F493697

General Info

Members Datasets Scaffolds Average Seq Length
1403 517 2806 290

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0010414|Ga0501031_0010414_4927_5988
Length 344
Sequence LASRTREGIHHVVPAKAGTHFAFAETIRSKMDPGLRRDDDVVGFCANPESRIFSRMKLWSLQGNSQRLDGGAMFGNAPRAMWEKWIAPDEDNRIPLACRCLLAEGLNGQNVLFETGIGAFFEPKLRERYGVVESRHVLLDSLVEAGFSHEDIDAVVVSHLHFDHAGGLLAEWKEGSPPRLLFPNATYLVGEECWQRALNPHPRDRASFIPELQPLLEASGRLERVWGAHSPTLGECVRFSYSNGHTPGLMLSEISPEGGEGGIVFCADLIPGRPWVHLPVTMGYDRYPELLIDEKKAFLEDKLARGVRLFFTHDAGCAIAHVARDAKGRFSTTDERAELIGEAA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
146 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
147 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
244 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
245 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
246 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
280 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
284 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
285 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
286 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
287 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
288 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
294 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
306 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
307 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
308 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
309 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
322 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
333 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
334 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
351 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
352 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
374 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
375 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
376 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
377 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
382 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
383 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
384 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
407 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
408 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
409 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
410 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
414 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
415 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
416 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
422 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
423 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
424 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
425 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
428 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
431 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
432 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
435 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
436 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
441 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
442 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
443 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
444 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
445 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
446 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
447 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
448 2643221559 Lysobacter sp. Root559 Isolate Unclassified
449 2643221573 Lysobacter sp. Root604 Isolate Unclassified
450 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
451 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
452 2643221586 Lysobacter sp. Root667 Isolate Unclassified
453 2643221593 Lysobacter sp. Root690 Isolate Unclassified
454 2643221612 Lysobacter sp. Root76 Isolate Unclassified
455 2643221695 Lysobacter sp. Root494 Isolate Unclassified
456 2643221720 Lysobacter sp. Root916 Isolate Unclassified
457 2643221727 Lysobacter sp. Root96 Isolate Unclassified
458 2643221728 Lysobacter sp. Root983 Isolate Unclassified
459 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
460 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
461 2734482264 Dyella sp. AD052 Isolate Unclassified
462 2738543009 Luteibacter sp. OK325 Isolate Unclassified
463 2739367700 Dyella sp. YR388 Isolate Unclassified
464 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
465 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
466 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
467 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
468 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
469 2818991457 Xanthomonas translucens 569 Isolate Unclassified
470 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
471 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
472 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
473 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
474 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
475 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
476 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
477 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
478 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
479 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
480 2884411467 Dyella sp. AD56 Isolate Rhizosphere
481 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
482 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
483 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
484 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
485 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
486 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
487 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
488 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
489 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
490 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
491 2919404418 Luteibacter sp. 3190 Isolate Unclassified
492 2919513703 Luteimonas sp. 3794 Isolate Unclassified
493 2919675420 Luteimonas terrae 4099 Isolate Unclassified
494 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
495 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
496 2928963466 Dyella japonica 1073 Isolate Unclassified
497 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
498 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
499 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
500 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
501 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
502 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
503 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
504 2941471342 Luteibacter sp. 621 Isolate Unclassified
505 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
506 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
507 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
508 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
509 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
510 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
511 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
512 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
513 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
514 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
515 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
516 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
517 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 0.36
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 13.54
Nodule 0.07
Rhizoplane 3.14
Rhizosphere 69.64
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0010414 3300049568 Bacteria 6055
2 SwRhRL2b_contig_3686161 2162886007 Bacteria 4716
3 JGI24736J21556_1011109 3300001904 Bacteria 1467
4 JGI24741J21665_1000813 3300001915 Bacteria 9386
5 JGI24741J21665_1006639 3300001915 Bacteria 2306
6 JGI24740J21852_10000219 3300001979 Bacteria 24169
7 JGI24739J22299_10000243 3300001989 Bacteria 18407
8 JGI24737J22298_10000669 3300001990 Bacteria 12109
9 JGI24737J22298_10013681 3300001990 Bacteria 2638
10 JGI24738J21930_10000133 3300002075 Bacteria 18136
11 JGI25156J39149_1004682 3300002705 Bacteria 4110
12 JGI25156J39149_1019717 3300002705 Bacteria 1207
13 JGI25156J39149_1019783 3300002705 Bacteria 1203
14 JGI25162J39368_1000124 3300002737 Bacteria 84810
15 JGI25162J39368_1001252 3300002737 Bacteria 14525
16 JGI25162J39368_1002606 3300002737 Bacteria 6755
17 JGI25162J39368_1002830 3300002737 Bacteria 6062
18 JGI25154J39366_1004567 3300002738 Bacteria 2443
19 JGI25157J39369_1000047 3300002741 Bacteria 118398
20 JGI25157J39369_1000465 3300002741 Bacteria 25507
21 JGI25157J39369_1000622 3300002741 Bacteria 20045
22 JGI25157J39369_1001028 3300002741 Bacteria 12867
23 JGI25157J39369_1010638 3300002741 Bacteria 1207
24 JGI25157J39369_1010677 3300002741 Bacteria 1203
25 JGI25163J39215_1000218 3300002771 Bacteria 21350
26 JGI25164J39214_1000134 3300002772 Bacteria 71350
27 JGI25164J39214_1000196 3300002772 Bacteria 51730
28 JGI25164J39214_1000436 3300002772 Bacteria 22682
29 JGI25164J39214_1000438 3300002772 Bacteria 22660
30 JGI25164J39214_1000955 3300002772 Bacteria 9300
31 JGI25164J39214_1001334 3300002772 Bacteria 6107
32 JGI25152J39213_1002119 3300002773 Bacteria 7782
33 JGI25150J39212_1001176 3300002774 Bacteria 7781
34 JGI25151J46595_10000257 3300003187 Bacteria 62308
35 JGI25151J46595_10000558 3300003187 Bacteria 33861
36 JGI25151J46595_10035027 3300003187 Bacteria 1912
37 JGI25151J46595_10067063 3300003187 Bacteria 1108
38 JGI25165J46597_1000119 3300003214 Bacteria 137181
39 JGI25165J46597_1000223 3300003214 Bacteria 79270
40 JGI25165J46597_1000275 3300003214 Bacteria 66238
41 JGI25165J46597_1002075 3300003214 Bacteria 7462
42 JGI25153J46596_10000334 3300003215 Bacteria 33861
43 rootH1_10057363 3300003316 Bacteria 3556
44 rootH2_10023810 3300003320 Bacteria 18625
45 rootH1_10187769 3300003323 Bacteria 2258
46 Ga0006562J51391_1003759 3300003578 Bacteria 15850
47 Ga0055538_1002063 3300003751 Bacteria 3231
48 Ga0055539_1001661 3300003752 Bacteria 3965
49 Ga0055533_1001179 3300003756 Bacteria 7374
50 Ga0055533_1001398 3300003756 Bacteria 6405
51 Ga0055525_1000111 3300003759 Bacteria 127836
52 Ga0055527_1000053 3300003760 Bacteria 100725
53 Ga0055527_1000114 3300003760 Bacteria 57775
54 Ga0055535_1000313 3300003761 Bacteria 49116
55 Ga0055535_1000340 3300003761 Bacteria 46611
56 Ga0055535_1000362 3300003761 Bacteria 43772
57 Ga0055535_1000440 3300003761 Bacteria 38420
58 Ga0055535_1000825 3300003761 Bacteria 22228
59 Ga0055535_1001942 3300003761 Bacteria 8607
60 Ga0055542_1000160 3300003762 Bacteria 84810
61 Ga0055542_1000240 3300003762 Bacteria 63139
62 Ga0055542_1000274 3300003762 Bacteria 57775
63 Ga0055542_1000371 3300003762 Bacteria 46425
64 Ga0055542_1000418 3300003762 Bacteria 41465
65 Ga0055542_1000825 3300003762 Bacteria 22228
66 Ga0055529_1000024 3300003763 Bacteria 305218
67 Ga0055529_1000161 3300003763 Bacteria 92257
68 Ga0055529_1000264 3300003763 Bacteria 62197
69 Ga0055529_1000296 3300003763 Bacteria 57775
70 Ga0055526_1000008 3300003771 Bacteria 300059
71 Ga0055526_1001264 3300003771 Bacteria 18153
72 Ga0055537_1000145 3300003773 Bacteria 53262
73 Ga0055537_1000338 3300003773 Bacteria 32024
74 Ga0055524_1000087 3300003775 Bacteria 116388
75 Ga0055524_1016305 3300003775 Bacteria 2671
76 Ga0055536_1001416 3300003781 Bacteria 14495
77 Ga0055536_1007159 3300003781 Bacteria 5042
78 Ga0055536_1007642 3300003781 Bacteria 4795
79 Ga0055536_1017277 3300003781 Bacteria 2370
80 Ga0055534_1000003 3300003784 Bacteria 300063
81 Ga0055534_1000039 3300003784 Bacteria 104863
82 Ga0055528_1000004 3300003790 Bacteria 285772
83 Ga0055528_1000212 3300003790 Bacteria 49305
84 Ga0055530_10000544 3300003791 Bacteria 32692
85 Ga0055530_10001029 3300003791 Bacteria 22199
86 Ga0055530_10001078 3300003791 Bacteria 21484
87 Ga0055531_10007594 3300003794 Bacteria 5878
88 Ga0055531_10011798 3300003794 Bacteria 4172
89 Ga0055531_10017155 3300003794 Bacteria 3073
90 Ga0055531_10029813 3300003794 Bacteria 1849
91 Ga0055531_10052738 3300003794 Bacteria 1057
92 Ga0058692_1000002 3300003856 Bacteria 508401
93 Ga0058692_1000006 3300003856 Bacteria 398109
94 Ga0065165_1005309 3300005262 Bacteria 7330
95 Ga0065704_10071155 3300005289 Bacteria 12813
96 Ga0065704_10071748 3300005289 Bacteria 10022
97 Ga0065704_10103241 3300005289 Bacteria 2178
98 Ga0065704_10174745 3300005289 Bacteria 1270
99 Ga0065704_10182412 3300005289 Bacteria 1230
100 Ga0065704_10245209 3300005289 Bacteria 1004
101 Ga0065715_10101077 3300005293 Bacteria 3239
102 Ga0065715_10110041 3300005293 Bacteria 2632
103 Ga0070658_10058881 3300005327 Bacteria 3128
104 Ga0070658_10255056 3300005327 Bacteria 1488
105 Ga0070676_10219546 3300005328 Bacteria 1255
106 Ga0070683_100041294 3300005329 Bacteria 4243
107 Ga0070683_100180314 3300005329 Bacteria 2004
108 Ga0070690_100080808 3300005330 Bacteria 2126
109 Ga0070670_100045095 3300005331 Bacteria 3790
110 Ga0070670_100132792 3300005331 Bacteria 2150
111 Ga0070670_100193136 3300005331 Bacteria 1768
112 Ga0070670_100258478 3300005331 Bacteria 1518
113 Ga0070670_100297996 3300005331 Bacteria 1410
114 Ga0070680_100003486 3300005336 Bacteria 11748
115 Ga0070680_100004486 3300005336 Bacteria 10514
116 Ga0070680_100113856 3300005336 Bacteria 2253
117 Ga0070680_100135659 3300005336 Bacteria 2061
118 Ga0070680_100275610 3300005336 Bacteria 1425
119 Ga0070682_100025405 3300005337 Bacteria 3534
120 Ga0070682_100179334 3300005337 Bacteria 1478
121 Ga0068868_100284710 3300005338 Bacteria 1400
122 Ga0070660_100005329 3300005339 Bacteria 8899
123 Ga0070660_100063795 3300005339 Bacteria 2864
124 Ga0070660_100111749 3300005339 Bacteria 2174
125 Ga0070660_100387323 3300005339 Bacteria 1154
126 Ga0070689_100031318 3300005340 Bacteria 4042
127 Ga0070689_100036392 3300005340 Bacteria 3765
128 Ga0070689_100248488 3300005340 Bacteria 1467
129 Ga0070691_10021483 3300005341 Bacteria 2987
130 Ga0070661_100006947 3300005344 Bacteria 7814
131 Ga0070661_100010502 3300005344 Bacteria 6439
132 Ga0070661_100029576 3300005344 Bacteria 3955
133 Ga0070661_100052266 3300005344 Bacteria 2990
134 Ga0070661_100095325 3300005344 Bacteria 2207
135 Ga0070661_100132831 3300005344 Bacteria 1871
136 Ga0070692_10003447 3300005345 Bacteria 6415
137 Ga0070692_10011702 3300005345 Bacteria 4036
138 Ga0070668_100014917 3300005347 Bacteria 5809
139 Ga0070668_100032294 3300005347 Bacteria 3984
140 Ga0070668_100109256 3300005347 Bacteria 2200
141 Ga0070669_100030652 3300005353 Bacteria 3882
142 Ga0070671_100003371 3300005355 Bacteria 12463
143 Ga0070671_100041811 3300005355 Bacteria 3809
144 Ga0070671_100106270 3300005355 Bacteria 2356
145 Ga0070673_100003011 3300005364 Bacteria 10407
146 Ga0070688_100197255 3300005365 Bacteria 1406
147 Ga0070659_100225731 3300005366 Bacteria 1547
148 Ga0070659_100227371 3300005366 Bacteria 1541
149 Ga0070667_100198567 3300005367 Bacteria 1779
150 Ga0070667_100554360 3300005367 Bacteria 1057
151 Ga0070703_10078108 3300005406 Bacteria 1121
152 Ga0070714_100000306 3300005435 Bacteria 37332
153 Ga0070714_100006767 3300005435 Bacteria 8886
154 Ga0070714_100008435 3300005435 Bacteria 8046
155 Ga0070713_100002668 3300005436 Bacteria 11627
156 Ga0070711_100594880 3300005439 Bacteria 922
157 Ga0070694_100360251 3300005444 Bacteria 1129
158 Ga0070708_100087187 3300005445 Bacteria 2836
159 Ga0070663_100004478 3300005455 Bacteria 8222
160 Ga0070663_100005489 3300005455 Bacteria 7538
161 Ga0070663_100006531 3300005455 Bacteria 7023
162 Ga0070663_100046365 3300005455 Bacteria 3075
163 Ga0070663_100100902 3300005455 Bacteria 2153
164 Ga0070678_100013349 3300005456 Bacteria 5146
165 Ga0070678_100031906 3300005456 Bacteria 3640
166 Ga0070662_100037135 3300005457 Bacteria 3452
167 Ga0070662_100112976 3300005457 Bacteria 2072
168 Ga0070681_10000086 3300005458 Bacteria 70488
169 Ga0070681_10000199 3300005458 Bacteria 46948
170 Ga0070681_10003486 3300005458 Bacteria 14730
171 Ga0070681_10028227 3300005458 Bacteria 5641
172 Ga0070681_10031798 3300005458 Bacteria 5297
173 Ga0070681_10039265 3300005458 Bacteria 4745
174 Ga0068867_100042494 3300005459 Bacteria 3326
175 Ga0068867_100046909 3300005459 Bacteria 3175
176 Ga0068867_100182253 3300005459 Bacteria 1670
177 Ga0070685_10003148 3300005466 Bacteria 8387
178 Ga0070698_100000567 3300005471 Bacteria 39696
179 Ga0070679_100000589 3300005530 Bacteria 30768
180 Ga0070679_100000739 3300005530 Bacteria 28238
181 Ga0070679_100013004 3300005530 Bacteria 7970
182 Ga0070679_100027652 3300005530 Bacteria 5583
183 Ga0070679_100033157 3300005530 Bacteria 5113
184 Ga0070679_100117068 3300005530 Bacteria 2649
185 Ga0070679_100453475 3300005530 Bacteria 1227
186 Ga0070684_100010589 3300005535 Bacteria 7312
187 Ga0070684_100018885 3300005535 Bacteria 5691
188 Ga0070684_100129558 3300005535 Bacteria 2275
189 Ga0070684_100432608 3300005535 Bacteria 1215
190 Ga0068853_100008449 3300005539 Bacteria 8273
191 Ga0068853_100014525 3300005539 Bacteria 6453
192 Ga0068853_100036176 3300005539 Bacteria 4196
193 Ga0068853_100043092 3300005539 Bacteria 3861
194 Ga0068853_100197148 3300005539 Bacteria 1831
195 Ga0070672_100034801 3300005543 Bacteria 3825
196 Ga0070672_100059578 3300005543 Bacteria 3004
197 Ga0070686_100027863 3300005544 Bacteria 3422
198 Ga0070696_100003674 3300005546 Bacteria 10227
199 Ga0070696_100007524 3300005546 Bacteria 7284
200 Ga0070696_100026727 3300005546 Bacteria 3927
201 Ga0070693_100008121 3300005547 Bacteria 5156
202 Ga0070693_100016526 3300005547 Bacteria 3822
203 Ga0070693_100020347 3300005547 Bacteria 3498
204 Ga0070693_100022988 3300005547 Bacteria 3325
205 Ga0070665_100000237 3300005548 Bacteria 91478
206 Ga0070665_100015986 3300005548 Bacteria 7532
207 Ga0070665_100055673 3300005548 Bacteria 3966
208 Ga0070665_100116552 3300005548 Bacteria 2674
209 Ga0070665_100129831 3300005548 Unclassified 2522
210 Ga0070665_100181087 3300005548 Bacteria 2108
211 Ga0070665_100200600 3300005548 Bacteria 1995
212 Ga0070665_100254246 3300005548 Bacteria 1758
213 Ga0070665_100262107 3300005548 Bacteria 1729
214 Ga0070665_100285093 3300005548 Bacteria 1654
215 Ga0070704_100023769 3300005549 Bacteria 4009
216 Ga0068855_100003227 3300005563 Bacteria 19958
217 Ga0068855_100015077 3300005563 Bacteria 9305
218 Ga0068855_100016959 3300005563 Bacteria 8759
219 Ga0068855_100022476 3300005563 Bacteria 7558
220 Ga0068855_100037824 3300005563 Bacteria 5735
221 Ga0068855_100094390 3300005563 Bacteria 3450
222 Ga0068855_100210809 3300005563 Bacteria 2183
223 Ga0068855_100468593 3300005563 Bacteria 1372
224 Ga0068855_100485454 3300005563 Bacteria 1344
225 Ga0068855_100492474 3300005563 Bacteria 1333
226 Ga0068855_100670633 3300005563 Bacteria 1112
227 Ga0070664_100291488 3300005564 Bacteria 1473
228 Ga0068857_100000180 3300005577 Bacteria 40331
229 Ga0068857_100005918 3300005577 Bacteria 10441
230 Ga0068857_100111552 3300005577 Bacteria 2459
231 Ga0068857_100291234 3300005577 Bacteria 1503
232 Ga0068854_100003500 3300005578 Bacteria 9809
233 Ga0068854_100014806 3300005578 Bacteria 5149
234 Ga0068854_100014875 3300005578 Bacteria 5137
235 Ga0068854_100015665 3300005578 Bacteria 5032
236 Ga0068854_100016080 3300005578 Bacteria 4977
237 Ga0068856_100000074 3300005614 Bacteria 94656
238 Ga0068856_100001551 3300005614 Bacteria 24050
239 Ga0068856_100012624 3300005614 Bacteria 8178
240 Ga0068856_100021481 3300005614 Bacteria 6273
241 Ga0068856_100130884 3300005614 Bacteria 2513
242 Ga0068856_100137484 3300005614 Bacteria 2449
243 Ga0068856_100153894 3300005614 Bacteria 2309
244 Ga0068856_100194133 3300005614 Bacteria 2044
245 Ga0068856_100400019 3300005614 Bacteria 1393
246 Ga0068856_100508288 3300005614 Bacteria 1226
247 Ga0070702_100036432 3300005615 Bacteria 2725
248 Ga0068852_100002579 3300005616 Bacteria 12500
249 Ga0068852_100007543 3300005616 Bacteria 7944
250 Ga0068852_100085277 3300005616 Bacteria 2813
251 Ga0068859_100119518 3300005617 Bacteria 2702
252 Ga0068864_100012182 3300005618 Bacteria 7108
253 Ga0068864_100028713 3300005618 Bacteria 4706
254 Ga0068864_100062451 3300005618 Bacteria 3227
255 Ga0068864_100110229 3300005618 Bacteria 2451
256 Ga0068864_100215793 3300005618 Bacteria 1768
257 Ga0068866_10039851 3300005718 Bacteria 2322
258 Ga0068861_100013414 3300005719 Bacteria 5734
259 Ga0068861_100232559 3300005719 Bacteria 1564
260 Ga0068851_10001429 3300005834 Bacteria 10454
261 Ga0068851_10023201 3300005834 Bacteria 3030
262 Ga0068863_100009921 3300005841 Bacteria 9274
263 Ga0068863_100383589 3300005841 Bacteria 1372
264 Ga0068858_100025509 3300005842 Bacteria 5499
265 Ga0068858_100055234 3300005842 Bacteria 3671
266 Ga0068860_100027053 3300005843 Bacteria 5527
267 Ga0068860_100106873 3300005843 Bacteria 2673
268 Ga0068860_100694567 3300005843 Bacteria 1027
269 Ga0068862_100063729 3300005844 Bacteria 3172
270 Ga0068862_100242886 3300005844 Bacteria 1638
271 Ga0081540_1007915 3300005983 Bacteria 7502
272 Ga0070717_10644565 3300006028 Bacteria 961
273 Ga0075363_100076865 3300006048 Bacteria 1821
274 Ga0075364_10000156 3300006051 Bacteria 29962
275 Ga0075364_10019911 3300006051 Bacteria 4217
276 Ga0075367_10059460 3300006178 Bacteria 2276
277 Ga0075369_10033668 3300006186 Bacteria 2172
278 Ga0097621_100043633 3300006237 Bacteria 3615
279 Ga0097621_100117910 3300006237 Bacteria 2249
280 Ga0068871_100042261 3300006358 Bacteria 3658
281 Ga0068871_100165152 3300006358 Bacteria 1895
282 Ga0075428_100501872 3300006844 Bacteria 1298
283 Ga0075430_100013708 3300006846 Bacteria 6911
284 Ga0075430_100031816 3300006846 Bacteria 4478
285 Ga0075430_100054394 3300006846 Bacteria 3368
286 Ga0075430_100214799 3300006846 Bacteria 1596
287 Ga0075429_100010231 3300006880 Bacteria 8121
288 Ga0075429_100015423 3300006880 Bacteria 6621
289 Ga0075429_100061688 3300006880 Bacteria 3267
290 Ga0075429_100076760 3300006880 Bacteria 2910
291 Ga0068865_100104168 3300006881 Bacteria 2082
292 Ga0097620_100119518 3300006931 Bacteria 2702
293 Ga0075435_100418708 3300007076 Bacteria 1153
294 Ga0105251_10000597 3300009011 Bacteria 33077
295 Ga0105251_10002239 3300009011 Bacteria 15416
296 Ga0105240_10010415 3300009093 Bacteria 13068
297 Ga0105240_10014636 3300009093 Bacteria 10704
298 Ga0105240_10015324 3300009093 Bacteria 10429
299 Ga0105240_10016233 3300009093 Bacteria 10092
300 Ga0105240_10018380 3300009093 Bacteria 9388
301 Ga0105240_10033449 3300009093 Bacteria 6642
302 Ga0105240_10054441 3300009093 Bacteria 5014
303 Ga0105240_10070725 3300009093 Bacteria 4316
304 Ga0105240_10071884 3300009093 Bacteria 4277
305 Ga0105240_10071908 3300009093 Bacteria 4277
306 Ga0105240_10117179 3300009093 Bacteria 3212
307 Ga0111539_10158205 3300009094 Bacteria 2651
308 Ga0105245_10000070 3300009098 Bacteria 106666
309 Ga0105245_10083402 3300009098 Bacteria 2926
310 Ga0105243_10006063 3300009148 Bacteria 9346
311 Ga0105243_10032254 3300009148 Bacteria 4046
312 Ga0105243_10337839 3300009148 Bacteria 1378
313 Ga0105241_10002770 3300009174 Bacteria 13130
314 Ga0105241_10003714 3300009174 Bacteria 11334
315 Ga0105241_10058772 3300009174 Bacteria 2953
316 Ga0105242_10507439 3300009176 Bacteria 1148
317 Ga0105248_10007576 3300009177 Bacteria 11925
318 Ga0105248_10015012 3300009177 Bacteria 8526
319 Ga0105248_10052738 3300009177 Bacteria 4564
320 Ga0105237_10000214 3300009545 Bacteria 82061
321 Ga0105237_10002033 3300009545 Bacteria 25718
322 Ga0105237_10009902 3300009545 Bacteria 10175
323 Ga0105237_10013212 3300009545 Bacteria 8660
324 Ga0105237_10078674 3300009545 Bacteria 3287
325 Ga0105237_10107835 3300009545 Bacteria 2777
326 Ga0105237_10140310 3300009545 Bacteria 2411
327 Ga0105237_10482908 3300009545 Bacteria 1245
328 Ga0105238_10006412 3300009551 Bacteria 11707
329 Ga0105238_10018096 3300009551 Bacteria 7164
330 Ga0105238_10022371 3300009551 Bacteria 6443
331 Ga0105238_10110718 3300009551 Bacteria 2726
332 Ga0105238_10166892 3300009551 Bacteria 2177
333 Ga0105249_10001773 3300009553 Bacteria 18808
334 Ga0105239_10000390 3300010375 Bacteria 64410
335 Ga0105239_10005287 3300010375 Bacteria 15171
336 Ga0105239_10014113 3300010375 Bacteria 8868
337 Ga0105239_10015740 3300010375 Bacteria 8371
338 Ga0105239_10017459 3300010375 Bacteria 7936
339 Ga0105239_10017493 3300010375 Bacteria 7928
340 Ga0105239_10068068 3300010375 Bacteria 3913
341 Ga0105239_10090965 3300010375 Bacteria 3367
342 Ga0105239_10112753 3300010375 Bacteria 3015
343 Ga0105239_10278980 3300010375 Bacteria 1881
344 Ga0105239_10317488 3300010375 Bacteria 1756
345 Ga0105246_10006015 3300011119 Bacteria 7409
346 Ga0157314_1000578 3300012500 Bacteria 3382
347 Ga0157373_10008009 3300013100 Bacteria 7857
348 Ga0157373_10326188 3300013100 Bacteria 1093
349 Ga0157371_10000487 3300013102 Bacteria 48309
350 Ga0157371_10004532 3300013102 Bacteria 12102
351 Ga0157371_10020289 3300013102 Bacteria 4892
352 Ga0157371_10033680 3300013102 Bacteria 3679
353 Ga0157371_10067563 3300013102 Bacteria 2530
354 Ga0157371_10096244 3300013102 Bacteria 2098
355 Ga0157371_10191613 3300013102 Bacteria 1464
356 Ga0157371_10240522 3300013102 Bacteria 1302
357 Ga0157370_10002080 3300013104 Bacteria 24511
358 Ga0157370_10004104 3300013104 Bacteria 16885
359 Ga0157370_10007609 3300013104 Bacteria 11764
360 Ga0157370_10015272 3300013104 Bacteria 7813
361 Ga0157370_10096201 3300013104 Bacteria 2778
362 Ga0157370_10200547 3300013104 Bacteria 1851
363 Ga0157370_10271467 3300013104 Bacteria 1567
364 Ga0157369_10000030 3300013105 Bacteria 203569
365 Ga0157369_10002243 3300013105 Bacteria 23244
366 Ga0157369_10004626 3300013105 Bacteria 16172
367 Ga0157369_10007366 3300013105 Bacteria 12667
368 Ga0157369_10023335 3300013105 Bacteria 6891
369 Ga0157369_10028763 3300013105 Bacteria 6147
370 Ga0157369_10118046 3300013105 Bacteria 2816
371 Ga0157374_10011293 3300013296 Bacteria 7724
372 Ga0157374_10023184 3300013296 Bacteria 5546
373 Ga0157374_10029499 3300013296 Bacteria 4969
374 Ga0157374_10057421 3300013296 Bacteria 3635
375 Ga0157378_10000158 3300013297 Bacteria 64291
376 Ga0157378_10030642 3300013297 Bacteria 4752
377 Ga0163162_10005297 3300013306 Bacteria 12452
378 Ga0163162_10029820 3300013306 Bacteria 5401
379 Ga0163162_10669708 3300013306 Bacteria 1161
380 Ga0157372_10001156 3300013307 Bacteria 28529
381 Ga0157372_10001163 3300013307 Bacteria 28496
382 Ga0157372_10009901 3300013307 Bacteria 10139
383 Ga0157372_10027403 3300013307 Bacteria 6204
384 Ga0157372_10030221 3300013307 Bacteria 5924
385 Ga0157372_10074640 3300013307 Bacteria 3824
386 Ga0157372_10192432 3300013307 Bacteria 2363
387 Ga0157372_10237659 3300013307 Bacteria 2113
388 Ga0157372_10684087 3300013307 Bacteria 1194
389 Ga0157372_10684788 3300013307 Bacteria 1193
390 Ga0157375_10002329 3300013308 Bacteria 16411
391 Ga0157375_10055851 3300013308 Bacteria 3895
392 Ga0157380_10042102 3300014326 Bacteria 3568
393 Ga0182008_10000143 3300014497 Bacteria 55118
394 Ga0182008_10001870 3300014497 Bacteria 13704
395 Ga0182008_10015447 3300014497 Bacteria 3984
396 Ga0182008_10016411 3300014497 Bacteria 3847
397 Ga0182008_10031878 3300014497 Bacteria 2650
398 Ga0182008_10079886 3300014497 Bacteria 1609
399 Ga0182008_10123506 3300014497 Bacteria 1288
400 Ga0157376_10005593 3300014969 Bacteria 8795
401 Ga0157376_10013924 3300014969 Bacteria 6015
402 Ga0157376_10132292 3300014969 Bacteria 2228
403 Ga0157376_10328088 3300014969 Bacteria 1457
404 Ga0157376_10486794 3300014969 Bacteria 1210
405 Ga0182006_1000148 3300015261 Bacteria 74813
406 Ga0182006_1000208 3300015261 Bacteria 58504
407 Ga0182006_1015497 3300015261 Bacteria 3267
408 Ga0182006_1019226 3300015261 Bacteria 2877
409 Ga0182006_1022687 3300015261 Bacteria 2606
410 Ga0182006_1025756 3300015261 Bacteria 2414
411 Ga0182006_1054130 3300015261 Bacteria 1536
412 Ga0182006_1090498 3300015261 Bacteria 1102
413 Ga0182007_10000043 3300015262 Bacteria 107693
414 Ga0182005_1000225 3300015265 Bacteria 37383
415 Ga0182005_1006372 3300015265 Bacteria 3617
416 Ga0182005_1007922 3300015265 Bacteria 3157
417 Ga0182005_1023059 3300015265 Bacteria 1703
418 Ga0183369_1003 3300015685 Bacteria 726443
419 Ga0183368_1002 3300015687 Bacteria 1865598
420 Ga0183360_10001 3300015689 Bacteria 3943671
421 Ga0163161_10002976 3300017792 Bacteria 11996
422 Ga0163161_10005305 3300017792 Bacteria 8973
423 Ga0163161_10027657 3300017792 Bacteria 4024
424 Ga0163161_10049683 3300017792 Bacteria 3032
425 Ga0206356_11596253 3300020070 Bacteria 4188
426 Ga0206354_10472637 3300020081 Bacteria 6882
427 Ga0206353_11520292 3300020082 Bacteria 1127
428 Ga0206353_11892459 3300020082 Bacteria 3841
429 Ga0209760_100270 3300025207 Bacteria 19113
430 Ga0209784_100011 3300025224 Bacteria 546770
431 Ga0209566_105937 3300025225 Bacteria 1483
432 Ga0209674_100061 3300025226 Bacteria 280844
433 Ga0209674_100077 3300025226 Bacteria 206312
434 Ga0209674_101778 3300025226 Bacteria 5225
435 Ga0209672_100004 3300025228 Bacteria 1467504
436 Ga0209672_100022 3300025228 Bacteria 374313
437 Ga0209672_100167 3300025228 Bacteria 55641
438 Ga0209672_100729 3300025228 Bacteria 16177
439 Ga0209672_101194 3300025228 Bacteria 10554
440 Ga0209147_106714 3300025229 Bacteria 1571
441 Ga0209563_100103 3300025230 Bacteria 151835
442 Ga0209563_111997 3300025230 Bacteria 1203
443 Ga0207427_100026 3300025231 Bacteria 412764
444 Ga0207427_100086 3300025231 Bacteria 140465
445 Ga0207427_100160 3300025231 Bacteria 75885
446 Ga0207427_100690 3300025231 Bacteria 15980
447 Ga0209437_100005 3300025233 Bacteria 1071596
448 Ga0209437_100178 3300025233 Bacteria 134932
449 Ga0209437_100244 3300025233 Bacteria 88556
450 Ga0209437_100293 3300025233 Bacteria 72458
451 Ga0209258_100003 3300025242 Bacteria 1467504
452 Ga0209258_100004 3300025242 Bacteria 1376422
453 Ga0209258_100027 3300025242 Bacteria 518449
454 Ga0209258_100182 3300025242 Bacteria 136629
455 Ga0209258_100327 3300025242 Bacteria 71811
456 Ga0209258_100610 3300025242 Bacteria 28851
457 Ga0209258_107210 3300025242 Bacteria 1669
458 Ga0207425_1000078 3300025245 Bacteria 104429
459 Ga0207425_1010809 3300025245 Bacteria 2205
460 Ga0209646_1001950 3300025246 Bacteria 4988
461 Ga0209646_1002809 3300025246 Bacteria 3677
462 Ga0209026_1000018 3300025250 Bacteria 381351
463 Ga0209026_1000084 3300025250 Bacteria 186997
464 Ga0209026_1000148 3300025250 Bacteria 111280
465 Ga0209026_1000155 3300025250 Bacteria 108684
466 Ga0209026_1000448 3300025250 Bacteria 32889
467 Ga0209026_1008095 3300025250 Bacteria 2247
468 Ga0209148_1000001 3300025254 Bacteria 2545271
469 Ga0209148_1000025 3300025254 Bacteria 663262
470 Ga0209148_1000062 3300025254 Bacteria 347704
471 Ga0209148_1000083 3300025254 Bacteria 270142
472 Ga0209148_1000299 3300025254 Bacteria 71811
473 Ga0209148_1006983 3300025254 Bacteria 2389
474 Ga0209759_1000066 3300025256 Bacteria 184163
475 Ga0209759_1000257 3300025256 Bacteria 77734
476 Ga0209759_1000305 3300025256 Bacteria 66754
477 Ga0209759_1000824 3300025256 Bacteria 24541
478 Ga0209759_1006727 3300025256 Bacteria 3815
479 Ga0209759_1025447 3300025256 Bacteria 1259
480 Ga0209759_1025535 3300025256 Bacteria 1255
481 Ga0209129_1000157 3300025258 Bacteria 105043
482 Ga0209129_1002303 3300025258 Bacteria 9488
483 Ga0209129_1006121 3300025258 Bacteria 4010
484 Ga0209233_1000002 3300025261 Bacteria 2501366
485 Ga0209233_1000011 3300025261 Bacteria 1071611
486 Ga0209233_1000128 3300025261 Bacteria 209927
487 Ga0209233_1000246 3300025261 Bacteria 88556
488 Ga0209565_1000001 3300025263 Bacteria 2950419
489 Ga0209565_1000014 3300025263 Bacteria 530302
490 Ga0209565_1004760 3300025263 Bacteria 4072
491 Ga0209455_1000004 3300025272 Bacteria 1467504
492 Ga0209455_1000019 3300025272 Bacteria 705658
493 Ga0209455_1000040 3300025272 Bacteria 430197
494 Ga0209455_1000084 3300025272 Bacteria 253164
495 Ga0209455_1000186 3300025272 Bacteria 97107
496 Ga0209455_1007936 3300025272 Bacteria 2939
497 Ga0209673_1000001 3300025273 Bacteria 3176258
498 Ga0209673_1000171 3300025273 Bacteria 133493
499 Ga0209673_1002529 3300025273 Bacteria 12518
500 Ga0209675_1000001 3300025291 Bacteria 2950293
501 Ga0209675_1000011 3300025291 Bacteria 520597
502 Ga0209675_1015425 3300025291 Bacteria 2268
503 Ga0209676_1000027 3300025292 Bacteria 560222
504 Ga0209676_1000047 3300025292 Bacteria 408645
505 Ga0209676_1000079 3300025292 Bacteria 290447
506 Ga0209676_1000963 3300025292 Bacteria 34865
507 Ga0209676_1000970 3300025292 Bacteria 34527
508 Ga0209676_1002059 3300025292 Bacteria 15674
509 Ga0209676_1006843 3300025292 Bacteria 5525
510 Ga0209676_1009313 3300025292 Bacteria 4251
511 Ga0209025_1000015 3300025294 Bacteria 808120
512 Ga0209025_1000054 3300025294 Bacteria 317002
513 Ga0209025_1001242 3300025294 Bacteria 35443
514 Ga0209025_1007257 3300025294 Bacteria 8328
515 Ga0209025_1069645 3300025294 Bacteria 1256
516 Ga0209564_1000001 3300025295 Bacteria 3176258
517 Ga0209564_1000221 3300025295 Bacteria 129537
518 Ga0209758_1000062 3300025297 Bacteria 317002
519 Ga0209758_1000577 3300025297 Bacteria 57284
520 Ga0209758_1010608 3300025297 Bacteria 5484
521 Ga0209758_1018409 3300025297 Bacteria 3424
522 Ga0209758_1027303 3300025297 Bacteria 2443
523 Ga0209050_1000329 3300025298 Bacteria 94932
524 Ga0209050_1000415 3300025298 Bacteria 79058
525 Ga0209256_1000002 3300025299 Bacteria 1906740
526 Ga0209256_1001265 3300025299 Bacteria 27598
527 Ga0209256_1004398 3300025299 Bacteria 8884
528 Ga0209256_1004927 3300025299 Bacteria 8008
529 Ga0209256_1004947 3300025299 Bacteria 7984
530 Ga0209256_1037984 3300025299 Bacteria 1250
531 Ga0209051_1001449 3300025303 Bacteria 20118
532 Ga0209051_1006817 3300025303 Bacteria 6359
533 Ga0209051_1073048 3300025303 Bacteria 1023
534 Ga0209257_1000081 3300025304 Bacteria 306577
535 Ga0209257_1000530 3300025304 Bacteria 66163
536 Ga0209257_1000837 3300025304 Bacteria 44348
537 Ga0209257_1001863 3300025304 Bacteria 22875
538 Ga0209257_1006985 3300025304 Bacteria 7023
539 Ga0209257_1011577 3300025304 Bacteria 4224
540 Ga0209257_1022250 3300025304 Bacteria 2267
541 Ga0207656_10027525 3300025321 Bacteria 2326
542 Ga0207656_10110112 3300025321 Bacteria 1272
543 Ga0207713_1001379 3300025735 Bacteria 19712
544 Ga0207713_1006311 3300025735 Bacteria 7241
545 Ga0207710_10004497 3300025900 Bacteria 6073
546 Ga0207680_10095441 3300025903 Bacteria 1900
547 Ga0207680_10269538 3300025903 Bacteria 1180
548 Ga0207680_10329785 3300025903 Bacteria 1069
549 Ga0207647_10000008 3300025904 Bacteria 192602
550 Ga0207647_10000250 3300025904 Bacteria 43994
551 Ga0207647_10002043 3300025904 Bacteria 15431
552 Ga0207647_10010215 3300025904 Bacteria 6632
553 Ga0207647_10016245 3300025904 Bacteria 5082
554 Ga0207645_10043171 3300025907 Bacteria 2885
555 Ga0207705_10000168 3300025909 Bacteria 70386
556 Ga0207705_10000836 3300025909 Bacteria 25177
557 Ga0207705_10028178 3300025909 Bacteria 4004
558 Ga0207705_10079577 3300025909 Bacteria 2387
559 Ga0207654_10007686 3300025911 Bacteria 5438
560 Ga0207707_10000032 3300025912 Bacteria 158499
561 Ga0207707_10000422 3300025912 Bacteria 44306
562 Ga0207707_10001438 3300025912 Bacteria 22028
563 Ga0207707_10001792 3300025912 Bacteria 19720
564 Ga0207707_10030814 3300025912 Bacteria 4692
565 Ga0207707_10054519 3300025912 Bacteria 3480
566 Ga0207707_10073158 3300025912 Bacteria 2988
567 Ga0207707_10118927 3300025912 Bacteria 2309
568 Ga0207707_10444042 3300025912 Bacteria 1110
569 Ga0207695_10000320 3300025913 Bacteria 116097
570 Ga0207695_10000355 3300025913 Bacteria 105211
571 Ga0207695_10000933 3300025913 Bacteria 52174
572 Ga0207695_10000943 3300025913 Bacteria 51800
573 Ga0207695_10001343 3300025913 Bacteria 41721
574 Ga0207695_10001428 3300025913 Bacteria 40198
575 Ga0207695_10001726 3300025913 Bacteria 34905
576 Ga0207695_10002647 3300025913 Bacteria 26166
577 Ga0207695_10021778 3300025913 Bacteria 7302
578 Ga0207695_10043366 3300025913 Bacteria 4794
579 Ga0207695_10083885 3300025913 Bacteria 3218
580 Ga0207695_10378944 3300025913 Bacteria 1300
581 Ga0207671_10000057 3300025914 Bacteria 183729
582 Ga0207671_10001018 3300025914 Bacteria 34285
583 Ga0207671_10044985 3300025914 Bacteria 3264
584 Ga0207671_10364419 3300025914 Bacteria 1147
585 Ga0207693_10125060 3300025915 Bacteria 2021
586 Ga0207660_10000362 3300025917 Bacteria 29578
587 Ga0207660_10000402 3300025917 Bacteria 28537
588 Ga0207660_10007496 3300025917 Bacteria 7061
589 Ga0207660_10126323 3300025917 Bacteria 1942
590 Ga0207660_10275262 3300025917 Bacteria 1334
591 Ga0207657_10002254 3300025919 Bacteria 20904
592 Ga0207657_10002369 3300025919 Bacteria 20383
593 Ga0207657_10004447 3300025919 Bacteria 14830
594 Ga0207657_10107616 3300025919 Bacteria 2306
595 Ga0207649_10001307 3300025920 Bacteria 14861
596 Ga0207649_10002328 3300025920 Bacteria 10668
597 Ga0207649_10008777 3300025920 Bacteria 5517
598 Ga0207649_10080454 3300025920 Bacteria 2107
599 Ga0207652_10000026 3300025921 Bacteria 156183
600 Ga0207652_10000368 3300025921 Bacteria 46835
601 Ga0207652_10000811 3300025921 Bacteria 29836
602 Ga0207652_10016377 3300025921 Bacteria 6052
603 Ga0207652_10045387 3300025921 Bacteria 3747
604 Ga0207652_10093455 3300025921 Bacteria 2647
605 Ga0207652_10217504 3300025921 Bacteria 1721
606 Ga0207652_10258450 3300025921 Bacteria 1571
607 Ga0207652_10290409 3300025921 Bacteria 1475
608 Ga0207681_10005273 3300025923 Bacteria 7940
609 Ga0207694_10036560 3300025924 Bacteria 3769
610 Ga0207694_10045240 3300025924 Bacteria 3400
611 Ga0207694_10327004 3300025924 Bacteria 1266
612 Ga0207650_10034083 3300025925 Bacteria 3691
613 Ga0207650_10071471 3300025925 Bacteria 2610
614 Ga0207650_10155894 3300025925 Bacteria 1806
615 Ga0207687_10000279 3300025927 Bacteria 35014
616 Ga0207687_10029377 3300025927 Bacteria 3697
617 Ga0207687_10065678 3300025927 Bacteria 2577
618 Ga0207700_10009087 3300025928 Bacteria 6189
619 Ga0207664_10000055 3300025929 Bacteria 126338
620 Ga0207664_10021264 3300025929 Bacteria 4821
621 Ga0207664_10081891 3300025929 Bacteria 2628
622 Ga0207690_10000209 3300025932 Bacteria 45368
623 Ga0207690_10002208 3300025932 Bacteria 11872
624 Ga0207690_10002280 3300025932 Bacteria 11697
625 Ga0207690_10005514 3300025932 Bacteria 7467
626 Ga0207690_10081658 3300025932 Bacteria 2259
627 Ga0207690_10086681 3300025932 Bacteria 2201
628 Ga0207706_10056810 3300025933 Bacteria 3450
629 Ga0207706_10066404 3300025933 Bacteria 3174
630 Ga0207709_10000536 3300025935 Bacteria 32696
631 Ga0207670_10000678 3300025936 Bacteria 18002
632 Ga0207670_10049654 3300025936 Bacteria 2808
633 Ga0207669_10127560 3300025937 Bacteria 1741
634 Ga0207704_10071318 3300025938 Bacteria 2204
635 Ga0207704_10154349 3300025938 Bacteria 1625
636 Ga0207691_10037062 3300025940 Bacteria 4517
637 Ga0207691_10045793 3300025940 Bacteria 4021
638 Ga0207691_10061408 3300025940 Bacteria 3414
639 Ga0207691_10246767 3300025940 Bacteria 1542
640 Ga0207711_10458380 3300025941 Bacteria 1187
641 Ga0207689_10049276 3300025942 Bacteria 3475
642 Ga0207661_10012207 3300025944 Bacteria 6239
643 Ga0207679_10003377 3300025945 Bacteria 9853
644 Ga0207667_10000139 3300025949 Bacteria 109949
645 Ga0207667_10000247 3300025949 Bacteria 76307
646 Ga0207667_10000436 3300025949 Bacteria 55945
647 Ga0207667_10001265 3300025949 Bacteria 31699
648 Ga0207667_10007174 3300025949 Bacteria 13444
649 Ga0207667_10008798 3300025949 Bacteria 11954
650 Ga0207667_10009079 3300025949 Bacteria 11756
651 Ga0207667_10025041 3300025949 Bacteria 6540
652 Ga0207667_10029132 3300025949 Bacteria 5990
653 Ga0207667_10134768 3300025949 Bacteria 2543
654 Ga0207667_10618636 3300025949 Bacteria 1091
655 Ga0207712_10000143 3300025961 Bacteria 74697
656 Ga0207668_10034221 3300025972 Bacteria 3373
657 Ga0207668_10072813 3300025972 Bacteria 2460
658 Ga0207640_10000072 3300025981 Bacteria 80118
659 Ga0207640_10001040 3300025981 Bacteria 15353
660 Ga0207640_10003987 3300025981 Bacteria 7973
661 Ga0207658_10109893 3300025986 Bacteria 2177
662 Ga0207658_10448990 3300025986 Bacteria 1141
663 Ga0207677_10127910 3300026023 Bacteria 1923
664 Ga0207639_10000639 3300026041 Bacteria 24160
665 Ga0207639_10002460 3300026041 Bacteria 12421
666 Ga0207639_10003288 3300026041 Bacteria 10876
667 Ga0207639_10025738 3300026041 Bacteria 4268
668 Ga0207639_10136780 3300026041 Bacteria 2036
669 Ga0207678_10001290 3300026067 Bacteria 23178
670 Ga0207678_10001605 3300026067 Bacteria 20808
671 Ga0207678_10006048 3300026067 Bacteria 10764
672 Ga0207678_10007279 3300026067 Bacteria 9809
673 Ga0207678_10037910 3300026067 Bacteria 4191
674 Ga0207678_10041911 3300026067 Bacteria 3968
675 Ga0207678_10119888 3300026067 Bacteria 2245
676 Ga0207678_10170353 3300026067 Bacteria 1859
677 Ga0207702_10000107 3300026078 Bacteria 96024
678 Ga0207702_10001032 3300026078 Bacteria 28557
679 Ga0207702_10050670 3300026078 Bacteria 3505
680 Ga0207702_10066079 3300026078 Bacteria 3099
681 Ga0207702_10110845 3300026078 Bacteria 2439
682 Ga0207702_10230769 3300026078 Bacteria 1730
683 Ga0207702_10337674 3300026078 Bacteria 1439
684 Ga0207641_10056239 3300026088 Bacteria 3343
685 Ga0207641_10279945 3300026088 Bacteria 1568
686 Ga0207641_10319656 3300026088 Bacteria 1472
687 Ga0207641_10557936 3300026088 Bacteria 1117
688 Ga0207648_10014914 3300026089 Bacteria 7163
689 Ga0207648_10136229 3300026089 Bacteria 2163
690 Ga0207648_10290057 3300026089 Bacteria 1465
691 Ga0207676_10134473 3300026095 Bacteria 2107
692 Ga0207676_10206733 3300026095 Bacteria 1739
693 Ga0207674_10000371 3300026116 Bacteria 58464
694 Ga0207674_10001386 3300026116 Bacteria 31217
695 Ga0207674_10053332 3300026116 Bacteria 4122
696 Ga0207674_10075758 3300026116 Bacteria 3374
697 Ga0207674_10118046 3300026116 Bacteria 2623
698 Ga0207674_10124450 3300026116 Bacteria 2544
699 Ga0207674_10148012 3300026116 Bacteria 2306
700 Ga0207674_10275043 3300026116 Bacteria 1632
701 Ga0207675_100227767 3300026118 Bacteria 1797
702 Ga0207675_100768183 3300026118 Bacteria 976
703 Ga0207683_10720618 3300026121 Bacteria 925
704 Ga0207683_10720911 3300026121 Bacteria 925
705 Ga0207698_10004539 3300026142 Bacteria 8475
706 Ga0207698_10015176 3300026142 Bacteria 5152
707 Ga0207698_10181051 3300026142 Bacteria 1867
708 Ga0207698_10462779 3300026142 Bacteria 1227
709 Ga0207698_10462942 3300026142 Bacteria 1227
710 Ga0209371_1000004 3300027312 Bacteria 1098197
711 Ga0209371_1000016 3300027312 Bacteria 646301
712 Ga0209969_1015899 3300027360 Bacteria 1101
713 Ga0209995_1012544 3300027471 Bacteria 1383
714 Ga0209970_1024957 3300027614 Bacteria 1023
715 Ga0210002_1012761 3300027617 Bacteria 1308
716 Ga0209983_1005036 3300027665 Bacteria 2755
717 Ga0209971_1005650 3300027682 Bacteria 2967
718 Ga0209974_10005392 3300027876 Bacteria 4501
719 Ga0209974_10008848 3300027876 Bacteria 3430
720 Ga0268266_10000001 3300028379 Bacteria 4040580
721 Ga0268266_10000901 3300028379 Bacteria 38422
722 Ga0268266_10048368 3300028379 Bacteria 3645
723 Ga0268266_10465344 3300028379 Bacteria 1203
724 Ga0268265_10551219 3300028380 Bacteria 1094
725 Ga0268264_10021249 3300028381 Bacteria 5303
726 Ga0268264_10541655 3300028381 Bacteria 1140
727 Ga0265338_10042995 3300028800 Bacteria 4198
728 Ga0265338_10103927 3300028800 Bacteria 2306
729 Ga0268256_1000005 3300030500 Bacteria 1082342
730 Ga0268256_1000015 3300030500 Bacteria 646300
731 Ga0316177_1080492 3300030731 Bacteria 3064
732 Ga0314311_1060965 3300030733 Bacteria 11188
733 Ga0316183_1146021 3300030742 Bacteria 9603
734 Ga0316181_1033804 3300030744 Bacteria 2389
735 Ga0307513_10008959 3300031456 Bacteria 12700
736 Ga0307513_10411234 3300031456 Bacteria 1085
737 Ga0307509_10022222 3300031507 Bacteria 7158
738 Ga0307509_10138438 3300031507 Bacteria 2375
739 Ga0307509_10363485 3300031507 Bacteria 1166
740 Ga0307408_100053478 3300031548 Bacteria 2916
741 Ga0307408_100114448 3300031548 Bacteria 2078
742 Ga0307408_100127429 3300031548 Bacteria 1981
743 Ga0307408_100517604 3300031548 Bacteria 1047
744 Ga0307508_10199806 3300031616 Bacteria 1600
745 Ga0316576_10123013 3300031727 Bacteria 1949
746 Ga0316576_10206213 3300031727 Bacteria 1480
747 Ga0316578_10037457 3300031728 Bacteria 2794
748 Ga0307405_10255915 3300031731 Bacteria 1305
749 Ga0316577_10006244 3300031733 Bacteria 6288
750 Ga0307413_10000147 3300031824 Bacteria 19006
751 Ga0307413_10059747 3300031824 Bacteria 2344
752 Ga0307413_10063188 3300031824 Bacteria 2294
753 Ga0307410_10188456 3300031852 Bacteria 1567
754 Ga0307406_10009208 3300031901 Bacteria 5531
755 Ga0307406_10063990 3300031901 Bacteria 2385
756 Ga0307406_10422843 3300031901 Bacteria 1062
757 Ga0307407_10214144 3300031903 Bacteria 1299
758 Ga0307412_10001351 3300031911 Bacteria 13640
759 Ga0307412_10029386 3300031911 Bacteria 3449
760 Ga0307409_100460041 3300031995 Bacteria 1230
761 Ga0307416_100014236 3300032002 Bacteria 5441
762 Ga0307416_100101159 3300032002 Bacteria 2509
763 Ga0307416_100149196 3300032002 Bacteria 2141
764 Ga0307416_100171404 3300032002 Bacteria 2021
765 Ga0307416_100375673 3300032002 Bacteria 1449
766 Ga0307414_10005629 3300032004 Bacteria 6912
767 Ga0307414_10007619 3300032004 Bacteria 6091
768 Ga0307414_10019115 3300032004 Bacteria 4238
769 Ga0307414_10022700 3300032004 Bacteria 3964
770 Ga0307414_10022879 3300032004 Bacteria 3952
771 Ga0307414_10049456 3300032004 Bacteria 2907
772 Ga0307414_10090000 3300032004 Bacteria 2276
773 Ga0307414_10093897 3300032004 Bacteria 2238
774 Ga0307414_10099984 3300032004 Bacteria 2180
775 Ga0307414_10113989 3300032004 Bacteria 2064
776 Ga0307414_10219041 3300032004 Bacteria 1561
777 Ga0307414_10316589 3300032004 Bacteria 1326
778 Ga0307411_10043506 3300032005 Bacteria 2873
779 Ga0307411_10101956 3300032005 Bacteria 2032
780 Ga0307411_10126775 3300032005 Bacteria 1858
781 Ga0307411_10182784 3300032005 Bacteria 1593
782 Ga0307411_10315102 3300032005 Bacteria 1261
783 Ga0307507_10159848 3300033179 Bacteria 1668
784 Ga0373937_0245944 3300036401 Bacteria 1686
785 Ga0316584_0000540 3300036712 Bacteria 20258
786 Ga0316584_0244550 3300036712 Bacteria 1312
787 Ga0395899_0012535 3300037312 Bacteria 6498
788 Ga0395899_0040277 3300037312 Bacteria 3494
789 Ga0395899_0148535 3300037312 Bacteria 1662
790 Ga0395899_0238747 3300037312 Bacteria 1252
791 Ga0395899_0239430 3300037312 Bacteria 1249
792 Ga0395900_0000012 3300037418 Bacteria 401198
793 Ga0395900_0000092 3300037418 Bacteria 166966
794 Ga0395900_0002817 3300037418 Bacteria 18982
795 Ga0395900_0006858 3300037418 Bacteria 11818
796 Ga0395900_0018342 3300037418 Bacteria 7138
797 Ga0395900_0035826 3300037418 Bacteria 5113
798 Ga0395900_0460485 3300037418 Bacteria 1226
799 Ga0395898_0000023 3300037466 Bacteria 379477
800 Ga0395898_0000237 3300037466 Bacteria 139991
801 Ga0395898_0013167 3300037466 Bacteria 8523
802 Ga0395898_0022209 3300037466 Bacteria 6430
803 Ga0395898_0050118 3300037466 Bacteria 4088
804 Ga0395898_0059861 3300037466 Bacteria 3703
805 Ga0395905_0000883 3300037471 Bacteria 39095
806 Ga0395905_0020602 3300037471 Bacteria 6243
807 Ga0395905_0039237 3300037471 Bacteria 4443
808 Ga0395905_0133615 3300037471 Bacteria 2334
809 Ga0395905_0385147 3300037471 Bacteria 1296
810 Ga0395905_0435349 3300037471 Bacteria 1208
811 Ga0395901_0000992 3300038443 Bacteria 30626
812 Ga0395901_0004126 3300038443 Bacteria 14640
813 Ga0395901_0015549 3300038443 Bacteria 7750
814 Ga0395901_0081819 3300038443 Bacteria 3373
815 Ga0395901_0146599 3300038443 Bacteria 2480
816 Ga0395901_0149959 3300038443 Bacteria 2450
817 Ga0395901_0217329 3300038443 Bacteria 1998
818 Ga0237816_01224 3300039145 Bacteria 2101
819 Ga0436365_0468765 3300039437 Bacteria 8473
820 Ga0436361_0109835 3300039447 Unclassified 1499
821 Ga0436363_0346981 3300039450 Bacteria 1402
822 Ga0439436_0000245 3300041404 Bacteria 13078
823 Ga0439436_0001317 3300041404 Bacteria 7115
824 Ga0439436_0015229 3300041404 Bacteria 2313
825 Ga0439436_0037155 3300041404 Bacteria 1403
826 Ga0439439_0011664 3300041406 Bacteria 2118
827 Ga0439439_0027692 3300041406 Bacteria 1432
828 Ga0439465_0002136 3300041413 Bacteria 6496
829 Ga0439465_0004591 3300041413 Bacteria 4460
830 Ga0439465_0021293 3300041413 Bacteria 2032
831 Ga0439465_0049045 3300041413 Bacteria 1378
832 Ga0451789_0816827 3300041443 Bacteria 1835
833 Ga0451793_0084196 3300041452 Bacteria 4406
834 Ga0451793_0245814 3300041452 Bacteria 1461
835 Ga0451793_0901274 3300041452 Bacteria 1221
836 Ga0451800_0792482 3300041459 Bacteria 11283
837 Ga0451802_1855302 3300041460 Bacteria 1065
838 Ga0451806_727761 3300041462 Bacteria 4050
839 Ga0451804_0198474 3300041463 Bacteria 7994
840 Ga0451807_0149715 3300041486 Bacteria 7635
841 Ga0451807_1723472 3300041486 Bacteria 3054
842 Ga0451807_1898858 3300041486 Bacteria 1329
843 Ga0451807_2241946 3300041486 Bacteria 3641
844 Ga0451837_1131221 3300041494 Bacteria 2119
845 Ga0451839_0504575 3300041496 Bacteria 864
846 Ga0451843_0827567 3300041509 Bacteria 1682
847 Ga0451843_0952033 3300041509 Bacteria 1871
848 Ga0451843_1048573 3300041509 Bacteria 1094
849 Ga0451843_1245072 3300041509 Bacteria 1611
850 Ga0451853_2369144 3300041512 Bacteria 1424
851 Ga0451853_3110382 3300041512 Bacteria 1818
852 Ga0439445_0022184 3300042004 Bacteria 1600
853 Ga0439432_003228 3300042006 Bacteria 6067
854 Ga0439432_005109 3300042006 Bacteria 4745
855 Ga0439432_037157 3300042006 Bacteria 1555
856 Ga0439432_041153 3300042006 Bacteria 1464
857 Ga0439449_0000046 3300042007 Bacteria 37723
858 Ga0439449_0001830 3300042007 Bacteria 8368
859 Ga0439449_0003679 3300042007 Bacteria 5951
860 Ga0439449_0007392 3300042007 Bacteria 4174
861 Ga0439449_0013568 3300042007 Bacteria 3066
862 Ga0439449_0015114 3300042007 Bacteria 2900
863 Ga0439449_0019863 3300042007 Bacteria 2519
864 Ga0450911_002326 3300042115 Bacteria 3795
865 Ga0450908_000075 3300042184 Bacteria 19743
866 Ga0439434_0077072 3300042435 Bacteria 1055
867 Ga0439459_0001196 3300042438 Bacteria 3784
868 Ga0451577_0028918 3300042876 Bacteria 5012
869 Ga0451577_0033724 3300042876 Bacteria 4616
870 Ga0451577_0177892 3300042876 Bacteria 1918
871 Ga0466969_0004032 3300044656 Bacteria 7784
872 Ga0466969_0012271 3300044656 Bacteria 4523
873 Ga0466969_0014973 3300044656 Bacteria 4069
874 Ga0466982_0000005 3300044672 Bacteria 364340
875 Ga0466982_0000037 3300044672 Bacteria 42622
876 Ga0466965_0001833 3300044683 Bacteria 8841
877 Ga0466965_0136517 3300044683 Bacteria 1274
878 Ga0466966_0002637 3300044684 Bacteria 11743
879 Ga0466966_0052390 3300044684 Bacteria 2592
880 Ga0466966_0087713 3300044684 Bacteria 1933
881 Ga0466961_0001395 3300044693 Bacteria 14966
882 Ga0466961_0004319 3300044693 Bacteria 8899
883 Ga0466961_0014369 3300044693 Bacteria 5081
884 Ga0466963_0098779 3300044694 Bacteria 1996
885 Ga0453684_0001089 3300044712 Bacteria 85906
886 Ga0453684_0639591 3300044712 Bacteria 1162
887 Ga0466971_0003218 3300044719 Bacteria 6968
888 Ga0466971_0049874 3300044719 Bacteria 1883
889 Ga0466971_0050168 3300044719 Bacteria 1878
890 Ga0466971_0088500 3300044719 Bacteria 1416
891 Ga0466968_0009977 3300044735 Bacteria 3667
892 Ga0466968_0041132 3300044735 Bacteria 1950
893 Ga0466970_0023113 3300044765 Bacteria 3245
894 Ga0466957_0013133 3300044842 Bacteria 4800
895 Ga0466957_0059035 3300044842 Bacteria 2351
896 Ga0466957_0061518 3300044842 Bacteria 2305
897 Ga0466960_0010676 3300044901 Bacteria 3819
898 Ga0466959_0000091 3300045049 Bacteria 57419
899 Ga0466959_0040070 3300045049 Bacteria 3461
900 Ga0451576_0000201 3300045051 Bacteria 150175
901 Ga0466958_0049995 3300045836 Bacteria 2531
902 Ga0466958_0218669 3300045836 Bacteria 1215
903 Ga0466967_0277813 3300045976 Bacteria 1606
904 Ga0466967_0375233 3300045976 Bacteria 1380
905 Ga0495617_000495 3300046452 Bacteria 20847
906 Ga0495627_021048 3300046453 Bacteria 2166
907 Ga0495590_0098444 3300046457 Bacteria 1038
908 Ga0495629_0140902 3300046459 Bacteria 1678
909 Ga0495638_0000019 3300046460 Bacteria 384671
910 Ga0495638_0000426 3300046460 Bacteria 50926
911 Ga0495638_0000718 3300046460 Bacteria 35732
912 Ga0495638_0002776 3300046460 Bacteria 14066
913 Ga0495638_0056603 3300046460 Bacteria 2433
914 Ga0495638_0137968 3300046460 Bacteria 1426
915 Ga0495650_0000206 3300046471 Bacteria 127713
916 Ga0495650_0029263 3300046471 Bacteria 2513
917 Ga0495585_0001731 3300046492 Bacteria 16612
918 Ga0495585_0002973 3300046492 Bacteria 11706
919 Ga0495607_0000178 3300046501 Bacteria 67386
920 Ga0495607_0000256 3300046501 Bacteria 57167
921 Ga0495607_0040761 3300046501 Bacteria 2762
922 Ga0495583_0005312 3300046506 Bacteria 8799
923 Ga0495606_0002288 3300046507 Bacteria 22642
924 Ga0495606_0003126 3300046507 Bacteria 17973
925 Ga0495606_0008786 3300046507 Bacteria 8675
926 Ga0495606_0042589 3300046507 Bacteria 3034
927 Ga0495606_0088622 3300046507 Bacteria 1907
928 Ga0495610_0000341 3300046512 Bacteria 49154
929 Ga0495610_0002042 3300046512 Bacteria 17236
930 Ga0495616_0000357 3300046513 Bacteria 35877
931 Ga0495616_0020609 3300046513 Bacteria 3583
932 Ga0495620_0000150 3300046515 Bacteria 56486
933 Ga0495620_0000287 3300046515 Bacteria 36247
934 Ga0495631_0000257 3300046518 Bacteria 36879
935 Ga0495631_0000558 3300046518 Bacteria 24972
936 Ga0495631_0011328 3300046518 Bacteria 4387
937 Ga0495632_0015511 3300046519 Bacteria 4267
938 Ga0495632_0015643 3300046519 Bacteria 4242
939 Ga0495637_0039421 3300046520 Bacteria 2039
940 Ga0495643_0001297 3300046522 Bacteria 23770
941 Ga0495648_0001786 3300046524 Bacteria 20692
942 Ga0495648_0005918 3300046524 Bacteria 10065
943 Ga0495663_0001355 3300046525 Bacteria 7726
944 Ga0495663_0011366 3300046525 Bacteria 2477
945 Ga0495663_0012667 3300046525 Bacteria 2352
946 Ga0495663_0031906 3300046525 Bacteria 1567
947 Ga0495598_0003992 3300046537 Bacteria 3168
948 Ga0495609_0002676 3300046538 Bacteria 10778
949 Ga0495622_0002790 3300046557 Bacteria 8338
950 Ga0495633_0016706 3300046558 Bacteria 3776
951 Ga0495633_0073875 3300046558 Bacteria 1589
952 Ga0495656_0001730 3300046615 Bacteria 7147
953 Ga0495656_0092462 3300046615 Bacteria 1385
954 Ga0495668_0004174 3300046616 Bacteria 10424
955 Ga0495611_0000001 3300046648 Bacteria 2628469
956 Ga0495611_0000044 3300046648 Bacteria 92551
957 Ga0495625_0000041 3300046660 Bacteria 206598
958 Ga0495625_0009643 3300046660 Bacteria 8051
959 Ga0495625_0047540 3300046660 Bacteria 3093
960 Ga0495625_0072541 3300046660 Bacteria 2414
961 Ga0495625_0104055 3300046660 Bacteria 1946
962 Ga0495661_0004401 3300046665 Bacteria 10181
963 Ga0495670_0001904 3300046691 Bacteria 10286
964 Ga0495670_0021176 3300046691 Bacteria 3207
965 Ga0495671_0001302 3300046692 Bacteria 17018
966 Ga0495649_0000930 3300046694 Bacteria 23188
967 Ga0495589_0000008 3300046794 Bacteria 266071
968 Ga0495660_0000231 3300046810 Bacteria 54997
969 Ga0495660_0000421 3300046810 Bacteria 35861
970 Ga0495636_0000667 3300047318 Bacteria 12588
971 Ga0495636_0008169 3300047318 Bacteria 4126
972 Ga0495636_0015711 3300047318 Bacteria 3018
973 Ga0495636_0033687 3300047318 Bacteria 2106
974 Ga0495672_0000373 3300047320 Bacteria 55844
975 Ga0495672_0009395 3300047320 Bacteria 7088
976 Ga0495672_0099020 3300047320 Bacteria 1585
977 Ga0495683_0000643 3300047323 Bacteria 25972
978 Ga0495679_000004 3300047446 Bacteria 748056
979 Ga0495673_0000004 3300047469 Bacteria 1354526
980 Ga0495673_0000041 3300047469 Bacteria 296723
981 Ga0495673_0004064 3300047469 Bacteria 9316
982 Ga0495673_0022472 3300047469 Bacteria 3090
983 Ga0495681_0058289 3300047470 Bacteria 1790
984 Ga0495686_0000108 3300047472 Bacteria 173579
985 Ga0495686_0004065 3300047472 Bacteria 12220
986 Ga0495686_0006536 3300047472 Bacteria 8902
987 Ga0495686_0006573 3300047472 Bacteria 8869
988 Ga0495686_0007270 3300047472 Bacteria 8327
989 Ga0495686_0010094 3300047472 Bacteria 6742
990 Ga0495686_0019590 3300047472 Bacteria 4521
991 Ga0495686_0054137 3300047472 Bacteria 2513
992 Ga0496100_0020951 3300048903 Bacteria 3929
993 Ga0496100_0074028 3300048903 Bacteria 2281
994 Ga0496101_0040842 3300048904 Bacteria 3305
995 Ga0496102_0313070 3300048905 Bacteria 1479
996 Ga0496104_0053198 3300048907 Bacteria 3825
997 Ga0496104_0338307 3300048907 Bacteria 1418
998 Ga0496104_0521717 3300048907 Bacteria 1099
999 Ga0496105_0000021 3300048908 Bacteria 164255
1000 Ga0496105_0002033 3300048908 Bacteria 14631
1001 Ga0496106_0031955 3300048909 Bacteria 3923
1002 Ga0496106_0148858 3300048909 Bacteria 1846
1003 Ga0496106_0346232 3300048909 Bacteria 1194
1004 Ga0496107_0041756 3300048910 Bacteria 3294
1005 Ga0496107_0099030 3300048910 Bacteria 2136
1006 Ga0496108_0055892 3300048911 Bacteria 3315
1007 Ga0496108_0143031 3300048911 Bacteria 2061
1008 Ga0496109_0251788 3300048912 Bacteria 1663
1009 Ga0496111_0474370 3300048914 Bacteria 922
1010 Ga0496112_0226721 3300048915 Bacteria 1824
1011 Ga0496113_0005101 3300048916 Bacteria 8158
1012 Ga0496113_0212743 3300048916 Bacteria 1539
1013 Ga0496114_0000820 3300048917 Bacteria 23314
1014 Ga0496114_0002725 3300048917 Bacteria 13496
1015 Ga0496114_0138149 3300048917 Bacteria 2108
1016 Ga0496115_0000114 3300048918 Bacteria 73307
1017 Ga0496115_0000387 3300048918 Bacteria 36211
1018 Ga0496115_0004395 3300048918 Bacteria 10205
1019 Ga0496115_0008772 3300048918 Bacteria 7494
1020 Ga0496115_0052195 3300048918 Bacteria 3280
1021 Ga0496115_0106677 3300048918 Bacteria 2300
1022 Ga0496115_0134012 3300048918 Bacteria 2042
1023 Ga0496115_0423901 3300048918 Bacteria 1078
1024 Ga0496116_0004008 3300048919 Bacteria 14280
1025 Ga0496116_0064193 3300048919 Bacteria 2361
1026 Ga0496116_0075584 3300048919 Bacteria 2113
1027 Ga0496117_0001196 3300048920 Bacteria 39067
1028 Ga0496117_0001459 3300048920 Bacteria 34088
1029 Ga0496117_0008161 3300048920 Bacteria 10000
1030 Ga0496117_0017436 3300048920 Bacteria 5995
1031 Ga0496117_0048556 3300048920 Bacteria 3030
1032 Ga0496117_0049740 3300048920 Bacteria 2978
1033 Ga0496117_0084717 3300048920 Bacteria 2066
1034 Ga0496117_0095972 3300048920 Bacteria 1893
1035 Ga0496118_0000169 3300048921 Bacteria 118190
1036 Ga0496118_0000528 3300048921 Bacteria 62711
1037 Ga0496118_0001268 3300048921 Bacteria 38749
1038 Ga0496118_0001486 3300048921 Bacteria 35102
1039 Ga0496118_0003436 3300048921 Bacteria 19937
1040 Ga0496118_0003579 3300048921 Bacteria 19347
1041 Ga0496118_0004865 3300048921 Bacteria 15636
1042 Ga0496118_0011727 3300048921 Bacteria 8518
1043 Ga0496118_0021844 3300048921 Bacteria 5616
1044 Ga0496118_0027255 3300048921 Bacteria 4840
1045 Ga0496118_0047598 3300048921 Bacteria 3321
1046 Ga0496118_0101421 3300048921 Bacteria 1944
1047 Ga0496119_0000165 3300048922 Bacteria 92447
1048 Ga0496119_0000659 3300048922 Bacteria 46235
1049 Ga0496119_0000951 3300048922 Bacteria 37280
1050 Ga0496119_0020548 3300048922 Bacteria 4814
1051 Ga0496120_0000054 3300048923 Bacteria 181170
1052 Ga0496120_0000217 3300048923 Bacteria 99402
1053 Ga0496120_0000276 3300048923 Bacteria 86130
1054 Ga0496120_0001321 3300048923 Bacteria 30616
1055 Ga0496121_0000148 3300048924 Bacteria 154021
1056 Ga0496121_0000364 3300048924 Bacteria 92919
1057 Ga0496121_0001122 3300048924 Bacteria 47076
1058 Ga0496121_0012440 3300048924 Bacteria 9277
1059 Ga0496121_0013502 3300048924 Bacteria 8766
1060 Ga0496121_0017454 3300048924 Bacteria 7332
1061 Ga0496121_0030555 3300048924 Bacteria 4945
1062 Ga0496121_0035477 3300048924 Bacteria 4469
1063 Ga0496121_0038038 3300048924 Bacteria 4267
1064 Ga0496121_0046365 3300048924 Bacteria 3721
1065 Ga0496121_0060089 3300048924 Bacteria 3129
1066 Ga0496121_0088573 3300048924 Bacteria 2426
1067 Ga0496121_0169928 3300048924 Bacteria 1585
1068 Ga0496122_0000062 3300048925 Bacteria 241387
1069 Ga0496122_0000372 3300048925 Bacteria 96314
1070 Ga0496122_0004100 3300048925 Bacteria 18458
1071 Ga0496122_0039267 3300048925 Bacteria 3777
1072 Ga0496122_0044506 3300048925 Bacteria 3462
1073 Ga0496122_0056232 3300048925 Bacteria 2935
1074 Ga0496122_0101530 3300048925 Bacteria 1921
1075 Ga0496122_0126181 3300048925 Bacteria 1637
1076 Ga0496123_0000253 3300048926 Bacteria 108364
1077 Ga0496123_0003248 3300048926 Bacteria 18471
1078 Ga0496123_0003662 3300048926 Bacteria 16955
1079 Ga0496123_0009343 3300048926 Bacteria 8844
1080 Ga0496123_0020955 3300048926 Bacteria 5095
1081 Ga0496123_0031098 3300048926 Bacteria 3891
1082 Ga0496123_0053244 3300048926 Bacteria 2676
1083 Ga0496123_0072151 3300048926 Bacteria 2149
1084 Ga0496123_0074609 3300048926 Bacteria 2098
1085 Ga0496123_0078488 3300048926 Bacteria 2022
1086 Ga0496123_0122514 3300048926 Bacteria 1459
1087 Ga0496123_0211205 3300048926 Bacteria 986
1088 Ga0496124_0000009 3300048927 Bacteria 734820
1089 Ga0496124_0000734 3300048927 Bacteria 53581
1090 Ga0496124_0000815 3300048927 Bacteria 50713
1091 Ga0496124_0011679 3300048927 Bacteria 8762
1092 Ga0496124_0012879 3300048927 Bacteria 8211
1093 Ga0496124_0035745 3300048927 Bacteria 4343
1094 Ga0496124_0052800 3300048927 Bacteria 3451
1095 Ga0496124_0056350 3300048927 Bacteria 3315
1096 Ga0496124_0063983 3300048927 Bacteria 3071
1097 Ga0496124_0120552 3300048927 Bacteria 2096
1098 Ga0496124_0173218 3300048927 Bacteria 1669
1099 Ga0496124_0224555 3300048927 Bacteria 1409
1100 Ga0496125_0000750 3300048928 Bacteria 53532
1101 Ga0496125_0004325 3300048928 Bacteria 16486
1102 Ga0496125_0007644 3300048928 Bacteria 11459
1103 Ga0496125_0013354 3300048928 Bacteria 8080
1104 Ga0496125_0015751 3300048928 Bacteria 7290
1105 Ga0496125_0019641 3300048928 Bacteria 6364
1106 Ga0496125_0087228 3300048928 Bacteria 2358
1107 Ga0496125_0090757 3300048928 Bacteria 2291
1108 Ga0496126_0000206 3300048929 Bacteria 132028
1109 Ga0496126_0000835 3300048929 Bacteria 54796
1110 Ga0496126_0013972 3300048929 Bacteria 8142
1111 Ga0496126_0038127 3300048929 Bacteria 4474
1112 Ga0496126_0058576 3300048929 Bacteria 3472
1113 Ga0496126_0060649 3300048929 Bacteria 3401
1114 Ga0496126_0061534 3300048929 Bacteria 3372
1115 Ga0496126_0071393 3300048929 Bacteria 3090
1116 Ga0496126_0109970 3300048929 Bacteria 2401
1117 Ga0496126_0142188 3300048929 Bacteria 2064
1118 Ga0495678_000116 3300049459 Bacteria 95210
1119 Ga0495682_0002358 3300049460 Bacteria 8973
1120 Ga0495682_0003246 3300049460 Bacteria 7291
1121 Ga0495682_0020963 3300049460 Bacteria 2451
1122 Ga0501290_000667 3300049513 Bacteria 5135
1123 Ga0501292_004939 3300049515 Bacteria 1844
1124 Ga0501299_010975 3300049522 Bacteria 1522
1125 Ga0501031_0002100 3300049568 Bacteria 12563
1126 Ga0501031_0018604 3300049568 Bacteria 4524
1127 Ga0501031_0172512 3300049568 Bacteria 1413
1128 Ga0501031_0174677 3300049568 Bacteria 1403
1129 Ga0501032_0001175 3300049569 Bacteria 20997
1130 Ga0501032_0019849 3300049569 Bacteria 4692
1131 Ga0501032_0023609 3300049569 Bacteria 4245
1132 Ga0501032_0113545 3300049569 Bacteria 1792
1133 Ga0501033_0000932 3300049570 Bacteria 26712
1134 Ga0501033_0004694 3300049570 Bacteria 10935
1135 Ga0501033_0005337 3300049570 Bacteria 10184
1136 Ga0501033_0016017 3300049570 Bacteria 5678
1137 Ga0501033_0023695 3300049570 Bacteria 4629
1138 Ga0501033_0035014 3300049570 Bacteria 3763
1139 Ga0501033_0091340 3300049570 Bacteria 2227
1140 Ga0501033_0136046 3300049570 Bacteria 1778
1141 Ga0501034_0000272 3300049571 Bacteria 93316
1142 Ga0501034_0000667 3300049571 Bacteria 52322
1143 Ga0501034_0001266 3300049571 Bacteria 34323
1144 Ga0501034_0001500 3300049571 Bacteria 30676
1145 Ga0501034_0010123 3300049571 Bacteria 9838
1146 Ga0501034_0012981 3300049571 Bacteria 8587
1147 Ga0501034_0016507 3300049571 Bacteria 7575
1148 Ga0501034_0026733 3300049571 Bacteria 5871
1149 Ga0501034_0047089 3300049571 Bacteria 4356
1150 Ga0501034_0146337 3300049571 Bacteria 2340
1151 Ga0501034_0178001 3300049571 Bacteria 2092
1152 Ga0501034_0227691 3300049571 Bacteria 1814
1153 Ga0501036_0022691 3300049572 Bacteria 5282
1154 Ga0501036_0038174 3300049572 Bacteria 4064
1155 Ga0501036_0041900 3300049572 Bacteria 3875
1156 Ga0501036_0056696 3300049572 Bacteria 3319
1157 Ga0501036_0058455 3300049572 Bacteria 3267
1158 Ga0501036_0059295 3300049572 Bacteria 3243
1159 Ga0501036_0082146 3300049572 Bacteria 2723
1160 Ga0501036_0427889 3300049572 Bacteria 1103
1161 Ga0501037_0000445 3300049573 Bacteria 33919
1162 Ga0501037_0014502 3300049573 Bacteria 5798
1163 Ga0501037_0022344 3300049573 Bacteria 4680
1164 Ga0501037_0091882 3300049573 Bacteria 2195
1165 Ga0501037_0114333 3300049573 Bacteria 1943
1166 Ga0501037_0139474 3300049573 Bacteria 1735
1167 Ga0501038_0002821 3300049574 Bacteria 16170
1168 Ga0501038_0010357 3300049574 Bacteria 8532
1169 Ga0501038_0055860 3300049574 Bacteria 3391
1170 Ga0501038_0106830 3300049574 Bacteria 2322
1171 Ga0501039_0034575 3300049575 Bacteria 3900
1172 Ga0501039_0157359 3300049575 Bacteria 1785
1173 Ga0501039_0215185 3300049575 Bacteria 1511
1174 Ga0501039_0238135 3300049575 Bacteria 1431
1175 Ga0501039_0482382 3300049575 Bacteria 973
1176 Ga0501040_0221534 3300049576 Bacteria 1346
1177 Ga0501042_0118114 3300049578 Bacteria 1909
1178 Ga0501042_0202016 3300049578 Bacteria 1433
1179 Ga0501042_0366625 3300049578 Bacteria 1042
1180 Ga0501042_0504737 3300049578 Bacteria 878
1181 Ga0501043_0003232 3300049579 Bacteria 13453
1182 Ga0501043_0003273 3300049579 Bacteria 13352
1183 Ga0501043_0015149 3300049579 Bacteria 6035
1184 Ga0501043_0016089 3300049579 Bacteria 5867
1185 Ga0501043_0031909 3300049579 Bacteria 4140
1186 Ga0501043_0082531 3300049579 Bacteria 2526
1187 Ga0501043_0156262 3300049579 Bacteria 1783
1188 Ga0501043_0180719 3300049579 Bacteria 1643
1189 Ga0501046_0000610 3300049580 Bacteria 35093
1190 Ga0501046_0031341 3300049580 Bacteria 4310
1191 Ga0501046_0051563 3300049580 Bacteria 3246
1192 Ga0501047_0000403 3300049581 Bacteria 48440
1193 Ga0501047_0004202 3300049581 Bacteria 13562
1194 Ga0501047_0010132 3300049581 Bacteria 8912
1195 Ga0501047_0018122 3300049581 Bacteria 6747
1196 Ga0501047_0029308 3300049581 Bacteria 5309
1197 Ga0501047_0045788 3300049581 Bacteria 4229
1198 Ga0501047_0142995 3300049581 Bacteria 2270
1199 Ga0501047_0214056 3300049581 Bacteria 1784
1200 Ga0501047_0289246 3300049581 Bacteria 1482
1201 Ga0501048_0011643 3300049582 Bacteria 6559
1202 Ga0501048_0131700 3300049582 Bacteria 1767
1203 Ga0501048_0187621 3300049582 Bacteria 1465
1204 Ga0501048_0218060 3300049582 Bacteria 1353
1205 Ga0501067_0003187 3300049583 Bacteria 9052
1206 Ga0501067_0021975 3300049583 Bacteria 3530
1207 Ga0501067_0108523 3300049583 Bacteria 1543
1208 Ga0501068_0017125 3300049584 Bacteria 4188
1209 Ga0501068_0038381 3300049584 Bacteria 2869
1210 Ga0501069_0002608 3300049585 Bacteria 9196
1211 Ga0501069_0022269 3300049585 Bacteria 3445
1212 Ga0501069_0028513 3300049585 Bacteria 3061
1213 Ga0501069_0034417 3300049585 Bacteria 2790
1214 Ga0501070_0002872 3300049586 Bacteria 15008
1215 Ga0501070_0008207 3300049586 Bacteria 8833
1216 Ga0501070_0030674 3300049586 Bacteria 4504
1217 Ga0501070_0034069 3300049586 Bacteria 4260
1218 Ga0501070_0047755 3300049586 Bacteria 3557
1219 Ga0501070_0052658 3300049586 Bacteria 3378
1220 Ga0501070_0086653 3300049586 Bacteria 2592
1221 Ga0501070_0129794 3300049586 Bacteria 2082
1222 Ga0501070_0134916 3300049586 Bacteria 2038
1223 Ga0501070_0146545 3300049586 Bacteria 1949
1224 Ga0501070_0185922 3300049586 Bacteria 1709
1225 Ga0501071_0034538 3300049587 Bacteria 3600
1226 Ga0501071_0088308 3300049587 Bacteria 2274
1227 Ga0501071_0095971 3300049587 Bacteria 2182
1228 Ga0501072_0004709 3300049588 Bacteria 10399
1229 Ga0501072_0202262 3300049588 Bacteria 1584
1230 Ga0501073_0007366 3300049589 Bacteria 8185
1231 Ga0501073_0008386 3300049589 Bacteria 7666
1232 Ga0501073_0045213 3300049589 Bacteria 3102
1233 Ga0501073_0067874 3300049589 Bacteria 2486
1234 Ga0501073_0081964 3300049589 Bacteria 2244
1235 Ga0501073_0391256 3300049589 Bacteria 960
1236 Ga0501074_0014799 3300049590 Bacteria 5675
1237 Ga0501074_0030893 3300049590 Bacteria 3881
1238 Ga0501074_0046392 3300049590 Bacteria 3141
1239 Ga0501074_0049582 3300049590 Bacteria 3032
1240 Ga0501074_0148533 3300049590 Bacteria 1676
1241 Ga0501075_0011521 3300049591 Bacteria 6259
1242 Ga0501216_004147 3300049660 Bacteria 2142
1243 Ga0501227_000487 3300049665 Bacteria 8444
1244 Ga0501227_009037 3300049665 Bacteria 2142
1245 Ga0501233_002222 3300049668 Bacteria 3401
1246 Ga0501221_013866 3300049704 Bacteria 1489
1247 Ga0501225_0005311 3300049705 Bacteria 3784
1248 Ga0501225_0012786 3300049705 Bacteria 2355
1249 Ga0501079_0225958 3300049741 Bacteria 1462
1250 Ga0501079_0310938 3300049741 Bacteria 1233
1251 Ga0501080_0004522 3300049742 Bacteria 12395
1252 Ga0501080_0033509 3300049742 Bacteria 4794
1253 Ga0501080_0064962 3300049742 Bacteria 3394
1254 Ga0501080_0175100 3300049742 Bacteria 1977
1255 Ga0501080_0175733 3300049742 Bacteria 1972
1256 Ga0501080_0230085 3300049742 Bacteria 1695
1257 Ga0501080_0529057 3300049742 Bacteria 1051
1258 Ga0501083_0010153 3300049744 Bacteria 6635
1259 Ga0501083_0185624 3300049744 Bacteria 1357
1260 Ga0501266_005358 3300049763 Bacteria 1597
1261 Ga0501268_017371 3300049765 Bacteria 1200
1262 Ga0501275_000196 3300049772 Bacteria 7076
1263 Ga0501035_0002806 3300049822 Bacteria 16845
1264 Ga0501035_0005911 3300049822 Bacteria 11521
1265 Ga0501035_0020001 3300049822 Bacteria 6149
1266 Ga0501035_0026236 3300049822 Bacteria 5332
1267 Ga0501035_0066830 3300049822 Bacteria 3190
1268 Ga0501035_0067564 3300049822 Bacteria 3171
1269 Ga0501035_0116644 3300049822 Bacteria 2336
1270 Ga0501035_0516911 3300049822 Bacteria 981
1271 Ga0501044_0001991 3300049823 Bacteria 23606
1272 Ga0501044_0005512 3300049823 Bacteria 14053
1273 Ga0501044_0009796 3300049823 Bacteria 10419
1274 Ga0501044_0012777 3300049823 Bacteria 9093
1275 Ga0501044_0016869 3300049823 Bacteria 7836
1276 Ga0501044_0019410 3300049823 Bacteria 7274
1277 Ga0501044_0020401 3300049823 Bacteria 7076
1278 Ga0501044_0025173 3300049823 Bacteria 6310
1279 Ga0501044_0055937 3300049823 Bacteria 4050
1280 Ga0501044_0094458 3300049823 Bacteria 3015
1281 Ga0501044_0110033 3300049823 Bacteria 2764
1282 Ga0501044_0113639 3300049823 Bacteria 2714
1283 Ga0501044_0125765 3300049823 Bacteria 2561
1284 Ga0501044_0125974 3300049823 Bacteria 2559
1285 Ga0501044_0165864 3300049823 Bacteria 2183
1286 Ga0501044_0208594 3300049823 Bacteria 1909
1287 Ga0501044_0417124 3300049823 Bacteria 1253
1288 nmdc:mga00v17_173377_c1 3300050491 Bacteria 1391
1289 nmdc:mga00v17_322994_c1 3300050491 Bacteria 1003
1290 nmdc:mga00v17_473_c1 3300050491 Bacteria 22592
1291 nmdc:mga00v17_5873_c1 3300050491 Bacteria 6484
1292 nmdc:mga00v17_70041_c1 3300050491 Bacteria 2172
1293 nmdc:mga06z11_119943_c1 3300050494 Bacteria 1466
1294 nmdc:mga05p37_341262_c2 3300050507 Bacteria 1254
1295 nmdc:mga09592_18444_c1 3300050508 Bacteria 5723
1296 nmdc:mga09592_9294_c1 3300050508 Bacteria 7992
1297 nmdc:mga09592_9898_c1 3300050508 Bacteria 7753
1298 nmdc:mga0qj67_206550_c1 3300050509 Bacteria 1595
1299 nmdc:mga0qj67_79983_c1 3300050509 Bacteria 2618
1300 nmdc:mga06r32_440633_c1 3300050510 Unclassified 1283
1301 nmdc:mga08y16_336478_c1 3300050511 Bacteria 1552
1302 nmdc:mga08y16_82022_c1 3300050511 Bacteria 3362
1303 nmdc:mga0rr50_176501_c1 3300050513 Bacteria 1744
1304 nmdc:mga0rr50_383273_c1 3300050513 Bacteria 1186
1305 Ga0500610_0009379 3300053079 Bacteria 4334
1306 Ga0500643_000103 3300053087 Bacteria 87887
1307 Ga0500643_006045 3300053087 Bacteria 5116
1308 Ga0500651_0000239 3300053093 Bacteria 33889
1309 Ga0500651_0042021 3300053093 Bacteria 2881
1310 Ga0500555_000554 3300053103 Bacteria 14879
1311 Ga0500597_000039 3300053120 Bacteria 26299
1312 Ga0500626_053580 3300053128 Bacteria 1812
1313 Ga0500568_0001946 3300053139 Bacteria 12657
1314 Ga0500568_0008117 3300053139 Bacteria 5090
1315 Ga0500620_002235 3300053155 Bacteria 3835
1316 Ga0500633_0000431 3300053160 Bacteria 6585
1317 Ga0500634_0000229 3300053161 Bacteria 18154
1318 Ga0500645_001165 3300053730 Bacteria 14117
1319 Ga0501084_0034311 3300054114 Bacteria 4243
1320 Ga0501084_0126409 3300054114 Bacteria 2151
1321 Ga0501084_0190487 3300054114 Bacteria 1730
1322 Ga0501082_0010653 3300060353 Bacteria 7914
1323 Ga0501082_0017743 3300060353 Bacteria 6130
1324 Ga0466962_0002470 3300061719 Bacteria 8766
1325 Ga0466962_0010704 3300061719 Bacteria 4411
1326 Ga0466962_0028639 3300061719 Bacteria 2667
1327 2525557105 2524614729 Bacteria 3091755
1328 2547502711 2547132130 Bacteria 4660562
1329 2572256341 2571042365 Bacteria 3289345
1330 2578458754 2576861471 Bacteria 4648976
1331 2595447090 2593339238 Bacteria 4182970
1332 2595449848 2593339239 Bacteria 4124669
1333 2630648701 2627854209 Bacteria 3093011
1334 2643816287 2643221559 Bacteria 4424915
1335 2643881653 2643221573 Bacteria 4784121
1336 2643905591 2643221579 Bacteria 4443405
1337 2643913276 2643221581 Bacteria 3893603
1338 2643939028 2643221586 Bacteria 4446529
1339 2643977666 2643221593 Bacteria 6296053
1340 2644077231 2643221612 Bacteria 4361984
1341 2644528660 2643221695 Bacteria 3441323
1342 2644662742 2643221720 Bacteria 4694283
1343 2644694542 2643221727 Bacteria 4415595
1344 2644698304 2643221728 Bacteria 4797149
1345 2687582214 2687453130 Bacteria 4227172
1346 2721026250 2718218334 Bacteria 4765486
1347 2735833774 2734482264 Unclassified 5014763
1348 2739228762 2738543009 Bacteria 4944499
1349 2739732263 2739367700 Bacteria 4747630
1350 2740992581 2740891818 Bacteria 6711283
1351 2747950782 2747842428 Bacteria 4689383
1352 2765578642 2765235840 Bacteria 4663337
1353 2816516718 2816332141 Bacteria 4436036
1354 2819564233 2818991440 Bacteria 4774720
1355 2819659992 2818991457 Bacteria 5323295
1356 2842394953 2842391507 Bacteria 4486072
1357 2842758441 2842757796 Bacteria 3981385
1358 2842781250 2842780639 Bacteria 4337790
1359 2842918118 2842914999 Bacteria 4419378
1360 2842920146 2842918807 Bacteria 4289178
1361 2852651108 2852649853 Bacteria 4036942
1362 2852685188 2852684882 Bacteria 5463342
1363 2857445258 2857442823 Bacteria 4562550
1364 2874221271 2874220319 Bacteria 4594709
1365 2884341762 2884338543 Bacteria 4610696
1366 2884411510 2884411467 Bacteria 5246714
1367 2894416170 2894414249 Bacteria 4405451
1368 2895396532 2895395659 Bacteria 3983269
1369 2895498991 2895498888 Bacteria 5283788
1370 2895512029 2895511927 Bacteria 6802080
1371 2895524904 2895522137 Bacteria 3284416
1372 2895527973 2895525241 Bacteria 3388457
1373 2904464873 2904463128 Bacteria 4775606
1374 2919091776 2919089067 Bacteria 4560942
1375 2919130730 2919130084 Bacteria 5301837
1376 2919136171 2919134579 Bacteria 4480386
1377 2919406382 2919404418 Bacteria 4232372
1378 2919515290 2919513703 Bacteria 3844312
1379 2919678305 2919675420 Bacteria 3969095
1380 2923517700 2923516293 Bacteria 3716336
1381 2928496240 2928496128 Bacteria 4631123
1382 2928964948 2928963466 Bacteria 5165703
1383 2929198264 2929195423 Bacteria 5325372
1384 2931381086 2931380184 Bacteria 4455911
1385 2937612092 2937610967 Bacteria 4618818
1386 2939590721 2939589442 Bacteria 4214238
1387 2939615183 2939611941 Bacteria 3892017
1388 2939622907 2939622612 Bacteria 4698046
1389 2939630831 2939626828 Bacteria 4695272
1390 2941475470 2941471342 Bacteria 5018624
1391 2941477947 2941475908 Bacteria 4145589
1392 2941489812 2941489479 Bacteria 6313767
1393 2961048037 2961047084 Bacteria 4594415
1394 2961065057 2961064222 Bacteria 4749990
1395 2974309231 2974307012 Bacteria 4172388
1396 2977249952 2977247770 Bacteria 4160543
1397 2984515559 2984514374 Bacteria 4172479
1398 2987606301 2987605356 Bacteria 4187822
1399 2995950679 2995948881 Bacteria 6358104
1400 8003016545 8003014200 Bacteria 4059994
1401 8021625305 8021622325 Bacteria 4844743
1402 8021630213 8021626552 Bacteria 4665214
1403 8021652126 8021648035 Bacteria 4772378
1404 Ga0501031_0010414
1405 SwRhRL2b_contig_3686161
1406 JGI24736J21556_1011109
1407 JGI24741J21665_1000813
1408 JGI24741J21665_1006639
1409 JGI24740J21852_10000219
1410 JGI24739J22299_10000243
1411 JGI24737J22298_10000669
1412 JGI24737J22298_10013681
1413 JGI24738J21930_10000133
1414 JGI25156J39149_1004682
1415 JGI25156J39149_1019717
1416 JGI25156J39149_1019783
1417 JGI25162J39368_1000124
1418 JGI25162J39368_1001252
1419 JGI25162J39368_1002606
1420 JGI25162J39368_1002830
1421 JGI25154J39366_1004567
1422 JGI25157J39369_1000047
1423 JGI25157J39369_1000465
1424 JGI25157J39369_1000622
1425 JGI25157J39369_1001028
1426 JGI25157J39369_1010638
1427 JGI25157J39369_1010677
1428 JGI25163J39215_1000218
1429 JGI25164J39214_1000134
1430 JGI25164J39214_1000196
1431 JGI25164J39214_1000436
1432 JGI25164J39214_1000438
1433 JGI25164J39214_1000955
1434 JGI25164J39214_1001334
1435 JGI25152J39213_1002119
1436 JGI25150J39212_1001176
1437 JGI25151J46595_10000257
1438 JGI25151J46595_10000558
1439 JGI25151J46595_10035027
1440 JGI25151J46595_10067063
1441 JGI25165J46597_1000119
1442 JGI25165J46597_1000223
1443 JGI25165J46597_1000275
1444 JGI25165J46597_1002075
1445 JGI25153J46596_10000334
1446 rootH1_10057363
1447 rootH2_10023810
1448 rootH1_10187769
1449 Ga0006562J51391_1003759
1450 Ga0055538_1002063
1451 Ga0055539_1001661
1452 Ga0055533_1001179
1453 Ga0055533_1001398
1454 Ga0055525_1000111
1455 Ga0055527_1000053
1456 Ga0055527_1000114
1457 Ga0055535_1000313
1458 Ga0055535_1000340
1459 Ga0055535_1000362
1460 Ga0055535_1000440
1461 Ga0055535_1000825
1462 Ga0055535_1001942
1463 Ga0055542_1000160
1464 Ga0055542_1000240
1465 Ga0055542_1000274
1466 Ga0055542_1000371
1467 Ga0055542_1000418
1468 Ga0055542_1000825
1469 Ga0055529_1000024
1470 Ga0055529_1000161
1471 Ga0055529_1000264
1472 Ga0055529_1000296
1473 Ga0055526_1000008
1474 Ga0055526_1001264
1475 Ga0055537_1000145
1476 Ga0055537_1000338
1477 Ga0055524_1000087
1478 Ga0055524_1016305
1479 Ga0055536_1001416
1480 Ga0055536_1007159
1481 Ga0055536_1007642
1482 Ga0055536_1017277
1483 Ga0055534_1000003
1484 Ga0055534_1000039
1485 Ga0055528_1000004
1486 Ga0055528_1000212
1487 Ga0055530_10000544
1488 Ga0055530_10001029
1489 Ga0055530_10001078
1490 Ga0055531_10007594
1491 Ga0055531_10011798
1492 Ga0055531_10017155
1493 Ga0055531_10029813
1494 Ga0055531_10052738
1495 Ga0058692_1000002
1496 Ga0058692_1000006
1497 Ga0065165_1005309
1498 Ga0065704_10071155
1499 Ga0065704_10071748
1500 Ga0065704_10103241
1501 Ga0065704_10174745
1502 Ga0065704_10182412
1503 Ga0065704_10245209
1504 Ga0065715_10101077
1505 Ga0065715_10110041
1506 Ga0070658_10058881
1507 Ga0070658_10255056
1508 Ga0070676_10219546
1509 Ga0070683_100041294
1510 Ga0070683_100180314
1511 Ga0070690_100080808
1512 Ga0070670_100045095
1513 Ga0070670_100132792
1514 Ga0070670_100193136
1515 Ga0070670_100258478
1516 Ga0070670_100297996
1517 Ga0070680_100003486
1518 Ga0070680_100004486
1519 Ga0070680_100113856
1520 Ga0070680_100135659
1521 Ga0070680_100275610
1522 Ga0070682_100025405
1523 Ga0070682_100179334
1524 Ga0068868_100284710
1525 Ga0070660_100005329
1526 Ga0070660_100063795
1527 Ga0070660_100111749
1528 Ga0070660_100387323
1529 Ga0070689_100031318
1530 Ga0070689_100036392
1531 Ga0070689_100248488
1532 Ga0070691_10021483
1533 Ga0070661_100006947
1534 Ga0070661_100010502
1535 Ga0070661_100029576
1536 Ga0070661_100052266
1537 Ga0070661_100095325
1538 Ga0070661_100132831
1539 Ga0070692_10003447
1540 Ga0070692_10011702
1541 Ga0070668_100014917
1542 Ga0070668_100032294
1543 Ga0070668_100109256
1544 Ga0070669_100030652
1545 Ga0070671_100003371
1546 Ga0070671_100041811
1547 Ga0070671_100106270
1548 Ga0070673_100003011
1549 Ga0070688_100197255
1550 Ga0070659_100225731
1551 Ga0070659_100227371
1552 Ga0070667_100198567
1553 Ga0070667_100554360
1554 Ga0070703_10078108
1555 Ga0070714_100000306
1556 Ga0070714_100006767
1557 Ga0070714_100008435
1558 Ga0070713_100002668
1559 Ga0070711_100594880
1560 Ga0070694_100360251
1561 Ga0070708_100087187
1562 Ga0070663_100004478
1563 Ga0070663_100005489
1564 Ga0070663_100006531
1565 Ga0070663_100046365
1566 Ga0070663_100100902
1567 Ga0070678_100013349
1568 Ga0070678_100031906
1569 Ga0070662_100037135
1570 Ga0070662_100112976
1571 Ga0070681_10000086
1572 Ga0070681_10000199
1573 Ga0070681_10003486
1574 Ga0070681_10028227
1575 Ga0070681_10031798
1576 Ga0070681_10039265
1577 Ga0068867_100042494
1578 Ga0068867_100046909
1579 Ga0068867_100182253
1580 Ga0070685_10003148
1581 Ga0070698_100000567
1582 Ga0070679_100000589
1583 Ga0070679_100000739
1584 Ga0070679_100013004
1585 Ga0070679_100027652
1586 Ga0070679_100033157
1587 Ga0070679_100117068
1588 Ga0070679_100453475
1589 Ga0070684_100010589
1590 Ga0070684_100018885
1591 Ga0070684_100129558
1592 Ga0070684_100432608
1593 Ga0068853_100008449
1594 Ga0068853_100014525
1595 Ga0068853_100036176
1596 Ga0068853_100043092
1597 Ga0068853_100197148
1598 Ga0070672_100034801
1599 Ga0070672_100059578
1600 Ga0070686_100027863
1601 Ga0070696_100003674
1602 Ga0070696_100007524
1603 Ga0070696_100026727
1604 Ga0070693_100008121
1605 Ga0070693_100016526
1606 Ga0070693_100020347
1607 Ga0070693_100022988
1608 Ga0070665_100000237
1609 Ga0070665_100015986
1610 Ga0070665_100055673
1611 Ga0070665_100116552
1612 Ga0070665_100129831
1613 Ga0070665_100181087
1614 Ga0070665_100200600
1615 Ga0070665_100254246
1616 Ga0070665_100262107
1617 Ga0070665_100285093
1618 Ga0070704_100023769
1619 Ga0068855_100003227
1620 Ga0068855_100015077
1621 Ga0068855_100016959
1622 Ga0068855_100022476
1623 Ga0068855_100037824
1624 Ga0068855_100094390
1625 Ga0068855_100210809
1626 Ga0068855_100468593
1627 Ga0068855_100485454
1628 Ga0068855_100492474
1629 Ga0068855_100670633
1630 Ga0070664_100291488
1631 Ga0068857_100000180
1632 Ga0068857_100005918
1633 Ga0068857_100111552
1634 Ga0068857_100291234
1635 Ga0068854_100003500
1636 Ga0068854_100014806
1637 Ga0068854_100014875
1638 Ga0068854_100015665
1639 Ga0068854_100016080
1640 Ga0068856_100000074
1641 Ga0068856_100001551
1642 Ga0068856_100012624
1643 Ga0068856_100021481
1644 Ga0068856_100130884
1645 Ga0068856_100137484
1646 Ga0068856_100153894
1647 Ga0068856_100194133
1648 Ga0068856_100400019
1649 Ga0068856_100508288
1650 Ga0070702_100036432
1651 Ga0068852_100002579
1652 Ga0068852_100007543
1653 Ga0068852_100085277
1654 Ga0068859_100119518
1655 Ga0068864_100012182
1656 Ga0068864_100028713
1657 Ga0068864_100062451
1658 Ga0068864_100110229
1659 Ga0068864_100215793
1660 Ga0068866_10039851
1661 Ga0068861_100013414
1662 Ga0068861_100232559
1663 Ga0068851_10001429
1664 Ga0068851_10023201
1665 Ga0068863_100009921
1666 Ga0068863_100383589
1667 Ga0068858_100025509
1668 Ga0068858_100055234
1669 Ga0068860_100027053
1670 Ga0068860_100106873
1671 Ga0068860_100694567
1672 Ga0068862_100063729
1673 Ga0068862_100242886
1674 Ga0081540_1007915
1675 Ga0070717_10644565
1676 Ga0075363_100076865
1677 Ga0075364_10000156
1678 Ga0075364_10019911
1679 Ga0075367_10059460
1680 Ga0075369_10033668
1681 Ga0097621_100043633
1682 Ga0097621_100117910
1683 Ga0068871_100042261
1684 Ga0068871_100165152
1685 Ga0075428_100501872
1686 Ga0075430_100013708
1687 Ga0075430_100031816
1688 Ga0075430_100054394
1689 Ga0075430_100214799
1690 Ga0075429_100010231
1691 Ga0075429_100015423
1692 Ga0075429_100061688
1693 Ga0075429_100076760
1694 Ga0068865_100104168
1695 Ga0097620_100119518
1696 Ga0075435_100418708
1697 Ga0105251_10000597
1698 Ga0105251_10002239
1699 Ga0105240_10010415
1700 Ga0105240_10014636
1701 Ga0105240_10015324
1702 Ga0105240_10016233
1703 Ga0105240_10018380
1704 Ga0105240_10033449
1705 Ga0105240_10054441
1706 Ga0105240_10070725
1707 Ga0105240_10071884
1708 Ga0105240_10071908
1709 Ga0105240_10117179
1710 Ga0111539_10158205
1711 Ga0105245_10000070
1712 Ga0105245_10083402
1713 Ga0105243_10006063
1714 Ga0105243_10032254
1715 Ga0105243_10337839
1716 Ga0105241_10002770
1717 Ga0105241_10003714
1718 Ga0105241_10058772
1719 Ga0105242_10507439
1720 Ga0105248_10007576
1721 Ga0105248_10015012
1722 Ga0105248_10052738
1723 Ga0105237_10000214
1724 Ga0105237_10002033
1725 Ga0105237_10009902
1726 Ga0105237_10013212
1727 Ga0105237_10078674
1728 Ga0105237_10107835
1729 Ga0105237_10140310
1730 Ga0105237_10482908
1731 Ga0105238_10006412
1732 Ga0105238_10018096
1733 Ga0105238_10022371
1734 Ga0105238_10110718
1735 Ga0105238_10166892
1736 Ga0105249_10001773
1737 Ga0105239_10000390
1738 Ga0105239_10005287
1739 Ga0105239_10014113
1740 Ga0105239_10015740
1741 Ga0105239_10017459
1742 Ga0105239_10017493
1743 Ga0105239_10068068
1744 Ga0105239_10090965
1745 Ga0105239_10112753
1746 Ga0105239_10278980
1747 Ga0105239_10317488
1748 Ga0105246_10006015
1749 Ga0157314_1000578
1750 Ga0157373_10008009
1751 Ga0157373_10326188
1752 Ga0157371_10000487
1753 Ga0157371_10004532
1754 Ga0157371_10020289
1755 Ga0157371_10033680
1756 Ga0157371_10067563
1757 Ga0157371_10096244
1758 Ga0157371_10191613
1759 Ga0157371_10240522
1760 Ga0157370_10002080
1761 Ga0157370_10004104
1762 Ga0157370_10007609
1763 Ga0157370_10015272
1764 Ga0157370_10096201
1765 Ga0157370_10200547
1766 Ga0157370_10271467
1767 Ga0157369_10000030
1768 Ga0157369_10002243
1769 Ga0157369_10004626
1770 Ga0157369_10007366
1771 Ga0157369_10023335
1772 Ga0157369_10028763
1773 Ga0157369_10118046
1774 Ga0157374_10011293
1775 Ga0157374_10023184
1776 Ga0157374_10029499
1777 Ga0157374_10057421
1778 Ga0157378_10000158
1779 Ga0157378_10030642
1780 Ga0163162_10005297
1781 Ga0163162_10029820
1782 Ga0163162_10669708
1783 Ga0157372_10001156
1784 Ga0157372_10001163
1785 Ga0157372_10009901
1786 Ga0157372_10027403
1787 Ga0157372_10030221
1788 Ga0157372_10074640
1789 Ga0157372_10192432
1790 Ga0157372_10237659
1791 Ga0157372_10684087
1792 Ga0157372_10684788
1793 Ga0157375_10002329
1794 Ga0157375_10055851
1795 Ga0157380_10042102
1796 Ga0182008_10000143
1797 Ga0182008_10001870
1798 Ga0182008_10015447
1799 Ga0182008_10016411
1800 Ga0182008_10031878
1801 Ga0182008_10079886
1802 Ga0182008_10123506
1803 Ga0157376_10005593
1804 Ga0157376_10013924
1805 Ga0157376_10132292
1806 Ga0157376_10328088
1807 Ga0157376_10486794
1808 Ga0182006_1000148
1809 Ga0182006_1000208
1810 Ga0182006_1015497
1811 Ga0182006_1019226
1812 Ga0182006_1022687
1813 Ga0182006_1025756
1814 Ga0182006_1054130
1815 Ga0182006_1090498
1816 Ga0182007_10000043
1817 Ga0182005_1000225
1818 Ga0182005_1006372
1819 Ga0182005_1007922
1820 Ga0182005_1023059
1821 Ga0183369_1003
1822 Ga0183368_1002
1823 Ga0183360_10001
1824 Ga0163161_10002976
1825 Ga0163161_10005305
1826 Ga0163161_10027657
1827 Ga0163161_10049683
1828 Ga0206356_11596253
1829 Ga0206354_10472637
1830 Ga0206353_11520292
1831 Ga0206353_11892459
1832 Ga0209760_100270
1833 Ga0209784_100011
1834 Ga0209566_105937
1835 Ga0209674_100061
1836 Ga0209674_100077
1837 Ga0209674_101778
1838 Ga0209672_100004
1839 Ga0209672_100022
1840 Ga0209672_100167
1841 Ga0209672_100729
1842 Ga0209672_101194
1843 Ga0209147_106714
1844 Ga0209563_100103
1845 Ga0209563_111997
1846 Ga0207427_100026
1847 Ga0207427_100086
1848 Ga0207427_100160
1849 Ga0207427_100690
1850 Ga0209437_100005
1851 Ga0209437_100178
1852 Ga0209437_100244
1853 Ga0209437_100293
1854 Ga0209258_100003
1855 Ga0209258_100004
1856 Ga0209258_100027
1857 Ga0209258_100182
1858 Ga0209258_100327
1859 Ga0209258_100610
1860 Ga0209258_107210
1861 Ga0207425_1000078
1862 Ga0207425_1010809
1863 Ga0209646_1001950
1864 Ga0209646_1002809
1865 Ga0209026_1000018
1866 Ga0209026_1000084
1867 Ga0209026_1000148
1868 Ga0209026_1000155
1869 Ga0209026_1000448
1870 Ga0209026_1008095
1871 Ga0209148_1000001
1872 Ga0209148_1000025
1873 Ga0209148_1000062
1874 Ga0209148_1000083
1875 Ga0209148_1000299
1876 Ga0209148_1006983
1877 Ga0209759_1000066
1878 Ga0209759_1000257
1879 Ga0209759_1000305
1880 Ga0209759_1000824
1881 Ga0209759_1006727
1882 Ga0209759_1025447
1883 Ga0209759_1025535
1884 Ga0209129_1000157
1885 Ga0209129_1002303
1886 Ga0209129_1006121
1887 Ga0209233_1000002
1888 Ga0209233_1000011
1889 Ga0209233_1000128
1890 Ga0209233_1000246
1891 Ga0209565_1000001
1892 Ga0209565_1000014
1893 Ga0209565_1004760
1894 Ga0209455_1000004
1895 Ga0209455_1000019
1896 Ga0209455_1000040
1897 Ga0209455_1000084
1898 Ga0209455_1000186
1899 Ga0209455_1007936
1900 Ga0209673_1000001
1901 Ga0209673_1000171
1902 Ga0209673_1002529
1903 Ga0209675_1000001
1904 Ga0209675_1000011
1905 Ga0209675_1015425
1906 Ga0209676_1000027
1907 Ga0209676_1000047
1908 Ga0209676_1000079
1909 Ga0209676_1000963
1910 Ga0209676_1000970
1911 Ga0209676_1002059
1912 Ga0209676_1006843
1913 Ga0209676_1009313
1914 Ga0209025_1000015
1915 Ga0209025_1000054
1916 Ga0209025_1001242
1917 Ga0209025_1007257
1918 Ga0209025_1069645
1919 Ga0209564_1000001
1920 Ga0209564_1000221
1921 Ga0209758_1000062
1922 Ga0209758_1000577
1923 Ga0209758_1010608
1924 Ga0209758_1018409
1925 Ga0209758_1027303
1926 Ga0209050_1000329
1927 Ga0209050_1000415
1928 Ga0209256_1000002
1929 Ga0209256_1001265
1930 Ga0209256_1004398
1931 Ga0209256_1004927
1932 Ga0209256_1004947
1933 Ga0209256_1037984
1934 Ga0209051_1001449
1935 Ga0209051_1006817
1936 Ga0209051_1073048
1937 Ga0209257_1000081
1938 Ga0209257_1000530
1939 Ga0209257_1000837
1940 Ga0209257_1001863
1941 Ga0209257_1006985
1942 Ga0209257_1011577
1943 Ga0209257_1022250
1944 Ga0207656_10027525
1945 Ga0207656_10110112
1946 Ga0207713_1001379
1947 Ga0207713_1006311
1948 Ga0207710_10004497
1949 Ga0207680_10095441
1950 Ga0207680_10269538
1951 Ga0207680_10329785
1952 Ga0207647_10000008
1953 Ga0207647_10000250
1954 Ga0207647_10002043
1955 Ga0207647_10010215
1956 Ga0207647_10016245
1957 Ga0207645_10043171
1958 Ga0207705_10000168
1959 Ga0207705_10000836
1960 Ga0207705_10028178
1961 Ga0207705_10079577
1962 Ga0207654_10007686
1963 Ga0207707_10000032
1964 Ga0207707_10000422
1965 Ga0207707_10001438
1966 Ga0207707_10001792
1967 Ga0207707_10030814
1968 Ga0207707_10054519
1969 Ga0207707_10073158
1970 Ga0207707_10118927
1971 Ga0207707_10444042
1972 Ga0207695_10000320
1973 Ga0207695_10000355
1974 Ga0207695_10000933
1975 Ga0207695_10000943
1976 Ga0207695_10001343
1977 Ga0207695_10001428
1978 Ga0207695_10001726
1979 Ga0207695_10002647
1980 Ga0207695_10021778
1981 Ga0207695_10043366
1982 Ga0207695_10083885
1983 Ga0207695_10378944
1984 Ga0207671_10000057
1985 Ga0207671_10001018
1986 Ga0207671_10044985
1987 Ga0207671_10364419
1988 Ga0207693_10125060
1989 Ga0207660_10000362
1990 Ga0207660_10000402
1991 Ga0207660_10007496
1992 Ga0207660_10126323
1993 Ga0207660_10275262
1994 Ga0207657_10002254
1995 Ga0207657_10002369
1996 Ga0207657_10004447
1997 Ga0207657_10107616
1998 Ga0207649_10001307
1999 Ga0207649_10002328
2000 Ga0207649_10008777
2001 Ga0207649_10080454
2002 Ga0207652_10000026
2003 Ga0207652_10000368
2004 Ga0207652_10000811
2005 Ga0207652_10016377
2006 Ga0207652_10045387
2007 Ga0207652_10093455
2008 Ga0207652_10217504
2009 Ga0207652_10258450
2010 Ga0207652_10290409
2011 Ga0207681_10005273
2012 Ga0207694_10036560
2013 Ga0207694_10045240
2014 Ga0207694_10327004
2015 Ga0207650_10034083
2016 Ga0207650_10071471
2017 Ga0207650_10155894
2018 Ga0207687_10000279
2019 Ga0207687_10029377
2020 Ga0207687_10065678
2021 Ga0207700_10009087
2022 Ga0207664_10000055
2023 Ga0207664_10021264
2024 Ga0207664_10081891
2025 Ga0207690_10000209
2026 Ga0207690_10002208
2027 Ga0207690_10002280
2028 Ga0207690_10005514
2029 Ga0207690_10081658
2030 Ga0207690_10086681
2031 Ga0207706_10056810
2032 Ga0207706_10066404
2033 Ga0207709_10000536
2034 Ga0207670_10000678
2035 Ga0207670_10049654
2036 Ga0207669_10127560
2037 Ga0207704_10071318
2038 Ga0207704_10154349
2039 Ga0207691_10037062
2040 Ga0207691_10045793
2041 Ga0207691_10061408
2042 Ga0207691_10246767
2043 Ga0207711_10458380
2044 Ga0207689_10049276
2045 Ga0207661_10012207
2046 Ga0207679_10003377
2047 Ga0207667_10000139
2048 Ga0207667_10000247
2049 Ga0207667_10000436
2050 Ga0207667_10001265
2051 Ga0207667_10007174
2052 Ga0207667_10008798
2053 Ga0207667_10009079
2054 Ga0207667_10025041
2055 Ga0207667_10029132
2056 Ga0207667_10134768
2057 Ga0207667_10618636
2058 Ga0207712_10000143
2059 Ga0207668_10034221
2060 Ga0207668_10072813
2061 Ga0207640_10000072
2062 Ga0207640_10001040
2063 Ga0207640_10003987
2064 Ga0207658_10109893
2065 Ga0207658_10448990
2066 Ga0207677_10127910
2067 Ga0207639_10000639
2068 Ga0207639_10002460
2069 Ga0207639_10003288
2070 Ga0207639_10025738
2071 Ga0207639_10136780
2072 Ga0207678_10001290
2073 Ga0207678_10001605
2074 Ga0207678_10006048
2075 Ga0207678_10007279
2076 Ga0207678_10037910
2077 Ga0207678_10041911
2078 Ga0207678_10119888
2079 Ga0207678_10170353
2080 Ga0207702_10000107
2081 Ga0207702_10001032
2082 Ga0207702_10050670
2083 Ga0207702_10066079
2084 Ga0207702_10110845
2085 Ga0207702_10230769
2086 Ga0207702_10337674
2087 Ga0207641_10056239
2088 Ga0207641_10279945
2089 Ga0207641_10319656
2090 Ga0207641_10557936
2091 Ga0207648_10014914
2092 Ga0207648_10136229
2093 Ga0207648_10290057
2094 Ga0207676_10134473
2095 Ga0207676_10206733
2096 Ga0207674_10000371
2097 Ga0207674_10001386
2098 Ga0207674_10053332
2099 Ga0207674_10075758
2100 Ga0207674_10118046
2101 Ga0207674_10124450
2102 Ga0207674_10148012
2103 Ga0207674_10275043
2104 Ga0207675_100227767
2105 Ga0207675_100768183
2106 Ga0207683_10720618
2107 Ga0207683_10720911
2108 Ga0207698_10004539
2109 Ga0207698_10015176
2110 Ga0207698_10181051
2111 Ga0207698_10462779
2112 Ga0207698_10462942
2113 Ga0209371_1000004
2114 Ga0209371_1000016
2115 Ga0209969_1015899
2116 Ga0209995_1012544
2117 Ga0209970_1024957
2118 Ga0210002_1012761
2119 Ga0209983_1005036
2120 Ga0209971_1005650
2121 Ga0209974_10005392
2122 Ga0209974_10008848
2123 Ga0268266_10000001
2124 Ga0268266_10000901
2125 Ga0268266_10048368
2126 Ga0268266_10465344
2127 Ga0268265_10551219
2128 Ga0268264_10021249
2129 Ga0268264_10541655
2130 Ga0265338_10042995
2131 Ga0265338_10103927
2132 Ga0268256_1000005
2133 Ga0268256_1000015
2134 Ga0316177_1080492
2135 Ga0314311_1060965
2136 Ga0316183_1146021
2137 Ga0316181_1033804
2138 Ga0307513_10008959
2139 Ga0307513_10411234
2140 Ga0307509_10022222
2141 Ga0307509_10138438
2142 Ga0307509_10363485
2143 Ga0307408_100053478
2144 Ga0307408_100114448
2145 Ga0307408_100127429
2146 Ga0307408_100517604
2147 Ga0307508_10199806
2148 Ga0316576_10123013
2149 Ga0316576_10206213
2150 Ga0316578_10037457
2151 Ga0307405_10255915
2152 Ga0316577_10006244
2153 Ga0307413_10000147
2154 Ga0307413_10059747
2155 Ga0307413_10063188
2156 Ga0307410_10188456
2157 Ga0307406_10009208
2158 Ga0307406_10063990
2159 Ga0307406_10422843
2160 Ga0307407_10214144
2161 Ga0307412_10001351
2162 Ga0307412_10029386
2163 Ga0307409_100460041
2164 Ga0307416_100014236
2165 Ga0307416_100101159
2166 Ga0307416_100149196
2167 Ga0307416_100171404
2168 Ga0307416_100375673
2169 Ga0307414_10005629
2170 Ga0307414_10007619
2171 Ga0307414_10019115
2172 Ga0307414_10022700
2173 Ga0307414_10022879
2174 Ga0307414_10049456
2175 Ga0307414_10090000
2176 Ga0307414_10093897
2177 Ga0307414_10099984
2178 Ga0307414_10113989
2179 Ga0307414_10219041
2180 Ga0307414_10316589
2181 Ga0307411_10043506
2182 Ga0307411_10101956
2183 Ga0307411_10126775
2184 Ga0307411_10182784
2185 Ga0307411_10315102
2186 Ga0307507_10159848
2187 Ga0373937_0245944
2188 Ga0316584_0000540
2189 Ga0316584_0244550
2190 Ga0395899_0012535
2191 Ga0395899_0040277
2192 Ga0395899_0148535
2193 Ga0395899_0238747
2194 Ga0395899_0239430
2195 Ga0395900_0000012
2196 Ga0395900_0000092
2197 Ga0395900_0002817
2198 Ga0395900_0006858
2199 Ga0395900_0018342
2200 Ga0395900_0035826
2201 Ga0395900_0460485
2202 Ga0395898_0000023
2203 Ga0395898_0000237
2204 Ga0395898_0013167
2205 Ga0395898_0022209
2206 Ga0395898_0050118
2207 Ga0395898_0059861
2208 Ga0395905_0000883
2209 Ga0395905_0020602
2210 Ga0395905_0039237
2211 Ga0395905_0133615
2212 Ga0395905_0385147
2213 Ga0395905_0435349
2214 Ga0395901_0000992
2215 Ga0395901_0004126
2216 Ga0395901_0015549
2217 Ga0395901_0081819
2218 Ga0395901_0146599
2219 Ga0395901_0149959
2220 Ga0395901_0217329
2221 Ga0237816_01224
2222 Ga0436365_0468765
2223 Ga0436361_0109835
2224 Ga0436363_0346981
2225 Ga0439436_0000245
2226 Ga0439436_0001317
2227 Ga0439436_0015229
2228 Ga0439436_0037155
2229 Ga0439439_0011664
2230 Ga0439439_0027692
2231 Ga0439465_0002136
2232 Ga0439465_0004591
2233 Ga0439465_0021293
2234 Ga0439465_0049045
2235 Ga0451789_0816827
2236 Ga0451793_0084196
2237 Ga0451793_0245814
2238 Ga0451793_0901274
2239 Ga0451800_0792482
2240 Ga0451802_1855302
2241 Ga0451806_727761
2242 Ga0451804_0198474
2243 Ga0451807_0149715
2244 Ga0451807_1723472
2245 Ga0451807_1898858
2246 Ga0451807_2241946
2247 Ga0451837_1131221
2248 Ga0451839_0504575
2249 Ga0451843_0827567
2250 Ga0451843_0952033
2251 Ga0451843_1048573
2252 Ga0451843_1245072
2253 Ga0451853_2369144
2254 Ga0451853_3110382
2255 Ga0439445_0022184
2256 Ga0439432_003228
2257 Ga0439432_005109
2258 Ga0439432_037157
2259 Ga0439432_041153
2260 Ga0439449_0000046
2261 Ga0439449_0001830
2262 Ga0439449_0003679
2263 Ga0439449_0007392
2264 Ga0439449_0013568
2265 Ga0439449_0015114
2266 Ga0439449_0019863
2267 Ga0450911_002326
2268 Ga0450908_000075
2269 Ga0439434_0077072
2270 Ga0439459_0001196
2271 Ga0451577_0028918
2272 Ga0451577_0033724
2273 Ga0451577_0177892
2274 Ga0466969_0004032
2275 Ga0466969_0012271
2276 Ga0466969_0014973
2277 Ga0466982_0000005
2278 Ga0466982_0000037
2279 Ga0466965_0001833
2280 Ga0466965_0136517
2281 Ga0466966_0002637
2282 Ga0466966_0052390
2283 Ga0466966_0087713
2284 Ga0466961_0001395
2285 Ga0466961_0004319
2286 Ga0466961_0014369
2287 Ga0466963_0098779
2288 Ga0453684_0001089
2289 Ga0453684_0639591
2290 Ga0466971_0003218
2291 Ga0466971_0049874
2292 Ga0466971_0050168
2293 Ga0466971_0088500
2294 Ga0466968_0009977
2295 Ga0466968_0041132
2296 Ga0466970_0023113
2297 Ga0466957_0013133
2298 Ga0466957_0059035
2299 Ga0466957_0061518
2300 Ga0466960_0010676
2301 Ga0466959_0000091
2302 Ga0466959_0040070
2303 Ga0451576_0000201
2304 Ga0466958_0049995
2305 Ga0466958_0218669
2306 Ga0466967_0277813
2307 Ga0466967_0375233
2308 Ga0495617_000495
2309 Ga0495627_021048
2310 Ga0495590_0098444
2311 Ga0495629_0140902
2312 Ga0495638_0000019
2313 Ga0495638_0000426
2314 Ga0495638_0000718
2315 Ga0495638_0002776
2316 Ga0495638_0056603
2317 Ga0495638_0137968
2318 Ga0495650_0000206
2319 Ga0495650_0029263
2320 Ga0495585_0001731
2321 Ga0495585_0002973
2322 Ga0495607_0000178
2323 Ga0495607_0000256
2324 Ga0495607_0040761
2325 Ga0495583_0005312
2326 Ga0495606_0002288
2327 Ga0495606_0003126
2328 Ga0495606_0008786
2329 Ga0495606_0042589
2330 Ga0495606_0088622
2331 Ga0495610_0000341
2332 Ga0495610_0002042
2333 Ga0495616_0000357
2334 Ga0495616_0020609
2335 Ga0495620_0000150
2336 Ga0495620_0000287
2337 Ga0495631_0000257
2338 Ga0495631_0000558
2339 Ga0495631_0011328
2340 Ga0495632_0015511
2341 Ga0495632_0015643
2342 Ga0495637_0039421
2343 Ga0495643_0001297
2344 Ga0495648_0001786
2345 Ga0495648_0005918
2346 Ga0495663_0001355
2347 Ga0495663_0011366
2348 Ga0495663_0012667
2349 Ga0495663_0031906
2350 Ga0495598_0003992
2351 Ga0495609_0002676
2352 Ga0495622_0002790
2353 Ga0495633_0016706
2354 Ga0495633_0073875
2355 Ga0495656_0001730
2356 Ga0495656_0092462
2357 Ga0495668_0004174
2358 Ga0495611_0000001
2359 Ga0495611_0000044
2360 Ga0495625_0000041
2361 Ga0495625_0009643
2362 Ga0495625_0047540
2363 Ga0495625_0072541
2364 Ga0495625_0104055
2365 Ga0495661_0004401
2366 Ga0495670_0001904
2367 Ga0495670_0021176
2368 Ga0495671_0001302
2369 Ga0495649_0000930
2370 Ga0495589_0000008
2371 Ga0495660_0000231
2372 Ga0495660_0000421
2373 Ga0495636_0000667
2374 Ga0495636_0008169
2375 Ga0495636_0015711
2376 Ga0495636_0033687
2377 Ga0495672_0000373
2378 Ga0495672_0009395
2379 Ga0495672_0099020
2380 Ga0495683_0000643
2381 Ga0495679_000004
2382 Ga0495673_0000004
2383 Ga0495673_0000041
2384 Ga0495673_0004064
2385 Ga0495673_0022472
2386 Ga0495681_0058289
2387 Ga0495686_0000108
2388 Ga0495686_0004065
2389 Ga0495686_0006536
2390 Ga0495686_0006573
2391 Ga0495686_0007270
2392 Ga0495686_0010094
2393 Ga0495686_0019590
2394 Ga0495686_0054137
2395 Ga0496100_0020951
2396 Ga0496100_0074028
2397 Ga0496101_0040842
2398 Ga0496102_0313070
2399 Ga0496104_0053198
2400 Ga0496104_0338307
2401 Ga0496104_0521717
2402 Ga0496105_0000021
2403 Ga0496105_0002033
2404 Ga0496106_0031955
2405 Ga0496106_0148858
2406 Ga0496106_0346232
2407 Ga0496107_0041756
2408 Ga0496107_0099030
2409 Ga0496108_0055892
2410 Ga0496108_0143031
2411 Ga0496109_0251788
2412 Ga0496111_0474370
2413 Ga0496112_0226721
2414 Ga0496113_0005101
2415 Ga0496113_0212743
2416 Ga0496114_0000820
2417 Ga0496114_0002725
2418 Ga0496114_0138149
2419 Ga0496115_0000114
2420 Ga0496115_0000387
2421 Ga0496115_0004395
2422 Ga0496115_0008772
2423 Ga0496115_0052195
2424 Ga0496115_0106677
2425 Ga0496115_0134012
2426 Ga0496115_0423901
2427 Ga0496116_0004008
2428 Ga0496116_0064193
2429 Ga0496116_0075584
2430 Ga0496117_0001196
2431 Ga0496117_0001459
2432 Ga0496117_0008161
2433 Ga0496117_0017436
2434 Ga0496117_0048556
2435 Ga0496117_0049740
2436 Ga0496117_0084717
2437 Ga0496117_0095972
2438 Ga0496118_0000169
2439 Ga0496118_0000528
2440 Ga0496118_0001268
2441 Ga0496118_0001486
2442 Ga0496118_0003436
2443 Ga0496118_0003579
2444 Ga0496118_0004865
2445 Ga0496118_0011727
2446 Ga0496118_0021844
2447 Ga0496118_0027255
2448 Ga0496118_0047598
2449 Ga0496118_0101421
2450 Ga0496119_0000165
2451 Ga0496119_0000659
2452 Ga0496119_0000951
2453 Ga0496119_0020548
2454 Ga0496120_0000054
2455 Ga0496120_0000217
2456 Ga0496120_0000276
2457 Ga0496120_0001321
2458 Ga0496121_0000148
2459 Ga0496121_0000364
2460 Ga0496121_0001122
2461 Ga0496121_0012440
2462 Ga0496121_0013502
2463 Ga0496121_0017454
2464 Ga0496121_0030555
2465 Ga0496121_0035477
2466 Ga0496121_0038038
2467 Ga0496121_0046365
2468 Ga0496121_0060089
2469 Ga0496121_0088573
2470 Ga0496121_0169928
2471 Ga0496122_0000062
2472 Ga0496122_0000372
2473 Ga0496122_0004100
2474 Ga0496122_0039267
2475 Ga0496122_0044506
2476 Ga0496122_0056232
2477 Ga0496122_0101530
2478 Ga0496122_0126181
2479 Ga0496123_0000253
2480 Ga0496123_0003248
2481 Ga0496123_0003662
2482 Ga0496123_0009343
2483 Ga0496123_0020955
2484 Ga0496123_0031098
2485 Ga0496123_0053244
2486 Ga0496123_0072151
2487 Ga0496123_0074609
2488 Ga0496123_0078488
2489 Ga0496123_0122514
2490 Ga0496123_0211205
2491 Ga0496124_0000009
2492 Ga0496124_0000734
2493 Ga0496124_0000815
2494 Ga0496124_0011679
2495 Ga0496124_0012879
2496 Ga0496124_0035745
2497 Ga0496124_0052800
2498 Ga0496124_0056350
2499 Ga0496124_0063983
2500 Ga0496124_0120552
2501 Ga0496124_0173218
2502 Ga0496124_0224555
2503 Ga0496125_0000750
2504 Ga0496125_0004325
2505 Ga0496125_0007644
2506 Ga0496125_0013354
2507 Ga0496125_0015751
2508 Ga0496125_0019641
2509 Ga0496125_0087228
2510 Ga0496125_0090757
2511 Ga0496126_0000206
2512 Ga0496126_0000835
2513 Ga0496126_0013972
2514 Ga0496126_0038127
2515 Ga0496126_0058576
2516 Ga0496126_0060649
2517 Ga0496126_0061534
2518 Ga0496126_0071393
2519 Ga0496126_0109970
2520 Ga0496126_0142188
2521 Ga0495678_000116
2522 Ga0495682_0002358
2523 Ga0495682_0003246
2524 Ga0495682_0020963
2525 Ga0501290_000667
2526 Ga0501292_004939
2527 Ga0501299_010975
2528 Ga0501031_0002100
2529 Ga0501031_0018604
2530 Ga0501031_0172512
2531 Ga0501031_0174677
2532 Ga0501032_0001175
2533 Ga0501032_0019849
2534 Ga0501032_0023609
2535 Ga0501032_0113545
2536 Ga0501033_0000932
2537 Ga0501033_0004694
2538 Ga0501033_0005337
2539 Ga0501033_0016017
2540 Ga0501033_0023695
2541 Ga0501033_0035014
2542 Ga0501033_0091340
2543 Ga0501033_0136046
2544 Ga0501034_0000272
2545 Ga0501034_0000667
2546 Ga0501034_0001266
2547 Ga0501034_0001500
2548 Ga0501034_0010123
2549 Ga0501034_0012981
2550 Ga0501034_0016507
2551 Ga0501034_0026733
2552 Ga0501034_0047089
2553 Ga0501034_0146337
2554 Ga0501034_0178001
2555 Ga0501034_0227691
2556 Ga0501036_0022691
2557 Ga0501036_0038174
2558 Ga0501036_0041900
2559 Ga0501036_0056696
2560 Ga0501036_0058455
2561 Ga0501036_0059295
2562 Ga0501036_0082146
2563 Ga0501036_0427889
2564 Ga0501037_0000445
2565 Ga0501037_0014502
2566 Ga0501037_0022344
2567 Ga0501037_0091882
2568 Ga0501037_0114333
2569 Ga0501037_0139474
2570 Ga0501038_0002821
2571 Ga0501038_0010357
2572 Ga0501038_0055860
2573 Ga0501038_0106830
2574 Ga0501039_0034575
2575 Ga0501039_0157359
2576 Ga0501039_0215185
2577 Ga0501039_0238135
2578 Ga0501039_0482382
2579 Ga0501040_0221534
2580 Ga0501042_0118114
2581 Ga0501042_0202016
2582 Ga0501042_0366625
2583 Ga0501042_0504737
2584 Ga0501043_0003232
2585 Ga0501043_0003273
2586 Ga0501043_0015149
2587 Ga0501043_0016089
2588 Ga0501043_0031909
2589 Ga0501043_0082531
2590 Ga0501043_0156262
2591 Ga0501043_0180719
2592 Ga0501046_0000610
2593 Ga0501046_0031341
2594 Ga0501046_0051563
2595 Ga0501047_0000403
2596 Ga0501047_0004202
2597 Ga0501047_0010132
2598 Ga0501047_0018122
2599 Ga0501047_0029308
2600 Ga0501047_0045788
2601 Ga0501047_0142995
2602 Ga0501047_0214056
2603 Ga0501047_0289246
2604 Ga0501048_0011643
2605 Ga0501048_0131700
2606 Ga0501048_0187621
2607 Ga0501048_0218060
2608 Ga0501067_0003187
2609 Ga0501067_0021975
2610 Ga0501067_0108523
2611 Ga0501068_0017125
2612 Ga0501068_0038381
2613 Ga0501069_0002608
2614 Ga0501069_0022269
2615 Ga0501069_0028513
2616 Ga0501069_0034417
2617 Ga0501070_0002872
2618 Ga0501070_0008207
2619 Ga0501070_0030674
2620 Ga0501070_0034069
2621 Ga0501070_0047755
2622 Ga0501070_0052658
2623 Ga0501070_0086653
2624 Ga0501070_0129794
2625 Ga0501070_0134916
2626 Ga0501070_0146545
2627 Ga0501070_0185922
2628 Ga0501071_0034538
2629 Ga0501071_0088308
2630 Ga0501071_0095971
2631 Ga0501072_0004709
2632 Ga0501072_0202262
2633 Ga0501073_0007366
2634 Ga0501073_0008386
2635 Ga0501073_0045213
2636 Ga0501073_0067874
2637 Ga0501073_0081964
2638 Ga0501073_0391256
2639 Ga0501074_0014799
2640 Ga0501074_0030893
2641 Ga0501074_0046392
2642 Ga0501074_0049582
2643 Ga0501074_0148533
2644 Ga0501075_0011521
2645 Ga0501216_004147
2646 Ga0501227_000487
2647 Ga0501227_009037
2648 Ga0501233_002222
2649 Ga0501221_013866
2650 Ga0501225_0005311
2651 Ga0501225_0012786
2652 Ga0501079_0225958
2653 Ga0501079_0310938
2654 Ga0501080_0004522
2655 Ga0501080_0033509
2656 Ga0501080_0064962
2657 Ga0501080_0175100
2658 Ga0501080_0175733
2659 Ga0501080_0230085
2660 Ga0501080_0529057
2661 Ga0501083_0010153
2662 Ga0501083_0185624
2663 Ga0501266_005358
2664 Ga0501268_017371
2665 Ga0501275_000196
2666 Ga0501035_0002806
2667 Ga0501035_0005911
2668 Ga0501035_0020001
2669 Ga0501035_0026236
2670 Ga0501035_0066830
2671 Ga0501035_0067564
2672 Ga0501035_0116644
2673 Ga0501035_0516911
2674 Ga0501044_0001991
2675 Ga0501044_0005512
2676 Ga0501044_0009796
2677 Ga0501044_0012777
2678 Ga0501044_0016869
2679 Ga0501044_0019410
2680 Ga0501044_0020401
2681 Ga0501044_0025173
2682 Ga0501044_0055937
2683 Ga0501044_0094458
2684 Ga0501044_0110033
2685 Ga0501044_0113639
2686 Ga0501044_0125765
2687 Ga0501044_0125974
2688 Ga0501044_0165864
2689 Ga0501044_0208594
2690 Ga0501044_0417124
2691 nmdc:mga00v17_173377_c1
2692 nmdc:mga00v17_322994_c1
2693 nmdc:mga00v17_473_c1
2694 nmdc:mga00v17_5873_c1
2695 nmdc:mga00v17_70041_c1
2696 nmdc:mga06z11_119943_c1
2697 nmdc:mga05p37_341262_c2
2698 nmdc:mga09592_18444_c1
2699 nmdc:mga09592_9294_c1
2700 nmdc:mga09592_9898_c1
2701 nmdc:mga0qj67_206550_c1
2702 nmdc:mga0qj67_79983_c1
2703 nmdc:mga06r32_440633_c1
2704 nmdc:mga08y16_336478_c1
2705 nmdc:mga08y16_82022_c1
2706 nmdc:mga0rr50_176501_c1
2707 nmdc:mga0rr50_383273_c1
2708 Ga0500610_0009379
2709 Ga0500643_000103
2710 Ga0500643_006045
2711 Ga0500651_0000239
2712 Ga0500651_0042021
2713 Ga0500555_000554
2714 Ga0500597_000039
2715 Ga0500626_053580
2716 Ga0500568_0001946
2717 Ga0500568_0008117
2718 Ga0500620_002235
2719 Ga0500633_0000431
2720 Ga0500634_0000229
2721 Ga0500645_001165
2722 Ga0501084_0034311
2723 Ga0501084_0126409
2724 Ga0501084_0190487
2725 Ga0501082_0010653
2726 Ga0501082_0017743
2727 Ga0466962_0002470
2728 Ga0466962_0010704
2729 Ga0466962_0028639
2730 2525557105
2731 2547502711
2732 2572256341
2733 2578458754
2734 2595447090
2735 2595449848
2736 2630648701
2737 2643816287
2738 2643881653
2739 2643905591
2740 2643913276
2741 2643939028
2742 2643977666
2743 2644077231
2744 2644528660
2745 2644662742
2746 2644694542
2747 2644698304
2748 2687582214
2749 2721026250
2750 2735833774
2751 2739228762
2752 2739732263
2753 2740992581
2754 2747950782
2755 2765578642
2756 2816516718
2757 2819564233
2758 2819659992
2759 2842394953
2760 2842758441
2761 2842781250
2762 2842918118
2763 2842920146
2764 2852651108
2765 2852685188
2766 2857445258
2767 2874221271
2768 2884341762
2769 2884411510
2770 2894416170
2771 2895396532
2772 2895498991
2773 2895512029
2774 2895524904
2775 2895527973
2776 2904464873
2777 2919091776
2778 2919130730
2779 2919136171
2780 2919406382
2781 2919515290
2782 2919678305
2783 2923517700
2784 2928496240
2785 2928964948
2786 2929198264
2787 2931381086
2788 2937612092
2789 2939590721
2790 2939615183
2791 2939622907
2792 2939630831
2793 2941475470
2794 2941477947
2795 2941489812
2796 2961048037
2797 2961065057
2798 2974309231
2799 2977249952
2800 2984515559
2801 2987606301
2802 2995950679
2803 8003016545
2804 8021625305
2805 8021630213
2806 8021652126

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

93

313

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.8904 3 296
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.8662 3 296
4le6-assembly2.cif.gz_C crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.822 3 283
4le6-assembly3.cif.gz_E crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8213 3 283
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8046 2 264
ID Description Score Start End Superfamily
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8976 3 275 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8742 3 275 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8213 3 283 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7749 3 282 3.60.15.10
3aj0A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7681 2 264 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A4R0YKK8-F1-model_v4 MBL fold metallo-hydrolase 0.9955 1 289 GO:0016787
AF-A0A7W6L2L3-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9943 2 296 GO:0016787
AF-A0A2R7NM18-F1-model_v4 deleted 0.9943 1 204
AF-A0A2D5EMW0-F1-model_v4 MBL fold hydrolase 0.9943 217 287 GO:0016787
AF-A0A848Q7N6-F1-model_v4 deleted 0.9937 1 132

Map