | Bacteria | 140465 |
| 445 | Ga0207427_100160 | 3300025231 | Bacteria | 75885 |
| 446 | Ga0207427_100690 | 3300025231 | Bacteria | 15980 |
| 447 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 448 | Ga0209437_100178 | 3300025233 | Bacteria | 134932 |
| 449 | Ga0209437_100244 | 3300025233 | Bacteria | 88556 |
| 450 | Ga0209437_100293 | 3300025233 | Bacteria | 72458 |
| 451 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 452 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 453 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 454 | Ga0209258_100182 | 3300025242 | Bacteria | 136629 |
| 455 | Ga0209258_100327 | 3300025242 | Bacteria | 71811 |
| 456 | Ga0209258_100610 | 3300025242 | Bacteria | 28851 |
| 457 | Ga0209258_107210 | 3300025242 | Bacteria | 1669 |
| 458 | Ga0207425_1000078 | 3300025245 | Bacteria | 104429 |
| 459 | Ga0207425_1010809 | 3300025245 | Bacteria | 2205 |
| 460 | Ga0209646_1001950 | 3300025246 | Bacteria | 4988 |
| 461 | Ga0209646_1002809 | 3300025246 | Bacteria | 3677 |
| 462 | Ga0209026_1000018 | 3300025250 | Bacteria | 381351 |
| 463 | Ga0209026_1000084 | 3300025250 | Bacteria | 186997 |
| 464 | Ga0209026_1000148 | 3300025250 | Bacteria | 111280 |
| 465 | Ga0209026_1000155 | 3300025250 | Bacteria | 108684 |
| 466 | Ga0209026_1000448 | 3300025250 | Bacteria | 32889 |
| 467 | Ga0209026_1008095 | 3300025250 | Bacteria | 2247 |
| 468 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 469 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 470 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 471 | Ga0209148_1000083 | 3300025254 | Bacteria | 270142 |
| 472 | Ga0209148_1000299 | 3300025254 | Bacteria | 71811 |
| 473 | Ga0209148_1006983 | 3300025254 | Bacteria | 2389 |
| 474 | Ga0209759_1000066 | 3300025256 | Bacteria | 184163 |
| 475 | Ga0209759_1000257 | 3300025256 | Bacteria | 77734 |
| 476 | Ga0209759_1000305 | 3300025256 | Bacteria | 66754 |
| 477 | Ga0209759_1000824 | 3300025256 | Bacteria | 24541 |
| 478 | Ga0209759_1006727 | 3300025256 | Bacteria | 3815 |
| 479 | Ga0209759_1025447 | 3300025256 | Bacteria | 1259 |
| 480 | Ga0209759_1025535 | 3300025256 | Bacteria | 1255 |
| 481 | Ga0209129_1000157 | 3300025258 | Bacteria | 105043 |
| 482 | Ga0209129_1002303 | 3300025258 | Bacteria | 9488 |
| 483 | Ga0209129_1006121 | 3300025258 | Bacteria | 4010 |
| 484 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 485 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 486 | Ga0209233_1000128 | 3300025261 | Bacteria | 209927 |
| 487 | Ga0209233_1000246 | 3300025261 | Bacteria | 88556 |
| 488 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 489 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 490 | Ga0209565_1004760 | 3300025263 | Bacteria | 4072 |
| 491 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 492 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 493 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 494 | Ga0209455_1000084 | 3300025272 | Bacteria | 253164 |
| 495 | Ga0209455_1000186 | 3300025272 | Bacteria | 97107 |
| 496 | Ga0209455_1007936 | 3300025272 | Bacteria | 2939 |
| 497 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 498 | Ga0209673_1000171 | 3300025273 | Bacteria | 133493 |
| 499 | Ga0209673_1002529 | 3300025273 | Bacteria | 12518 |
| 500 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 501 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 502 | Ga0209675_1015425 | 3300025291 | Bacteria | 2268 |
| 503 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 504 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 505 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 506 | Ga0209676_1000963 | 3300025292 | Bacteria | 34865 |
| 507 | Ga0209676_1000970 | 3300025292 | Bacteria | 34527 |
| 508 | Ga0209676_1002059 | 3300025292 | Bacteria | 15674 |
| 509 | Ga0209676_1006843 | 3300025292 | Bacteria | 5525 |
| 510 | Ga0209676_1009313 | 3300025292 | Bacteria | 4251 |
| 511 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 512 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 513 | Ga0209025_1001242 | 3300025294 | Bacteria | 35443 |
| 514 | Ga0209025_1007257 | 3300025294 | Bacteria | 8328 |
| 515 | Ga0209025_1069645 | 3300025294 | Bacteria | 1256 |
| 516 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 517 | Ga0209564_1000221 | 3300025295 | Bacteria | 129537 |
| 518 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 519 | Ga0209758_1000577 | 3300025297 | Bacteria | 57284 |
| 520 | Ga0209758_1010608 | 3300025297 | Bacteria | 5484 |
| 521 | Ga0209758_1018409 | 3300025297 | Bacteria | 3424 |
| 522 | Ga0209758_1027303 | 3300025297 | Bacteria | 2443 |
| 523 | Ga0209050_1000329 | 3300025298 | Bacteria | 94932 |
| 524 | Ga0209050_1000415 | 3300025298 | Bacteria | 79058 |
| 525 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 526 | Ga0209256_1001265 | 3300025299 | Bacteria | 27598 |
| 527 | Ga0209256_1004398 | 3300025299 | Bacteria | 8884 |
| 528 | Ga0209256_1004927 | 3300025299 | Bacteria | 8008 |
| 529 | Ga0209256_1004947 | 3300025299 | Bacteria | 7984 |
| 530 | Ga0209256_1037984 | 3300025299 | Bacteria | 1250 |
| 531 | Ga0209051_1001449 | 3300025303 | Bacteria | 20118 |
| 532 | Ga0209051_1006817 | 3300025303 | Bacteria | 6359 |
| 533 | Ga0209051_1073048 | 3300025303 | Bacteria | 1023 |
| 534 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 535 | Ga0209257_1000530 | 3300025304 | Bacteria | 66163 |
| 536 | Ga0209257_1000837 | 3300025304 | Bacteria | 44348 |
| 537 | Ga0209257_1001863 | 3300025304 | Bacteria | 22875 |
| 538 | Ga0209257_1006985 | 3300025304 | Bacteria | 7023 |
| 539 | Ga0209257_1011577 | 3300025304 | Bacteria | 4224 |
| 540 | Ga0209257_1022250 | 3300025304 | Bacteria | 2267 |
| 541 | Ga0207656_10027525 | 3300025321 | Bacteria | 2326 |
| 542 | Ga0207656_10110112 | 3300025321 | Bacteria | 1272 |
| 543 | Ga0207713_1001379 | 3300025735 | Bacteria | 19712 |
| 544 | Ga0207713_1006311 | 3300025735 | Bacteria | 7241 |
| 545 | Ga0207710_10004497 | 3300025900 | Bacteria | 6073 |
| 546 | Ga0207680_10095441 | 3300025903 | Bacteria | 1900 |
| 547 | Ga0207680_10269538 | 3300025903 | Bacteria | 1180 |
| 548 | Ga0207680_10329785 | 3300025903 | Bacteria | 1069 |
| 549 | Ga0207647_10000008 | 3300025904 | Bacteria | 192602 |
| 550 | Ga0207647_10000250 | 3300025904 | Bacteria | 43994 |
| 551 | Ga0207647_10002043 | 3300025904 | Bacteria | 15431 |
| 552 | Ga0207647_10010215 | 3300025904 | Bacteria | 6632 |
| 553 | Ga0207647_10016245 | 3300025904 | Bacteria | 5082 |
| 554 | Ga0207645_10043171 | 3300025907 | Bacteria | 2885 |
| 555 | Ga0207705_10000168 | 3300025909 | Bacteria | 70386 |
| 556 | Ga0207705_10000836 | 3300025909 | Bacteria | 25177 |
| 557 | Ga0207705_10028178 | 3300025909 | Bacteria | 4004 |
| 558 | Ga0207705_10079577 | 3300025909 | Bacteria | 2387 |
| 559 | Ga0207654_10007686 | 3300025911 | Bacteria | 5438 |
| 560 | Ga0207707_10000032 | 3300025912 | Bacteria | 158499 |
| 561 | Ga0207707_10000422 | 3300025912 | Bacteria | 44306 |
| 562 | Ga0207707_10001438 | 3300025912 | Bacteria | 22028 |
| 563 | Ga0207707_10001792 | 3300025912 | Bacteria | 19720 |
| 564 | Ga0207707_10030814 | 3300025912 | Bacteria | 4692 |
| 565 | Ga0207707_10054519 | 3300025912 | Bacteria | 3480 |
| 566 | Ga0207707_10073158 | 3300025912 | Bacteria | 2988 |
| 567 | Ga0207707_10118927 | 3300025912 | Bacteria | 2309 |
| 568 | Ga0207707_10444042 | 3300025912 | Bacteria | 1110 |
| 569 | Ga0207695_10000320 | 3300025913 | Bacteria | 116097 |
| 570 | Ga0207695_10000355 | 3300025913 | Bacteria | 105211 |
| 571 | Ga0207695_10000933 | 3300025913 | Bacteria | 52174 |
| 572 | Ga0207695_10000943 | 3300025913 | Bacteria | 51800 |
| 573 | Ga0207695_10001343 | 3300025913 | Bacteria | 41721 |
| 574 | Ga0207695_10001428 | 3300025913 | Bacteria | 40198 |
| 575 | Ga0207695_10001726 | 3300025913 | Bacteria | 34905 |
| 576 | Ga0207695_10002647 | 3300025913 | Bacteria | 26166 |
| 577 | Ga0207695_10021778 | 3300025913 | Bacteria | 7302 |
| 578 | Ga0207695_10043366 | 3300025913 | Bacteria | 4794 |
| 579 | Ga0207695_10083885 | 3300025913 | Bacteria | 3218 |
| 580 | Ga0207695_10378944 | 3300025913 | Bacteria | 1300 |
| 581 | Ga0207671_10000057 | 3300025914 | Bacteria | 183729 |
| 582 | Ga0207671_10001018 | 3300025914 | Bacteria | 34285 |
| 583 | Ga0207671_10044985 | 3300025914 | Bacteria | 3264 |
| 584 | Ga0207671_10364419 | 3300025914 | Bacteria | 1147 |
| 585 | Ga0207693_10125060 | 3300025915 | Bacteria | 2021 |
| 586 | Ga0207660_10000362 | 3300025917 | Bacteria | 29578 |
| 587 | Ga0207660_10000402 | 3300025917 | Bacteria | 28537 |
| 588 | Ga0207660_10007496 | 3300025917 | Bacteria | 7061 |
| 589 | Ga0207660_10126323 | 3300025917 | Bacteria | 1942 |
| 590 | Ga0207660_10275262 | 3300025917 | Bacteria | 1334 |
| 591 | Ga0207657_10002254 | 3300025919 | Bacteria | 20904 |
| 592 | Ga0207657_10002369 | 3300025919 | Bacteria | 20383 |
| 593 | Ga0207657_10004447 | 3300025919 | Bacteria | 14830 |
| 594 | Ga0207657_10107616 | 3300025919 | Bacteria | 2306 |
| 595 | Ga0207649_10001307 | 3300025920 | Bacteria | 14861 |
| 596 | Ga0207649_10002328 | 3300025920 | Bacteria | 10668 |
| 597 | Ga0207649_10008777 | 3300025920 | Bacteria | 5517 |
| 598 | Ga0207649_10080454 | 3300025920 | Bacteria | 2107 |
| 599 | Ga0207652_10000026 | 3300025921 | Bacteria | 156183 |
| 600 | Ga0207652_10000368 | 3300025921 | Bacteria | 46835 |
| 601 | Ga0207652_10000811 | 3300025921 | Bacteria | 29836 |
| 602 | Ga0207652_10016377 | 3300025921 | Bacteria | 6052 |
| 603 | Ga0207652_10045387 | 3300025921 | Bacteria | 3747 |
| 604 | Ga0207652_10093455 | 3300025921 | Bacteria | 2647 |
| 605 | Ga0207652_10217504 | 3300025921 | Bacteria | 1721 |
| 606 | Ga0207652_10258450 | 3300025921 | Bacteria | 1571 |
| 607 | Ga0207652_10290409 | 3300025921 | Bacteria | 1475 |
| 608 | Ga0207681_10005273 | 3300025923 | Bacteria | 7940 |
| 609 | Ga0207694_10036560 | 3300025924 | Bacteria | 3769 |
| 610 | Ga0207694_10045240 | 3300025924 | Bacteria | 3400 |
| 611 | Ga0207694_10327004 | 3300025924 | Bacteria | 1266 |
| 612 | Ga0207650_10034083 | 3300025925 | Bacteria | 3691 |
| 613 | Ga0207650_10071471 | 3300025925 | Bacteria | 2610 |
| 614 | Ga0207650_10155894 | 3300025925 | Bacteria | 1806 |
| 615 | Ga0207687_10000279 | 3300025927 | Bacteria | 35014 |
| 616 | Ga0207687_10029377 | 3300025927 | Bacteria | 3697 |
| 617 | Ga0207687_10065678 | 3300025927 | Bacteria | 2577 |
| 618 | Ga0207700_10009087 | 3300025928 | Bacteria | 6189 |
| 619 | Ga0207664_10000055 | 3300025929 | Bacteria | 126338 |
| 620 | Ga0207664_10021264 | 3300025929 | Bacteria | 4821 |
| 621 | Ga0207664_10081891 | 3300025929 | Bacteria | 2628 |
| 622 | Ga0207690_10000209 | 3300025932 | Bacteria | 45368 |
| 623 | Ga0207690_10002208 | 3300025932 | Bacteria | 11872 |
| 624 | Ga0207690_10002280 | 3300025932 | Bacteria | 11697 |
| 625 | Ga0207690_10005514 | 3300025932 | Bacteria | 7467 |
| 626 | Ga0207690_10081658 | 3300025932 | Bacteria | 2259 |
| 627 | Ga0207690_10086681 | 3300025932 | Bacteria | 2201 |
| 628 | Ga0207706_10056810 | 3300025933 | Bacteria | 3450 |
| 629 | Ga0207706_10066404 | 3300025933 | Bacteria | 3174 |
| 630 | Ga0207709_10000536 | 3300025935 | Bacteria | 32696 |
| 631 | Ga0207670_10000678 | 3300025936 | Bacteria | 18002 |
| 632 | Ga0207670_10049654 | 3300025936 | Bacteria | 2808 |
| 633 | Ga0207669_10127560 | 3300025937 | Bacteria | 1741 |
| 634 | Ga0207704_10071318 | 3300025938 | Bacteria | 2204 |
| 635 | Ga0207704_10154349 | 3300025938 | Bacteria | 1625 |
| 636 | Ga0207691_10037062 | 3300025940 | Bacteria | 4517 |
| 637 | Ga0207691_10045793 | 3300025940 | Bacteria | 4021 |
| 638 | Ga0207691_10061408 | 3300025940 | Bacteria | 3414 |
| 639 | Ga0207691_10246767 | 3300025940 | Bacteria | 1542 |
| 640 | Ga0207711_10458380 | 3300025941 | Bacteria | 1187 |
| 641 | Ga0207689_10049276 | 3300025942 | Bacteria | 3475 |
| 642 | Ga0207661_10012207 | 3300025944 | Bacteria | 6239 |
| 643 | Ga0207679_10003377 | 3300025945 | Bacteria | 9853 |
| 644 | Ga0207667_10000139 | 3300025949 | Bacteria | 109949 |
| 645 | Ga0207667_10000247 | 3300025949 | Bacteria | 76307 |
| 646 | Ga0207667_10000436 | 3300025949 | Bacteria | 55945 |
| 647 | Ga0207667_10001265 | 3300025949 | Bacteria | 31699 |
| 648 | Ga0207667_10007174 | 3300025949 | Bacteria | 13444 |
| 649 | Ga0207667_10008798 | 3300025949 | Bacteria | 11954 |
| 650 | Ga0207667_10009079 | 3300025949 | Bacteria | 11756 |
| 651 | Ga0207667_10025041 | 3300025949 | Bacteria | 6540 |
| 652 | Ga0207667_10029132 | 3300025949 | Bacteria | 5990 |
| 653 | Ga0207667_10134768 | 3300025949 | Bacteria | 2543 |
| 654 | Ga0207667_10618636 | 3300025949 | Bacteria | 1091 |
| 655 | Ga0207712_10000143 | 3300025961 | Bacteria | 74697 |
| 656 | Ga0207668_10034221 | 3300025972 | Bacteria | 3373 |
| 657 | Ga0207668_10072813 | 3300025972 | Bacteria | 2460 |
| 658 | Ga0207640_10000072 | 3300025981 | Bacteria | 80118 |
| 659 | Ga0207640_10001040 | 3300025981 | Bacteria | 15353 |
| 660 | Ga0207640_10003987 | 3300025981 | Bacteria | 7973 |
| 661 | Ga0207658_10109893 | 3300025986 | Bacteria | 2177 |
| 662 | Ga0207658_10448990 | 3300025986 | Bacteria | 1141 |
| 663 | Ga0207677_10127910 | 3300026023 | Bacteria | 1923 |
| 664 | Ga0207639_10000639 | 3300026041 | Bacteria | 24160 |
| 665 | Ga0207639_10002460 | 3300026041 | Bacteria | 12421 |
| 666 | Ga0207639_10003288 | 3300026041 | Bacteria | 10876 |
| 667 | Ga0207639_10025738 | 3300026041 | Bacteria | 4268 |
| 668 | Ga0207639_10136780 | 3300026041 | Bacteria | 2036 |
| 669 | Ga0207678_10001290 | 3300026067 | Bacteria | 23178 |
| 670 | Ga0207678_10001605 | 3300026067 | Bacteria | 20808 |
| 671 | Ga0207678_10006048 | 3300026067 | Bacteria | 10764 |
| 672 | Ga0207678_10007279 | 3300026067 | Bacteria | 9809 |
| 673 | Ga0207678_10037910 | 3300026067 | Bacteria | 4191 |
| 674 | Ga0207678_10041911 | 3300026067 | Bacteria | 3968 |
| 675 | Ga0207678_10119888 | 3300026067 | Bacteria | 2245 |
| 676 | Ga0207678_10170353 | 3300026067 | Bacteria | 1859 |
| 677 | Ga0207702_10000107 | 3300026078 | Bacteria | 96024 |
| 678 | Ga0207702_10001032 | 3300026078 | Bacteria | 28557 |
| 679 | Ga0207702_10050670 | 3300026078 | Bacteria | 3505 |
| 680 | Ga0207702_10066079 | 3300026078 | Bacteria | 3099 |
| 681 | Ga0207702_10110845 | 3300026078 | Bacteria | 2439 |
| 682 | Ga0207702_10230769 | 3300026078 | Bacteria | 1730 |
| 683 | Ga0207702_10337674 | 3300026078 | Bacteria | 1439 |
| 684 | Ga0207641_10056239 | 3300026088 | Bacteria | 3343 |
| 685 | Ga0207641_10279945 | 3300026088 | Bacteria | 1568 |
| 686 | Ga0207641_10319656 | 3300026088 | Bacteria | 1472 |
| 687 | Ga0207641_10557936 | 3300026088 | Bacteria | 1117 |
| 688 | Ga0207648_10014914 | 3300026089 | Bacteria | 7163 |
| 689 | Ga0207648_10136229 | 3300026089 | Bacteria | 2163 |
| 690 | Ga0207648_10290057 | 3300026089 | Bacteria | 1465 |
| 691 | Ga0207676_10134473 | 3300026095 | Bacteria | 2107 |
| 692 | Ga0207676_10206733 | 3300026095 | Bacteria | 1739 |
| 693 | Ga0207674_10000371 | 3300026116 | Bacteria | 58464 |
| 694 | Ga0207674_10001386 | 3300026116 | Bacteria | 31217 |
| 695 | Ga0207674_10053332 | 3300026116 | Bacteria | 4122 |
| 696 | Ga0207674_10075758 | 3300026116 | Bacteria | 3374 |
| 697 | Ga0207674_10118046 | 3300026116 | Bacteria | 2623 |
| 698 | Ga0207674_10124450 | 3300026116 | Bacteria | 2544 |
| 699 | Ga0207674_10148012 | 3300026116 | Bacteria | 2306 |
| 700 | Ga0207674_10275043 | 3300026116 | Bacteria | 1632 |
| 701 | Ga0207675_100227767 | 3300026118 | Bacteria | 1797 |
| 702 | Ga0207675_100768183 | 3300026118 | Bacteria | 976 |
| 703 | Ga0207683_10720618 | 3300026121 | Bacteria | 925 |
| 704 | Ga0207683_10720911 | 3300026121 | Bacteria | 925 |
| 705 | Ga0207698_10004539 | 3300026142 | Bacteria | 8475 |
| 706 | Ga0207698_10015176 | 3300026142 | Bacteria | 5152 |
| 707 | Ga0207698_10181051 | 3300026142 | Bacteria | 1867 |
| 708 | Ga0207698_10462779 | 3300026142 | Bacteria | 1227 |
| 709 | Ga0207698_10462942 | 3300026142 | Bacteria | 1227 |
| 710 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 711 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 712 | Ga0209969_1015899 | 3300027360 | Bacteria | 1101 |
| 713 | Ga0209995_1012544 | 3300027471 | Bacteria | 1383 |
| 714 | Ga0209970_1024957 | 3300027614 | Bacteria | 1023 |
| 715 | Ga0210002_1012761 | 3300027617 | Bacteria | 1308 |
| 716 | Ga0209983_1005036 | 3300027665 | Bacteria | 2755 |
| 717 | Ga0209971_1005650 | 3300027682 | Bacteria | 2967 |
| 718 | Ga0209974_10005392 | 3300027876 | Bacteria | 4501 |
| 719 | Ga0209974_10008848 | 3300027876 | Bacteria | 3430 |
| 720 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 721 | Ga0268266_10000901 | 3300028379 | Bacteria | 38422 |
| 722 | Ga0268266_10048368 | 3300028379 | Bacteria | 3645 |
| 723 | Ga0268266_10465344 | 3300028379 | Bacteria | 1203 |
| 724 | Ga0268265_10551219 | 3300028380 | Bacteria | 1094 |
| 725 | Ga0268264_10021249 | 3300028381 | Bacteria | 5303 |
| 726 | Ga0268264_10541655 | 3300028381 | Bacteria | 1140 |
| 727 | Ga0265338_10042995 | 3300028800 | Bacteria | 4198 |
| 728 | Ga0265338_10103927 | 3300028800 | Bacteria | 2306 |
| 729 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 730 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 731 | Ga0316177_1080492 | 3300030731 | Bacteria | 3064 |
| 732 | Ga0314311_1060965 | 3300030733 | Bacteria | 11188 |
| 733 | Ga0316183_1146021 | 3300030742 | Bacteria | 9603 |
| 734 | Ga0316181_1033804 | 3300030744 | Bacteria | 2389 |
| 735 | Ga0307513_10008959 | 3300031456 | Bacteria | 12700 |
| 736 | Ga0307513_10411234 | 3300031456 | Bacteria | 1085 |
| 737 | Ga0307509_10022222 | 3300031507 | Bacteria | 7158 |
| 738 | Ga0307509_10138438 | 3300031507 | Bacteria | 2375 |
| 739 | Ga0307509_10363485 | 3300031507 | Bacteria | 1166 |
| 740 | Ga0307408_100053478 | 3300031548 | Bacteria | 2916 |
| 741 | Ga0307408_100114448 | 3300031548 | Bacteria | 2078 |
| 742 | Ga0307408_100127429 | 3300031548 | Bacteria | 1981 |
| 743 | Ga0307408_100517604 | 3300031548 | Bacteria | 1047 |
| 744 | Ga0307508_10199806 | 3300031616 | Bacteria | 1600 |
| 745 | Ga0316576_10123013 | 3300031727 | Bacteria | 1949 |
| 746 | Ga0316576_10206213 | 3300031727 | Bacteria | 1480 |
| 747 | Ga0316578_10037457 | 3300031728 | Bacteria | 2794 |
| 748 | Ga0307405_10255915 | 3300031731 | Bacteria | 1305 |
| 749 | Ga0316577_10006244 | 3300031733 | Bacteria | 6288 |
| 750 | Ga0307413_10000147 | 3300031824 | Bacteria | 19006 |
| 751 | Ga0307413_10059747 | 3300031824 | Bacteria | 2344 |
| 752 | Ga0307413_10063188 | 3300031824 | Bacteria | 2294 |
| 753 | Ga0307410_10188456 | 3300031852 | Bacteria | 1567 |
| 754 | Ga0307406_10009208 | 3300031901 | Bacteria | 5531 |
| 755 | Ga0307406_10063990 | 3300031901 | Bacteria | 2385 |
| 756 | Ga0307406_10422843 | 3300031901 | Bacteria | 1062 |
| 757 | Ga0307407_10214144 | 3300031903 | Bacteria | 1299 |
| 758 | Ga0307412_10001351 | 3300031911 | Bacteria | 13640 |
| 759 | Ga0307412_10029386 | 3300031911 | Bacteria | 3449 |
| 760 | Ga0307409_100460041 | 3300031995 | Bacteria | 1230 |
| 761 | Ga0307416_100014236 | 3300032002 | Bacteria | 5441 |
| 762 | Ga0307416_100101159 | 3300032002 | Bacteria | 2509 |
| 763 | Ga0307416_100149196 | 3300032002 | Bacteria | 2141 |
| 764 | Ga0307416_100171404 | 3300032002 | Bacteria | 2021 |
| 765 | Ga0307416_100375673 | 3300032002 | Bacteria | 1449 |
| 766 | Ga0307414_10005629 | 3300032004 | Bacteria | 6912 |
| 767 | Ga0307414_10007619 | 3300032004 | Bacteria | 6091 |
| 768 | Ga0307414_10019115 | 3300032004 | Bacteria | 4238 |
| 769 | Ga0307414_10022700 | 3300032004 | Bacteria | 3964 |
| 770 | Ga0307414_10022879 | 3300032004 | Bacteria | 3952 |
| 771 | Ga0307414_10049456 | 3300032004 | Bacteria | 2907 |
| 772 | Ga0307414_10090000 | 3300032004 | Bacteria | 2276 |
| 773 | Ga0307414_10093897 | 3300032004 | Bacteria | 2238 |
| 774 | Ga0307414_10099984 | 3300032004 | Bacteria | 2180 |
| 775 | Ga0307414_10113989 | 3300032004 | Bacteria | 2064 |
| 776 | Ga0307414_10219041 | 3300032004 | Bacteria | 1561 |
| 777 | Ga0307414_10316589 | 3300032004 | Bacteria | 1326 |
| 778 | Ga0307411_10043506 | 3300032005 | Bacteria | 2873 |
| 779 | Ga0307411_10101956 | 3300032005 | Bacteria | 2032 |
| 780 | Ga0307411_10126775 | 3300032005 | Bacteria | 1858 |
| 781 | Ga0307411_10182784 | 3300032005 | Bacteria | 1593 |
| 782 | Ga0307411_10315102 | 3300032005 | Bacteria | 1261 |
| 783 | Ga0307507_10159848 | 3300033179 | Bacteria | 1668 |
| 784 | Ga0373937_0245944 | 3300036401 | Bacteria | 1686 |
| 785 | Ga0316584_0000540 | 3300036712 | Bacteria | 20258 |
| 786 | Ga0316584_0244550 | 3300036712 | Bacteria | 1312 |
| 787 | Ga0395899_0012535 | 3300037312 | Bacteria | 6498 |
| 788 | Ga0395899_0040277 | 3300037312 | Bacteria | 3494 |
| 789 | Ga0395899_0148535 | 3300037312 | Bacteria | 1662 |
| 790 | Ga0395899_0238747 | 3300037312 | Bacteria | 1252 |
| 791 | Ga0395899_0239430 | 3300037312 | Bacteria | 1249 |
| 792 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 793 | Ga0395900_0000092 | 3300037418 | Bacteria | 166966 |
| 794 | Ga0395900_0002817 | 3300037418 | Bacteria | 18982 |
| 795 | Ga0395900_0006858 | 3300037418 | Bacteria | 11818 |
| 796 | Ga0395900_0018342 | 3300037418 | Bacteria | 7138 |
| 797 | Ga0395900_0035826 | 3300037418 | Bacteria | 5113 |
| 798 | Ga0395900_0460485 | 3300037418 | Bacteria | 1226 |
| 799 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 800 | Ga0395898_0000237 | 3300037466 | Bacteria | 139991 |
| 801 | Ga0395898_0013167 | 3300037466 | Bacteria | 8523 |
| 802 | Ga0395898_0022209 | 3300037466 | Bacteria | 6430 |
| 803 | Ga0395898_0050118 | 3300037466 | Bacteria | 4088 |
| 804 | Ga0395898_0059861 | 3300037466 | Bacteria | 3703 |
| 805 | Ga0395905_0000883 | 3300037471 | Bacteria | 39095 |
| 806 | Ga0395905_0020602 | 3300037471 | Bacteria | 6243 |
| 807 | Ga0395905_0039237 | 3300037471 | Bacteria | 4443 |
| 808 | Ga0395905_0133615 | 3300037471 | Bacteria | 2334 |
| 809 | Ga0395905_0385147 | 3300037471 | Bacteria | 1296 |
| 810 | Ga0395905_0435349 | 3300037471 | Bacteria | 1208 |
| 811 | Ga0395901_0000992 | 3300038443 | Bacteria | 30626 |
| 812 | Ga0395901_0004126 | 3300038443 | Bacteria | 14640 |
| 813 | Ga0395901_0015549 | 3300038443 | Bacteria | 7750 |
| 814 | Ga0395901_0081819 | 3300038443 | Bacteria | 3373 |
| 815 | Ga0395901_0146599 | 3300038443 | Bacteria | 2480 |
| 816 | Ga0395901_0149959 | 3300038443 | Bacteria | 2450 |
| 817 | Ga0395901_0217329 | 3300038443 | Bacteria | 1998 |
| 818 | Ga0237816_01224 | 3300039145 | Bacteria | 2101 |
| 819 | Ga0436365_0468765 | 3300039437 | Bacteria | 8473 |
| 820 | Ga0436361_0109835 | 3300039447 | Unclassified | 1499 |
| 821 | Ga0436363_0346981 | 3300039450 | Bacteria | 1402 |
| 822 | Ga0439436_0000245 | 3300041404 | Bacteria | 13078 |
| 823 | Ga0439436_0001317 | 3300041404 | Bacteria | 7115 |
| 824 | Ga0439436_0015229 | 3300041404 | Bacteria | 2313 |
| 825 | Ga0439436_0037155 | 3300041404 | Bacteria | 1403 |
| 826 | Ga0439439_0011664 | 3300041406 | Bacteria | 2118 |
| 827 | Ga0439439_0027692 | 3300041406 | Bacteria | 1432 |
| 828 | Ga0439465_0002136 | 3300041413 | Bacteria | 6496 |
| 829 | Ga0439465_0004591 | 3300041413 | Bacteria | 4460 |
| 830 | Ga0439465_0021293 | 3300041413 | Bacteria | 2032 |
| 831 | Ga0439465_0049045 | 3300041413 | Bacteria | 1378 |
| 832 | Ga0451789_0816827 | 3300041443 | Bacteria | 1835 |
| 833 | Ga0451793_0084196 | 3300041452 | Bacteria | 4406 |
| 834 | Ga0451793_0245814 | 3300041452 | Bacteria | 1461 |
| 835 | Ga0451793_0901274 | 3300041452 | Bacteria | 1221 |
| 836 | Ga0451800_0792482 | 3300041459 | Bacteria | 11283 |
| 837 | Ga0451802_1855302 | 3300041460 | Bacteria | 1065 |
| 838 | Ga0451806_727761 | 3300041462 | Bacteria | 4050 |
| 839 | Ga0451804_0198474 | 3300041463 | Bacteria | 7994 |
| 840 | Ga0451807_0149715 | 3300041486 | Bacteria | 7635 |
| 841 | Ga0451807_1723472 | 3300041486 | Bacteria | 3054 |
| 842 | Ga0451807_1898858 | 3300041486 | Bacteria | 1329 |
| 843 | Ga0451807_2241946 | 3300041486 | Bacteria | 3641 |
| 844 | Ga0451837_1131221 | 3300041494 | Bacteria | 2119 |
| 845 | Ga0451839_0504575 | 3300041496 | Bacteria | 864 |
| 846 | Ga0451843_0827567 | 3300041509 | Bacteria | 1682 |
| 847 | Ga0451843_0952033 | 3300041509 | Bacteria | 1871 |
| 848 | Ga0451843_1048573 | 3300041509 | Bacteria | 1094 |
| 849 | Ga0451843_1245072 | 3300041509 | Bacteria | 1611 |
| 850 | Ga0451853_2369144 | 3300041512 | Bacteria | 1424 |
| 851 | Ga0451853_3110382 | 3300041512 | Bacteria | 1818 |
| 852 | Ga0439445_0022184 | 3300042004 | Bacteria | 1600 |
| 853 | Ga0439432_003228 | 3300042006 | Bacteria | 6067 |
| 854 | Ga0439432_005109 | 3300042006 | Bacteria | 4745 |
| 855 | Ga0439432_037157 | 3300042006 | Bacteria | 1555 |
| 856 | Ga0439432_041153 | 3300042006 | Bacteria | 1464 |
| 857 | Ga0439449_0000046 | 3300042007 | Bacteria | 37723 |
| 858 | Ga0439449_0001830 | 3300042007 | Bacteria | 8368 |
| 859 | Ga0439449_0003679 | 3300042007 | Bacteria | 5951 |
| 860 | Ga0439449_0007392 | 3300042007 | Bacteria | 4174 |
| 861 | Ga0439449_0013568 | 3300042007 | Bacteria | 3066 |
| 862 | Ga0439449_0015114 | 3300042007 | Bacteria | 2900 |
| 863 | Ga0439449_0019863 | 3300042007 | Bacteria | 2519 |
| 864 | Ga0450911_002326 | 3300042115 | Bacteria | 3795 |
| 865 | Ga0450908_000075 | 3300042184 | Bacteria | 19743 |
| 866 | Ga0439434_0077072 | 3300042435 | Bacteria | 1055 |
| 867 | Ga0439459_0001196 | 3300042438 | Bacteria | 3784 |
| 868 | Ga0451577_0028918 | 3300042876 | Bacteria | 5012 |
| 869 | Ga0451577_0033724 | 3300042876 | Bacteria | 4616 |
| 870 | Ga0451577_0177892 | 3300042876 | Bacteria | 1918 |
| 871 | Ga0466969_0004032 | 3300044656 | Bacteria | 7784 |
| 872 | Ga0466969_0012271 | 3300044656 | Bacteria | 4523 |
| 873 | Ga0466969_0014973 | 3300044656 | Bacteria | 4069 |
| 874 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 875 | Ga0466982_0000037 | 3300044672 | Bacteria | 42622 |
| 876 | Ga0466965_0001833 | 3300044683 | Bacteria | 8841 |
| 877 | Ga0466965_0136517 | 3300044683 | Bacteria | 1274 |
| 878 | Ga0466966_0002637 | 3300044684 | Bacteria | 11743 |
| 879 | Ga0466966_0052390 | 3300044684 | Bacteria | 2592 |
| 880 | Ga0466966_0087713 | 3300044684 | Bacteria | 1933 |
| 881 | Ga0466961_0001395 | 3300044693 | Bacteria | 14966 |
| 882 | Ga0466961_0004319 | 3300044693 | Bacteria | 8899 |
| 883 | Ga0466961_0014369 | 3300044693 | Bacteria | 5081 |
| 884 | Ga0466963_0098779 | 3300044694 | Bacteria | 1996 |
| 885 | Ga0453684_0001089 | 3300044712 | Bacteria | 85906 |
| 886 | Ga0453684_0639591 | 3300044712 | Bacteria | 1162 |
| 887 | Ga0466971_0003218 | 3300044719 | Bacteria | 6968 |
| 888 | Ga0466971_0049874 | 3300044719 | Bacteria | 1883 |
| 889 | Ga0466971_0050168 | 3300044719 | Bacteria | 1878 |
| 890 | Ga0466971_0088500 | 3300044719 | Bacteria | 1416 |
| 891 | Ga0466968_0009977 | 3300044735 | Bacteria | 3667 |
| 892 | Ga0466968_0041132 | 3300044735 | Bacteria | 1950 |
| 893 | Ga0466970_0023113 | 3300044765 | Bacteria | 3245 |
| 894 | Ga0466957_0013133 | 3300044842 | Bacteria | 4800 |
| 895 | Ga0466957_0059035 | 3300044842 | Bacteria | 2351 |
| 896 | Ga0466957_0061518 | 3300044842 | Bacteria | 2305 |
| 897 | Ga0466960_0010676 | 3300044901 | Bacteria | 3819 |
| 898 | Ga0466959_0000091 | 3300045049 | Bacteria | 57419 |
| 899 | Ga0466959_0040070 | 3300045049 | Bacteria | 3461 |
| 900 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 901 | Ga0466958_0049995 | 3300045836 | Bacteria | 2531 |
| 902 | Ga0466958_0218669 | 3300045836 | Bacteria | 1215 |
| 903 | Ga0466967_0277813 | 3300045976 | Bacteria | 1606 |
| 904 | Ga0466967_0375233 | 3300045976 | Bacteria | 1380 |
| 905 | Ga0495617_000495 | 3300046452 | Bacteria | 20847 |
| 906 | Ga0495627_021048 | 3300046453 | Bacteria | 2166 |
| 907 | Ga0495590_0098444 | 3300046457 | Bacteria | 1038 |
| 908 | Ga0495629_0140902 | 3300046459 | Bacteria | 1678 |
| 909 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 910 | Ga0495638_0000426 | 3300046460 | Bacteria | 50926 |
| 911 | Ga0495638_0000718 | 3300046460 | Bacteria | 35732 |
| 912 | Ga0495638_0002776 | 3300046460 | Bacteria | 14066 |
| 913 | Ga0495638_0056603 | 3300046460 | Bacteria | 2433 |
| 914 | Ga0495638_0137968 | 3300046460 | Bacteria | 1426 |
| 915 | Ga0495650_0000206 | 3300046471 | Bacteria | 127713 |
| 916 | Ga0495650_0029263 | 3300046471 | Bacteria | 2513 |
| 917 | Ga0495585_0001731 | 3300046492 | Bacteria | 16612 |
| 918 | Ga0495585_0002973 | 3300046492 | Bacteria | 11706 |
| 919 | Ga0495607_0000178 | 3300046501 | Bacteria | 67386 |
| 920 | Ga0495607_0000256 | 3300046501 | Bacteria | 57167 |
| 921 | Ga0495607_0040761 | 3300046501 | Bacteria | 2762 |
| 922 | Ga0495583_0005312 | 3300046506 | Bacteria | 8799 |
| 923 | Ga0495606_0002288 | 3300046507 | Bacteria | 22642 |
| 924 | Ga0495606_0003126 | 3300046507 | Bacteria | 17973 |
| 925 | Ga0495606_0008786 | 3300046507 | Bacteria | 8675 |
| 926 | Ga0495606_0042589 | 3300046507 | Bacteria | 3034 |
| 927 | Ga0495606_0088622 | 3300046507 | Bacteria | 1907 |
| 928 | Ga0495610_0000341 | 3300046512 | Bacteria | 49154 |
| 929 | Ga0495610_0002042 | 3300046512 | Bacteria | 17236 |
| 930 | Ga0495616_0000357 | 3300046513 | Bacteria | 35877 |
| 931 | Ga0495616_0020609 | 3300046513 | Bacteria | 3583 |
| 932 | Ga0495620_0000150 | 3300046515 | Bacteria | 56486 |
| 933 | Ga0495620_0000287 | 3300046515 | Bacteria | 36247 |
| 934 | Ga0495631_0000257 | 3300046518 | Bacteria | 36879 |
| 935 | Ga0495631_0000558 | 3300046518 | Bacteria | 24972 |
| 936 | Ga0495631_0011328 | 3300046518 | Bacteria | 4387 |
| 937 | Ga0495632_0015511 | 3300046519 | Bacteria | 4267 |
| 938 | Ga0495632_0015643 | 3300046519 | Bacteria | 4242 |
| 939 | Ga0495637_0039421 | 3300046520 | Bacteria | 2039 |
| 940 | Ga0495643_0001297 | 3300046522 | Bacteria | 23770 |
| 941 | Ga0495648_0001786 | 3300046524 | Bacteria | 20692 |
| 942 | Ga0495648_0005918 | 3300046524 | Bacteria | 10065 |
| 943 | Ga0495663_0001355 | 3300046525 | Bacteria | 7726 |
| 944 | Ga0495663_0011366 | 3300046525 | Bacteria | 2477 |
| 945 | Ga0495663_0012667 | 3300046525 | Bacteria | 2352 |
| 946 | Ga0495663_0031906 | 3300046525 | Bacteria | 1567 |
| 947 | Ga0495598_0003992 | 3300046537 | Bacteria | 3168 |
| 948 | Ga0495609_0002676 | 3300046538 | Bacteria | 10778 |
| 949 | Ga0495622_0002790 | 3300046557 | Bacteria | 8338 |
| 950 | Ga0495633_0016706 | 3300046558 | Bacteria | 3776 |
| 951 | Ga0495633_0073875 | 3300046558 | Bacteria | 1589 |
| 952 | Ga0495656_0001730 | 3300046615 | Bacteria | 7147 |
| 953 | Ga0495656_0092462 | 3300046615 | Bacteria | 1385 |
| 954 | Ga0495668_0004174 | 3300046616 | Bacteria | 10424 |
| 955 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 956 | Ga0495611_0000044 | 3300046648 | Bacteria | 92551 |
| 957 | Ga0495625_0000041 | 3300046660 | Bacteria | 206598 |
| 958 | Ga0495625_0009643 | 3300046660 | Bacteria | 8051 |
| 959 | Ga0495625_0047540 | 3300046660 | Bacteria | 3093 |
| 960 | Ga0495625_0072541 | 3300046660 | Bacteria | 2414 |
| 961 | Ga0495625_0104055 | 3300046660 | Bacteria | 1946 |
| 962 | Ga0495661_0004401 | 3300046665 | Bacteria | 10181 |
| 963 | Ga0495670_0001904 | 3300046691 | Bacteria | 10286 |
| 964 | Ga0495670_0021176 | 3300046691 | Bacteria | 3207 |
| 965 | Ga0495671_0001302 | 3300046692 | Bacteria | 17018 |
| 966 | Ga0495649_0000930 | 3300046694 | Bacteria | 23188 |
| 967 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 968 | Ga0495660_0000231 | 3300046810 | Bacteria | 54997 |
| 969 | Ga0495660_0000421 | 3300046810 | Bacteria | 35861 |
| 970 | Ga0495636_0000667 | 3300047318 | Bacteria | 12588 |
| 971 | Ga0495636_0008169 | 3300047318 | Bacteria | 4126 |
| 972 | Ga0495636_0015711 | 3300047318 | Bacteria | 3018 |
| 973 | Ga0495636_0033687 | 3300047318 | Bacteria | 2106 |
| 974 | Ga0495672_0000373 | 3300047320 | Bacteria | 55844 |
| 975 | Ga0495672_0009395 | 3300047320 | Bacteria | 7088 |
| 976 | Ga0495672_0099020 | 3300047320 | Bacteria | 1585 |
| 977 | Ga0495683_0000643 | 3300047323 | Bacteria | 25972 |
| 978 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 979 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 980 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 981 | Ga0495673_0004064 | 3300047469 | Bacteria | 9316 |
| 982 | Ga0495673_0022472 | 3300047469 | Bacteria | 3090 |
| 983 | Ga0495681_0058289 | 3300047470 | Bacteria | 1790 |
| 984 | Ga0495686_0000108 | 3300047472 | Bacteria | 173579 |
| 985 | Ga0495686_0004065 | 3300047472 | Bacteria | 12220 |
| 986 | Ga0495686_0006536 | 3300047472 | Bacteria | 8902 |
| 987 | Ga0495686_0006573 | 3300047472 | Bacteria | 8869 |
| 988 | Ga0495686_0007270 | 3300047472 | Bacteria | 8327 |
| 989 | Ga0495686_0010094 | 3300047472 | Bacteria | 6742 |
| 990 | Ga0495686_0019590 | 3300047472 | Bacteria | 4521 |
| 991 | Ga0495686_0054137 | 3300047472 | Bacteria | 2513 |
| 992 | Ga0496100_0020951 | 3300048903 | Bacteria | 3929 |
| 993 | Ga0496100_0074028 | 3300048903 | Bacteria | 2281 |
| 994 | Ga0496101_0040842 | 3300048904 | Bacteria | 3305 |
| 995 | Ga0496102_0313070 | 3300048905 | Bacteria | 1479 |
| 996 | Ga0496104_0053198 | 3300048907 | Bacteria | 3825 |
| 997 | Ga0496104_0338307 | 3300048907 | Bacteria | 1418 |
| 998 | Ga0496104_0521717 | 3300048907 | Bacteria | 1099 |
| 999 | Ga0496105_0000021 | 3300048908 | Bacteria | 164255 |
| 1000 | Ga0496105_0002033 | 3300048908 | Bacteria | 14631 |
| 1001 | Ga0496106_0031955 | 3300048909 | Bacteria | 3923 |
| 1002 | Ga0496106_0148858 | 3300048909 | Bacteria | 1846 |
| 1003 | Ga0496106_0346232 | 3300048909 | Bacteria | 1194 |
| 1004 | Ga0496107_0041756 | 3300048910 | Bacteria | 3294 |
| 1005 | Ga0496107_0099030 | 3300048910 | Bacteria | 2136 |
| 1006 | Ga0496108_0055892 | 3300048911 | Bacteria | 3315 |
| 1007 | Ga0496108_0143031 | 3300048911 | Bacteria | 2061 |
| 1008 | Ga0496109_0251788 | 3300048912 | Bacteria | 1663 |
| 1009 | Ga0496111_0474370 | 3300048914 | Bacteria | 922 |
| 1010 | Ga0496112_0226721 | 3300048915 | Bacteria | 1824 |
| 1011 | Ga0496113_0005101 | 3300048916 | Bacteria | 8158 |
| 1012 | Ga0496113_0212743 | 3300048916 | Bacteria | 1539 |
| 1013 | Ga0496114_0000820 | 3300048917 | Bacteria | 23314 |
| 1014 | Ga0496114_0002725 | 3300048917 | Bacteria | 13496 |
| 1015 | Ga0496114_0138149 | 3300048917 | Bacteria | 2108 |
| 1016 | Ga0496115_0000114 | 3300048918 | Bacteria | 73307 |
| 1017 | Ga0496115_0000387 | 3300048918 | Bacteria | 36211 |
| 1018 | Ga0496115_0004395 | 3300048918 | Bacteria | 10205 |
| 1019 | Ga0496115_0008772 | 3300048918 | Bacteria | 7494 |
| 1020 | Ga0496115_0052195 | 3300048918 | Bacteria | 3280 |
| 1021 | Ga0496115_0106677 | 3300048918 | Bacteria | 2300 |
| 1022 | Ga0496115_0134012 | 3300048918 | Bacteria | 2042 |
| 1023 | Ga0496115_0423901 | 3300048918 | Bacteria | 1078 |
| 1024 | Ga0496116_0004008 | 3300048919 | Bacteria | 14280 |
| 1025 | Ga0496116_0064193 | 3300048919 | Bacteria | 2361 |
| 1026 | Ga0496116_0075584 | 3300048919 | Bacteria | 2113 |
| 1027 | Ga0496117_0001196 | 3300048920 | Bacteria | 39067 |
| 1028 | Ga0496117_0001459 | 3300048920 | Bacteria | 34088 |
| 1029 | Ga0496117_0008161 | 3300048920 | Bacteria | 10000 |
| 1030 | Ga0496117_0017436 | 3300048920 | Bacteria | 5995 |
| 1031 | Ga0496117_0048556 | 3300048920 | Bacteria | 3030 |
| 1032 | Ga0496117_0049740 | 3300048920 | Bacteria | 2978 |
| 1033 | Ga0496117_0084717 | 3300048920 | Bacteria | 2066 |
| 1034 | Ga0496117_0095972 | 3300048920 | Bacteria | 1893 |
| 1035 | Ga0496118_0000169 | 3300048921 | Bacteria | 118190 |
| 1036 | Ga0496118_0000528 | 3300048921 | Bacteria | 62711 |
| 1037 | Ga0496118_0001268 | 3300048921 | Bacteria | 38749 |
| 1038 | Ga0496118_0001486 | 3300048921 | Bacteria | 35102 |
| 1039 | Ga0496118_0003436 | 3300048921 | Bacteria | 19937 |
| 1040 | Ga0496118_0003579 | 3300048921 | Bacteria | 19347 |
| 1041 | Ga0496118_0004865 | 3300048921 | Bacteria | 15636 |
| 1042 | Ga0496118_0011727 | 3300048921 | Bacteria | 8518 |
| 1043 | Ga0496118_0021844 | 3300048921 | Bacteria | 5616 |
| 1044 | Ga0496118_0027255 | 3300048921 | Bacteria | 4840 |
| 1045 | Ga0496118_0047598 | 3300048921 | Bacteria | 3321 |
| 1046 | Ga0496118_0101421 | 3300048921 | Bacteria | 1944 |
| 1047 | Ga0496119_0000165 | 3300048922 | Bacteria | 92447 |
| 1048 | Ga0496119_0000659 | 3300048922 | Bacteria | 46235 |
| 1049 | Ga0496119_0000951 | 3300048922 | Bacteria | 37280 |
| 1050 | Ga0496119_0020548 | 3300048922 | Bacteria | 4814 |
| 1051 | Ga0496120_0000054 | 3300048923 | Bacteria | 181170 |
| 1052 | Ga0496120_0000217 | 3300048923 | Bacteria | 99402 |
| 1053 | Ga0496120_0000276 | 3300048923 | Bacteria | 86130 |
| 1054 | Ga0496120_0001321 | 3300048923 | Bacteria | 30616 |
| 1055 | Ga0496121_0000148 | 3300048924 | Bacteria | 154021 |
| 1056 | Ga0496121_0000364 | 3300048924 | Bacteria | 92919 |
| 1057 | Ga0496121_0001122 | 3300048924 | Bacteria | 47076 |
| 1058 | Ga0496121_0012440 | 3300048924 | Bacteria | 9277 |
| 1059 | Ga0496121_0013502 | 3300048924 | Bacteria | 8766 |
| 1060 | Ga0496121_0017454 | 3300048924 | Bacteria | 7332 |
| 1061 | Ga0496121_0030555 | 3300048924 | Bacteria | 4945 |
| 1062 | Ga0496121_0035477 | 3300048924 | Bacteria | 4469 |
| 1063 | Ga0496121_0038038 | 3300048924 | Bacteria | 4267 |
| 1064 | Ga0496121_0046365 | 3300048924 | Bacteria | 3721 |
| 1065 | Ga0496121_0060089 | 3300048924 | Bacteria | 3129 |
| 1066 | Ga0496121_0088573 | 3300048924 | Bacteria | 2426 |
| 1067 | Ga0496121_0169928 | 3300048924 | Bacteria | 1585 |
| 1068 | Ga0496122_0000062 | 3300048925 | Bacteria | 241387 |
| 1069 | Ga0496122_0000372 | 3300048925 | Bacteria | 96314 |
| 1070 | Ga0496122_0004100 | 3300048925 | Bacteria | 18458 |
| 1071 | Ga0496122_0039267 | 3300048925 | Bacteria | 3777 |
| 1072 | Ga0496122_0044506 | 3300048925 | Bacteria | 3462 |
| 1073 | Ga0496122_0056232 | 3300048925 | Bacteria | 2935 |
| 1074 | Ga0496122_0101530 | 3300048925 | Bacteria | 1921 |
| 1075 | Ga0496122_0126181 | 3300048925 | Bacteria | 1637 |
| 1076 | Ga0496123_0000253 | 3300048926 | Bacteria | 108364 |
| 1077 | Ga0496123_0003248 | 3300048926 | Bacteria | 18471 |
| 1078 | Ga0496123_0003662 | 3300048926 | Bacteria | 16955 |
| 1079 | Ga0496123_0009343 | 3300048926 | Bacteria | 8844 |
| 1080 | Ga0496123_0020955 | 3300048926 | Bacteria | 5095 |
| 1081 | Ga0496123_0031098 | 3300048926 | Bacteria | 3891 |
| 1082 | Ga0496123_0053244 | 3300048926 | Bacteria | 2676 |
| 1083 | Ga0496123_0072151 | 3300048926 | Bacteria | 2149 |
| 1084 | Ga0496123_0074609 | 3300048926 | Bacteria | 2098 |
| 1085 | Ga0496123_0078488 | 3300048926 | Bacteria | 2022 |
| 1086 | Ga0496123_0122514 | 3300048926 | Bacteria | 1459 |
| 1087 | Ga0496123_0211205 | 3300048926 | Bacteria | 986 |
| 1088 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 1089 | Ga0496124_0000734 | 3300048927 | Bacteria | 53581 |
| 1090 | Ga0496124_0000815 | 3300048927 | Bacteria | 50713 |
| 1091 | Ga0496124_0011679 | 3300048927 | Bacteria | 8762 |
| 1092 | Ga0496124_0012879 | 3300048927 | Bacteria | 8211 |
| 1093 | Ga0496124_0035745 | 3300048927 | Bacteria | 4343 |
| 1094 | Ga0496124_0052800 | 3300048927 | Bacteria | 3451 |
| 1095 | Ga0496124_0056350 | 3300048927 | Bacteria | 3315 |
| 1096 | Ga0496124_0063983 | 3300048927 | Bacteria | 3071 |
| 1097 | Ga0496124_0120552 | 3300048927 | Bacteria | 2096 |
| 1098 | Ga0496124_0173218 | 3300048927 | Bacteria | 1669 |
| 1099 | Ga0496124_0224555 | 3300048927 | Bacteria | 1409 |
| 1100 | Ga0496125_0000750 | 3300048928 | Bacteria | 53532 |
| 1101 | Ga0496125_0004325 | 3300048928 | Bacteria | 16486 |
| 1102 | Ga0496125_0007644 | 3300048928 | Bacteria | 11459 |
| 1103 | Ga0496125_0013354 | 3300048928 | Bacteria | 8080 |
| 1104 | Ga0496125_0015751 | 3300048928 | Bacteria | 7290 |
| 1105 | Ga0496125_0019641 | 3300048928 | Bacteria | 6364 |
| 1106 | Ga0496125_0087228 | 3300048928 | Bacteria | 2358 |
| 1107 | Ga0496125_0090757 | 3300048928 | Bacteria | 2291 |
| 1108 | Ga0496126_0000206 | 3300048929 | Bacteria | 132028 |
| 1109 | Ga0496126_0000835 | 3300048929 | Bacteria | 54796 |
| 1110 | Ga0496126_0013972 | 3300048929 | Bacteria | 8142 |
| 1111 | Ga0496126_0038127 | 3300048929 | Bacteria | 4474 |
| 1112 | Ga0496126_0058576 | 3300048929 | Bacteria | 3472 |
| 1113 | Ga0496126_0060649 | 3300048929 | Bacteria | 3401 |
| 1114 | Ga0496126_0061534 | 3300048929 | Bacteria | 3372 |
| 1115 | Ga0496126_0071393 | 3300048929 | Bacteria | 3090 |
| 1116 | Ga0496126_0109970 | 3300048929 | Bacteria | 2401 |
| 1117 | Ga0496126_0142188 | 3300048929 | Bacteria | 2064 |
| 1118 | Ga0495678_000116 | 3300049459 | Bacteria | 95210 |
| 1119 | Ga0495682_0002358 | 3300049460 | Bacteria | 8973 |
| 1120 | Ga0495682_0003246 | 3300049460 | Bacteria | 7291 |
| 1121 | Ga0495682_0020963 | 3300049460 | Bacteria | 2451 |
| 1122 | Ga0501290_000667 | 3300049513 | Bacteria | 5135 |
| 1123 | Ga0501292_004939 | 3300049515 | Bacteria | 1844 |
| 1124 | Ga0501299_010975 | 3300049522 | Bacteria | 1522 |
| 1125 | Ga0501031_0002100 | 3300049568 | Bacteria | 12563 |
| 1126 | Ga0501031_0018604 | 3300049568 | Bacteria | 4524 |
| 1127 | Ga0501031_0172512 | 3300049568 | Bacteria | 1413 |
| 1128 | Ga0501031_0174677 | 3300049568 | Bacteria | 1403 |
| 1129 | Ga0501032_0001175 | 3300049569 | Bacteria | 20997 |
| 1130 | Ga0501032_0019849 | 3300049569 | Bacteria | 4692 |
| 1131 | Ga0501032_0023609 | 3300049569 | Bacteria | 4245 |
| 1132 | Ga0501032_0113545 | 3300049569 | Bacteria | 1792 |
| 1133 | Ga0501033_0000932 | 3300049570 | Bacteria | 26712 |
| 1134 | Ga0501033_0004694 | 3300049570 | Bacteria | 10935 |
| 1135 | Ga0501033_0005337 | 3300049570 | Bacteria | 10184 |
| 1136 | Ga0501033_0016017 | 3300049570 | Bacteria | 5678 |
| 1137 | Ga0501033_0023695 | 3300049570 | Bacteria | 4629 |
| 1138 | Ga0501033_0035014 | 3300049570 | Bacteria | 3763 |
| 1139 | Ga0501033_0091340 | 3300049570 | Bacteria | 2227 |
| 1140 | Ga0501033_0136046 | 3300049570 | Bacteria | 1778 |
| 1141 | Ga0501034_0000272 | 3300049571 | Bacteria | 93316 |
| 1142 | Ga0501034_0000667 | 3300049571 | Bacteria | 52322 |
| 1143 | Ga0501034_0001266 | 3300049571 | Bacteria | 34323 |
| 1144 | Ga0501034_0001500 | 3300049571 | Bacteria | 30676 |
| 1145 | Ga0501034_0010123 | 3300049571 | Bacteria | 9838 |
| 1146 | Ga0501034_0012981 | 3300049571 | Bacteria | 8587 |
| 1147 | Ga0501034_0016507 | 3300049571 | Bacteria | 7575 |
| 1148 | Ga0501034_0026733 | 3300049571 | Bacteria | 5871 |
| 1149 | Ga0501034_0047089 | 3300049571 | Bacteria | 4356 |
| 1150 | Ga0501034_0146337 | 3300049571 | Bacteria | 2340 |
| 1151 | Ga0501034_0178001 | 3300049571 | Bacteria | 2092 |
| 1152 | Ga0501034_0227691 | 3300049571 | Bacteria | 1814 |
| 1153 | Ga0501036_0022691 | 3300049572 | Bacteria | 5282 |
| 1154 | Ga0501036_0038174 | 3300049572 | Bacteria | 4064 |
| 1155 | Ga0501036_0041900 | 3300049572 | Bacteria | 3875 |
| 1156 | Ga0501036_0056696 | 3300049572 | Bacteria | 3319 |
| 1157 | Ga0501036_0058455 | 3300049572 | Bacteria | 3267 |
| 1158 | Ga0501036_0059295 | 3300049572 | Bacteria | 3243 |
| 1159 | Ga0501036_0082146 | 3300049572 | Bacteria | 2723 |
| 1160 | Ga0501036_0427889 | 3300049572 | Bacteria | 1103 |
| 1161 | Ga0501037_0000445 | 3300049573 | Bacteria | 33919 |
| 1162 | Ga0501037_0014502 | 3300049573 | Bacteria | 5798 |
| 1163 | Ga0501037_0022344 | 3300049573 | Bacteria | 4680 |
| 1164 | Ga0501037_0091882 | 3300049573 | Bacteria | 2195 |
| 1165 | Ga0501037_0114333 | 3300049573 | Bacteria | 1943 |
| 1166 | Ga0501037_0139474 | 3300049573 | Bacteria | 1735 |
| 1167 | Ga0501038_0002821 | 3300049574 | Bacteria | 16170 |
| 1168 | Ga0501038_0010357 | 3300049574 | Bacteria | 8532 |
| 1169 | Ga0501038_0055860 | 3300049574 | Bacteria | 3391 |
| 1170 | Ga0501038_0106830 | 3300049574 | Bacteria | 2322 |
| 1171 | Ga0501039_0034575 | 3300049575 | Bacteria | 3900 |
| 1172 | Ga0501039_0157359 | 3300049575 | Bacteria | 1785 |
| 1173 | Ga0501039_0215185 | 3300049575 | Bacteria | 1511 |
| 1174 | Ga0501039_0238135 | 3300049575 | Bacteria | 1431 |
| 1175 | Ga0501039_0482382 | 3300049575 | Bacteria | 973 |
| 1176 | Ga0501040_0221534 | 3300049576 | Bacteria | 1346 |
| 1177 | Ga0501042_0118114 | 3300049578 | Bacteria | 1909 |
| 1178 | Ga0501042_0202016 | 3300049578 | Bacteria | 1433 |
| 1179 | Ga0501042_0366625 | 3300049578 | Bacteria | 1042 |
| 1180 | Ga0501042_0504737 | 3300049578 | Bacteria | 878 |
| 1181 | Ga0501043_0003232 | 3300049579 | Bacteria | 13453 |
| 1182 | Ga0501043_0003273 | 3300049579 | Bacteria | 13352 |
| 1183 | Ga0501043_0015149 | 3300049579 | Bacteria | 6035 |
| 1184 | Ga0501043_0016089 | 3300049579 | Bacteria | 5867 |
| 1185 | Ga0501043_0031909 | 3300049579 | Bacteria | 4140 |
| 1186 | Ga0501043_0082531 | 3300049579 | Bacteria | 2526 |
| 1187 | Ga0501043_0156262 | 3300049579 | Bacteria | 1783 |
| 1188 | Ga0501043_0180719 | 3300049579 | Bacteria | 1643 |
| 1189 | Ga0501046_0000610 | 3300049580 | Bacteria | 35093 |
| 1190 | Ga0501046_0031341 | 3300049580 | Bacteria | 4310 |
| 1191 | Ga0501046_0051563 | 3300049580 | Bacteria | 3246 |
| 1192 | Ga0501047_0000403 | 3300049581 | Bacteria | 48440 |
| 1193 | Ga0501047_0004202 | 3300049581 | Bacteria | 13562 |
| 1194 | Ga0501047_0010132 | 3300049581 | Bacteria | 8912 |
| 1195 | Ga0501047_0018122 | 3300049581 | Bacteria | 6747 |
| 1196 | Ga0501047_0029308 | 3300049581 | Bacteria | 5309 |
| 1197 | Ga0501047_0045788 | 3300049581 | Bacteria | 4229 |
| 1198 | Ga0501047_0142995 | 3300049581 | Bacteria | 2270 |
| 1199 | Ga0501047_0214056 | 3300049581 | Bacteria | 1784 |
| 1200 | Ga0501047_0289246 | 3300049581 | Bacteria | 1482 |
| 1201 | Ga0501048_0011643 | 3300049582 | Bacteria | 6559 |
| 1202 | Ga0501048_0131700 | 3300049582 | Bacteria | 1767 |
| 1203 | Ga0501048_0187621 | 3300049582 | Bacteria | 1465 |
| 1204 | Ga0501048_0218060 | 3300049582 | Bacteria | 1353 |
| 1205 | Ga0501067_0003187 | 3300049583 | Bacteria | 9052 |
| 1206 | Ga0501067_0021975 | 3300049583 | Bacteria | 3530 |
| 1207 | Ga0501067_0108523 | 3300049583 | Bacteria | 1543 |
| 1208 | Ga0501068_0017125 | 3300049584 | Bacteria | 4188 |
| 1209 | Ga0501068_0038381 | 3300049584 | Bacteria | 2869 |
| 1210 | Ga0501069_0002608 | 3300049585 | Bacteria | 9196 |
| 1211 | Ga0501069_0022269 | 3300049585 | Bacteria | 3445 |
| 1212 | Ga0501069_0028513 | 3300049585 | Bacteria | 3061 |
| 1213 | Ga0501069_0034417 | 3300049585 | Bacteria | 2790 |
| 1214 | Ga0501070_0002872 | 3300049586 | Bacteria | 15008 |
| 1215 | Ga0501070_0008207 | 3300049586 | Bacteria | 8833 |
| 1216 | Ga0501070_0030674 | 3300049586 | Bacteria | 4504 |
| 1217 | Ga0501070_0034069 | 3300049586 | Bacteria | 4260 |
| 1218 | Ga0501070_0047755 | 3300049586 | Bacteria | 3557 |
| 1219 | Ga0501070_0052658 | 3300049586 | Bacteria | 3378 |
| 1220 | Ga0501070_0086653 | 3300049586 | Bacteria | 2592 |
| 1221 | Ga0501070_0129794 | 3300049586 | Bacteria | 2082 |
| 1222 | Ga0501070_0134916 | 3300049586 | Bacteria | 2038 |
| 1223 | Ga0501070_0146545 | 3300049586 | Bacteria | 1949 |
| 1224 | Ga0501070_0185922 | 3300049586 | Bacteria | 1709 |
| 1225 | Ga0501071_0034538 | 3300049587 | Bacteria | 3600 |
| 1226 | Ga0501071_0088308 | 3300049587 | Bacteria | 2274 |
| 1227 | Ga0501071_0095971 | 3300049587 | Bacteria | 2182 |
| 1228 | Ga0501072_0004709 | 3300049588 | Bacteria | 10399 |
| 1229 | Ga0501072_0202262 | 3300049588 | Bacteria | 1584 |
| 1230 | Ga0501073_0007366 | 3300049589 | Bacteria | 8185 |
| 1231 | Ga0501073_0008386 | 3300049589 | Bacteria | 7666 |
| 1232 | Ga0501073_0045213 | 3300049589 | Bacteria | 3102 |
| 1233 | Ga0501073_0067874 | 3300049589 | Bacteria | 2486 |
| 1234 | Ga0501073_0081964 | 3300049589 | Bacteria | 2244 |
| 1235 | Ga0501073_0391256 | 3300049589 | Bacteria | 960 |
| 1236 | Ga0501074_0014799 | 3300049590 | Bacteria | 5675 |
| 1237 | Ga0501074_0030893 | 3300049590 | Bacteria | 3881 |
| 1238 | Ga0501074_0046392 | 3300049590 | Bacteria | 3141 |
| 1239 | Ga0501074_0049582 | 3300049590 | Bacteria | 3032 |
| 1240 | Ga0501074_0148533 | 3300049590 | Bacteria | 1676 |
| 1241 | Ga0501075_0011521 | 3300049591 | Bacteria | 6259 |
| 1242 | Ga0501216_004147 | 3300049660 | Bacteria | 2142 |
| 1243 | Ga0501227_000487 | 3300049665 | Bacteria | 8444 |
| 1244 | Ga0501227_009037 | 3300049665 | Bacteria | 2142 |
| 1245 | Ga0501233_002222 | 3300049668 | Bacteria | 3401 |
| 1246 | Ga0501221_013866 | 3300049704 | Bacteria | 1489 |
| 1247 | Ga0501225_0005311 | 3300049705 | Bacteria | 3784 |
| 1248 | Ga0501225_0012786 | 3300049705 | Bacteria | 2355 |
| 1249 | Ga0501079_0225958 | 3300049741 | Bacteria | 1462 |
| 1250 | Ga0501079_0310938 | 3300049741 | Bacteria | 1233 |
| 1251 | Ga0501080_0004522 | 3300049742 | Bacteria | 12395 |
| 1252 | Ga0501080_0033509 | 3300049742 | Bacteria | 4794 |
| 1253 | Ga0501080_0064962 | 3300049742 | Bacteria | 3394 |
| 1254 | Ga0501080_0175100 | 3300049742 | Bacteria | 1977 |
| 1255 | Ga0501080_0175733 | 3300049742 | Bacteria | 1972 |
| 1256 | Ga0501080_0230085 | 3300049742 | Bacteria | 1695 |
| 1257 | Ga0501080_0529057 | 3300049742 | Bacteria | 1051 |
| 1258 | Ga0501083_0010153 | 3300049744 | Bacteria | 6635 |
| 1259 | Ga0501083_0185624 | 3300049744 | Bacteria | 1357 |
| 1260 | Ga0501266_005358 | 3300049763 | Bacteria | 1597 |
| 1261 | Ga0501268_017371 | 3300049765 | Bacteria | 1200 |
| 1262 | Ga0501275_000196 | 3300049772 | Bacteria | 7076 |
| 1263 | Ga0501035_0002806 | 3300049822 | Bacteria | 16845 |
| 1264 | Ga0501035_0005911 | 3300049822 | Bacteria | 11521 |
| 1265 | Ga0501035_0020001 | 3300049822 | Bacteria | 6149 |
| 1266 | Ga0501035_0026236 | 3300049822 | Bacteria | 5332 |
| 1267 | Ga0501035_0066830 | 3300049822 | Bacteria | 3190 |
| 1268 | Ga0501035_0067564 | 3300049822 | Bacteria | 3171 |
| 1269 | Ga0501035_0116644 | 3300049822 | Bacteria | 2336 |
| 1270 | Ga0501035_0516911 | 3300049822 | Bacteria | 981 |
| 1271 | Ga0501044_0001991 | 3300049823 | Bacteria | 23606 |
| 1272 | Ga0501044_0005512 | 3300049823 | Bacteria | 14053 |
| 1273 | Ga0501044_0009796 | 3300049823 | Bacteria | 10419 |
| 1274 | Ga0501044_0012777 | 3300049823 | Bacteria | 9093 |
| 1275 | Ga0501044_0016869 | 3300049823 | Bacteria | 7836 |
| 1276 | Ga0501044_0019410 | 3300049823 | Bacteria | 7274 |
| 1277 | Ga0501044_0020401 | 3300049823 | Bacteria | 7076 |
| 1278 | Ga0501044_0025173 | 3300049823 | Bacteria | 6310 |
| 1279 | Ga0501044_0055937 | 3300049823 | Bacteria | 4050 |
| 1280 | Ga0501044_0094458 | 3300049823 | Bacteria | 3015 |
| 1281 | Ga0501044_0110033 | 3300049823 | Bacteria | 2764 |
| 1282 | Ga0501044_0113639 | 3300049823 | Bacteria | 2714 |
| 1283 | Ga0501044_0125765 | 3300049823 | Bacteria | 2561 |
| 1284 | Ga0501044_0125974 | 3300049823 | Bacteria | 2559 |
| 1285 | Ga0501044_0165864 | 3300049823 | Bacteria | 2183 |
| 1286 | Ga0501044_0208594 | 3300049823 | Bacteria | 1909 |
| 1287 | Ga0501044_0417124 | 3300049823 | Bacteria | 1253 |
| 1288 | nmdc:mga00v17_173377_c1 | 3300050491 | Bacteria | 1391 |
| 1289 | nmdc:mga00v17_322994_c1 | 3300050491 | Bacteria | 1003 |
| 1290 | nmdc:mga00v17_473_c1 | 3300050491 | Bacteria | 22592 |
| 1291 | nmdc:mga00v17_5873_c1 | 3300050491 | Bacteria | 6484 |
| 1292 | nmdc:mga00v17_70041_c1 | 3300050491 | Bacteria | 2172 |
| 1293 | nmdc:mga06z11_119943_c1 | 3300050494 | Bacteria | 1466 |
| 1294 | nmdc:mga05p37_341262_c2 | 3300050507 | Bacteria | 1254 |
| 1295 | nmdc:mga09592_18444_c1 | 3300050508 | Bacteria | 5723 |
| 1296 | nmdc:mga09592_9294_c1 | 3300050508 | Bacteria | 7992 |
| 1297 | nmdc:mga09592_9898_c1 | 3300050508 | Bacteria | 7753 |
| 1298 | nmdc:mga0qj67_206550_c1 | 3300050509 | Bacteria | 1595 |
| 1299 | nmdc:mga0qj67_79983_c1 | 3300050509 | Bacteria | 2618 |
| 1300 | nmdc:mga06r32_440633_c1 | 3300050510 | Unclassified | 1283 |
| 1301 | nmdc:mga08y16_336478_c1 | 3300050511 | Bacteria | 1552 |
| 1302 | nmdc:mga08y16_82022_c1 | 3300050511 | Bacteria | 3362 |
| 1303 | nmdc:mga0rr50_176501_c1 | 3300050513 | Bacteria | 1744 |
| 1304 | nmdc:mga0rr50_383273_c1 | 3300050513 | Bacteria | 1186 |
| 1305 | Ga0500610_0009379 | 3300053079 | Bacteria | 4334 |
| 1306 | Ga0500643_000103 | 3300053087 | Bacteria | 87887 |
| 1307 | Ga0500643_006045 | 3300053087 | Bacteria | 5116 |
| 1308 | Ga0500651_0000239 | 3300053093 | Bacteria | 33889 |
| 1309 | Ga0500651_0042021 | 3300053093 | Bacteria | 2881 |
| 1310 | Ga0500555_000554 | 3300053103 | Bacteria | 14879 |
| 1311 | Ga0500597_000039 | 3300053120 | Bacteria | 26299 |
| 1312 | Ga0500626_053580 | 3300053128 | Bacteria | 1812 |
| 1313 | Ga0500568_0001946 | 3300053139 | Bacteria | 12657 |
| 1314 | Ga0500568_0008117 | 3300053139 | Bacteria | 5090 |
| 1315 | Ga0500620_002235 | 3300053155 | Bacteria | 3835 |
| 1316 | Ga0500633_0000431 | 3300053160 | Bacteria | 6585 |
| 1317 | Ga0500634_0000229 | 3300053161 | Bacteria | 18154 |
| 1318 | Ga0500645_001165 | 3300053730 | Bacteria | 14117 |
| 1319 | Ga0501084_0034311 | 3300054114 | Bacteria | 4243 |
| 1320 | Ga0501084_0126409 | 3300054114 | Bacteria | 2151 |
| 1321 | Ga0501084_0190487 | 3300054114 | Bacteria | 1730 |
| 1322 | Ga0501082_0010653 | 3300060353 | Bacteria | 7914 |
| 1323 | Ga0501082_0017743 | 3300060353 | Bacteria | 6130 |
| 1324 | Ga0466962_0002470 | 3300061719 | Bacteria | 8766 |
| 1325 | Ga0466962_0010704 | 3300061719 | Bacteria | 4411 |
| 1326 | Ga0466962_0028639 | 3300061719 | Bacteria | 2667 |
| 1327 | 2525557105 | 2524614729 | Bacteria | 3091755 |
| 1328 | 2547502711 | 2547132130 | Bacteria | 4660562 |
| 1329 | 2572256341 | 2571042365 | Bacteria | 3289345 |
| 1330 | 2578458754 | 2576861471 | Bacteria | 4648976 |
| 1331 | 2595447090 | 2593339238 | Bacteria | 4182970 |
| 1332 | 2595449848 | 2593339239 | Bacteria | 4124669 |
| 1333 | 2630648701 | 2627854209 | Bacteria | 3093011 |
| 1334 | 2643816287 | 2643221559 | Bacteria | 4424915 |
| 1335 | 2643881653 | 2643221573 | Bacteria | 4784121 |
| 1336 | 2643905591 | 2643221579 | Bacteria | 4443405 |
| 1337 | 2643913276 | 2643221581 | Bacteria | 3893603 |
| 1338 | 2643939028 | 2643221586 | Bacteria | 4446529 |
| 1339 | 2643977666 | 2643221593 | Bacteria | 6296053 |
| 1340 | 2644077231 | 2643221612 | Bacteria | 4361984 |
| 1341 | 2644528660 | 2643221695 | Bacteria | 3441323 |
| 1342 | 2644662742 | 2643221720 | Bacteria | 4694283 |
| 1343 | 2644694542 | 2643221727 | Bacteria | 4415595 |
| 1344 | 2644698304 | 2643221728 | Bacteria | 4797149 |
| 1345 | 2687582214 | 2687453130 | Bacteria | 4227172 |
| 1346 | 2721026250 | 2718218334 | Bacteria | 4765486 |
| 1347 | 2735833774 | 2734482264 | Unclassified | 5014763 |
| 1348 | 2739228762 | 2738543009 | Bacteria | 4944499 |
| 1349 | 2739732263 | 2739367700 | Bacteria | 4747630 |
| 1350 | 2740992581 | 2740891818 | Bacteria | 6711283 |
| 1351 | 2747950782 | 2747842428 | Bacteria | 4689383 |
| 1352 | 2765578642 | 2765235840 | Bacteria | 4663337 |
| 1353 | 2816516718 | 2816332141 | Bacteria | 4436036 |
| 1354 | 2819564233 | 2818991440 | Bacteria | 4774720 |
| 1355 | 2819659992 | 2818991457 | Bacteria | 5323295 |
| 1356 | 2842394953 | 2842391507 | Bacteria | 4486072 |
| 1357 | 2842758441 | 2842757796 | Bacteria | 3981385 |
| 1358 | 2842781250 | 2842780639 | Bacteria | 4337790 |
| 1359 | 2842918118 | 2842914999 | Bacteria | 4419378 |
| 1360 | 2842920146 | 2842918807 | Bacteria | 4289178 |
| 1361 | 2852651108 | 2852649853 | Bacteria | 4036942 |
| 1362 | 2852685188 | 2852684882 | Bacteria | 5463342 |
| 1363 | 2857445258 | 2857442823 | Bacteria | 4562550 |
| 1364 | 2874221271 | 2874220319 | Bacteria | 4594709 |
| 1365 | 2884341762 | 2884338543 | Bacteria | 4610696 |
| 1366 | 2884411510 | 2884411467 | Bacteria | 5246714 |
| 1367 | 2894416170 | 2894414249 | Bacteria | 4405451 |
| 1368 | 2895396532 | 2895395659 | Bacteria | 3983269 |
| 1369 | 2895498991 | 2895498888 | Bacteria | 5283788 |
| 1370 | 2895512029 | 2895511927 | Bacteria | 6802080 |
| 1371 | 2895524904 | 2895522137 | Bacteria | 3284416 |
| 1372 | 2895527973 | 2895525241 | Bacteria | 3388457 |
| 1373 | 2904464873 | 2904463128 | Bacteria | 4775606 |
| 1374 | 2919091776 | 2919089067 | Bacteria | 4560942 |
| 1375 | 2919130730 | 2919130084 | Bacteria | 5301837 |
| 1376 | 2919136171 | 2919134579 | Bacteria | 4480386 |
| 1377 | 2919406382 | 2919404418 | Bacteria | 4232372 |
| 1378 | 2919515290 | 2919513703 | Bacteria | 3844312 |
| 1379 | 2919678305 | 2919675420 | Bacteria | 3969095 |
| 1380 | 2923517700 | 2923516293 | Bacteria | 3716336 |
| 1381 | 2928496240 | 2928496128 | Bacteria | 4631123 |
| 1382 | 2928964948 | 2928963466 | Bacteria | 5165703 |
| 1383 | 2929198264 | 2929195423 | Bacteria | 5325372 |
| 1384 | 2931381086 | 2931380184 | Bacteria | 4455911 |
| 1385 | 2937612092 | 2937610967 | Bacteria | 4618818 |
| 1386 | 2939590721 | 2939589442 | Bacteria | 4214238 |
| 1387 | 2939615183 | 2939611941 | Bacteria | 3892017 |
| 1388 | 2939622907 | 2939622612 | Bacteria | 4698046 |
| 1389 | 2939630831 | 2939626828 | Bacteria | 4695272 |
| 1390 | 2941475470 | 2941471342 | Bacteria | 5018624 |
| 1391 | 2941477947 | 2941475908 | Bacteria | 4145589 |
| 1392 | 2941489812 | 2941489479 | Bacteria | 6313767 |
| 1393 | 2961048037 | 2961047084 | Bacteria | 4594415 |
| 1394 | 2961065057 | 2961064222 | Bacteria | 4749990 |
| 1395 | 2974309231 | 2974307012 | Bacteria | 4172388 |
| 1396 | 2977249952 | 2977247770 | Bacteria | 4160543 |
| 1397 | 2984515559 | 2984514374 | Bacteria | 4172479 |
| 1398 | 2987606301 | 2987605356 | Bacteria | 4187822 |
| 1399 | 2995950679 | 2995948881 | Bacteria | 6358104 |
| 1400 | 8003016545 | 8003014200 | Bacteria | 4059994 |
| 1401 | 8021625305 | 8021622325 | Bacteria | 4844743 |
| 1402 | 8021630213 | 8021626552 | Bacteria | 4665214 |
| 1403 | 8021652126 | 8021648035 | Bacteria | 4772378 |
| 1404 | Ga0501031_0010414 | |||
| 1405 | SwRhRL2b_contig_3686161 | |||
| 1406 | JGI24736J21556_1011109 | |||
| 1407 | JGI24741J21665_1000813 | |||
| 1408 | JGI24741J21665_1006639 | |||
| 1409 | JGI24740J21852_10000219 | |||
| 1410 | JGI24739J22299_10000243 | |||
| 1411 | JGI24737J22298_10000669 | |||
| 1412 | JGI24737J22298_10013681 | |||
| 1413 | JGI24738J21930_10000133 | |||
| 1414 | JGI25156J39149_1004682 | |||
| 1415 | JGI25156J39149_1019717 | |||
| 1416 | JGI25156J39149_1019783 | |||
| 1417 | JGI25162J39368_1000124 | |||
| 1418 | JGI25162J39368_1001252 | |||
| 1419 | JGI25162J39368_1002606 | |||
| 1420 | JGI25162J39368_1002830 | |||
| 1421 | JGI25154J39366_1004567 | |||
| 1422 | JGI25157J39369_1000047 | |||
| 1423 | JGI25157J39369_1000465 | |||
| 1424 | JGI25157J39369_1000622 | |||
| 1425 | JGI25157J39369_1001028 | |||
| 1426 | JGI25157J39369_1010638 | |||
| 1427 | JGI25157J39369_1010677 | |||
| 1428 | JGI25163J39215_1000218 | |||
| 1429 | JGI25164J39214_1000134 | |||
| 1430 | JGI25164J39214_1000196 | |||
| 1431 | JGI25164J39214_1000436 | |||
| 1432 | JGI25164J39214_1000438 | |||
| 1433 | JGI25164J39214_1000955 | |||
| 1434 | JGI25164J39214_1001334 | |||
| 1435 | JGI25152J39213_1002119 | |||
| 1436 | JGI25150J39212_1001176 | |||
| 1437 | JGI25151J46595_10000257 | |||
| 1438 | JGI25151J46595_10000558 | |||
| 1439 | JGI25151J46595_10035027 | |||
| 1440 | JGI25151J46595_10067063 | |||
| 1441 | JGI25165J46597_1000119 | |||
| 1442 | JGI25165J46597_1000223 | |||
| 1443 | JGI25165J46597_1000275 | |||
| 1444 | JGI25165J46597_1002075 | |||
| 1445 | JGI25153J46596_10000334 | |||
| 1446 | rootH1_10057363 | |||
| 1447 | rootH2_10023810 | |||
| 1448 | rootH1_10187769 | |||
| 1449 | Ga0006562J51391_1003759 | |||
| 1450 | Ga0055538_1002063 | |||
| 1451 | Ga0055539_1001661 | |||
| 1452 | Ga0055533_1001179 | |||
| 1453 | Ga0055533_1001398 | |||
| 1454 | Ga0055525_1000111 | |||
| 1455 | Ga0055527_1000053 | |||
| 1456 | Ga0055527_1000114 | |||
| 1457 | Ga0055535_1000313 | |||
| 1458 | Ga0055535_1000340 | |||
| 1459 | Ga0055535_1000362 | |||
| 1460 | Ga0055535_1000440 | |||
| 1461 | Ga0055535_1000825 | |||
| 1462 | Ga0055535_1001942 | |||
| 1463 | Ga0055542_1000160 | |||
| 1464 | Ga0055542_1000240 | |||
| 1465 | Ga0055542_1000274 | |||
| 1466 | Ga0055542_1000371 | |||
| 1467 | Ga0055542_1000418 | |||
| 1468 | Ga0055542_1000825 | |||
| 1469 | Ga0055529_1000024 | |||
| 1470 | Ga0055529_1000161 | |||
| 1471 | Ga0055529_1000264 | |||
| 1472 | Ga0055529_1000296 | |||
| 1473 | Ga0055526_1000008 | |||
| 1474 | Ga0055526_1001264 | |||
| 1475 | Ga0055537_1000145 | |||
| 1476 | Ga0055537_1000338 | |||
| 1477 | Ga0055524_1000087 | |||
| 1478 | Ga0055524_1016305 | |||
| 1479 | Ga0055536_1001416 | |||
| 1480 | Ga0055536_1007159 | |||
| 1481 | Ga0055536_1007642 | |||
| 1482 | Ga0055536_1017277 | |||
| 1483 | Ga0055534_1000003 | |||
| 1484 | Ga0055534_1000039 | |||
| 1485 | Ga0055528_1000004 | |||
| 1486 | Ga0055528_1000212 | |||
| 1487 | Ga0055530_10000544 | |||
| 1488 | Ga0055530_10001029 | |||
| 1489 | Ga0055530_10001078 | |||
| 1490 | Ga0055531_10007594 | |||
| 1491 | Ga0055531_10011798 | |||
| 1492 | Ga0055531_10017155 | |||
| 1493 | Ga0055531_10029813 | |||
| 1494 | Ga0055531_10052738 | |||
| 1495 | Ga0058692_1000002 | |||
| 1496 | Ga0058692_1000006 | |||
| 1497 | Ga0065165_1005309 | |||
| 1498 | Ga0065704_10071155 | |||
| 1499 | Ga0065704_10071748 | |||
| 1500 | Ga0065704_10103241 | |||
| 1501 | Ga0065704_10174745 | |||
| 1502 | Ga0065704_10182412 | |||
| 1503 | Ga0065704_10245209 | |||
| 1504 | Ga0065715_10101077 | |||
| 1505 | Ga0065715_10110041 | |||
| 1506 | Ga0070658_10058881 | |||
| 1507 | Ga0070658_10255056 | |||
| 1508 | Ga0070676_10219546 | |||
| 1509 | Ga0070683_100041294 | |||
| 1510 | Ga0070683_100180314 | |||
| 1511 | Ga0070690_100080808 | |||
| 1512 | Ga0070670_100045095 | |||
| 1513 | Ga0070670_100132792 | |||
| 1514 | Ga0070670_100193136 | |||
| 1515 | Ga0070670_100258478 | |||
| 1516 | Ga0070670_100297996 | |||
| 1517 | Ga0070680_100003486 | |||
| 1518 | Ga0070680_100004486 | |||
| 1519 | Ga0070680_100113856 | |||
| 1520 | Ga0070680_100135659 | |||
| 1521 | Ga0070680_100275610 | |||
| 1522 | Ga0070682_100025405 | |||
| 1523 | Ga0070682_100179334 | |||
| 1524 | Ga0068868_100284710 | |||
| 1525 | Ga0070660_100005329 | |||
| 1526 | Ga0070660_100063795 | |||
| 1527 | Ga0070660_100111749 | |||
| 1528 | Ga0070660_100387323 | |||
| 1529 | Ga0070689_100031318 | |||
| 1530 | Ga0070689_100036392 | |||
| 1531 | Ga0070689_100248488 | |||
| 1532 | Ga0070691_10021483 | |||
| 1533 | Ga0070661_100006947 | |||
| 1534 | Ga0070661_100010502 | |||
| 1535 | Ga0070661_100029576 | |||
| 1536 | Ga0070661_100052266 | |||
| 1537 | Ga0070661_100095325 | |||
| 1538 | Ga0070661_100132831 | |||
| 1539 | Ga0070692_10003447 | |||
| 1540 | Ga0070692_10011702 | |||
| 1541 | Ga0070668_100014917 | |||
| 1542 | Ga0070668_100032294 | |||
| 1543 | Ga0070668_100109256 | |||
| 1544 | Ga0070669_100030652 | |||
| 1545 | Ga0070671_100003371 | |||
| 1546 | Ga0070671_100041811 | |||
| 1547 | Ga0070671_100106270 | |||
| 1548 | Ga0070673_100003011 | |||
| 1549 | Ga0070688_100197255 | |||
| 1550 | Ga0070659_100225731 | |||
| 1551 | Ga0070659_100227371 | |||
| 1552 | Ga0070667_100198567 | |||
| 1553 | Ga0070667_100554360 | |||
| 1554 | Ga0070703_10078108 | |||
| 1555 | Ga0070714_100000306 | |||
| 1556 | Ga0070714_100006767 | |||
| 1557 | Ga0070714_100008435 | |||
| 1558 | Ga0070713_100002668 | |||
| 1559 | Ga0070711_100594880 | |||
| 1560 | Ga0070694_100360251 | |||
| 1561 | Ga0070708_100087187 | |||
| 1562 | Ga0070663_100004478 | |||
| 1563 | Ga0070663_100005489 | |||
| 1564 | Ga0070663_100006531 | |||
| 1565 | Ga0070663_100046365 | |||
| 1566 | Ga0070663_100100902 | |||
| 1567 | Ga0070678_100013349 | |||
| 1568 | Ga0070678_100031906 | |||
| 1569 | Ga0070662_100037135 | |||
| 1570 | Ga0070662_100112976 | |||
| 1571 | Ga0070681_10000086 | |||
| 1572 | Ga0070681_10000199 | |||
| 1573 | Ga0070681_10003486 | |||
| 1574 | Ga0070681_10028227 | |||
| 1575 | Ga0070681_10031798 | |||
| 1576 | Ga0070681_10039265 | |||
| 1577 | Ga0068867_100042494 | |||
| 1578 | Ga0068867_100046909 | |||
| 1579 | Ga0068867_100182253 | |||
| 1580 | Ga0070685_10003148 | |||
| 1581 | Ga0070698_100000567 | |||
| 1582 | Ga0070679_100000589 | |||
| 1583 | Ga0070679_100000739 | |||
| 1584 | Ga0070679_100013004 | |||
| 1585 | Ga0070679_100027652 | |||
| 1586 | Ga0070679_100033157 | |||
| 1587 | Ga0070679_100117068 | |||
| 1588 | Ga0070679_100453475 | |||
| 1589 | Ga0070684_100010589 | |||
| 1590 | Ga0070684_100018885 | |||
| 1591 | Ga0070684_100129558 | |||
| 1592 | Ga0070684_100432608 | |||
| 1593 | Ga0068853_100008449 | |||
| 1594 | Ga0068853_100014525 | |||
| 1595 | Ga0068853_100036176 | |||
| 1596 | Ga0068853_100043092 | |||
| 1597 | Ga0068853_100197148 | |||
| 1598 | Ga0070672_100034801 | |||
| 1599 | Ga0070672_100059578 | |||
| 1600 | Ga0070686_100027863 | |||
| 1601 | Ga0070696_100003674 | |||
| 1602 | Ga0070696_100007524 | |||
| 1603 | Ga0070696_100026727 | |||
| 1604 | Ga0070693_100008121 | |||
| 1605 | Ga0070693_100016526 | |||
| 1606 | Ga0070693_100020347 | |||
| 1607 | Ga0070693_100022988 | |||
| 1608 | Ga0070665_100000237 | |||
| 1609 | Ga0070665_100015986 | |||
| 1610 | Ga0070665_100055673 | |||
| 1611 | Ga0070665_100116552 | |||
| 1612 | Ga0070665_100129831 | |||
| 1613 | Ga0070665_100181087 | |||
| 1614 | Ga0070665_100200600 | |||
| 1615 | Ga0070665_100254246 | |||
| 1616 | Ga0070665_100262107 | |||
| 1617 | Ga0070665_100285093 | |||
| 1618 | Ga0070704_100023769 | |||
| 1619 | Ga0068855_100003227 | |||
| 1620 | Ga0068855_100015077 | |||
| 1621 | Ga0068855_100016959 | |||
| 1622 | Ga0068855_100022476 | |||
| 1623 | Ga0068855_100037824 | |||
| 1624 | Ga0068855_100094390 | |||
| 1625 | Ga0068855_100210809 | |||
| 1626 | Ga0068855_100468593 | |||
| 1627 | Ga0068855_100485454 | |||
| 1628 | Ga0068855_100492474 | |||
| 1629 | Ga0068855_100670633 | |||
| 1630 | Ga0070664_100291488 | |||
| 1631 | Ga0068857_100000180 | |||
| 1632 | Ga0068857_100005918 | |||
| 1633 | Ga0068857_100111552 | |||
| 1634 | Ga0068857_100291234 | |||
| 1635 | Ga0068854_100003500 | |||
| 1636 | Ga0068854_100014806 | |||
| 1637 | Ga0068854_100014875 | |||
| 1638 | Ga0068854_100015665 | |||
| 1639 | Ga0068854_100016080 | |||
| 1640 | Ga0068856_100000074 | |||
| 1641 | Ga0068856_100001551 | |||
| 1642 | Ga0068856_100012624 | |||
| 1643 | Ga0068856_100021481 | |||
| 1644 | Ga0068856_100130884 | |||
| 1645 | Ga0068856_100137484 | |||
| 1646 | Ga0068856_100153894 | |||
| 1647 | Ga0068856_100194133 | |||
| 1648 | Ga0068856_100400019 | |||
| 1649 | Ga0068856_100508288 | |||
| 1650 | Ga0070702_100036432 | |||
| 1651 | Ga0068852_100002579 | |||
| 1652 | Ga0068852_100007543 | |||
| 1653 | Ga0068852_100085277 | |||
| 1654 | Ga0068859_100119518 | |||
| 1655 | Ga0068864_100012182 | |||
| 1656 | Ga0068864_100028713 | |||
| 1657 | Ga0068864_100062451 | |||
| 1658 | Ga0068864_100110229 | |||
| 1659 | Ga0068864_100215793 | |||
| 1660 | Ga0068866_10039851 | |||
| 1661 | Ga0068861_100013414 | |||
| 1662 | Ga0068861_100232559 | |||
| 1663 | Ga0068851_10001429 | |||
| 1664 | Ga0068851_10023201 | |||
| 1665 | Ga0068863_100009921 | |||
| 1666 | Ga0068863_100383589 | |||
| 1667 | Ga0068858_100025509 | |||
| 1668 | Ga0068858_100055234 | |||
| 1669 | Ga0068860_100027053 | |||
| 1670 | Ga0068860_100106873 | |||
| 1671 | Ga0068860_100694567 | |||
| 1672 | Ga0068862_100063729 | |||
| 1673 | Ga0068862_100242886 | |||
| 1674 | Ga0081540_1007915 | |||
| 1675 | Ga0070717_10644565 | |||
| 1676 | Ga0075363_100076865 | |||
| 1677 | Ga0075364_10000156 | |||
| 1678 | Ga0075364_10019911 | |||
| 1679 | Ga0075367_10059460 | |||
| 1680 | Ga0075369_10033668 | |||
| 1681 | Ga0097621_100043633 | |||
| 1682 | Ga0097621_100117910 | |||
| 1683 | Ga0068871_100042261 | |||
| 1684 | Ga0068871_100165152 | |||
| 1685 | Ga0075428_100501872 | |||
| 1686 | Ga0075430_100013708 | |||
| 1687 | Ga0075430_100031816 | |||
| 1688 | Ga0075430_100054394 | |||
| 1689 | Ga0075430_100214799 | |||
| 1690 | Ga0075429_100010231 | |||
| 1691 | Ga0075429_100015423 | |||
| 1692 | Ga0075429_100061688 | |||
| 1693 | Ga0075429_100076760 | |||
| 1694 | Ga0068865_100104168 | |||
| 1695 | Ga0097620_100119518 | |||
| 1696 | Ga0075435_100418708 | |||
| 1697 | Ga0105251_10000597 | |||
| 1698 | Ga0105251_10002239 | |||
| 1699 | Ga0105240_10010415 | |||
| 1700 | Ga0105240_10014636 | |||
| 1701 | Ga0105240_10015324 | |||
| 1702 | Ga0105240_10016233 | |||
| 1703 | Ga0105240_10018380 | |||
| 1704 | Ga0105240_10033449 | |||
| 1705 | Ga0105240_10054441 | |||
| 1706 | Ga0105240_10070725 | |||
| 1707 | Ga0105240_10071884 | |||
| 1708 | Ga0105240_10071908 | |||
| 1709 | Ga0105240_10117179 | |||
| 1710 | Ga0111539_10158205 | |||
| 1711 | Ga0105245_10000070 | |||
| 1712 | Ga0105245_10083402 | |||
| 1713 | Ga0105243_10006063 | |||
| 1714 | Ga0105243_10032254 | |||
| 1715 | Ga0105243_10337839 | |||
| 1716 | Ga0105241_10002770 | |||
| 1717 | Ga0105241_10003714 | |||
| 1718 | Ga0105241_10058772 | |||
| 1719 | Ga0105242_10507439 | |||
| 1720 | Ga0105248_10007576 | |||
| 1721 | Ga0105248_10015012 | |||
| 1722 | Ga0105248_10052738 | |||
| 1723 | Ga0105237_10000214 | |||
| 1724 | Ga0105237_10002033 | |||
| 1725 | Ga0105237_10009902 | |||
| 1726 | Ga0105237_10013212 | |||
| 1727 | Ga0105237_10078674 | |||
| 1728 | Ga0105237_10107835 | |||
| 1729 | Ga0105237_10140310 | |||
| 1730 | Ga0105237_10482908 | |||
| 1731 | Ga0105238_10006412 | |||
| 1732 | Ga0105238_10018096 | |||
| 1733 | Ga0105238_10022371 | |||
| 1734 | Ga0105238_10110718 | |||
| 1735 | Ga0105238_10166892 | |||
| 1736 | Ga0105249_10001773 | |||
| 1737 | Ga0105239_10000390 | |||
| 1738 | Ga0105239_10005287 | |||
| 1739 | Ga0105239_10014113 | |||
| 1740 | Ga0105239_10015740 | |||
| 1741 | Ga0105239_10017459 | |||
| 1742 | Ga0105239_10017493 | |||
| 1743 | Ga0105239_10068068 | |||
| 1744 | Ga0105239_10090965 | |||
| 1745 | Ga0105239_10112753 | |||
| 1746 | Ga0105239_10278980 | |||
| 1747 | Ga0105239_10317488 | |||
| 1748 | Ga0105246_10006015 | |||
| 1749 | Ga0157314_1000578 | |||
| 1750 | Ga0157373_10008009 | |||
| 1751 | Ga0157373_10326188 | |||
| 1752 | Ga0157371_10000487 | |||
| 1753 | Ga0157371_10004532 | |||
| 1754 | Ga0157371_10020289 | |||
| 1755 | Ga0157371_10033680 | |||
| 1756 | Ga0157371_10067563 | |||
| 1757 | Ga0157371_10096244 | |||
| 1758 | Ga0157371_10191613 | |||
| 1759 | Ga0157371_10240522 | |||
| 1760 | Ga0157370_10002080 | |||
| 1761 | Ga0157370_10004104 | |||
| 1762 | Ga0157370_10007609 | |||
| 1763 | Ga0157370_10015272 | |||
| 1764 | Ga0157370_10096201 | |||
| 1765 | Ga0157370_10200547 | |||
| 1766 | Ga0157370_10271467 | |||
| 1767 | Ga0157369_10000030 | |||
| 1768 | Ga0157369_10002243 | |||
| 1769 | Ga0157369_10004626 | |||
| 1770 | Ga0157369_10007366 | |||
| 1771 | Ga0157369_10023335 | |||
| 1772 | Ga0157369_10028763 | |||
| 1773 | Ga0157369_10118046 | |||
| 1774 | Ga0157374_10011293 | |||
| 1775 | Ga0157374_10023184 | |||
| 1776 | Ga0157374_10029499 | |||
| 1777 | Ga0157374_10057421 | |||
| 1778 | Ga0157378_10000158 | |||
| 1779 | Ga0157378_10030642 | |||
| 1780 | Ga0163162_10005297 | |||
| 1781 | Ga0163162_10029820 | |||
| 1782 | Ga0163162_10669708 | |||
| 1783 | Ga0157372_10001156 | |||
| 1784 | Ga0157372_10001163 | |||
| 1785 | Ga0157372_10009901 | |||
| 1786 | Ga0157372_10027403 | |||
| 1787 | Ga0157372_10030221 | |||
| 1788 | Ga0157372_10074640 | |||
| 1789 | Ga0157372_10192432 | |||
| 1790 | Ga0157372_10237659 | |||
| 1791 | Ga0157372_10684087 | |||
| 1792 | Ga0157372_10684788 | |||
| 1793 | Ga0157375_10002329 | |||
| 1794 | Ga0157375_10055851 | |||
| 1795 | Ga0157380_10042102 | |||
| 1796 | Ga0182008_10000143 | |||
| 1797 | Ga0182008_10001870 | |||
| 1798 | Ga0182008_10015447 | |||
| 1799 | Ga0182008_10016411 | |||
| 1800 | Ga0182008_10031878 | |||
| 1801 | Ga0182008_10079886 | |||
| 1802 | Ga0182008_10123506 | |||
| 1803 | Ga0157376_10005593 | |||
| 1804 | Ga0157376_10013924 | |||
| 1805 | Ga0157376_10132292 | |||
| 1806 | Ga0157376_10328088 | |||
| 1807 | Ga0157376_10486794 | |||
| 1808 | Ga0182006_1000148 | |||
| 1809 | Ga0182006_1000208 | |||
| 1810 | Ga0182006_1015497 | |||
| 1811 | Ga0182006_1019226 | |||
| 1812 | Ga0182006_1022687 | |||
| 1813 | Ga0182006_1025756 | |||
| 1814 | Ga0182006_1054130 | |||
| 1815 | Ga0182006_1090498 | |||
| 1816 | Ga0182007_10000043 | |||
| 1817 | Ga0182005_1000225 | |||
| 1818 | Ga0182005_1006372 | |||
| 1819 | Ga0182005_1007922 | |||
| 1820 | Ga0182005_1023059 | |||
| 1821 | Ga0183369_1003 | |||
| 1822 | Ga0183368_1002 | |||
| 1823 | Ga0183360_10001 | |||
| 1824 | Ga0163161_10002976 | |||
| 1825 | Ga0163161_10005305 | |||
| 1826 | Ga0163161_10027657 | |||
| 1827 | Ga0163161_10049683 | |||
| 1828 | Ga0206356_11596253 | |||
| 1829 | Ga0206354_10472637 | |||
| 1830 | Ga0206353_11520292 | |||
| 1831 | Ga0206353_11892459 | |||
| 1832 | Ga0209760_100270 | |||
| 1833 | Ga0209784_100011 | |||
| 1834 | Ga0209566_105937 | |||
| 1835 | Ga0209674_100061 | |||
| 1836 | Ga0209674_100077 | |||
| 1837 | Ga0209674_101778 | |||
| 1838 | Ga0209672_100004 | |||
| 1839 | Ga0209672_100022 | |||
| 1840 | Ga0209672_100167 | |||
| 1841 | Ga0209672_100729 | |||
| 1842 | Ga0209672_101194 | |||
| 1843 | Ga0209147_106714 | |||
| 1844 | Ga0209563_100103 | |||
| 1845 | Ga0209563_111997 | |||
| 1846 | Ga0207427_100026 | |||
| 1847 | Ga0207427_100086 | |||
| 1848 | Ga0207427_100160 | |||
| 1849 | Ga0207427_100690 | |||
| 1850 | Ga0209437_100005 | |||
| 1851 | Ga0209437_100178 | |||
| 1852 | Ga0209437_100244 | |||
| 1853 | Ga0209437_100293 | |||
| 1854 | Ga0209258_100003 | |||
| 1855 | Ga0209258_100004 | |||
| 1856 | Ga0209258_100027 | |||
| 1857 | Ga0209258_100182 | |||
| 1858 | Ga0209258_100327 | |||
| 1859 | Ga0209258_100610 | |||
| 1860 | Ga0209258_107210 | |||
| 1861 | Ga0207425_1000078 | |||
| 1862 | Ga0207425_1010809 | |||
| 1863 | Ga0209646_1001950 | |||
| 1864 | Ga0209646_1002809 | |||
| 1865 | Ga0209026_1000018 | |||
| 1866 | Ga0209026_1000084 | |||
| 1867 | Ga0209026_1000148 | |||
| 1868 | Ga0209026_1000155 | |||
| 1869 | Ga0209026_1000448 | |||
| 1870 | Ga0209026_1008095 | |||
| 1871 | Ga0209148_1000001 | |||
| 1872 | Ga0209148_1000025 | |||
| 1873 | Ga0209148_1000062 | |||
| 1874 | Ga0209148_1000083 | |||
| 1875 | Ga0209148_1000299 | |||
| 1876 | Ga0209148_1006983 | |||
| 1877 | Ga0209759_1000066 | |||
| 1878 | Ga0209759_1000257 | |||
| 1879 | Ga0209759_1000305 | |||
| 1880 | Ga0209759_1000824 | |||
| 1881 | Ga0209759_1006727 | |||
| 1882 | Ga0209759_1025447 | |||
| 1883 | Ga0209759_1025535 | |||
| 1884 | Ga0209129_1000157 | |||
| 1885 | Ga0209129_1002303 | |||
| 1886 | Ga0209129_1006121 | |||
| 1887 | Ga0209233_1000002 | |||
| 1888 | Ga0209233_1000011 | |||
| 1889 | Ga0209233_1000128 | |||
| 1890 | Ga0209233_1000246 | |||
| 1891 | Ga0209565_1000001 | |||
| 1892 | Ga0209565_1000014 | |||
| 1893 | Ga0209565_1004760 | |||
| 1894 | Ga0209455_1000004 | |||
| 1895 | Ga0209455_1000019 | |||
| 1896 | Ga0209455_1000040 | |||
| 1897 | Ga0209455_1000084 | |||
| 1898 | Ga0209455_1000186 | |||
| 1899 | Ga0209455_1007936 | |||
| 1900 | Ga0209673_1000001 | |||
| 1901 | Ga0209673_1000171 | |||
| 1902 | Ga0209673_1002529 | |||
| 1903 | Ga0209675_1000001 | |||
| 1904 | Ga0209675_1000011 | |||
| 1905 | Ga0209675_1015425 | |||
| 1906 | Ga0209676_1000027 | |||
| 1907 | Ga0209676_1000047 | |||
| 1908 | Ga0209676_1000079 | |||
| 1909 | Ga0209676_1000963 | |||
| 1910 | Ga0209676_1000970 | |||
| 1911 | Ga0209676_1002059 | |||
| 1912 | Ga0209676_1006843 | |||
| 1913 | Ga0209676_1009313 | |||
| 1914 | Ga0209025_1000015 | |||
| 1915 | Ga0209025_1000054 | |||
| 1916 | Ga0209025_1001242 | |||
| 1917 | Ga0209025_1007257 | |||
| 1918 | Ga0209025_1069645 | |||
| 1919 | Ga0209564_1000001 | |||
| 1920 | Ga0209564_1000221 | |||
| 1921 | Ga0209758_1000062 | |||
| 1922 | Ga0209758_1000577 | |||
| 1923 | Ga0209758_1010608 | |||
| 1924 | Ga0209758_1018409 | |||
| 1925 | Ga0209758_1027303 | |||
| 1926 | Ga0209050_1000329 | |||
| 1927 | Ga0209050_1000415 | |||
| 1928 | Ga0209256_1000002 | |||
| 1929 | Ga0209256_1001265 | |||
| 1930 | Ga0209256_1004398 | |||
| 1931 | Ga0209256_1004927 | |||
| 1932 | Ga0209256_1004947 | |||
| 1933 | Ga0209256_1037984 | |||
| 1934 | Ga0209051_1001449 | |||
| 1935 | Ga0209051_1006817 | |||
| 1936 | Ga0209051_1073048 | |||
| 1937 | Ga0209257_1000081 | |||
| 1938 | Ga0209257_1000530 | |||
| 1939 | Ga0209257_1000837 | |||
| 1940 | Ga0209257_1001863 | |||
| 1941 | Ga0209257_1006985 | |||
| 1942 | Ga0209257_1011577 | |||
| 1943 | Ga0209257_1022250 | |||
| 1944 | Ga0207656_10027525 | |||
| 1945 | Ga0207656_10110112 | |||
| 1946 | Ga0207713_1001379 | |||
| 1947 | Ga0207713_1006311 | |||
| 1948 | Ga0207710_10004497 | |||
| 1949 | Ga0207680_10095441 | |||
| 1950 | Ga0207680_10269538 | |||
| 1951 | Ga0207680_10329785 | |||
| 1952 | Ga0207647_10000008 | |||
| 1953 | Ga0207647_10000250 | |||
| 1954 | Ga0207647_10002043 | |||
| 1955 | Ga0207647_10010215 | |||
| 1956 | Ga0207647_10016245 | |||
| 1957 | Ga0207645_10043171 | |||
| 1958 | Ga0207705_10000168 | |||
| 1959 | Ga0207705_10000836 | |||
| 1960 | Ga0207705_10028178 | |||
| 1961 | Ga0207705_10079577 | |||
| 1962 | Ga0207654_10007686 | |||
| 1963 | Ga0207707_10000032 | |||
| 1964 | Ga0207707_10000422 | |||
| 1965 | Ga0207707_10001438 | |||
| 1966 | Ga0207707_10001792 | |||
| 1967 | Ga0207707_10030814 | |||
| 1968 | Ga0207707_10054519 | |||
| 1969 | Ga0207707_10073158 | |||
| 1970 | Ga0207707_10118927 | |||
| 1971 | Ga0207707_10444042 | |||
| 1972 | Ga0207695_10000320 | |||
| 1973 | Ga0207695_10000355 | |||
| 1974 | Ga0207695_10000933 | |||
| 1975 | Ga0207695_10000943 | |||
| 1976 | Ga0207695_10001343 | |||
| 1977 | Ga0207695_10001428 | |||
| 1978 | Ga0207695_10001726 | |||
| 1979 | Ga0207695_10002647 | |||
| 1980 | Ga0207695_10021778 | |||
| 1981 | Ga0207695_10043366 | |||
| 1982 | Ga0207695_10083885 | |||
| 1983 | Ga0207695_10378944 | |||
| 1984 | Ga0207671_10000057 | |||
| 1985 | Ga0207671_10001018 | |||
| 1986 | Ga0207671_10044985 | |||
| 1987 | Ga0207671_10364419 | |||
| 1988 | Ga0207693_10125060 | |||
| 1989 | Ga0207660_10000362 | |||
| 1990 | Ga0207660_10000402 | |||
| 1991 | Ga0207660_10007496 | |||
| 1992 | Ga0207660_10126323 | |||
| 1993 | Ga0207660_10275262 | |||
| 1994 | Ga0207657_10002254 | |||
| 1995 | Ga0207657_10002369 | |||
| 1996 | Ga0207657_10004447 | |||
| 1997 | Ga0207657_10107616 | |||
| 1998 | Ga0207649_10001307 | |||
| 1999 | Ga0207649_10002328 | |||
| 2000 | Ga0207649_10008777 | |||
| 2001 | Ga0207649_10080454 | |||
| 2002 | Ga0207652_10000026 | |||
| 2003 | Ga0207652_10000368 | |||
| 2004 | Ga0207652_10000811 | |||
| 2005 | Ga0207652_10016377 | |||
| 2006 | Ga0207652_10045387 | |||
| 2007 | Ga0207652_10093455 | |||
| 2008 | Ga0207652_10217504 | |||
| 2009 | Ga0207652_10258450 | |||
| 2010 | Ga0207652_10290409 | |||
| 2011 | Ga0207681_10005273 | |||
| 2012 | Ga0207694_10036560 | |||
| 2013 | Ga0207694_10045240 | |||
| 2014 | Ga0207694_10327004 | |||
| 2015 | Ga0207650_10034083 | |||
| 2016 | Ga0207650_10071471 | |||
| 2017 | Ga0207650_10155894 | |||
| 2018 | Ga0207687_10000279 | |||
| 2019 | Ga0207687_10029377 | |||
| 2020 | Ga0207687_10065678 | |||
| 2021 | Ga0207700_10009087 | |||
| 2022 | Ga0207664_10000055 | |||
| 2023 | Ga0207664_10021264 | |||
| 2024 | Ga0207664_10081891 | |||
| 2025 | Ga0207690_10000209 | |||
| 2026 | Ga0207690_10002208 | |||
| 2027 | Ga0207690_10002280 | |||
| 2028 | Ga0207690_10005514 | |||
| 2029 | Ga0207690_10081658 | |||
| 2030 | Ga0207690_10086681 | |||
| 2031 | Ga0207706_10056810 | |||
| 2032 | Ga0207706_10066404 | |||
| 2033 | Ga0207709_10000536 | |||
| 2034 | Ga0207670_10000678 | |||
| 2035 | Ga0207670_10049654 | |||
| 2036 | Ga0207669_10127560 | |||
| 2037 | Ga0207704_10071318 | |||
| 2038 | Ga0207704_10154349 | |||
| 2039 | Ga0207691_10037062 | |||
| 2040 | Ga0207691_10045793 | |||
| 2041 | Ga0207691_10061408 | |||
| 2042 | Ga0207691_10246767 | |||
| 2043 | Ga0207711_10458380 | |||
| 2044 | Ga0207689_10049276 | |||
| 2045 | Ga0207661_10012207 | |||
| 2046 | Ga0207679_10003377 | |||
| 2047 | Ga0207667_10000139 | |||
| 2048 | Ga0207667_10000247 | |||
| 2049 | Ga0207667_10000436 | |||
| 2050 | Ga0207667_10001265 | |||
| 2051 | Ga0207667_10007174 | |||
| 2052 | Ga0207667_10008798 | |||
| 2053 | Ga0207667_10009079 | |||
| 2054 | Ga0207667_10025041 | |||
| 2055 | Ga0207667_10029132 | |||
| 2056 | Ga0207667_10134768 | |||
| 2057 | Ga0207667_10618636 | |||
| 2058 | Ga0207712_10000143 | |||
| 2059 | Ga0207668_10034221 | |||
| 2060 | Ga0207668_10072813 | |||
| 2061 | Ga0207640_10000072 | |||
| 2062 | Ga0207640_10001040 | |||
| 2063 | Ga0207640_10003987 | |||
| 2064 | Ga0207658_10109893 | |||
| 2065 | Ga0207658_10448990 | |||
| 2066 | Ga0207677_10127910 | |||
| 2067 | Ga0207639_10000639 | |||
| 2068 | Ga0207639_10002460 | |||
| 2069 | Ga0207639_10003288 | |||
| 2070 | Ga0207639_10025738 | |||
| 2071 | Ga0207639_10136780 | |||
| 2072 | Ga0207678_10001290 | |||
| 2073 | Ga0207678_10001605 | |||
| 2074 | Ga0207678_10006048 | |||
| 2075 | Ga0207678_10007279 | |||
| 2076 | Ga0207678_10037910 | |||
| 2077 | Ga0207678_10041911 | |||
| 2078 | Ga0207678_10119888 | |||
| 2079 | Ga0207678_10170353 | |||
| 2080 | Ga0207702_10000107 | |||
| 2081 | Ga0207702_10001032 | |||
| 2082 | Ga0207702_10050670 | |||
| 2083 | Ga0207702_10066079 | |||
| 2084 | Ga0207702_10110845 | |||
| 2085 | Ga0207702_10230769 | |||
| 2086 | Ga0207702_10337674 | |||
| 2087 | Ga0207641_10056239 | |||
| 2088 | Ga0207641_10279945 | |||
| 2089 | Ga0207641_10319656 | |||
| 2090 | Ga0207641_10557936 | |||
| 2091 | Ga0207648_10014914 | |||
| 2092 | Ga0207648_10136229 | |||
| 2093 | Ga0207648_10290057 | |||
| 2094 | Ga0207676_10134473 | |||
| 2095 | Ga0207676_10206733 | |||
| 2096 | Ga0207674_10000371 | |||
| 2097 | Ga0207674_10001386 | |||
| 2098 | Ga0207674_10053332 | |||
| 2099 | Ga0207674_10075758 | |||
| 2100 | Ga0207674_10118046 | |||
| 2101 | Ga0207674_10124450 | |||
| 2102 | Ga0207674_10148012 | |||
| 2103 | Ga0207674_10275043 | |||
| 2104 | Ga0207675_100227767 | |||
| 2105 | Ga0207675_100768183 | |||
| 2106 | Ga0207683_10720618 | |||
| 2107 | Ga0207683_10720911 | |||
| 2108 | Ga0207698_10004539 | |||
| 2109 | Ga0207698_10015176 | |||
| 2110 | Ga0207698_10181051 | |||
| 2111 | Ga0207698_10462779 | |||
| 2112 | Ga0207698_10462942 | |||
| 2113 | Ga0209371_1000004 | |||
| 2114 | Ga0209371_1000016 | |||
| 2115 | Ga0209969_1015899 | |||
| 2116 | Ga0209995_1012544 | |||
| 2117 | Ga0209970_1024957 | |||
| 2118 | Ga0210002_1012761 | |||
| 2119 | Ga0209983_1005036 | |||
| 2120 | Ga0209971_1005650 | |||
| 2121 | Ga0209974_10005392 | |||
| 2122 | Ga0209974_10008848 | |||
| 2123 | Ga0268266_10000001 | |||
| 2124 | Ga0268266_10000901 | |||
| 2125 | Ga0268266_10048368 | |||
| 2126 | Ga0268266_10465344 | |||
| 2127 | Ga0268265_10551219 | |||
| 2128 | Ga0268264_10021249 | |||
| 2129 | Ga0268264_10541655 | |||
| 2130 | Ga0265338_10042995 | |||
| 2131 | Ga0265338_10103927 | |||
| 2132 | Ga0268256_1000005 | |||
| 2133 | Ga0268256_1000015 | |||
| 2134 | Ga0316177_1080492 | |||
| 2135 | Ga0314311_1060965 | |||
| 2136 | Ga0316183_1146021 | |||
| 2137 | Ga0316181_1033804 | |||
| 2138 | Ga0307513_10008959 | |||
| 2139 | Ga0307513_10411234 | |||
| 2140 | Ga0307509_10022222 | |||
| 2141 | Ga0307509_10138438 | |||
| 2142 | Ga0307509_10363485 | |||
| 2143 | Ga0307408_100053478 | |||
| 2144 | Ga0307408_100114448 | |||
| 2145 | Ga0307408_100127429 | |||
| 2146 | Ga0307408_100517604 | |||
| 2147 | Ga0307508_10199806 | |||
| 2148 | Ga0316576_10123013 | |||
| 2149 | Ga0316576_10206213 | |||
| 2150 | Ga0316578_10037457 | |||
| 2151 | Ga0307405_10255915 | |||
| 2152 | Ga0316577_10006244 | |||
| 2153 | Ga0307413_10000147 | |||
| 2154 | Ga0307413_10059747 | |||
| 2155 | Ga0307413_10063188 | |||
| 2156 | Ga0307410_10188456 | |||
| 2157 | Ga0307406_10009208 | |||
| 2158 | Ga0307406_10063990 | |||
| 2159 | Ga0307406_10422843 | |||
| 2160 | Ga0307407_10214144 | |||
| 2161 | Ga0307412_10001351 | |||
| 2162 | Ga0307412_10029386 | |||
| 2163 | Ga0307409_100460041 | |||
| 2164 | Ga0307416_100014236 | |||
| 2165 | Ga0307416_100101159 | |||
| 2166 | Ga0307416_100149196 | |||
| 2167 | Ga0307416_100171404 | |||
| 2168 | Ga0307416_100375673 | |||
| 2169 | Ga0307414_10005629 | |||
| 2170 | Ga0307414_10007619 | |||
| 2171 | Ga0307414_10019115 | |||
| 2172 | Ga0307414_10022700 | |||
| 2173 | Ga0307414_10022879 | |||
| 2174 | Ga0307414_10049456 | |||
| 2175 | Ga0307414_10090000 | |||
| 2176 | Ga0307414_10093897 | |||
| 2177 | Ga0307414_10099984 | |||
| 2178 | Ga0307414_10113989 | |||
| 2179 | Ga0307414_10219041 | |||
| 2180 | Ga0307414_10316589 | |||
| 2181 | Ga0307411_10043506 | |||
| 2182 | Ga0307411_10101956 | |||
| 2183 | Ga0307411_10126775 | |||
| 2184 | Ga0307411_10182784 | |||
| 2185 | Ga0307411_10315102 | |||
| 2186 | Ga0307507_10159848 | |||
| 2187 | Ga0373937_0245944 | |||
| 2188 | Ga0316584_0000540 | |||
| 2189 | Ga0316584_0244550 | |||
| 2190 | Ga0395899_0012535 | |||
| 2191 | Ga0395899_0040277 | |||
| 2192 | Ga0395899_0148535 | |||
| 2193 | Ga0395899_0238747 | |||
| 2194 | Ga0395899_0239430 | |||
| 2195 | Ga0395900_0000012 | |||
| 2196 | Ga0395900_0000092 | |||
| 2197 | Ga0395900_0002817 | |||
| 2198 | Ga0395900_0006858 | |||
| 2199 | Ga0395900_0018342 | |||
| 2200 | Ga0395900_0035826 | |||
| 2201 | Ga0395900_0460485 | |||
| 2202 | Ga0395898_0000023 | |||
| 2203 | Ga0395898_0000237 | |||
| 2204 | Ga0395898_0013167 | |||
| 2205 | Ga0395898_0022209 | |||
| 2206 | Ga0395898_0050118 | |||
| 2207 | Ga0395898_0059861 | |||
| 2208 | Ga0395905_0000883 | |||
| 2209 | Ga0395905_0020602 | |||
| 2210 | Ga0395905_0039237 | |||
| 2211 | Ga0395905_0133615 | |||
| 2212 | Ga0395905_0385147 | |||
| 2213 | Ga0395905_0435349 | |||
| 2214 | Ga0395901_0000992 | |||
| 2215 | Ga0395901_0004126 | |||
| 2216 | Ga0395901_0015549 | |||
| 2217 | Ga0395901_0081819 | |||
| 2218 | Ga0395901_0146599 | |||
| 2219 | Ga0395901_0149959 | |||
| 2220 | Ga0395901_0217329 | |||
| 2221 | Ga0237816_01224 | |||
| 2222 | Ga0436365_0468765 | |||
| 2223 | Ga0436361_0109835 | |||
| 2224 | Ga0436363_0346981 | |||
| 2225 | Ga0439436_0000245 | |||
| 2226 | Ga0439436_0001317 | |||
| 2227 | Ga0439436_0015229 | |||
| 2228 | Ga0439436_0037155 | |||
| 2229 | Ga0439439_0011664 | |||
| 2230 | Ga0439439_0027692 | |||
| 2231 | Ga0439465_0002136 | |||
| 2232 | Ga0439465_0004591 | |||
| 2233 | Ga0439465_0021293 | |||
| 2234 | Ga0439465_0049045 | |||
| 2235 | Ga0451789_0816827 | |||
| 2236 | Ga0451793_0084196 | |||
| 2237 | Ga0451793_0245814 | |||
| 2238 | Ga0451793_0901274 | |||
| 2239 | Ga0451800_0792482 | |||
| 2240 | Ga0451802_1855302 | |||
| 2241 | Ga0451806_727761 | |||
| 2242 | Ga0451804_0198474 | |||
| 2243 | Ga0451807_0149715 | |||
| 2244 | Ga0451807_1723472 | |||
| 2245 | Ga0451807_1898858 | |||
| 2246 | Ga0451807_2241946 | |||
| 2247 | Ga0451837_1131221 | |||
| 2248 | Ga0451839_0504575 | |||
| 2249 | Ga0451843_0827567 | |||
| 2250 | Ga0451843_0952033 | |||
| 2251 | Ga0451843_1048573 | |||
| 2252 | Ga0451843_1245072 | |||
| 2253 | Ga0451853_2369144 | |||
| 2254 | Ga0451853_3110382 | |||
| 2255 | Ga0439445_0022184 | |||
| 2256 | Ga0439432_003228 | |||
| 2257 | Ga0439432_005109 | |||
| 2258 | Ga0439432_037157 | |||
| 2259 | Ga0439432_041153 | |||
| 2260 | Ga0439449_0000046 | |||
| 2261 | Ga0439449_0001830 | |||
| 2262 | Ga0439449_0003679 | |||
| 2263 | Ga0439449_0007392 | |||
| 2264 | Ga0439449_0013568 | |||
| 2265 | Ga0439449_0015114 | |||
| 2266 | Ga0439449_0019863 | |||
| 2267 | Ga0450911_002326 | |||
| 2268 | Ga0450908_000075 | |||
| 2269 | Ga0439434_0077072 | |||
| 2270 | Ga0439459_0001196 | |||
| 2271 | Ga0451577_0028918 | |||
| 2272 | Ga0451577_0033724 | |||
| 2273 | Ga0451577_0177892 | |||
| 2274 | Ga0466969_0004032 | |||
| 2275 | Ga0466969_0012271 | |||
| 2276 | Ga0466969_0014973 | |||
| 2277 | Ga0466982_0000005 | |||
| 2278 | Ga0466982_0000037 | |||
| 2279 | Ga0466965_0001833 | |||
| 2280 | Ga0466965_0136517 | |||
| 2281 | Ga0466966_0002637 | |||
| 2282 | Ga0466966_0052390 | |||
| 2283 | Ga0466966_0087713 | |||
| 2284 | Ga0466961_0001395 | |||
| 2285 | Ga0466961_0004319 | |||
| 2286 | Ga0466961_0014369 | |||
| 2287 | Ga0466963_0098779 | |||
| 2288 | Ga0453684_0001089 | |||
| 2289 | Ga0453684_0639591 | |||
| 2290 | Ga0466971_0003218 | |||
| 2291 | Ga0466971_0049874 | |||
| 2292 | Ga0466971_0050168 | |||
| 2293 | Ga0466971_0088500 | |||
| 2294 | Ga0466968_0009977 | |||
| 2295 | Ga0466968_0041132 | |||
| 2296 | Ga0466970_0023113 | |||
| 2297 | Ga0466957_0013133 | |||
| 2298 | Ga0466957_0059035 | |||
| 2299 | Ga0466957_0061518 | |||
| 2300 | Ga0466960_0010676 | |||
| 2301 | Ga0466959_0000091 | |||
| 2302 | Ga0466959_0040070 | |||
| 2303 | Ga0451576_0000201 | |||
| 2304 | Ga0466958_0049995 | |||
| 2305 | Ga0466958_0218669 | |||
| 2306 | Ga0466967_0277813 | |||
| 2307 | Ga0466967_0375233 | |||
| 2308 | Ga0495617_000495 | |||
| 2309 | Ga0495627_021048 | |||
| 2310 | Ga0495590_0098444 | |||
| 2311 | Ga0495629_0140902 | |||
| 2312 | Ga0495638_0000019 | |||
| 2313 | Ga0495638_0000426 | |||
| 2314 | Ga0495638_0000718 | |||
| 2315 | Ga0495638_0002776 | |||
| 2316 | Ga0495638_0056603 | |||
| 2317 | Ga0495638_0137968 | |||
| 2318 | Ga0495650_0000206 | |||
| 2319 | Ga0495650_0029263 | |||
| 2320 | Ga0495585_0001731 | |||
| 2321 | Ga0495585_0002973 | |||
| 2322 | Ga0495607_0000178 | |||
| 2323 | Ga0495607_0000256 | |||
| 2324 | Ga0495607_0040761 | |||
| 2325 | Ga0495583_0005312 | |||
| 2326 | Ga0495606_0002288 | |||
| 2327 | Ga0495606_0003126 | |||
| 2328 | Ga0495606_0008786 | |||
| 2329 | Ga0495606_0042589 | |||
| 2330 | Ga0495606_0088622 | |||
| 2331 | Ga0495610_0000341 | |||
| 2332 | Ga0495610_0002042 | |||
| 2333 | Ga0495616_0000357 | |||
| 2334 | Ga0495616_0020609 | |||
| 2335 | Ga0495620_0000150 | |||
| 2336 | Ga0495620_0000287 | |||
| 2337 | Ga0495631_0000257 | |||
| 2338 | Ga0495631_0000558 | |||
| 2339 | Ga0495631_0011328 | |||
| 2340 | Ga0495632_0015511 | |||
| 2341 | Ga0495632_0015643 | |||
| 2342 | Ga0495637_0039421 | |||
| 2343 | Ga0495643_0001297 | |||
| 2344 | Ga0495648_0001786 | |||
| 2345 | Ga0495648_0005918 | |||
| 2346 | Ga0495663_0001355 | |||
| 2347 | Ga0495663_0011366 | |||
| 2348 | Ga0495663_0012667 | |||
| 2349 | Ga0495663_0031906 | |||
| 2350 | Ga0495598_0003992 | |||
| 2351 | Ga0495609_0002676 | |||
| 2352 | Ga0495622_0002790 | |||
| 2353 | Ga0495633_0016706 | |||
| 2354 | Ga0495633_0073875 | |||
| 2355 | Ga0495656_0001730 | |||
| 2356 | Ga0495656_0092462 | |||
| 2357 | Ga0495668_0004174 | |||
| 2358 | Ga0495611_0000001 | |||
| 2359 | Ga0495611_0000044 | |||
| 2360 | Ga0495625_0000041 | |||
| 2361 | Ga0495625_0009643 | |||
| 2362 | Ga0495625_0047540 | |||
| 2363 | Ga0495625_0072541 | |||
| 2364 | Ga0495625_0104055 | |||
| 2365 | Ga0495661_0004401 | |||
| 2366 | Ga0495670_0001904 | |||
| 2367 | Ga0495670_0021176 | |||
| 2368 | Ga0495671_0001302 | |||
| 2369 | Ga0495649_0000930 | |||
| 2370 | Ga0495589_0000008 | |||
| 2371 | Ga0495660_0000231 | |||
| 2372 | Ga0495660_0000421 | |||
| 2373 | Ga0495636_0000667 | |||
| 2374 | Ga0495636_0008169 | |||
| 2375 | Ga0495636_0015711 | |||
| 2376 | Ga0495636_0033687 | |||
| 2377 | Ga0495672_0000373 | |||
| 2378 | Ga0495672_0009395 | |||
| 2379 | Ga0495672_0099020 | |||
| 2380 | Ga0495683_0000643 | |||
| 2381 | Ga0495679_000004 | |||
| 2382 | Ga0495673_0000004 | |||
| 2383 | Ga0495673_0000041 | |||
| 2384 | Ga0495673_0004064 | |||
| 2385 | Ga0495673_0022472 | |||
| 2386 | Ga0495681_0058289 | |||
| 2387 | Ga0495686_0000108 | |||
| 2388 | Ga0495686_0004065 | |||
| 2389 | Ga0495686_0006536 | |||
| 2390 | Ga0495686_0006573 | |||
| 2391 | Ga0495686_0007270 | |||
| 2392 | Ga0495686_0010094 | |||
| 2393 | Ga0495686_0019590 | |||
| 2394 | Ga0495686_0054137 | |||
| 2395 | Ga0496100_0020951 | |||
| 2396 | Ga0496100_0074028 | |||
| 2397 | Ga0496101_0040842 | |||
| 2398 | Ga0496102_0313070 | |||
| 2399 | Ga0496104_0053198 | |||
| 2400 | Ga0496104_0338307 | |||
| 2401 | Ga0496104_0521717 | |||
| 2402 | Ga0496105_0000021 | |||
| 2403 | Ga0496105_0002033 | |||
| 2404 | Ga0496106_0031955 | |||
| 2405 | Ga0496106_0148858 | |||
| 2406 | Ga0496106_0346232 | |||
| 2407 | Ga0496107_0041756 | |||
| 2408 | Ga0496107_0099030 | |||
| 2409 | Ga0496108_0055892 | |||
| 2410 | Ga0496108_0143031 | |||
| 2411 | Ga0496109_0251788 | |||
| 2412 | Ga0496111_0474370 | |||
| 2413 | Ga0496112_0226721 | |||
| 2414 | Ga0496113_0005101 | |||
| 2415 | Ga0496113_0212743 | |||
| 2416 | Ga0496114_0000820 | |||
| 2417 | Ga0496114_0002725 | |||
| 2418 | Ga0496114_0138149 | |||
| 2419 | Ga0496115_0000114 | |||
| 2420 | Ga0496115_0000387 | |||
| 2421 | Ga0496115_0004395 | |||
| 2422 | Ga0496115_0008772 | |||
| 2423 | Ga0496115_0052195 | |||
| 2424 | Ga0496115_0106677 | |||
| 2425 | Ga0496115_0134012 | |||
| 2426 | Ga0496115_0423901 | |||
| 2427 | Ga0496116_0004008 | |||
| 2428 | Ga0496116_0064193 | |||
| 2429 | Ga0496116_0075584 | |||
| 2430 | Ga0496117_0001196 | |||
| 2431 | Ga0496117_0001459 | |||
| 2432 | Ga0496117_0008161 | |||
| 2433 | Ga0496117_0017436 | |||
| 2434 | Ga0496117_0048556 | |||
| 2435 | Ga0496117_0049740 | |||
| 2436 | Ga0496117_0084717 | |||
| 2437 | Ga0496117_0095972 | |||
| 2438 | Ga0496118_0000169 | |||
| 2439 | Ga0496118_0000528 | |||
| 2440 | Ga0496118_0001268 | |||
| 2441 | Ga0496118_0001486 | |||
| 2442 | Ga0496118_0003436 | |||
| 2443 | Ga0496118_0003579 | |||
| 2444 | Ga0496118_0004865 | |||
| 2445 | Ga0496118_0011727 | |||
| 2446 | Ga0496118_0021844 | |||
| 2447 | Ga0496118_0027255 | |||
| 2448 | Ga0496118_0047598 | |||
| 2449 | Ga0496118_0101421 | |||
| 2450 | Ga0496119_0000165 | |||
| 2451 | Ga0496119_0000659 | |||
| 2452 | Ga0496119_0000951 | |||
| 2453 | Ga0496119_0020548 | |||
| 2454 | Ga0496120_0000054 | |||
| 2455 | Ga0496120_0000217 | |||
| 2456 | Ga0496120_0000276 | |||
| 2457 | Ga0496120_0001321 | |||
| 2458 | Ga0496121_0000148 | |||
| 2459 | Ga0496121_0000364 | |||
| 2460 | Ga0496121_0001122 | |||
| 2461 | Ga0496121_0012440 | |||
| 2462 | Ga0496121_0013502 | |||
| 2463 | Ga0496121_0017454 | |||
| 2464 | Ga0496121_0030555 | |||
| 2465 | Ga0496121_0035477 | |||
| 2466 | Ga0496121_0038038 | |||
| 2467 | Ga0496121_0046365 | |||
| 2468 | Ga0496121_0060089 | |||
| 2469 | Ga0496121_0088573 | |||
| 2470 | Ga0496121_0169928 | |||
| 2471 | Ga0496122_0000062 | |||
| 2472 | Ga0496122_0000372 | |||
| 2473 | Ga0496122_0004100 | |||
| 2474 | Ga0496122_0039267 | |||
| 2475 | Ga0496122_0044506 | |||
| 2476 | Ga0496122_0056232 | |||
| 2477 | Ga0496122_0101530 | |||
| 2478 | Ga0496122_0126181 | |||
| 2479 | Ga0496123_0000253 | |||
| 2480 | Ga0496123_0003248 | |||
| 2481 | Ga0496123_0003662 | |||
| 2482 | Ga0496123_0009343 | |||
| 2483 | Ga0496123_0020955 | |||
| 2484 | Ga0496123_0031098 | |||
| 2485 | Ga0496123_0053244 | |||
| 2486 | Ga0496123_0072151 | |||
| 2487 | Ga0496123_0074609 | |||
| 2488 | Ga0496123_0078488 | |||
| 2489 | Ga0496123_0122514 | |||
| 2490 | Ga0496123_0211205 | |||
| 2491 | Ga0496124_0000009 | |||
| 2492 | Ga0496124_0000734 | |||
| 2493 | Ga0496124_0000815 | |||
| 2494 | Ga0496124_0011679 | |||
| 2495 | Ga0496124_0012879 | |||
| 2496 | Ga0496124_0035745 | |||
| 2497 | Ga0496124_0052800 | |||
| 2498 | Ga0496124_0056350 | |||
| 2499 | Ga0496124_0063983 | |||
| 2500 | Ga0496124_0120552 | |||
| 2501 | Ga0496124_0173218 | |||
| 2502 | Ga0496124_0224555 | |||
| 2503 | Ga0496125_0000750 | |||
| 2504 | Ga0496125_0004325 | |||
| 2505 | Ga0496125_0007644 | |||
| 2506 | Ga0496125_0013354 | |||
| 2507 | Ga0496125_0015751 | |||
| 2508 | Ga0496125_0019641 | |||
| 2509 | Ga0496125_0087228 | |||
| 2510 | Ga0496125_0090757 | |||
| 2511 | Ga0496126_0000206 | |||
| 2512 | Ga0496126_0000835 | |||
| 2513 | Ga0496126_0013972 | |||
| 2514 | Ga0496126_0038127 | |||
| 2515 | Ga0496126_0058576 | |||
| 2516 | Ga0496126_0060649 | |||
| 2517 | Ga0496126_0061534 | |||
| 2518 | Ga0496126_0071393 | |||
| 2519 | Ga0496126_0109970 | |||
| 2520 | Ga0496126_0142188 | |||
| 2521 | Ga0495678_000116 | |||
| 2522 | Ga0495682_0002358 | |||
| 2523 | Ga0495682_0003246 | |||
| 2524 | Ga0495682_0020963 | |||
| 2525 | Ga0501290_000667 | |||
| 2526 | Ga0501292_004939 | |||
| 2527 | Ga0501299_010975 | |||
| 2528 | Ga0501031_0002100 | |||
| 2529 | Ga0501031_0018604 | |||
| 2530 | Ga0501031_0172512 | |||
| 2531 | Ga0501031_0174677 | |||
| 2532 | Ga0501032_0001175 | |||
| 2533 | Ga0501032_0019849 | |||
| 2534 | Ga0501032_0023609 | |||
| 2535 | Ga0501032_0113545 | |||
| 2536 | Ga0501033_0000932 | |||
| 2537 | Ga0501033_0004694 | |||
| 2538 | Ga0501033_0005337 | |||
| 2539 | Ga0501033_0016017 | |||
| 2540 | Ga0501033_0023695 | |||
| 2541 | Ga0501033_0035014 | |||
| 2542 | Ga0501033_0091340 | |||
| 2543 | Ga0501033_0136046 | |||
| 2544 | Ga0501034_0000272 | |||
| 2545 | Ga0501034_0000667 | |||
| 2546 | Ga0501034_0001266 | |||
| 2547 | Ga0501034_0001500 | |||
| 2548 | Ga0501034_0010123 | |||
| 2549 | Ga0501034_0012981 | |||
| 2550 | Ga0501034_0016507 | |||
| 2551 | Ga0501034_0026733 | |||
| 2552 | Ga0501034_0047089 | |||
| 2553 | Ga0501034_0146337 | |||
| 2554 | Ga0501034_0178001 | |||
| 2555 | Ga0501034_0227691 | |||
| 2556 | Ga0501036_0022691 | |||
| 2557 | Ga0501036_0038174 | |||
| 2558 | Ga0501036_0041900 | |||
| 2559 | Ga0501036_0056696 | |||
| 2560 | Ga0501036_0058455 | |||
| 2561 | Ga0501036_0059295 | |||
| 2562 | Ga0501036_0082146 | |||
| 2563 | Ga0501036_0427889 | |||
| 2564 | Ga0501037_0000445 | |||
| 2565 | Ga0501037_0014502 | |||
| 2566 | Ga0501037_0022344 | |||
| 2567 | Ga0501037_0091882 | |||
| 2568 | Ga0501037_0114333 | |||
| 2569 | Ga0501037_0139474 | |||
| 2570 | Ga0501038_0002821 | |||
| 2571 | Ga0501038_0010357 | |||
| 2572 | Ga0501038_0055860 | |||
| 2573 | Ga0501038_0106830 | |||
| 2574 | Ga0501039_0034575 | |||
| 2575 | Ga0501039_0157359 | |||
| 2576 | Ga0501039_0215185 | |||
| 2577 | Ga0501039_0238135 | |||
| 2578 | Ga0501039_0482382 | |||
| 2579 | Ga0501040_0221534 | |||
| 2580 | Ga0501042_0118114 | |||
| 2581 | Ga0501042_0202016 | |||
| 2582 | Ga0501042_0366625 | |||
| 2583 | Ga0501042_0504737 | |||
| 2584 | Ga0501043_0003232 | |||
| 2585 | Ga0501043_0003273 | |||
| 2586 | Ga0501043_0015149 | |||
| 2587 | Ga0501043_0016089 | |||
| 2588 | Ga0501043_0031909 | |||
| 2589 | Ga0501043_0082531 | |||
| 2590 | Ga0501043_0156262 | |||
| 2591 | Ga0501043_0180719 | |||
| 2592 | Ga0501046_0000610 | |||
| 2593 | Ga0501046_0031341 | |||
| 2594 | Ga0501046_0051563 | |||
| 2595 | Ga0501047_0000403 | |||
| 2596 | Ga0501047_0004202 | |||
| 2597 | Ga0501047_0010132 | |||
| 2598 | Ga0501047_0018122 | |||
| 2599 | Ga0501047_0029308 | |||
| 2600 | Ga0501047_0045788 | |||
| 2601 | Ga0501047_0142995 | |||
| 2602 | Ga0501047_0214056 | |||
| 2603 | Ga0501047_0289246 | |||
| 2604 | Ga0501048_0011643 | |||
| 2605 | Ga0501048_0131700 | |||
| 2606 | Ga0501048_0187621 | |||
| 2607 | Ga0501048_0218060 | |||
| 2608 | Ga0501067_0003187 | |||
| 2609 | Ga0501067_0021975 | |||
| 2610 | Ga0501067_0108523 | |||
| 2611 | Ga0501068_0017125 | |||
| 2612 | Ga0501068_0038381 | |||
| 2613 | Ga0501069_0002608 | |||
| 2614 | Ga0501069_0022269 | |||
| 2615 | Ga0501069_0028513 | |||
| 2616 | Ga0501069_0034417 | |||
| 2617 | Ga0501070_0002872 | |||
| 2618 | Ga0501070_0008207 | |||
| 2619 | Ga0501070_0030674 | |||
| 2620 | Ga0501070_0034069 | |||
| 2621 | Ga0501070_0047755 | |||
| 2622 | Ga0501070_0052658 | |||
| 2623 | Ga0501070_0086653 | |||
| 2624 | Ga0501070_0129794 | |||
| 2625 | Ga0501070_0134916 | |||
| 2626 | Ga0501070_0146545 | |||
| 2627 | Ga0501070_0185922 | |||
| 2628 | Ga0501071_0034538 | |||
| 2629 | Ga0501071_0088308 | |||
| 2630 | Ga0501071_0095971 | |||
| 2631 | Ga0501072_0004709 | |||
| 2632 | Ga0501072_0202262 | |||
| 2633 | Ga0501073_0007366 | |||
| 2634 | Ga0501073_0008386 | |||
| 2635 | Ga0501073_0045213 | |||
| 2636 | Ga0501073_0067874 | |||
| 2637 | Ga0501073_0081964 | |||
| 2638 | Ga0501073_0391256 | |||
| 2639 | Ga0501074_0014799 | |||
| 2640 | Ga0501074_0030893 | |||
| 2641 | Ga0501074_0046392 | |||
| 2642 | Ga0501074_0049582 | |||
| 2643 | Ga0501074_0148533 | |||
| 2644 | Ga0501075_0011521 | |||
| 2645 | Ga0501216_004147 | |||
| 2646 | Ga0501227_000487 | |||
| 2647 | Ga0501227_009037 | |||
| 2648 | Ga0501233_002222 | |||
| 2649 | Ga0501221_013866 | |||
| 2650 | Ga0501225_0005311 | |||
| 2651 | Ga0501225_0012786 | |||
| 2652 | Ga0501079_0225958 | |||
| 2653 | Ga0501079_0310938 | |||
| 2654 | Ga0501080_0004522 | |||
| 2655 | Ga0501080_0033509 | |||
| 2656 | Ga0501080_0064962 | |||
| 2657 | Ga0501080_0175100 | |||
| 2658 | Ga0501080_0175733 | |||
| 2659 | Ga0501080_0230085 | |||
| 2660 | Ga0501080_0529057 | |||
| 2661 | Ga0501083_0010153 | |||
| 2662 | Ga0501083_0185624 | |||
| 2663 | Ga0501266_005358 | |||
| 2664 | Ga0501268_017371 | |||
| 2665 | Ga0501275_000196 | |||
| 2666 | Ga0501035_0002806 | |||
| 2667 | Ga0501035_0005911 | |||
| 2668 | Ga0501035_0020001 | |||
| 2669 | Ga0501035_0026236 | |||
| 2670 | Ga0501035_0066830 | |||
| 2671 | Ga0501035_0067564 | |||
| 2672 | Ga0501035_0116644 | |||
| 2673 | Ga0501035_0516911 | |||
| 2674 | Ga0501044_0001991 | |||
| 2675 | Ga0501044_0005512 | |||
| 2676 | Ga0501044_0009796 | |||
| 2677 | Ga0501044_0012777 | |||
| 2678 | Ga0501044_0016869 | |||
| 2679 | Ga0501044_0019410 | |||
| 2680 | Ga0501044_0020401 | |||
| 2681 | Ga0501044_0025173 | |||
| 2682 | Ga0501044_0055937 | |||
| 2683 | Ga0501044_0094458 | |||
| 2684 | Ga0501044_0110033 | |||
| 2685 | Ga0501044_0113639 | |||
| 2686 | Ga0501044_0125765 | |||
| 2687 | Ga0501044_0125974 | |||
| 2688 | Ga0501044_0165864 | |||
| 2689 | Ga0501044_0208594 | |||
| 2690 | Ga0501044_0417124 | |||
| 2691 | nmdc:mga00v17_173377_c1 | |||
| 2692 | nmdc:mga00v17_322994_c1 | |||
| 2693 | nmdc:mga00v17_473_c1 | |||
| 2694 | nmdc:mga00v17_5873_c1 | |||
| 2695 | nmdc:mga00v17_70041_c1 | |||
| 2696 | nmdc:mga06z11_119943_c1 | |||
| 2697 | nmdc:mga05p37_341262_c2 | |||
| 2698 | nmdc:mga09592_18444_c1 | |||
| 2699 | nmdc:mga09592_9294_c1 | |||
| 2700 | nmdc:mga09592_9898_c1 | |||
| 2701 | nmdc:mga0qj67_206550_c1 | |||
| 2702 | nmdc:mga0qj67_79983_c1 | |||
| 2703 | nmdc:mga06r32_440633_c1 | |||
| 2704 | nmdc:mga08y16_336478_c1 | |||
| 2705 | nmdc:mga08y16_82022_c1 | |||
| 2706 | nmdc:mga0rr50_176501_c1 | |||
| 2707 | nmdc:mga0rr50_383273_c1 | |||
| 2708 | Ga0500610_0009379 | |||
| 2709 | Ga0500643_000103 | |||
| 2710 | Ga0500643_006045 | |||
| 2711 | Ga0500651_0000239 | |||
| 2712 | Ga0500651_0042021 | |||
| 2713 | Ga0500555_000554 | |||
| 2714 | Ga0500597_000039 | |||
| 2715 | Ga0500626_053580 | |||
| 2716 | Ga0500568_0001946 | |||
| 2717 | Ga0500568_0008117 | |||
| 2718 | Ga0500620_002235 | |||
| 2719 | Ga0500633_0000431 | |||
| 2720 | Ga0500634_0000229 | |||
| 2721 | Ga0500645_001165 | |||
| 2722 | Ga0501084_0034311 | |||
| 2723 | Ga0501084_0126409 | |||
| 2724 | Ga0501084_0190487 | |||
| 2725 | Ga0501082_0010653 | |||
| 2726 | Ga0501082_0017743 | |||
| 2727 | Ga0466962_0002470 | |||
| 2728 | Ga0466962_0010704 | |||
| 2729 | Ga0466962_0028639 | |||
| 2730 | 2525557105 | |||
| 2731 | 2547502711 | |||
| 2732 | 2572256341 | |||
| 2733 | 2578458754 | |||
| 2734 | 2595447090 | |||
| 2735 | 2595449848 | |||
| 2736 | 2630648701 | |||
| 2737 | 2643816287 | |||
| 2738 | 2643881653 | |||
| 2739 | 2643905591 | |||
| 2740 | 2643913276 | |||
| 2741 | 2643939028 | |||
| 2742 | 2643977666 | |||
| 2743 | 2644077231 | |||
| 2744 | 2644528660 | |||
| 2745 | 2644662742 | |||
| 2746 | 2644694542 | |||
| 2747 | 2644698304 | |||
| 2748 | 2687582214 | |||
| 2749 | 2721026250 | |||
| 2750 | 2735833774 | |||
| 2751 | 2739228762 | |||
| 2752 | 2739732263 | |||
| 2753 | 2740992581 | |||
| 2754 | 2747950782 | |||
| 2755 | 2765578642 | |||
| 2756 | 2816516718 | |||
| 2757 | 2819564233 | |||
| 2758 | 2819659992 | |||
| 2759 | 2842394953 | |||
| 2760 | 2842758441 | |||
| 2761 | 2842781250 | |||
| 2762 | 2842918118 | |||
| 2763 | 2842920146 | |||
| 2764 | 2852651108 | |||
| 2765 | 2852685188 | |||
| 2766 | 2857445258 | |||
| 2767 | 2874221271 | |||
| 2768 | 2884341762 | |||
| 2769 | 2884411510 | |||
| 2770 | 2894416170 | |||
| 2771 | 2895396532 | |||
| 2772 | 2895498991 | |||
| 2773 | 2895512029 | |||
| 2774 | 2895524904 | |||
| 2775 | 2895527973 | |||
| 2776 | 2904464873 | |||
| 2777 | 2919091776 | |||
| 2778 | 2919130730 | |||
| 2779 | 2919136171 | |||
| 2780 | 2919406382 | |||
| 2781 | 2919515290 | |||
| 2782 | 2919678305 | |||
| 2783 | 2923517700 | |||
| 2784 | 2928496240 | |||
| 2785 | 2928964948 | |||
| 2786 | 2929198264 | |||
| 2787 | 2931381086 | |||
| 2788 | 2937612092 | |||
| 2789 | 2939590721 | |||
| 2790 | 2939615183 | |||
| 2791 | 2939622907 | |||
| 2792 | 2939630831 | |||
| 2793 | 2941475470 | |||
| 2794 | 2941477947 | |||
| 2795 | 2941489812 | |||
| 2796 | 2961048037 | |||
| 2797 | 2961065057 | |||
| 2798 | 2974309231 | |||
| 2799 | 2977249952 | |||
| 2800 | 2984515559 | |||
| 2801 | 2987606301 | |||
| 2802 | 2995950679 | |||
| 2803 | 8003016545 | |||
| 2804 | 8021625305 | |||
| 2805 | 8021630213 | |||
| 2806 | 8021652126 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3esh-assembly1.cif.gz_A | crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 | 0.8904 | 3 | 296 |
| 3esh-assembly1.cif.gz_A | crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 | 0.8662 | 3 | 296 |
| 4le6-assembly2.cif.gz_C | crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes | 0.822 | 3 | 283 |
| 4le6-assembly3.cif.gz_E | crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes | 0.8213 | 3 | 283 |
| 2br6-assembly1.cif.gz_A | crystal structure of quorum-quenching n-acyl homoserine lactone lactonase | 0.8046 | 2 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3eshC01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8976 | 3 | 275 | 3.60.15.10 |
| 3eshC01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8742 | 3 | 275 | 3.60.15.10 |
| 4le6E00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8213 | 3 | 283 | 3.60.15.10 |
| 4xukA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7749 | 3 | 282 | 3.60.15.10 |
| 3aj0A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7681 | 2 | 264 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R0YKK8-F1-model_v4 | MBL fold metallo-hydrolase | 0.9955 | 1 | 289 |
GO:0016787
|
| AF-A0A7W6L2L3-F1-model_v4 | Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) | 0.9943 | 2 | 296 |
GO:0016787
|
| AF-A0A2R7NM18-F1-model_v4 | deleted | 0.9943 | 1 | 204 |
|
| AF-A0A2D5EMW0-F1-model_v4 | MBL fold hydrolase | 0.9943 | 217 | 287 |
GO:0016787
|
| AF-A0A848Q7N6-F1-model_v4 | deleted | 0.9937 | 1 | 132 |
|