F493756

General Info

Members Datasets Scaffolds Average Seq Length
1411 956 900 383

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0008525|Ga0501047_0008525_6473_7624
Length 383
Sequence MIIAVPQETAEGERRVALVPAAAATLKKAGHDIRVERGAGLSSGFHDSDYERVGASLYDNRAALLAEAETIVQVKAAGANPNNGMQDIGALHGGQTLIGFAEPLTAHDATRALSERGVALLAMELIPRITRAQAMDALSSQANLAGYKAVVKAADLIGQAFPMFITAAGTIQPAKVFIIGAGVAGLQAIATAKRLGAXXXXIDVRPEVKEQVESLGARFVMPPVQASGEGGYAKELTDEQKAQXXXMMADTVADADVVVTTALIPGRPAPRLVTAAMVQRMRSGSVIVDLGAERGGNVEGTEAGKIIDKNGVLLVGAINTASEVAHDASSMYAGNIVKLIQHLTGKNAQQIQWNLEDPIIAGALVCKGGKIVHPQVKKSMGIE

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681786 Brucella suis 92/29 Isolate Unclassified
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
62 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
63 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
64 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
65 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
66 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
67 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
68 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
69 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
70 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
71 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
72 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
73 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
79 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
80 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
81 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
82 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
83 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
84 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
85 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
86 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
87 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
88 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
89 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
90 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
91 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
92 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
93 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221557 Ensifer sp. Root558 Isolate Unclassified
96 2643221599 Rhizobium sp. Root708 Isolate Unclassified
97 2643221607 Rhizobium sp. Root73 Isolate Unclassified
98 2643221610 Ensifer sp. Root74 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221626 Ensifer sp. Root31 Isolate Unclassified
101 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
102 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
103 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
104 2643221655 Ensifer sp. Root1252 Isolate Unclassified
105 2643221659 Ensifer sp. Root127 Isolate Unclassified
106 2643221668 Ensifer sp. Root423 Isolate Unclassified
107 2643221675 Ensifer sp. Root1298 Isolate Unclassified
108 2643221680 Ensifer sp. Root1312 Isolate Unclassified
109 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
110 2643221688 Rhizobium sp. Root482 Isolate Unclassified
111 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
112 2643221698 Ensifer sp. Root142 Isolate Unclassified
113 2643221712 Ensifer sp. Root258 Isolate Unclassified
114 2643221723 Ensifer sp. Root278 Isolate Unclassified
115 2643221726 Ensifer sp. Root954 Isolate Unclassified
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
118 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
119 2718217882 Rhizobium sp. N741 Isolate Nodule
120 2718217927 Rhizobium sp. N324 Isolate Nodule
121 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
122 2718218009 Rhizobium sp. N561 Isolate Nodule
123 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
124 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
125 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
126 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
127 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2718218423 Rhizobium sp. N941 Isolate Nodule
132 2721755514 Rhizobium sp. N6212 Isolate Nodule
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
136 2721755809 Rhizobium sp. N541 Isolate Nodule
137 2721755810 Rhizobium sp. N871 Isolate Nodule
138 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
139 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
140 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
141 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
142 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
143 2728369365 Rhizobium sp. N1341 Isolate Nodule
144 2728369397 Rhizobium sp. N1314 Isolate Nodule
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
147 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
148 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
149 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
150 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
151 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
152 2791355256 Rhizobium sp. M10 Isolate Nodule
153 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
154 2791355260 Rhizobium sp. L9 Isolate Nodule
155 2791355261 Rhizobium sp. J15 Isolate Nodule
156 2791355262 Rhizobium sp. M1 Isolate Nodule
157 2791355264 Rhizobium sp. S9 Isolate Nodule
158 2791355265 Rhizobium sp. H4 Isolate Nodule
159 2791355266 Rhizobium sp. L43 Isolate Nodule
160 2791355267 Rhizobium sp. L18 Isolate Nodule
161 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
162 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
163 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
164 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
165 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
166 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
167 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
168 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
169 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
170 2802429633 Rhizobium anhuiense J3 Isolate Nodule
171 2802429634 Rhizobium anhuiense S10 Isolate Nodule
172 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
173 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
174 2802429637 Rhizobium anhuiense C15 Isolate Nodule
175 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
176 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
177 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
178 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
179 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
180 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
181 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
182 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
183 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
184 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
185 2838048938 Rhizobium pisi 27/80 Isolate Nodule
186 2838061910 Rhizobium phaseoli L15 Isolate Nodule
187 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
188 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
189 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
190 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
191 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
192 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
193 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
194 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
195 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
196 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
197 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
198 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
199 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
200 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
203 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
204 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
205 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
206 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
207 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
208 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
209 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
210 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
211 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
212 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
213 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
214 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
215 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
216 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
217 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
218 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
219 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
220 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
221 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
222 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
223 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
224 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
225 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
226 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
227 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
228 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
229 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
230 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
231 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
232 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
233 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
234 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
235 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
236 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
237 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
238 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
239 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
240 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
241 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
242 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
243 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
244 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
245 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
246 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
247 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
248 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
249 2842694124 Methylopila sp. R-72369 Isolate Unclassified
250 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
251 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
252 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
253 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
254 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
255 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
256 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
257 2854911287 Brucella lupini LUP21 Isolate Unclassified
258 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
259 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
260 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
261 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
262 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
263 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
264 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
265 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
266 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
267 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
268 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
269 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
270 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
271 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
272 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
273 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
274 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
275 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
276 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
277 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
278 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
279 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
280 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
281 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
282 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
283 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
284 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
285 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
286 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
287 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
288 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
289 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
290 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
291 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
292 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
293 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
294 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
295 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
296 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
297 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
298 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
299 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
300 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
301 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
302 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
303 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
304 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
305 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
306 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
307 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
308 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
309 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
310 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
311 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
312 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
313 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
314 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
315 2933599457 Rhizobium phaseoli M3 Isolate Nodule
316 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
317 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
318 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
319 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
320 2936381700 Rhizobium chutanense C16 Isolate Unclassified
321 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
322 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
323 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
324 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
325 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
326 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
327 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
328 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
329 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
330 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
331 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
332 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
333 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
334 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
335 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
336 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
337 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
338 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
339 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
340 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
341 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
342 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
343 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
344 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
345 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
346 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
347 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
348 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
349 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
350 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
351 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
352 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
353 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
354 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
355 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
356 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
357 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
358 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
359 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
360 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
361 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
362 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
363 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
364 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
365 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
366 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
367 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
368 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
369 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
370 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
371 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
372 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
373 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
374 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
375 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
376 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
377 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
378 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
379 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
380 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
381 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
382 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
383 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
384 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
385 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
386 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
387 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
388 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
389 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
390 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
391 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
392 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
393 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
394 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
395 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
396 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
397 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
398 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
399 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
400 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
401 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
402 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
403 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
404 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
405 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
406 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
407 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
408 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
409 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
410 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
411 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
412 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
413 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
414 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
415 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
416 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
417 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
418 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
419 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
420 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
421 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
422 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
423 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
424 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
425 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
426 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
427 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
428 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
429 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
430 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
431 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
432 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
433 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
434 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
435 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
436 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
437 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
438 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
439 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
440 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
441 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
442 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
443 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
444 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
445 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
446 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
447 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
448 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
449 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
450 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
451 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
452 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
453 2996887358 Rhizobium sp. R711 Isolate Nodule
454 2996893221 Rhizobium sp. R635 Isolate Nodule
455 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
456 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
457 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
458 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
459 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
460 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
461 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
462 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
463 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
464 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
465 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
466 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
467 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
468 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
469 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
470 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
471 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
472 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
473 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
474 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
475 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
476 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
477 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
478 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
479 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
480 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
481 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
482 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
483 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
484 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
485 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
486 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
487 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
488 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
489 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
490 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
491 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
492 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
493 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
494 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
495 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
496 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
497 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
498 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
499 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
500 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
501 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
502 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
503 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
504 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
505 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
506 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
507 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
508 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
509 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
510 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
511 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
512 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
513 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
514 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
515 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
516 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
517 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
518 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
519 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
520 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
521 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
522 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
523 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
524 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
525 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
526 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
527 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
528 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
529 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
530 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
531 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
532 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
533 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
534 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
535 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
536 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
537 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
538 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
539 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
540 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
541 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
542 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
543 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
544 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
545 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
546 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
547 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
548 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
549 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
550 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
551 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
552 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
553 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
554 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
555 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
556 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
557 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
558 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
559 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
560 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
561 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
562 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
563 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
564 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
565 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
566 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
567 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
568 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
569 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
570 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
571 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
572 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
573 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
574 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
575 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
576 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
577 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
578 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
579 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
580 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
581 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
582 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
583 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
584 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
585 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
586 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
587 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
588 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
589 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
590 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
591 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
592 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
593 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
594 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
595 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
596 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
597 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
598 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
599 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
600 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
601 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
602 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
603 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
604 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
605 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
606 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
607 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
608 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
609 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
611 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
612 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
613 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
614 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
616 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
617 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
618 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
619 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
620 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
621 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
622 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
623 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
624 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
626 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
627 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
628 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
629 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
660 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
670 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
671 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
674 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
675 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
676 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
677 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
678 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
680 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
681 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
682 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
683 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
684 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
685 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
687 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
688 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
689 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
690 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
691 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
692 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
693 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
694 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
695 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
696 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
697 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
698 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
699 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
700 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
701 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
702 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
703 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
704 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
705 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
706 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
707 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
709 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
710 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
711 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
712 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
713 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
714 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
715 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
716 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
717 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
718 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
719 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
720 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
721 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
722 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
723 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
724 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
725 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
726 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
727 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
728 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
729 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
730 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
731 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
732 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
733 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
734 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
735 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
736 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
737 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
738 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
739 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
740 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
741 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
742 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
743 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
744 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
745 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
746 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
747 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
748 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
749 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
750 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
751 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
752 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
753 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
754 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
755 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
756 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
757 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
758 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
759 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
760 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
761 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
762 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
763 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
764 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
765 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
766 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
767 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
768 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
769 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
770 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
771 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
772 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
773 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
774 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
775 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
776 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
777 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
778 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
779 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
780 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
781 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
782 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
783 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
784 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
785 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
786 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
787 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
788 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
789 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
790 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
791 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
792 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
793 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
794 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
795 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
796 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
797 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
798 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
799 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
800 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
801 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
802 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
803 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
804 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
805 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
806 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
807 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
808 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
809 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
810 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
811 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
812 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
813 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
814 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
815 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
816 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
817 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
818 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
819 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
820 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
821 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
822 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
823 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
824 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
825 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
826 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
827 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
828 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
829 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
830 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
831 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
832 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
833 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
834 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
835 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
836 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
837 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
838 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
839 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
840 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
841 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
842 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
843 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
844 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
845 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
846 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
847 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
848 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
849 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
850 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
851 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
852 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
853 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
854 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
855 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
856 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
857 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
858 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
859 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
860 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
861 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
862 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
863 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
864 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
865 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
866 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
867 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
868 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
869 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
870 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
871 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
872 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
873 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
874 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
875 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
876 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
877 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
878 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
879 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
880 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
881 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
882 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
883 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
884 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
885 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
886 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
887 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
888 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
889 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
890 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
891 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
892 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
893 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
894 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
895 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
896 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
897 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
898 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
899 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
900 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
901 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
902 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
903 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
904 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
905 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
906 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
907 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
908 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
909 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
910 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
911 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
912 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
913 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
914 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
915 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
916 8005258706 Rhizobium sp. R693 Isolate Nodule
917 8005275841 Rhizobium sp. N4311 Isolate Nodule
918 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
919 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
920 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
921 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
922 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
923 8005321885 Rhizobium sp. R72 Isolate Nodule
924 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
925 8005382845 Rhizobium sp. R634 Isolate Nodule
926 8005395548 Rhizobium sp. R339 Isolate Nodule
927 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
928 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
929 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
930 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
931 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
932 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
933 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
934 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
935 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
936 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
937 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
938 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
939 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
940 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
941 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
942 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
943 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
944 8018176218 Rhizobium sp. N122 Isolate Nodule
945 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
946 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
947 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
948 8024501048 Rhizobium sp. H4 Isolate Nodule
949 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
950 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
951 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
952 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
953 8056382006 Rhizobium croatiense 13T Isolate Nodule
954 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
955 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
956 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.64
Metatranscriptomes 0.14
Isolates 36.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 28.84
Rhizoplane 4.32
Rhizosphere 46.28
Stem 0
Stem Tuber 0
Unclassified 9.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000012 3300002704 Bacteria 199435
2 JGI25156J39149_1000036 3300002705 Bacteria 110527
3 JGI25162J39368_1000641 3300002737 Bacteria 24773
4 JGI25162J39368_1000669 3300002737 Bacteria 24197
5 JGI25154J39366_1000033 3300002738 Bacteria 184379
6 JGI25157J39369_1000124 3300002741 Bacteria 65844
7 JGI25152J39213_1009370 3300002773 Bacteria 2331
8 JGI25150J39212_1002811 3300002774 Bacteria 4222
9 JGI25159J45721_1000032 3300002987 Bacteria 90158
10 JGI25159J45721_1000508 3300002987 Bacteria 17749
11 JGI25151J46595_10003417 3300003187 Bacteria 8786
12 JGI25151J46595_10009531 3300003187 Bacteria 4587
13 JGI25151J46595_10032321 3300003187 Bacteria 2030
14 JGI25165J46597_1000758 3300003214 Bacteria 24773
15 JGI25165J46597_1001693 3300003214 Bacteria 9952
16 JGI25153J46596_10004999 3300003215 Bacteria 7034
17 JGI25153J46596_10038136 3300003215 Bacteria 1519
18 JGI25160J50197_1000006 3300003354 Bacteria 316247
19 JGI25160J50197_1000009 3300003354 Bacteria 282862
20 JGI25160J50197_1011868 3300003354 Bacteria 3057
21 JGI25161J50226_1000004 3300003374 Bacteria 316212
22 JGI25161J50226_1000120 3300003374 Bacteria 57896
23 JGI25161J50226_1000240 3300003374 Bacteria 32956
24 Ga0006562J51391_1021693 3300003578 Bacteria 5770
25 JGI25404J52841_10000756 3300003659 Bacteria 5073
26 Ga0055526_1001379 3300003771 Bacteria 17367
27 Ga0055526_1002044 3300003771 Bacteria 13881
28 Ga0055526_1002151 3300003771 Bacteria 13515
29 Ga0055526_1018637 3300003771 Bacteria 2580
30 Ga0055524_1002134 3300003775 Bacteria 10403
31 Ga0055524_1003185 3300003775 Bacteria 8059
32 Ga0055524_1004686 3300003775 Bacteria 6265
33 Ga0055524_1005912 3300003775 Bacteria 5389
34 Ga0055536_1002454 3300003781 Bacteria 10410
35 Ga0055536_1012053 3300003781 Bacteria 3245
36 Ga0055528_1000445 3300003790 Bacteria 33070
37 Ga0055528_1000693 3300003790 Bacteria 24016
38 Ga0055528_1002180 3300003790 Bacteria 10724
39 Ga0055528_1015774 3300003790 Bacteria 2709
40 Ga0055528_1021652 3300003790 Bacteria 2030
41 Ga0055528_1023626 3300003790 Bacteria 1868
42 Ga0055540_1002182 3300003792 Bacteria 10641
43 Ga0055540_1002353 3300003792 Bacteria 10116
44 Ga0055540_1003170 3300003792 Bacteria 8116
45 Ga0055531_10002326 3300003794 Bacteria 12826
46 Ga0055531_10011072 3300003794 Bacteria 4401
47 Ga0055543_1000002 3300004625 Bacteria 390020
48 Ga0055543_1000055 3300004625 Bacteria 103837
49 Ga0055543_1000155 3300004625 Bacteria 57253
50 Ga0065165_1000020 3300005262 Bacteria 265570
51 Ga0065165_1000391 3300005262 Bacteria 71184
52 Ga0065165_1009728 3300005262 Bacteria 4260
53 Ga0070658_10024041 3300005327 Bacteria 4890
54 Ga0070683_100020763 3300005329 Bacteria 5850
55 Ga0068869_100010176 3300005334 Bacteria 6124
56 Ga0070666_10035078 3300005335 Bacteria 3325
57 Ga0070680_100002445 3300005336 Bacteria 13764
58 Ga0070680_100008772 3300005336 Bacteria 7755
59 Ga0070682_100001331 3300005337 Bacteria 13981
60 Ga0070660_100001803 3300005339 Bacteria 14705
61 Ga0070689_100000297 3300005340 Bacteria 28868
62 Ga0070691_10004703 3300005341 Bacteria 6208
63 Ga0070687_100091232 3300005343 Bacteria 1686
64 Ga0070661_100018427 3300005344 Bacteria 4962
65 Ga0070692_10001269 3300005345 Bacteria 9012
66 Ga0070668_100015668 3300005347 Bacteria 5669
67 Ga0070668_100036586 3300005347 Bacteria 3747
68 Ga0070668_100050203 3300005347 Bacteria 3211
69 Ga0070669_100001902 3300005353 Bacteria 15072
70 Ga0070675_100008391 3300005354 Bacteria 8017
71 Ga0070675_100174193 3300005354 Bacteria 1857
72 Ga0070674_100000216 3300005356 Bacteria 27872
73 Ga0070674_100047854 3300005356 Bacteria 2933
74 Ga0070673_100001299 3300005364 Bacteria 14558
75 Ga0070688_100001065 3300005365 Bacteria 13776
76 Ga0070688_100085170 3300005365 Bacteria 2054
77 Ga0070667_100004535 3300005367 Bacteria 11697
78 Ga0070703_10000417 3300005406 Bacteria 17544
79 Ga0070709_10002320 3300005434 Bacteria 10318
80 Ga0070709_10043745 3300005434 Bacteria 2771
81 Ga0070714_100002631 3300005435 Bacteria 13220
82 Ga0070714_100148275 3300005435 Bacteria 2112
83 Ga0070714_100178834 3300005435 Bacteria 1929
84 Ga0070713_100025539 3300005436 Bacteria 4619
85 Ga0070713_100104724 3300005436 Bacteria 2457
86 Ga0070713_100117450 3300005436 Bacteria 2328
87 Ga0070713_100119588 3300005436 Bacteria 2308
88 Ga0070710_10007642 3300005437 Bacteria 5240
89 Ga0070701_10010600 3300005438 Bacteria 4083
90 Ga0070701_10018654 3300005438 Bacteria 3263
91 Ga0070711_100014866 3300005439 Bacteria 4916
92 Ga0070711_100230832 3300005439 Bacteria 1443
93 Ga0070705_100000230 3300005440 Bacteria 33188
94 Ga0070700_100010745 3300005441 Bacteria 5058
95 Ga0070708_100010142 3300005445 Bacteria 7624
96 Ga0070663_100023100 3300005455 Bacteria 4164
97 Ga0070678_100290307 3300005456 Bacteria 1386
98 Ga0070662_100000604 3300005457 Bacteria 21916
99 Ga0070681_10303612 3300005458 Bacteria 1506
100 Ga0070685_10008115 3300005466 Bacteria 5381
101 Ga0070706_100093390 3300005467 Bacteria 2792
102 Ga0070707_100255816 3300005468 Bacteria 1704
103 Ga0070699_100000750 3300005518 Bacteria 30008
104 Ga0070699_100046972 3300005518 Bacteria 3735
105 Ga0070679_100027088 3300005530 Bacteria 5636
106 Ga0070679_100098825 3300005530 Bacteria 2906
107 Ga0070679_100488095 3300005530 Bacteria 1176
108 Ga0070684_100038554 3300005535 Bacteria 4105
109 Ga0070697_100000500 3300005536 Bacteria 29734
110 Ga0070697_100019948 3300005536 Bacteria 5298
111 Ga0070697_100022188 3300005536 Bacteria 5038
112 Ga0068853_100002229 3300005539 Bacteria 14494
113 Ga0070672_100035343 3300005543 Bacteria 3799
114 Ga0070686_100007583 3300005544 Bacteria 6060
115 Ga0070695_100000466 3300005545 Bacteria 20996
116 Ga0070695_100003589 3300005545 Bacteria 9060
117 Ga0070695_100042149 3300005545 Bacteria 2897
118 Ga0070696_100000987 3300005546 Bacteria 18435
119 Ga0070696_100094318 3300005546 Bacteria 2135
120 Ga0070693_100000285 3300005547 Bacteria 23809
121 Ga0070665_100145554 3300005548 Bacteria 2373
122 Ga0070665_100297393 3300005548 Bacteria 1617
123 Ga0070704_100005358 3300005549 Bacteria 7470
124 Ga0070704_100052600 3300005549 Bacteria 2874
125 Ga0070704_100225481 3300005549 Bacteria 1526
126 Ga0068855_100017911 3300005563 Bacteria 8510
127 Ga0068855_100061883 3300005563 Bacteria 4372
128 Ga0068855_100388143 3300005563 Bacteria 1532
129 Ga0070664_100002460 3300005564 Bacteria 14914
130 Ga0068857_100009396 3300005577 Bacteria 8488
131 Ga0068857_100067241 3300005577 Bacteria 3190
132 Ga0068857_100085613 3300005577 Bacteria 2817
133 Ga0068854_100001563 3300005578 Bacteria 13889
134 Ga0068854_100061128 3300005578 Bacteria 2727
135 Ga0070702_100005294 3300005615 Bacteria 5990
136 Ga0070702_100062351 3300005615 Bacteria 2174
137 Ga0068852_100004868 3300005616 Bacteria 9536
138 Ga0068859_100121929 3300005617 Bacteria 2673
139 Ga0068859_100173421 3300005617 Bacteria 2238
140 Ga0068864_100019253 3300005618 Bacteria 5706
141 Ga0068861_100003642 3300005719 Bacteria 10271
142 Ga0068851_10058825 3300005834 Bacteria 1965
143 Ga0068870_10100448 3300005840 Bacteria 1634
144 Ga0068863_100087143 3300005841 Bacteria 2958
145 Ga0068858_100089328 3300005842 Bacteria 2867
146 Ga0068860_100002382 3300005843 Bacteria 19747
147 Ga0068860_100070214 3300005843 Bacteria 3330
148 Ga0068860_100247839 3300005843 Bacteria 1734
149 Ga0068862_100021798 3300005844 Bacteria 5357
150 Ga0081455_10000774 3300005937 Bacteria 41248
151 Ga0081540_1000012 3300005983 Bacteria 189939
152 Ga0081540_1000054 3300005983 Bacteria 122877
153 Ga0081540_1001486 3300005983 Bacteria 20247
154 Ga0081540_1015093 3300005983 Bacteria 4903
155 Ga0070717_10079340 3300006028 Bacteria 2752
156 Ga0075365_10036417 3300006038 Bacteria 3188
157 Ga0075365_10043515 3300006038 Bacteria 2940
158 Ga0075368_10025731 3300006042 Bacteria 2259
159 Ga0075368_10069607 3300006042 Bacteria 1419
160 Ga0075363_100003983 3300006048 Bacteria 6387
161 Ga0075363_100007595 3300006048 Bacteria 4994
162 Ga0075363_100010441 3300006048 Bacteria 4413
163 Ga0075432_10000269 3300006058 Bacteria 14338
164 Ga0070715_10000999 3300006163 Bacteria 7934
165 Ga0070715_10011710 3300006163 Bacteria 3166
166 Ga0070715_10014418 3300006163 Bacteria 2928
167 Ga0070716_100004866 3300006173 Bacteria 6457
168 Ga0070716_100033356 3300006173 Bacteria 2815
169 Ga0070712_100001076 3300006175 Bacteria 16488
170 Ga0070712_100009628 3300006175 Bacteria 6092
171 Ga0070712_100020042 3300006175 Bacteria 4371
172 Ga0075362_10109047 3300006177 Bacteria 1301
173 Ga0075367_10008749 3300006178 Bacteria 5260
174 Ga0075367_10014094 3300006178 Bacteria 4319
175 Ga0075367_10056890 3300006178 Bacteria 2324
176 Ga0075367_10135685 3300006178 Bacteria 1522
177 Ga0075367_10154980 3300006178 Bacteria 1423
178 Ga0075367_10193488 3300006178 Bacteria 1269
179 Ga0075369_10001874 3300006186 Bacteria 7348
180 Ga0075369_10027078 3300006186 Bacteria 2394
181 Ga0075369_10048496 3300006186 Bacteria 1833
182 Ga0075366_10094412 3300006195 Bacteria 1793
183 Ga0075366_10128412 3300006195 Bacteria 1529
184 Ga0097621_100065952 3300006237 Bacteria 2981
185 Ga0075370_10008293 3300006353 Bacteria 5340
186 Ga0075428_100049763 3300006844 Bacteria 4598
187 Ga0075428_100064618 3300006844 Bacteria 4008
188 Ga0075428_100188527 3300006844 Bacteria 2231
189 Ga0075430_100000157 3300006846 Bacteria 44474
190 Ga0075430_100000649 3300006846 Bacteria 26543
191 Ga0075430_100039849 3300006846 Bacteria 3976
192 Ga0075430_100185349 3300006846 Bacteria 1730
193 Ga0075431_100002610 3300006847 Bacteria 17438
194 Ga0075431_100158514 3300006847 Bacteria 2328
195 Ga0075433_10002200 3300006852 Bacteria 14781
196 Ga0075433_10023733 3300006852 Bacteria 5165
197 Ga0075434_100002869 3300006871 Bacteria 15290
198 Ga0075434_100006936 3300006871 Bacteria 10441
199 Ga0075434_100126118 3300006871 Bacteria 2576
200 Ga0075429_100022909 3300006880 Bacteria 5414
201 Ga0068865_100002002 3300006881 Bacteria 12028
202 Ga0075436_100003257 3300006914 Bacteria 11117
203 Ga0097620_100121930 3300006931 Bacteria 2673
204 Ga0097620_100173419 3300006931 Bacteria 2238
205 Ga0079104_1000753 3300006946 Bacteria 27971
206 Ga0075435_100005496 3300007076 Bacteria 8856
207 Ga0075435_100007445 3300007076 Bacteria 7800
208 Ga0075435_100045808 3300007076 Bacteria 3507
209 Ga0075435_100064020 3300007076 Bacteria 2987
210 Ga0075435_100174988 3300007076 Bacteria 1812
211 Ga0105251_10025163 3300009011 Bacteria 3049
212 Ga0105240_10000019 3300009093 Bacteria 406211
213 Ga0105240_10002229 3300009093 Bacteria 31523
214 Ga0105240_10514096 3300009093 Bacteria 1330
215 Ga0111539_10006105 3300009094 Bacteria 15549
216 Ga0111539_10023165 3300009094 Bacteria 7626
217 Ga0111539_10050865 3300009094 Bacteria 4936
218 Ga0111539_10153054 3300009094 Bacteria 2699
219 Ga0111539_10480252 3300009094 Bacteria 1447
220 Ga0105245_10014514 3300009098 Bacteria 6860
221 Ga0105245_10270717 3300009098 Bacteria 1657
222 Ga0105247_10001618 3300009101 Bacteria 15945
223 Ga0105247_10115198 3300009101 Bacteria 1734
224 Ga0114129_10004123 3300009147 Bacteria 20534
225 Ga0114129_10035514 3300009147 Bacteria 7041
226 Ga0114129_10157778 3300009147 Bacteria 3102
227 Ga0114129_10221122 3300009147 Bacteria 2554
228 Ga0114129_10256366 3300009147 Bacteria 2346
229 Ga0105243_10004747 3300009148 Bacteria 10687
230 Ga0105243_10039405 3300009148 Bacteria 3683
231 Ga0105241_10025603 3300009174 Bacteria 4386
232 Ga0105242_10015301 3300009176 Bacteria 5958
233 Ga0105242_10075995 3300009176 Bacteria 2799
234 Ga0105242_10253878 3300009176 Bacteria 1586
235 Ga0105248_10005005 3300009177 Bacteria 14642
236 Ga0105248_10030678 3300009177 Bacteria 6004
237 Ga0105237_10001429 3300009545 Bacteria 31570
238 Ga0105237_10031663 3300009545 Bacteria 5357
239 Ga0105237_10040231 3300009545 Bacteria 4715
240 Ga0105237_10097844 3300009545 Bacteria 2925
241 Ga0105238_10026348 3300009551 Bacteria 5926
242 Ga0105238_10110065 3300009551 Bacteria 2736
243 Ga0105249_10002348 3300009553 Bacteria 16441
244 Ga0123341_1000016 3300009765 Bacteria 85309
245 Ga0105239_10011981 3300010375 Bacteria 9669
246 Ga0105239_10038823 3300010375 Bacteria 5217
247 Ga0105239_10198289 3300010375 Bacteria 2248
248 Ga0105246_10001570 3300011119 Bacteria 13599
249 Ga0105246_10184823 3300011119 Bacteria 1608
250 Ga0157373_10059900 3300013100 Bacteria 2697
251 Ga0157371_10011141 3300013102 Bacteria 6957
252 Ga0157370_10001824 3300013104 Bacteria 26237
253 Ga0157370_10033099 3300013104 Bacteria 5040
254 Ga0171463_1006 3300013249 Bacteria 336402
255 Ga0157375_10000397 3300013308 Bacteria 39527
256 Ga0157375_10027475 3300013308 Bacteria 5319
257 Ga0157375_10321932 3300013308 Bacteria 1711
258 Ga0163163_10056213 3300014325 Bacteria 3889
259 Ga0163163_10160296 3300014325 Bacteria 2295
260 Ga0157380_10014895 3300014326 Bacteria 5700
261 Ga0182008_10010866 3300014497 Bacteria 4858
262 Ga0157377_10004671 3300014745 Bacteria 6337
263 Ga0157379_10002662 3300014968 Bacteria 15043
264 Ga0157379_10056700 3300014968 Bacteria 3500
265 Ga0157379_10167831 3300014968 Bacteria 1981
266 Ga0157376_10001462 3300014969 Bacteria 15556
267 Ga0157376_10075130 3300014969 Bacteria 2883
268 Ga0157376_10120675 3300014969 Bacteria 2323
269 Ga0182007_10001337 3300015262 Bacteria 13301
270 Ga0183363_1227 3300015690 Bacteria 10367
271 Ga0214544_1000063 3300021320 Bacteria 129929
272 Ga0214542_1000095 3300021321 Bacteria 116012
273 Ga0214543_1000026 3300021327 Bacteria 220652
274 Ga0213874_10004310 3300021377 Bacteria 3232
275 Ga0213876_10000462 3300021384 Bacteria 32528
276 Ga0213876_10001766 3300021384 Bacteria 13104
277 Ga0213875_10004649 3300021388 Bacteria 7481
278 Ga0209435_100005 3300025206 Bacteria 573745
279 Ga0209436_100041 3300025208 Bacteria 74018
280 Ga0209672_108136 3300025228 Bacteria 1573
281 Ga0209437_100078 3300025233 Bacteria 278088
282 Ga0209437_100174 3300025233 Bacteria 138811
283 Ga0209437_107444 3300025233 Bacteria 1781
284 Ga0207425_1002069 3300025245 Bacteria 7464
285 Ga0207425_1002695 3300025245 Bacteria 6079
286 Ga0209646_1000011 3300025246 Bacteria 573745
287 Ga0209026_1000008 3300025250 Bacteria 573745
288 Ga0209677_100286 3300025253 Bacteria 33495
289 Ga0209759_1000004 3300025256 Bacteria 573745
290 Ga0209129_1000199 3300025258 Bacteria 77091
291 Ga0209129_1001513 3300025258 Bacteria 12887
292 Ga0209129_1001544 3300025258 Bacteria 12684
293 Ga0209129_1002718 3300025258 Bacteria 8289
294 Ga0209129_1009357 3300025258 Bacteria 2594
295 Ga0209129_1014942 3300025258 Bacteria 1625
296 Ga0209233_1000192 3300025261 Bacteria 127171
297 Ga0209233_1000194 3300025261 Bacteria 126185
298 Ga0209233_1000476 3300025261 Bacteria 24825
299 Ga0209673_1000037 3300025273 Bacteria 313804
300 Ga0209673_1000060 3300025273 Bacteria 263602
301 Ga0209673_1001773 3300025273 Bacteria 17916
302 Ga0209673_1001909 3300025273 Bacteria 16692
303 Ga0209673_1002125 3300025273 Bacteria 14804
304 Ga0209673_1023295 3300025273 Bacteria 2113
305 Ga0209130_1000030 3300025284 Bacteria 323323
306 Ga0209130_1000032 3300025284 Bacteria 316240
307 Ga0209130_1000037 3300025284 Bacteria 284019
308 Ga0209676_1003539 3300025292 Bacteria 9501
309 Ga0209676_1008914 3300025292 Bacteria 4406
310 Ga0209025_1000052 3300025294 Bacteria 324648
311 Ga0209025_1000196 3300025294 Bacteria 147356
312 Ga0209025_1001009 3300025294 Bacteria 41686
313 Ga0209025_1001184 3300025294 Bacteria 36925
314 Ga0209025_1003594 3300025294 Bacteria 14475
315 Ga0209025_1012061 3300025294 Bacteria 5597
316 Ga0209025_1013072 3300025294 Bacteria 5248
317 Ga0209025_1015920 3300025294 Bacteria 4487
318 Ga0209564_1000086 3300025295 Bacteria 251385
319 Ga0209564_1000281 3300025295 Bacteria 104019
320 Ga0209564_1000937 3300025295 Bacteria 37831
321 Ga0209564_1001052 3300025295 Bacteria 33676
322 Ga0209564_1022032 3300025295 Bacteria 2266
323 Ga0209758_1000576 3300025297 Bacteria 57318
324 Ga0209758_1000637 3300025297 Bacteria 53635
325 Ga0209758_1001377 3300025297 Bacteria 29000
326 Ga0209758_1001843 3300025297 Bacteria 23265
327 Ga0209758_1001862 3300025297 Bacteria 23127
328 Ga0209758_1004801 3300025297 Bacteria 10922
329 Ga0209758_1006689 3300025297 Bacteria 8138
330 Ga0209758_1014154 3300025297 Bacteria 4272
331 Ga0209050_1004517 3300025298 Bacteria 9355
332 Ga0209256_1000321 3300025299 Bacteria 82735
333 Ga0209256_1000348 3300025299 Bacteria 75070
334 Ga0209256_1001295 3300025299 Bacteria 26989
335 Ga0209256_1002621 3300025299 Bacteria 14217
336 Ga0209256_1012480 3300025299 Bacteria 3246
337 Ga0207426_1000047 3300025302 Bacteria 417011
338 Ga0207426_1000048 3300025302 Bacteria 409127
339 Ga0207426_1000077 3300025302 Bacteria 316246
340 Ga0207426_1002020 3300025302 Bacteria 14306
341 Ga0209051_1000236 3300025303 Bacteria 92738
342 Ga0209051_1008523 3300025303 Bacteria 5416
343 Ga0209051_1020077 3300025303 Bacteria 2893
344 Ga0209051_1041942 3300025303 Bacteria 1622
345 Ga0209257_1002011 3300025304 Bacteria 21749
346 Ga0209257_1004633 3300025304 Bacteria 10437
347 Ga0209257_1004844 3300025304 Bacteria 9958
348 Ga0209257_1020335 3300025304 Bacteria 2458
349 Ga0207656_10036067 3300025321 Bacteria 2074
350 Ga0207653_10000614 3300025885 Bacteria 12421
351 Ga0207692_10006578 3300025898 Bacteria 4721
352 Ga0207642_10057946 3300025899 Bacteria 1785
353 Ga0207710_10003659 3300025900 Bacteria 6816
354 Ga0207710_10023003 3300025900 Bacteria 2676
355 Ga0207688_10006040 3300025901 Bacteria 6590
356 Ga0207680_10023917 3300025903 Bacteria 3344
357 Ga0207680_10099149 3300025903 Bacteria 1869
358 Ga0207647_10003262 3300025904 Bacteria 12184
359 Ga0207647_10040176 3300025904 Bacteria 2947
360 Ga0207645_10018030 3300025907 Bacteria 4653
361 Ga0207654_10016041 3300025911 Bacteria 3896
362 Ga0207707_10247143 3300025912 Bacteria 1550
363 Ga0207695_10000049 3300025913 Bacteria 406233
364 Ga0207695_10018154 3300025913 Bacteria 8141
365 Ga0207671_10000107 3300025914 Bacteria 128950
366 Ga0207671_10026966 3300025914 Bacteria 4298
367 Ga0207693_10001214 3300025915 Bacteria 22993
368 Ga0207693_10001843 3300025915 Bacteria 18573
369 Ga0207693_10002790 3300025915 Bacteria 15130
370 Ga0207693_10010142 3300025915 Bacteria 7653
371 Ga0207693_10036247 3300025915 Bacteria 3888
372 Ga0207663_10048067 3300025916 Bacteria 2638
373 Ga0207660_10001814 3300025917 Bacteria 14226
374 Ga0207660_10005450 3300025917 Bacteria 8257
375 Ga0207662_10002012 3300025918 Bacteria 10049
376 Ga0207657_10006393 3300025919 Bacteria 12235
377 Ga0207649_10003953 3300025920 Bacteria 8081
378 Ga0207652_10047442 3300025921 Bacteria 3669
379 Ga0207652_10077839 3300025921 Bacteria 2895
380 Ga0207652_10250551 3300025921 Bacteria 1597
381 Ga0207681_10038013 3300025923 Bacteria 3186
382 Ga0207694_10030630 3300025924 Bacteria 4108
383 Ga0207694_10080002 3300025924 Bacteria 2564
384 Ga0207650_10030791 3300025925 Bacteria 3869
385 Ga0207687_10027934 3300025927 Bacteria 3788
386 Ga0207700_10020029 3300025928 Bacteria 4533
387 Ga0207644_10016821 3300025931 Bacteria 4926
388 Ga0207644_10042398 3300025931 Bacteria 3225
389 Ga0207690_10001636 3300025932 Bacteria 13873
390 Ga0207706_10001549 3300025933 Bacteria 22771
391 Ga0207709_10008268 3300025935 Bacteria 5762
392 Ga0207670_10007780 3300025936 Bacteria 6012
393 Ga0207670_10066256 3300025936 Bacteria 2481
394 Ga0207669_10016603 3300025937 Bacteria 3746
395 Ga0207669_10023338 3300025937 Bacteria 3303
396 Ga0207665_10000206 3300025939 Bacteria 39664
397 Ga0207665_10002147 3300025939 Bacteria 13347
398 Ga0207691_10020588 3300025940 Bacteria 6237
399 Ga0207691_10176794 3300025940 Bacteria 1867
400 Ga0207689_10015316 3300025942 Bacteria 6491
401 Ga0207661_10029018 3300025944 Bacteria 4245
402 Ga0207667_10124250 3300025949 Bacteria 2658
403 Ga0207651_10003739 3300025960 Bacteria 7526
404 Ga0207668_10003501 3300025972 Bacteria 9218
405 Ga0207668_10025353 3300025972 Bacteria 3837
406 Ga0207668_10035719 3300025972 Bacteria 3312
407 Ga0207668_10046312 3300025972 Bacteria 2971
408 Ga0207640_10001586 3300025981 Bacteria 12217
409 Ga0207658_10013167 3300025986 Bacteria 5646
410 Ga0207703_10022849 3300026035 Bacteria 4913
411 Ga0207703_10065760 3300026035 Bacteria 2980
412 Ga0207639_10077638 3300026041 Bacteria 2618
413 Ga0207678_10001431 3300026067 Bacteria 21886
414 Ga0207678_10005835 3300026067 Bacteria 10976
415 Ga0207678_10172069 3300026067 Bacteria 1849
416 Ga0207678_10230579 3300026067 Bacteria 1586
417 Ga0207708_10000424 3300026075 Bacteria 33010
418 Ga0207708_10005630 3300026075 Bacteria 9248
419 Ga0207708_10095691 3300026075 Bacteria 2293
420 Ga0207708_10140403 3300026075 Bacteria 1894
421 Ga0207641_10160214 3300026088 Bacteria 2045
422 Ga0207648_10039265 3300026089 Bacteria 4163
423 Ga0207648_10089853 3300026089 Bacteria 2684
424 Ga0207676_10005901 3300026095 Bacteria 8651
425 Ga0207674_10005526 3300026116 Bacteria 15006
426 Ga0207674_10029209 3300026116 Bacteria 5807
427 Ga0207674_10072581 3300026116 Bacteria 3458
428 Ga0207675_100026458 3300026118 Bacteria 5400
429 Ga0207675_100078527 3300026118 Bacteria 3093
430 Ga0207675_100091656 3300026118 Bacteria 2858
431 Ga0207675_100098170 3300026118 Bacteria 2758
432 Ga0207675_100258410 3300026118 Bacteria 1687
433 Ga0207683_10001480 3300026121 Bacteria 21174
434 Ga0207683_10314738 3300026121 Bacteria 1433
435 Ga0207698_10002976 3300026142 Bacteria 10151
436 Ga0209281_1000081 3300027111 Bacteria 258084
437 Ga0209282_1000036 3300027666 Bacteria 130242
438 Ga0209998_10005479 3300027717 Bacteria 2655
439 Ga0209813_10000260 3300027866 Bacteria 15229
440 Ga0207428_10000243 3300027907 Bacteria 74403
441 Ga0207428_10030428 3300027907 Bacteria 4462
442 Ga0268266_10029443 3300028379 Bacteria 4668
443 Ga0268266_10125333 3300028379 Bacteria 2291
444 Ga0268266_10462482 3300028379 Bacteria 1207
445 Ga0268265_10000787 3300028380 Bacteria 30284
446 Ga0268264_10004872 3300028381 Bacteria 11376
447 Ga0265318_10007983 3300028577 Bacteria 4745
448 Ga0307515_10000263 3300028794 Bacteria 130303
449 Ga0307515_10002397 3300028794 Bacteria 40905
450 Ga0307515_10174603 3300028794 Bacteria 2125
451 Ga0265330_10016009 3300031235 Bacteria 3465
452 Ga0265328_10000422 3300031239 Bacteria 19867
453 Ga0265328_10000744 3300031239 Bacteria 15123
454 Ga0265325_10000329 3300031241 Bacteria 33468
455 Ga0265325_10002969 3300031241 Bacteria 11265
456 Ga0265340_10004053 3300031247 Bacteria 8227
457 Ga0265339_10010391 3300031249 Bacteria 5784
458 Ga0265331_10000038 3300031250 Bacteria 196951
459 Ga0265331_10001441 3300031250 Bacteria 17466
460 Ga0265331_10053639 3300031250 Bacteria 1922
461 Ga0265316_10017418 3300031344 Bacteria 6212
462 Ga0265316_10022919 3300031344 Bacteria 5254
463 Ga0265316_10026703 3300031344 Bacteria 4796
464 Ga0265316_10176421 3300031344 Bacteria 1592
465 Ga0307513_10001607 3300031456 Bacteria 32450
466 Ga0307513_10026369 3300031456 Bacteria 6701
467 Ga0265313_10004907 3300031595 Bacteria 10027
468 Ga0265314_10034372 3300031711 Bacteria 3706
469 Ga0265314_10045740 3300031711 Bacteria 3092
470 Ga0265342_10020051 3300031712 Bacteria 4298
471 Ga0265342_10051517 3300031712 Bacteria 2456
472 Ga0316576_10013328 3300031727 Bacteria 5459
473 Ga0307412_10201641 3300031911 Bacteria 1511
474 Ga0315914_1000002 3300031967 Bacteria 365357
475 Ga0307409_100134705 3300031995 Bacteria 2118
476 Ga0307416_100053617 3300032002 Bacteria 3236
477 Ga0316580_10017791 3300032139 Bacteria 2186
478 Ga0316593_10015250 3300032168 Bacteria 2309
479 Ga0315915_1000005 3300033464 Bacteria 397591
480 Ga0373938_0003033 3300034957 Bacteria 2726
481 Ga0373938_0003902 3300034957 Bacteria 2466
482 Ga0373926_0013058 3300035083 Bacteria 2813
483 Ga0373934_0054014 3300035086 Bacteria 1595
484 Ga0373940_0001673 3300035088 Bacteria 4093
485 Ga0373940_0019760 3300035088 Bacteria 1705
486 Ga0373944_0001932 3300035089 Bacteria 5242
487 Ga0373944_0014436 3300035089 Bacteria 2204
488 Ga0373952_0013646 3300035092 Bacteria 1615
489 Ga0373923_0001635 3300035111 Bacteria 6532
490 Ga0373939_0003496 3300035114 Bacteria 3689
491 Ga0373941_0022432 3300035115 Bacteria 1791
492 Ga0373945_0002656 3300035116 Bacteria 5603
493 Ga0373954_0015244 3300035118 Bacteria 3434
494 Ga0373943_0000072 3300035170 Bacteria 35413
495 Ga0373943_0018214 3300035170 Bacteria 3224
496 Ga0373946_0016223 3300035171 Bacteria 2836
497 Ga0373946_0084259 3300035171 Bacteria 1397
498 Ga0373955_0018141 3300035172 Bacteria 3495
499 Ga0373961_0008194 3300035241 Bacteria 2540
500 Ga0373961_0014157 3300035241 Bacteria 2023
501 Ga0316574_0002045 3300035398 Bacteria 9960
502 Ga0373931_0007725 3300035691 Bacteria 5078
503 Ga0373931_0018603 3300035691 Bacteria 3457
504 Ga0373931_0031774 3300035691 Bacteria 2727
505 Ga0373935_0000643 3300035692 Bacteria 18383
506 Ga0373927_0000047 3300035695 Bacteria 87289
507 Ga0373927_0000701 3300035695 Bacteria 25652
508 Ga0373927_0002001 3300035695 Bacteria 15025
509 Ga0373927_0009793 3300035695 Bacteria 6428
510 Ga0373927_0024175 3300035695 Bacteria 3974
511 Ga0373933_0011775 3300035724 Bacteria 4830
512 Ga0373947_0000410 3300035725 Bacteria 24327
513 Ga0373947_0009651 3300035725 Bacteria 5541
514 Ga0373947_0038457 3300035725 Bacteria 2843
515 Ga0373947_0046316 3300035725 Bacteria 2604
516 Ga0373937_0009090 3300036401 Bacteria 8622
517 Ga0373937_0297060 3300036401 Bacteria 1526
518 Ga0316582_0035016 3300036647 Bacteria 3096
519 Ga0316582_0078505 3300036647 Bacteria 2151
520 Ga0316584_0007758 3300036712 Bacteria 7360
521 Ga0316584_0012904 3300036712 Bacteria 5900
522 Ga0373925_0002644 3300037068 Bacteria 14219
523 Ga0373925_0006393 3300037068 Bacteria 8674
524 Ga0373925_0009566 3300037068 Bacteria 7061
525 Ga0373925_0012893 3300037068 Bacteria 6055
526 Ga0373925_0073761 3300037068 Bacteria 2583
527 Ga0373925_0085398 3300037068 Bacteria 2406
528 Ga0373925_0243615 3300037068 Bacteria 1440
529 Ga0395899_0115466 3300037312 Bacteria 1927
530 Ga0395900_0028460 3300037418 Bacteria 5724
531 Ga0395898_0028293 3300037466 Bacteria 5619
532 Ga0395898_0126795 3300037466 Bacteria 2445
533 Ga0395905_0003051 3300037471 Bacteria 18140
534 Ga0395905_0006639 3300037471 Bacteria 11601
535 Ga0395905_0056428 3300037471 Bacteria 3674
536 Ga0395905_0222975 3300037471 Bacteria 1764
537 Ga0436364_0046367 3300037853 Bacteria 3509
538 Ga0436364_1092228 3300037853 Bacteria 3388
539 Ga0400489_68725 3300039093 Bacteria 2322
540 Ga0436365_0323217 3300039437 Bacteria 33413
541 Ga0436365_1477108 3300039437 Bacteria 6537
542 Ga0436365_1602908 3300039437 Bacteria 36718
543 Ga0436360_0849847 3300039438 Bacteria 5383
544 Ga0436361_0438619 3300039447 Bacteria 4351
545 Ga0436361_0485827 3300039447 Bacteria 1702
546 Ga0436361_0767272 3300039447 Bacteria 33690
547 Ga0436363_0461300 3300039450 Bacteria 15419
548 Ga0436363_0693641 3300039450 Bacteria 10508
549 Ga0436363_1352461 3300039450 Bacteria 4464
550 Ga0436362_0228906 3300039453 Bacteria 10261
551 Ga0439465_0000653 3300041413 Bacteria 10596
552 Ga0439465_0018348 3300041413 Bacteria 2186
553 Ga0451837_1572201 3300041494 Bacteria 2541
554 Ga0451841_1185357 3300041498 Bacteria 3815
555 Ga0451845_0694601 3300041501 Bacteria 1860
556 Ga0451847_0959938 3300041503 Bacteria 1830
557 Ga0451851_0367807 3300041507 Bacteria 1835
558 Ga0439448_0014036 3300042005 Bacteria 2414
559 Ga0439449_0029037 3300042007 Bacteria 2061
560 Ga0466966_0081721 3300044684 Bacteria 2011
561 Ga0466970_0005373 3300044765 Bacteria 6354
562 Ga0466958_0006903 3300045836 Bacteria 6209
563 Ga0466958_0068069 3300045836 Bacteria 2176
564 Ga0495592_0007326 3300046454 Bacteria 8253
565 Ga0495603_0000028 3300046455 Bacteria 61042
566 Ga0495603_0015561 3300046455 Bacteria 4603
567 Ga0495629_0000102 3300046459 Bacteria 75235
568 Ga0495629_0006971 3300046459 Bacteria 8333
569 Ga0495629_0073461 3300046459 Bacteria 2388
570 Ga0495629_0150303 3300046459 Bacteria 1619
571 Ga0495629_0248076 3300046459 Bacteria 1225
572 Ga0495638_0021031 3300046460 Bacteria 4304
573 Ga0495641_0006124 3300046461 Bacteria 7883
574 Ga0495651_0023338 3300046462 Bacteria 4810
575 Ga0495653_0014996 3300046463 Bacteria 6320
576 Ga0495580_0012694 3300046472 Bacteria 6458
577 Ga0495580_0043578 3300046472 Bacteria 3193
578 Ga0495582_0001962 3300046473 Bacteria 11548
579 Ga0495582_0020327 3300046473 Bacteria 3633
580 Ga0495582_0037204 3300046473 Bacteria 2677
581 Ga0495639_0010090 3300046475 Bacteria 4060
582 Ga0495639_0043402 3300046475 Bacteria 2031
583 Ga0495662_0019662 3300046476 Bacteria 3267
584 Ga0495664_0000901 3300046477 Bacteria 15252
585 Ga0495664_0004771 3300046477 Bacteria 7417
586 Ga0495664_0089837 3300046477 Bacteria 1847
587 Ga0495584_0030161 3300046491 Bacteria 2748
588 Ga0495584_0032726 3300046491 Bacteria 2631
589 Ga0495585_0002116 3300046492 Bacteria 14511
590 Ga0495585_0069453 3300046492 Bacteria 1923
591 Ga0495594_0000227 3300046499 Bacteria 27180
592 Ga0495607_0024450 3300046501 Bacteria 3766
593 Ga0495583_0015009 3300046506 Bacteria 4238
594 Ga0495583_0058568 3300046506 Bacteria 1729
595 Ga0495583_0063670 3300046506 Bacteria 1638
596 Ga0495606_0003402 3300046507 Bacteria 16897
597 Ga0495608_0226102 3300046511 Bacteria 1172
598 Ga0495618_0000287 3300046514 Bacteria 36354
599 Ga0495630_0021339 3300046517 Bacteria 4782
600 Ga0495632_0040659 3300046519 Bacteria 2340
601 Ga0495643_0008740 3300046522 Bacteria 6385
602 Ga0495643_0017019 3300046522 Bacteria 4260
603 Ga0495644_0010699 3300046523 Bacteria 3534
604 Ga0495663_0008914 3300046525 Bacteria 2781
605 Ga0495666_0019308 3300046526 Bacteria 3384
606 Ga0495652_0062228 3300046529 Bacteria 3147
607 Ga0495654_0010022 3300046530 Bacteria 5176
608 Ga0495665_0038089 3300046531 Bacteria 2564
609 Ga0495640_0002682 3300046533 Bacteria 14305
610 Ga0495640_0043955 3300046533 Bacteria 3108
611 Ga0495640_0108934 3300046533 Bacteria 1812
612 Ga0495640_0194562 3300046533 Bacteria 1288
613 Ga0495586_0015886 3300046535 Bacteria 4005
614 Ga0495598_0014879 3300046537 Bacteria 1952
615 Ga0495609_0017793 3300046538 Bacteria 3298
616 Ga0495645_0002472 3300046543 Bacteria 12553
617 Ga0495645_0015673 3300046543 Bacteria 5393
618 Ga0495622_0000895 3300046557 Bacteria 16229
619 Ga0495633_0028700 3300046558 Bacteria 2709
620 Ga0495667_0030221 3300046559 Bacteria 3642
621 Ga0495656_0002538 3300046615 Bacteria 6083
622 Ga0495668_0009867 3300046616 Bacteria 5824
623 Ga0495634_0023428 3300046642 Bacteria 4340
624 Ga0495634_0048787 3300046642 Bacteria 2849
625 Ga0495611_0008117 3300046648 Bacteria 4453
626 Ga0495625_0003234 3300046660 Bacteria 16490
627 Ga0495625_0087585 3300046660 Bacteria 2158
628 Ga0495635_0125003 3300046663 Bacteria 1754
629 Ga0495659_0001627 3300046664 Bacteria 7542
630 Ga0495588_0003666 3300046674 Bacteria 6721
631 Ga0495588_0004914 3300046674 Bacteria 5929
632 Ga0495588_0074379 3300046674 Bacteria 1769
633 Ga0495599_0019040 3300046678 Bacteria 4280
634 Ga0495646_0003085 3300046680 Bacteria 10335
635 Ga0495647_0005435 3300046681 Bacteria 4173
636 Ga0495647_0005579 3300046681 Bacteria 4131
637 Ga0495658_0000986 3300046683 Bacteria 15097
638 Ga0495613_0001425 3300046689 Bacteria 18237
639 Ga0495613_0004448 3300046689 Bacteria 10502
640 Ga0495613_0035006 3300046689 Bacteria 3728
641 Ga0495624_0010460 3300046690 Bacteria 6396
642 Ga0495670_0004365 3300046691 Bacteria 6935
643 Ga0495670_0006459 3300046691 Bacteria 5759
644 Ga0495649_0123799 3300046694 Bacteria 1366
645 Ga0495600_0006862 3300046809 Bacteria 6943
646 Ga0495600_0022575 3300046809 Bacteria 4041
647 Ga0495660_0055669 3300046810 Bacteria 2140
648 Ga0495660_0056700 3300046810 Bacteria 2116
649 Ga0495581_0015667 3300047315 Bacteria 4399
650 Ga0495672_0040829 3300047320 Bacteria 2811
651 Ga0495676_0010391 3300047321 Bacteria 8446
652 Ga0495676_0199183 3300047321 Bacteria 1392
653 Ga0495680_0099771 3300047322 Bacteria 2164
654 Ga0495680_0115820 3300047322 Bacteria 1983
655 Ga0495679_009250 3300047446 Bacteria 3955
656 Ga0495684_0003534 3300047471 Bacteria 12230
657 Ga0495684_0070180 3300047471 Bacteria 2663
658 Ga0495684_0213497 3300047471 Bacteria 1418
659 Ga0495686_0000170 3300047472 Bacteria 123336
660 Ga0495686_0001666 3300047472 Bacteria 23112
661 Ga0495686_0007561 3300047472 Bacteria 8126
662 Ga0495686_0034885 3300047472 Bacteria 3236
663 Ga0495593_0000799 3300047673 Bacteria 18227
664 Ga0495593_0013448 3300047673 Bacteria 4668
665 Ga0495614_0013307 3300048089 Bacteria 3609
666 Ga0496100_0006159 3300048903 Bacteria 6524
667 Ga0496100_0008467 3300048903 Bacteria 5736
668 Ga0496101_0000994 3300048904 Bacteria 16776
669 Ga0496101_0191878 3300048904 Bacteria 1577
670 Ga0496102_0013750 3300048905 Bacteria 7019
671 Ga0496102_0017034 3300048905 Bacteria 6359
672 Ga0496102_0031543 3300048905 Bacteria 4755
673 Ga0496102_0054032 3300048905 Bacteria 3661
674 Ga0496102_0076973 3300048905 Bacteria 3070
675 Ga0496102_0159154 3300048905 Bacteria 2124
676 Ga0496103_0012644 3300048906 Bacteria 5007
677 Ga0496104_0007307 3300048907 Bacteria 9749
678 Ga0496104_0017841 3300048907 Bacteria 6470
679 Ga0496104_0058147 3300048907 Bacteria 3659
680 Ga0496104_0160549 3300048907 Bacteria 2156
681 Ga0496104_0212516 3300048907 Bacteria 1846
682 Ga0496105_0003294 3300048908 Bacteria 11922
683 Ga0496105_0004161 3300048908 Bacteria 10858
684 Ga0496105_0025634 3300048908 Bacteria 4802
685 Ga0496105_0109520 3300048908 Bacteria 2280
686 Ga0496105_0219058 3300048908 Bacteria 1550
687 Ga0496106_0000415 3300048909 Bacteria 30247
688 Ga0496106_0001184 3300048909 Bacteria 19446
689 Ga0496106_0002538 3300048909 Bacteria 13578
690 Ga0496106_0007118 3300048909 Bacteria 8265
691 Ga0496106_0084852 3300048909 Bacteria 2437
692 Ga0496106_0100861 3300048909 Bacteria 2239
693 Ga0496106_0199420 3300048909 Bacteria 1593
694 Ga0496107_0005509 3300048910 Bacteria 8662
695 Ga0496107_0021107 3300048910 Bacteria 4602
696 Ga0496108_0027714 3300048911 Bacteria 4682
697 Ga0496108_0042711 3300048911 Bacteria 3785
698 Ga0496108_0056252 3300048911 Bacteria 3304
699 Ga0496109_0028295 3300048912 Bacteria 5011
700 Ga0496109_0036719 3300048912 Bacteria 4424
701 Ga0496109_0042699 3300048912 Bacteria 4109
702 Ga0496109_0083354 3300048912 Bacteria 2948
703 Ga0496109_0105695 3300048912 Bacteria 2615
704 Ga0496110_0005190 3300048913 Bacteria 10190
705 Ga0496110_0102303 3300048913 Bacteria 2569
706 Ga0496110_0243334 3300048913 Bacteria 1637
707 Ga0496111_0000974 3300048914 Bacteria 15651
708 Ga0496111_0040687 3300048914 Bacteria 3334
709 Ga0496111_0067954 3300048914 Bacteria 2589
710 Ga0496112_0010710 3300048915 Bacteria 8335
711 Ga0496112_0062683 3300048915 Bacteria 3668
712 Ga0496112_0268083 3300048915 Bacteria 1656
713 Ga0496113_0007623 3300048916 Bacteria 6982
714 Ga0496113_0014864 3300048916 Bacteria 5327
715 Ga0496113_0075119 3300048916 Bacteria 2579
716 Ga0496113_0104748 3300048916 Bacteria 2195
717 Ga0496113_0115836 3300048916 Bacteria 2091
718 Ga0496114_0006817 3300048917 Bacteria 8996
719 Ga0496114_0016605 3300048917 Bacteria 5935
720 Ga0496115_0002429 3300048918 Bacteria 13374
721 Ga0496115_0006517 3300048918 Bacteria 8558
722 Ga0496115_0022912 3300048918 Bacteria 4844
723 Ga0496115_0035794 3300048918 Bacteria 3930
724 Ga0496116_0018295 3300048919 Bacteria 5407
725 Ga0496117_0001980 3300048920 Bacteria 27225
726 Ga0496117_0079910 3300048920 Bacteria 2152
727 Ga0496117_0088002 3300048920 Bacteria 2011
728 Ga0496118_0002011 3300048921 Bacteria 28790
729 Ga0496118_0007747 3300048921 Bacteria 11276
730 Ga0496118_0055152 3300048921 Bacteria 3002
731 Ga0496119_0008324 3300048922 Bacteria 9141
732 Ga0496119_0013421 3300048922 Bacteria 6527
733 Ga0496120_0037158 3300048923 Bacteria 2892
734 Ga0496120_0064507 3300048923 Bacteria 2032
735 Ga0496121_0000003 3300048924 Bacteria 1191431
736 Ga0496121_0002604 3300048924 Bacteria 27252
737 Ga0496121_0034233 3300048924 Bacteria 4575
738 Ga0496122_0036587 3300048925 Bacteria 3965
739 Ga0496122_0099541 3300048925 Bacteria 1948
740 Ga0496123_0007564 3300048926 Bacteria 10184
741 Ga0496123_0011402 3300048926 Bacteria 7707
742 Ga0496123_0054107 3300048926 Bacteria 2645
743 Ga0496123_0085424 3300048926 Bacteria 1898
744 Ga0496124_0029558 3300048927 Bacteria 4880
745 Ga0496124_0097388 3300048927 Bacteria 2388
746 Ga0496124_0181864 3300048927 Bacteria 1617
747 Ga0496124_0209418 3300048927 Bacteria 1476
748 Ga0496125_0000345 3300048928 Bacteria 88357
749 Ga0496126_0063976 3300048929 Bacteria 3295
750 Ga0496126_0098962 3300048929 Bacteria 2555
751 Ga0496126_0113574 3300048929 Bacteria 2357
752 Ga0501031_0056435 3300049568 Bacteria 2558
753 Ga0501031_0068652 3300049568 Bacteria 2309
754 Ga0501032_0078550 3300049569 Bacteria 2197
755 Ga0501033_0074376 3300049570 Bacteria 2494
756 Ga0501033_0198617 3300049570 Bacteria 1433
757 Ga0501033_0248350 3300049570 Bacteria 1262
758 Ga0501034_0046048 3300049571 Bacteria 4407
759 Ga0501036_0022959 3300049572 Bacteria 5252
760 Ga0501037_0020197 3300049573 Bacteria 4920
761 Ga0501037_0066811 3300049573 Bacteria 2619
762 Ga0501038_0046815 3300049574 Bacteria 3749
763 Ga0501038_0129396 3300049574 Bacteria 2074
764 Ga0501039_0024956 3300049575 Bacteria 4592
765 Ga0501040_0027436 3300049576 Bacteria 3834
766 Ga0501040_0027664 3300049576 Bacteria 3819
767 Ga0501040_0140853 3300049576 Bacteria 1699
768 Ga0501040_0144591 3300049576 Bacteria 1676
769 Ga0501041_0084329 3300049577 Bacteria 1958
770 Ga0501041_0109868 3300049577 Bacteria 1710
771 Ga0501042_0014861 3300049578 Bacteria 5319
772 Ga0501042_0036726 3300049578 Bacteria 3476
773 Ga0501042_0047685 3300049578 Bacteria 3055
774 Ga0501042_0115695 3300049578 Bacteria 1931
775 Ga0501042_0174390 3300049578 Bacteria 1551
776 Ga0501043_0060715 3300049579 Bacteria 2968
777 Ga0501043_0091664 3300049579 Bacteria 2389
778 Ga0501046_0000011 3300049580 Bacteria 326457
779 Ga0501046_0017428 3300049580 Bacteria 5995
780 Ga0501047_0003112 3300049581 Bacteria 15739
781 Ga0501047_0008525 3300049581 Bacteria 9670
782 Ga0501047_0066723 3300049581 Bacteria 3469
783 Ga0501047_0205144 3300049581 Bacteria 1831
784 Ga0501047_0228588 3300049581 Bacteria 1715
785 Ga0501048_0048180 3300049582 Bacteria 3040
786 Ga0501048_0076781 3300049582 Bacteria 2357
787 Ga0501067_0028443 3300049583 Bacteria 3097
788 Ga0501070_0073856 3300049586 Bacteria 2822
789 Ga0501071_0019517 3300049587 Bacteria 4704
790 Ga0501072_0008899 3300049588 Bacteria 7630
791 Ga0501072_0009194 3300049588 Bacteria 7507
792 Ga0501072_0096875 3300049588 Bacteria 2344
793 Ga0501072_0110117 3300049588 Bacteria 2192
794 Ga0501073_0022029 3300049589 Bacteria 4591
795 Ga0501073_0056594 3300049589 Bacteria 2743
796 Ga0501073_0070584 3300049589 Bacteria 2433
797 Ga0501074_0162271 3300049590 Bacteria 1596
798 Ga0501075_0005390 3300049591 Bacteria 8749
799 Ga0501075_0015874 3300049591 Bacteria 5415
800 Ga0501075_0097011 3300049591 Bacteria 2237
801 Ga0501076_0035201 3300049592 Bacteria 3918
802 Ga0501076_0053841 3300049592 Bacteria 3189
803 Ga0501077_0001899 3300049593 Bacteria 12650
804 Ga0501077_0008697 3300049593 Bacteria 6296
805 Ga0501077_0036555 3300049593 Bacteria 3129
806 Ga0501077_0041003 3300049593 Bacteria 2948
807 Ga0501077_0041982 3300049593 Bacteria 2911
808 Ga0501077_0056108 3300049593 Bacteria 2500
809 Ga0501077_0184410 3300049593 Bacteria 1326
810 Ga0501079_0095152 3300049741 Bacteria 2308
811 Ga0501079_0096444 3300049741 Bacteria 2292
812 Ga0501080_0155653 3300049742 Bacteria 2111
813 Ga0501080_0180660 3300049742 Bacteria 1942
814 Ga0501081_0012642 3300049743 Bacteria 5549
815 Ga0501081_0031811 3300049743 Bacteria 3576
816 Ga0501081_0048299 3300049743 Bacteria 2929
817 Ga0501081_0129408 3300049743 Bacteria 1803
818 Ga0501083_0028095 3300049744 Bacteria 3879
819 Ga0501035_0147201 3300049822 Bacteria 2045
820 Ga0501035_0148693 3300049822 Bacteria 2033
821 Ga0501035_0232442 3300049822 Bacteria 1571
822 Ga0501044_0001188 3300049823 Bacteria 30861
823 Ga0501044_0038076 3300049823 Bacteria 5022
824 Ga0501044_0329846 3300049823 Bacteria 1449
825 Ga0501045_0009672 3300049824 Bacteria 6746
826 Ga0501045_0010352 3300049824 Bacteria 6532
827 nmdc:mga03683_15677_c1 3300050489 Bacteria 2832
828 nmdc:mga03n38_51117_c1 3300050490 Bacteria 1844
829 nmdc:mga00v17_19288_c1 3300050491 Bacteria 3892
830 nmdc:mga00v17_41033_c1 3300050491 Bacteria 2778
831 nmdc:mga00v17_58022_c1 3300050491 Bacteria 2370
832 nmdc:mga0yw44_12432_c1 3300050492 Bacteria 4437
833 nmdc:mga0yw44_2069_c2 3300050492 Bacteria 1355
834 nmdc:mga0k408_44547_c1 3300050493 Bacteria 2559
835 nmdc:mga06z11_118719_c1 3300050494 Bacteria 1473
836 nmdc:mga06z11_130_c1 3300050494 Bacteria 30483
837 nmdc:mga06z11_15567_c1 3300050494 Bacteria 3398
838 nmdc:mga06z11_4963_c1 3300050494 Bacteria 5283
839 nmdc:mga06z11_9654_c1 3300050494 Bacteria 4075
840 nmdc:mga04h51_786_c1 3300050495 Bacteria 7361
841 nmdc:mga05p37_117308_c1 3300050507 Bacteria 3271
842 nmdc:mga05p37_202603_c1 3300050507 Bacteria 2402
843 nmdc:mga05p37_250_c2 3300050507 Bacteria 22896
844 nmdc:mga05p37_490821_c1 3300050507 Bacteria 1412
845 nmdc:mga09592_28457_c1 3300050508 Bacteria 4643
846 nmdc:mga0qj67_13293_c1 3300050509 Bacteria 6212
847 nmdc:mga0qj67_171_c1 3300050509 Bacteria 43599
848 nmdc:mga0qj67_2972_c1 3300050509 Bacteria 12163
849 nmdc:mga0qj67_33816_c1 3300050509 Bacteria 3991
850 nmdc:mga0qj67_71549_c1 3300050509 Bacteria 2768
851 nmdc:mga06r32_13648_c1 3300050510 Bacteria 7367
852 nmdc:mga06r32_249580_c1 3300050510 Bacteria 1762
853 nmdc:mga06r32_82290_c1 3300050510 Bacteria 3136
854 nmdc:mga08y16_16756_c1 3300050511 Bacteria 7712
855 nmdc:mga08y16_23182_c1 3300050511 Bacteria 6552
856 nmdc:mga08y16_337916_c1 3300050511 Bacteria 1548
857 nmdc:mga08y16_7578_c1 3300050511 Bacteria 11365
858 nmdc:mga0n895_11081_c1 3300050512 Bacteria 8021
859 nmdc:mga0n895_160222_c1 3300050512 Bacteria 2282
860 nmdc:mga0n895_174544_c1 3300050512 Bacteria 2180
861 nmdc:mga0n895_346617_c1 3300050512 Bacteria 1504
862 nmdc:mga0n895_580_c1 3300050512 Bacteria 25141
863 nmdc:mga0rr50_1710_c1 3300050513 Bacteria 12110
864 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
865 nmdc:mga0a205_31320_c1 3300050515 Bacteria 5096
866 nmdc:mga0a205_713_c1 3300050515 Bacteria 26710
867 Ga0495601_0001782 3300053077 Bacteria 11945
868 Ga0495601_0004932 3300053077 Bacteria 7740
869 Ga0495601_0008269 3300053077 Bacteria 6141
870 Ga0495612_0000095 3300053078 Bacteria 38147
871 Ga0495595_0003847 3300053084 Bacteria 5985
872 Ga0495595_0132687 3300053084 Bacteria 1218
873 Ga0495619_0000415 3300053085 Bacteria 28936
874 Ga0495619_0001134 3300053085 Bacteria 17501
875 Ga0495619_0022317 3300053085 Bacteria 4049
876 Ga0495619_0036465 3300053085 Bacteria 3203
877 Ga0495619_0079690 3300053085 Bacteria 2203
878 Ga0500562_010861 3300053108 Bacteria 2310
879 Ga0500618_011556 3300053125 Bacteria 2338
880 Ga0500652_000019 3300053131 Bacteria 120149
881 Ga0500658_0007610 3300053134 Bacteria 4001
882 Ga0500568_0004679 3300053139 Bacteria 7273
883 Ga0500590_043534 3300053148 Bacteria 2302
884 Ga0500616_0000709 3300053153 Bacteria 38615
885 Ga0500616_0004710 3300053153 Bacteria 9604
886 Ga0500616_0005255 3300053153 Bacteria 8851
887 Ga0500622_0001347 3300053156 Bacteria 19875
888 Ga0500634_0033297 3300053161 Bacteria 2809
889 Ga0500636_0077752 3300053177 Bacteria 1916
890 Ga0501084_0020557 3300054114 Bacteria 5505
891 Ga0501084_0061685 3300054114 Bacteria 3139
892 Ga0501084_0283364 3300054114 Bacteria 1399
893 Ga0501082_0031116 3300060353 Bacteria 4600
894 Ga0501082_0091378 3300060353 Bacteria 2628
895 Ga0501082_0237340 3300060353 Bacteria 1587
896 Ga0530510_0005930 3300061734 Bacteria 8471
897 Ga0530510_0020392 3300061734 Bacteria 4712
898 Ga0530510_0062824 3300061734 Bacteria 2688
899 Ga0530510_0099136 3300061734 Bacteria 2130
900 Ga0530510_0147245 3300061734 Bacteria 1737

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2835312727 2835319379 370
2 3300009093 Ga0105240_10002229 Ga0105240_1000222928 372
3 3300009545 Ga0105237_10031663 Ga0105237_100316632 372
4 3300025903 Ga0207680_10099149 Ga0207680_100991491 372
5 3300025913 Ga0207695_10018154 Ga0207695_100181548 372
6 3300039438 Ga0436360_0849847 Ga0436360_0849847_1047_2282 372
7 3300049573 Ga0501037_0020197 Ga0501037_0020197_2050_3201 372
8 3300049581 Ga0501047_0008525 Ga0501047_0008525_6473_7624 372
9 3300049823 Ga0501044_0001188 Ga0501044_0001188_14106_15257 372
10 iso_pu_bacteria 2510917026 2511170098 372
11 iso_pu_bacteria 2842694124 2842696072 372
12 iso_pu_bacteria 2842698319 2842702208 372
13 3300005336 Ga0070680_100002445 Ga0070680_1000024459 373
14 3300005406 Ga0070703_10000417 Ga0070703_100004174 373
15 3300005438 Ga0070701_10010600 Ga0070701_100106003 373
16 3300005440 Ga0070705_100000230 Ga0070705_1000002309 373
17 3300005441 Ga0070700_100010745 Ga0070700_1000107452 373
18 3300005445 Ga0070708_100010142 Ga0070708_1000101428 373
19 3300005455 Ga0070663_100023100 Ga0070663_1000231003 373
20 3300005467 Ga0070706_100093390 Ga0070706_1000933901 373
21 3300005518 Ga0070699_100000750 Ga0070699_1000007509 373
22 3300005530 Ga0070679_100488095 Ga0070679_1004880951 373
23 3300005536 Ga0070697_100022188 Ga0070697_1000221882 373
24 3300005545 Ga0070695_100000466 Ga0070695_1000004669 373
25 3300005546 Ga0070696_100000987 Ga0070696_10000098711 373
26 3300005548 Ga0070665_100145554 Ga0070665_1001455543 373
27 3300005549 Ga0070704_100005358 Ga0070704_1000053583 373
28 3300005563 Ga0068855_100061883 Ga0068855_1000618833 373
29 3300005577 Ga0068857_100067241 Ga0068857_1000672412 373
30 3300005577 Ga0068857_100085613 Ga0068857_1000856133 373
31 3300005842 Ga0068858_100089328 Ga0068858_1000893283 373
32 3300005843 Ga0068860_100070214 Ga0068860_1000702143 373
33 3300009176 Ga0105242_10015301 Ga0105242_100153012 373
34 3300025885 Ga0207653_10000614 Ga0207653_100006143 373
35 3300025917 Ga0207660_10001814 Ga0207660_100018143 373
36 3300025949 Ga0207667_10124250 Ga0207667_101242502 373
37 3300026035 Ga0207703_10022849 Ga0207703_100228493 373
38 3300026067 Ga0207678_10005835 Ga0207678_100058357 373
39 3300026075 Ga0207708_10000424 Ga0207708_100004249 373
40 3300026095 Ga0207676_10005901 Ga0207676_100059016 373
41 3300026116 Ga0207674_10029209 Ga0207674_100292094 373
42 3300026116 Ga0207674_10072581 Ga0207674_100725813 373
43 3300026118 Ga0207675_100078527 Ga0207675_1000785273 373
44 3300028379 Ga0268266_10125333 Ga0268266_101253332 373
45 3300028380 Ga0268265_10000787 Ga0268265_100007879 373
46 3300028381 Ga0268264_10004872 Ga0268264_100048723 373
47 3300031995 Ga0307409_100134705 Ga0307409_1001347052 373
48 3300032139 Ga0316580_10017791 Ga0316580_100177912 373
49 3300032168 Ga0316593_10015250 Ga0316593_100152503 373
50 3300035088 Ga0373940_0019760 Ga0373940_0019760_163_1296 373
51 3300036647 Ga0316582_0035016 Ga0316582_0035016_621_1763 373
52 3300037471 Ga0395905_0056428 Ga0395905_0056428_787_1920 373
53 3300039447 Ga0436361_0438619 Ga0436361_0438619_2655_3791 373
54 3300042005 Ga0439448_0014036 Ga0439448_0014036_616_1746 373
55 3300048905 Ga0496102_0017034 Ga0496102_0017034_3235_4368 373
56 3300048909 Ga0496106_0000415 Ga0496106_0000415_15855_16988 373
57 3300048909 Ga0496106_0199420 Ga0496106_0199420_233_1363 373
58 3300048910 Ga0496107_0021107 Ga0496107_0021107_1722_2855 373
59 3300048913 Ga0496110_0243334 Ga0496110_0243334_64_1197 373
60 3300048918 Ga0496115_0022912 Ga0496115_0022912_360_1493 373
61 3300048927 Ga0496124_0181864 Ga0496124_0181864_182_1315 373
62 3300049570 Ga0501033_0248350 Ga0501033_0248350_28_1248 373
63 3300049573 Ga0501037_0066811 Ga0501037_0066811_45_1175 373
64 3300049576 Ga0501040_0027664 Ga0501040_0027664_1860_3080 373
65 3300049578 Ga0501042_0047685 Ga0501042_0047685_740_1960 373
66 3300049578 Ga0501042_0115695 Ga0501042_0115695_244_1377 373
67 3300049579 Ga0501043_0091664 Ga0501043_0091664_310_1440 373
68 3300049581 Ga0501047_0003112 Ga0501047_0003112_11521_12654 373
69 3300049581 Ga0501047_0205144 Ga0501047_0205144_76_1206 373
70 3300049581 Ga0501047_0228588 Ga0501047_0228588_181_1365 373
71 3300049588 Ga0501072_0096875 Ga0501072_0096875_897_2117 373
72 3300049589 Ga0501073_0022029 Ga0501073_0022029_2600_3730 373
73 3300049590 Ga0501074_0162271 Ga0501074_0162271_20_1153 373
74 3300049593 Ga0501077_0041003 Ga0501077_0041003_1707_2840 373
75 3300049741 Ga0501079_0096444 Ga0501079_0096444_108_1241 373
76 3300049742 Ga0501080_0155653 Ga0501080_0155653_186_1319 373
77 3300049743 Ga0501081_0048299 Ga0501081_0048299_860_1993 373
78 3300054114 Ga0501084_0020557 Ga0501084_0020557_1505_2638 373
79 3300060353 Ga0501082_0031116 Ga0501082_0031116_1726_2859 373
80 3300060353 Ga0501082_0091378 Ga0501082_0091378_1432_2565 373
81 3300061734 Ga0530510_0020392 Ga0530510_0020392_63_1283 373
82 iso_pu_bacteria 2671180139 2671691824 373
83 iso_pu_bacteria 8054563764 8054566345 373
84 3300005436 Ga0070713_100117450 Ga0070713_1001174503 374
85 3300005456 Ga0070678_100290307 Ga0070678_1002903071 374
86 3300005536 Ga0070697_100000500 Ga0070697_10000050014 374
87 3300005545 Ga0070695_100042149 Ga0070695_1000421493 374
88 3300005937 Ga0081455_10000774 Ga0081455_1000077433 374
89 3300006048 Ga0075363_100010441 Ga0075363_1000104415 374
90 3300006178 Ga0075367_10056890 Ga0075367_100568903 374
91 3300006178 Ga0075367_10154980 Ga0075367_101549802 374
92 3300006186 Ga0075369_10027078 Ga0075369_100270781 374
93 3300006844 Ga0075428_100188527 Ga0075428_1001885272 374
94 3300006846 Ga0075430_100039849 Ga0075430_1000398494 374
95 3300006914 Ga0075436_100003257 Ga0075436_1000032577 374
96 3300007076 Ga0075435_100007445 Ga0075435_1000074455 374
97 3300009094 Ga0111539_10153054 Ga0111539_101530544 374
98 3300009101 Ga0105247_10115198 Ga0105247_101151982 374
99 3300009147 Ga0114129_10157778 Ga0114129_101577783 374
100 3300009147 Ga0114129_10221122 Ga0114129_102211222 374
101 3300009147 Ga0114129_10256366 Ga0114129_102563661 374
102 3300009148 Ga0105243_10039405 Ga0105243_100394052 374
103 3300009176 Ga0105242_10253878 Ga0105242_102538782 374
104 3300009545 Ga0105237_10097844 Ga0105237_100978444 374
105 3300011119 Ga0105246_10184823 Ga0105246_101848232 374
106 3300014325 Ga0163163_10160296 Ga0163163_101602963 374
107 3300025921 Ga0207652_10047442 Ga0207652_100474423 374
108 3300025972 Ga0207668_10046312 Ga0207668_100463123 374
109 3300026067 Ga0207678_10172069 Ga0207678_101720692 374
110 3300026067 Ga0207678_10230579 Ga0207678_102305792 374
111 3300026121 Ga0207683_10314738 Ga0207683_103147381 374
112 3300027907 Ga0207428_10030428 Ga0207428_100304284 374
113 3300028577 Ga0265318_10007983 Ga0265318_100079834 374
114 3300031235 Ga0265330_10016009 Ga0265330_100160093 374
115 3300031239 Ga0265328_10000422 Ga0265328_1000042221 374
116 3300031239 Ga0265328_10000744 Ga0265328_100007444 374
117 3300031241 Ga0265325_10002969 Ga0265325_100029695 374
118 3300031247 Ga0265340_10004053 Ga0265340_100040536 374
119 3300031249 Ga0265339_10010391 Ga0265339_100103913 374
120 3300031250 Ga0265331_10000038 Ga0265331_1000003849 374
121 3300031250 Ga0265331_10053639 Ga0265331_100536393 374
122 3300031344 Ga0265316_10017418 Ga0265316_100174182 374
123 3300031344 Ga0265316_10022919 Ga0265316_100229195 374
124 3300031344 Ga0265316_10176421 Ga0265316_101764211 374
125 3300031595 Ga0265313_10004907 Ga0265313_100049077 374
126 3300031711 Ga0265314_10034372 Ga0265314_100343723 374
127 3300031711 Ga0265314_10045740 Ga0265314_100457403 374
128 3300031712 Ga0265342_10020051 Ga0265342_100200514 374
129 3300031712 Ga0265342_10051517 Ga0265342_100515171 374
130 3300032002 Ga0307416_100053617 Ga0307416_1000536173 374
131 3300037471 Ga0395905_0222975 Ga0395905_0222975_111_1247 374
132 3300039447 Ga0436361_0485827 Ga0436361_0485827_43_1176 374
133 3300039447 Ga0436361_0767272 Ga0436361_0767272_15307_16443 374
134 3300044684 Ga0466966_0081721 Ga0466966_0081721_742_1872 374
135 3300045836 Ga0466958_0006903 Ga0466958_0006903_2161_3291 374
136 3300047472 Ga0495686_0000170 Ga0495686_0000170_118213_119343 374
137 3300048904 Ga0496101_0191878 Ga0496101_0191878_390_1526 374
138 3300048905 Ga0496102_0031543 Ga0496102_0031543_188_1318 374
139 3300048908 Ga0496105_0219058 Ga0496105_0219058_388_1518 374
140 3300048915 Ga0496112_0268083 Ga0496112_0268083_422_1552 374
141 3300049570 Ga0501033_0074376 Ga0501033_0074376_213_1343 374
142 3300049575 Ga0501039_0024956 Ga0501039_0024956_299_1429 374
143 3300049580 Ga0501046_0000011 Ga0501046_0000011_71331_72467 374
144 3300049586 Ga0501070_0073856 Ga0501070_0073856_327_1457 374
145 3300049588 Ga0501072_0008899 Ga0501072_0008899_3801_4931 374
146 3300049593 Ga0501077_0041982 Ga0501077_0041982_322_1452 374
147 3300049593 Ga0501077_0184410 Ga0501077_0184410_85_1221 374
148 3300049822 Ga0501035_0147201 Ga0501035_0147201_182_1321 374
149 3300050489 nmdc:mga03683_15677_c1 nmdc:mga03683_15677_c1_944_2074 374
150 3300050491 nmdc:mga00v17_58022_c1 nmdc:mga00v17_58022_c1_974_2104 374
151 3300050494 nmdc:mga06z11_15567_c1 nmdc:mga06z11_15567_c1_1227_2357 374
152 3300050509 nmdc:mga0qj67_33816_c1 nmdc:mga0qj67_33816_c1_2080_3216 374
153 3300050511 nmdc:mga08y16_23182_c1 nmdc:mga08y16_23182_c1_2567_3703 374
154 3300050511 nmdc:mga08y16_337916_c1 nmdc:mga08y16_337916_c1_290_1426 374
155 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_252559_253692 374
156 3300053077 Ga0495601_0008269 Ga0495601_0008269_4527_5657 374
157 3300053085 Ga0495619_0022317 Ga0495619_0022317_639_1769 374
158 3300053108 Ga0500562_010861 Ga0500562_010861_465_1601 374
159 3300053153 Ga0500616_0004710 Ga0500616_0004710_3610_4746 374
160 3300061734 Ga0530510_0099136 Ga0530510_0099136_283_1419 374
161 3300003659 JGI25404J52841_10000756 JGI25404J52841_100007563 375
162 3300005343 Ga0070687_100091232 Ga0070687_1000912321 375
163 3300005347 Ga0070668_100036586 Ga0070668_1000365863 375
164 3300005434 Ga0070709_10002320 Ga0070709_100023204 375
165 3300005435 Ga0070714_100148275 Ga0070714_1001482753 375
166 3300005435 Ga0070714_100178834 Ga0070714_1001788343 375
167 3300005436 Ga0070713_100104724 Ga0070713_1001047243 375
168 3300005436 Ga0070713_100119588 Ga0070713_1001195882 375
169 3300005439 Ga0070711_100014866 Ga0070711_1000148664 375
170 3300005439 Ga0070711_100230832 Ga0070711_1002308321 375
171 3300005458 Ga0070681_10303612 Ga0070681_103036121 375
172 3300005468 Ga0070707_100255816 Ga0070707_1002558161 375
173 3300005518 Ga0070699_100046972 Ga0070699_1000469723 375
174 3300005530 Ga0070679_100098825 Ga0070679_1000988253 375
175 3300005546 Ga0070696_100094318 Ga0070696_1000943183 375
176 3300005549 Ga0070704_100225481 Ga0070704_1002254812 375
177 3300005840 Ga0068870_10100448 Ga0068870_101004482 375
178 3300005843 Ga0068860_100247839 Ga0068860_1002478392 375
179 3300005983 Ga0081540_1000012 Ga0081540_100001278 375
180 3300005983 Ga0081540_1000054 Ga0081540_10000549 375
181 3300005983 Ga0081540_1001486 Ga0081540_10014866 375
182 3300006028 Ga0070717_10079340 Ga0070717_100793403 375
183 3300006038 Ga0075365_10036417 Ga0075365_100364173 375
184 3300006042 Ga0075368_10025731 Ga0075368_100257314 375
185 3300006042 Ga0075368_10069607 Ga0075368_100696072 375
186 3300006048 Ga0075363_100003983 Ga0075363_1000039834 375
187 3300006058 Ga0075432_10000269 Ga0075432_100002696 375
188 3300006163 Ga0070715_10011710 Ga0070715_100117103 375
189 3300006163 Ga0070715_10014418 Ga0070715_100144182 375
190 3300006173 Ga0070716_100033356 Ga0070716_1000333562 375
191 3300006175 Ga0070712_100001076 Ga0070712_1000010763 375
192 3300006175 Ga0070712_100020042 Ga0070712_1000200425 375
193 3300006178 Ga0075367_10014094 Ga0075367_100140945 375
194 3300006178 Ga0075367_10135685 Ga0075367_101356852 375
195 3300006178 Ga0075367_10193488 Ga0075367_101934882 375
196 3300006186 Ga0075369_10048496 Ga0075369_100484962 375
197 3300006844 Ga0075428_100049763 Ga0075428_1000497633 375
198 3300006844 Ga0075428_100064618 Ga0075428_1000646183 375
199 3300006846 Ga0075430_100000157 Ga0075430_10000015719 375
200 3300006846 Ga0075430_100000649 Ga0075430_10000064925 375
201 3300006847 Ga0075431_100002610 Ga0075431_10000261017 375
202 3300006847 Ga0075431_100158514 Ga0075431_1001585143 375
203 3300006852 Ga0075433_10002200 Ga0075433_100022005 375
204 3300006852 Ga0075433_10023733 Ga0075433_100237333 375
205 3300006871 Ga0075434_100002869 Ga0075434_10000286913 375
206 3300006871 Ga0075434_100006936 Ga0075434_1000069369 375
207 3300006871 Ga0075434_100126118 Ga0075434_1001261183 375
208 3300006880 Ga0075429_100022909 Ga0075429_1000229093 375
209 3300007076 Ga0075435_100005496 Ga0075435_10000549610 375
210 3300007076 Ga0075435_100045808 Ga0075435_1000458082 375
211 3300007076 Ga0075435_100064020 Ga0075435_1000640203 375
212 3300007076 Ga0075435_100174988 Ga0075435_1001749882 375
213 3300009094 Ga0111539_10006105 Ga0111539_1000610513 375
214 3300009094 Ga0111539_10023165 Ga0111539_100231653 375
215 3300009094 Ga0111539_10050865 Ga0111539_100508651 375
216 3300009147 Ga0114129_10004123 Ga0114129_1000412319 375
217 3300009147 Ga0114129_10035514 Ga0114129_100355145 375
218 3300009553 Ga0105249_10002348 Ga0105249_1000234813 375
219 3300014969 Ga0157376_10120675 Ga0157376_101206753 375
220 3300025899 Ga0207642_10057946 Ga0207642_100579462 375
221 3300025912 Ga0207707_10247143 Ga0207707_102471432 375
222 3300025915 Ga0207693_10001214 Ga0207693_100012143 375
223 3300025915 Ga0207693_10001843 Ga0207693_100018434 375
224 3300025915 Ga0207693_10010142 Ga0207693_100101423 375
225 3300025915 Ga0207693_10036247 Ga0207693_100362474 375
226 3300025916 Ga0207663_10048067 Ga0207663_100480671 375
227 3300025921 Ga0207652_10077839 Ga0207652_100778392 375
228 3300025921 Ga0207652_10250551 Ga0207652_102505512 375
229 3300025939 Ga0207665_10000206 Ga0207665_100002063 375
230 3300026118 Ga0207675_100026458 Ga0207675_1000264585 375
231 3300027866 Ga0209813_10000260 Ga0209813_100002607 375
232 3300027907 Ga0207428_10000243 Ga0207428_1000024321 375
233 3300028379 Ga0268266_10462482 Ga0268266_104624821 375
234 3300031241 Ga0265325_10000329 Ga0265325_100003293 375
235 3300034957 Ga0373938_0003033 Ga0373938_0003033_546_1685 375
236 3300034957 Ga0373938_0003902 Ga0373938_0003902_638_1777 375
237 3300035083 Ga0373926_0013058 Ga0373926_0013058_1099_2229 375
238 3300035086 Ga0373934_0054014 Ga0373934_0054014_207_1340 375
239 3300035088 Ga0373940_0001673 Ga0373940_0001673_886_2025 375
240 3300035089 Ga0373944_0001932 Ga0373944_0001932_3457_4587 375
241 3300035089 Ga0373944_0014436 Ga0373944_0014436_125_1258 375
242 3300035092 Ga0373952_0013646 Ga0373952_0013646_237_1376 375
243 3300035111 Ga0373923_0001635 Ga0373923_0001635_3619_4749 375
244 3300035114 Ga0373939_0003496 Ga0373939_0003496_327_1466 375
245 3300035115 Ga0373941_0022432 Ga0373941_0022432_424_1563 375
246 3300035116 Ga0373945_0002656 Ga0373945_0002656_3985_5115 375
247 3300035118 Ga0373954_0015244 Ga0373954_0015244_146_1276 375
248 3300035170 Ga0373943_0000072 Ga0373943_0000072_29582_30715 375
249 3300035170 Ga0373943_0018214 Ga0373943_0018214_1812_2942 375
250 3300035171 Ga0373946_0084259 Ga0373946_0084259_17_1147 375
251 3300035172 Ga0373955_0018141 Ga0373955_0018141_2340_3470 375
252 3300035241 Ga0373961_0008194 Ga0373961_0008194_782_1921 375
253 3300035398 Ga0316574_0002045 Ga0316574_0002045_4836_5969 375
254 3300035691 Ga0373931_0007725 Ga0373931_0007725_2676_3815 375
255 3300035691 Ga0373931_0018603 Ga0373931_0018603_1947_3086 375
256 3300035692 Ga0373935_0000643 Ga0373935_0000643_458_1588 375
257 3300035695 Ga0373927_0002001 Ga0373927_0002001_2332_3462 375
258 3300035695 Ga0373927_0024175 Ga0373927_0024175_2325_3458 375
259 3300035724 Ga0373933_0011775 Ga0373933_0011775_3640_4770 375
260 3300035725 Ga0373947_0000410 Ga0373947_0000410_13432_14562 375
261 3300035725 Ga0373947_0009651 Ga0373947_0009651_764_1897 375
262 3300035725 Ga0373947_0038457 Ga0373947_0038457_590_1723 375
263 3300036401 Ga0373937_0009090 Ga0373937_0009090_4142_5272 375
264 3300036647 Ga0316582_0078505 Ga0316582_0078505_599_1732 375
265 3300036712 Ga0316584_0007758 Ga0316584_0007758_3843_4976 375
266 3300037068 Ga0373925_0002644 Ga0373925_0002644_8038_9168 375
267 3300037068 Ga0373925_0012893 Ga0373925_0012893_2578_3711 375
268 3300037068 Ga0373925_0085398 Ga0373925_0085398_217_1350 375
269 3300037068 Ga0373925_0243615 Ga0373925_0243615_284_1414 375
270 3300045836 Ga0466958_0068069 Ga0466958_0068069_566_1699 375
271 3300046454 Ga0495592_0007326 Ga0495592_0007326_1965_3095 375
272 3300046455 Ga0495603_0015561 Ga0495603_0015561_390_1520 375
273 3300046459 Ga0495629_0000102 Ga0495629_0000102_73679_74809 375
274 3300046459 Ga0495629_0150303 Ga0495629_0150303_396_1529 375
275 3300046459 Ga0495629_0248076 Ga0495629_0248076_37_1170 375
276 3300046461 Ga0495641_0006124 Ga0495641_0006124_4779_5909 375
277 3300046462 Ga0495651_0023338 Ga0495651_0023338_26_1156 375
278 3300046463 Ga0495653_0014996 Ga0495653_0014996_2548_3678 375
279 3300046472 Ga0495580_0043578 Ga0495580_0043578_185_1318 375
280 3300046473 Ga0495582_0020327 Ga0495582_0020327_1194_2324 375
281 3300046473 Ga0495582_0037204 Ga0495582_0037204_595_1725 375
282 3300046475 Ga0495639_0043402 Ga0495639_0043402_605_1738 375
283 3300046477 Ga0495664_0000901 Ga0495664_0000901_13580_14713 375
284 3300046477 Ga0495664_0004771 Ga0495664_0004771_2761_3891 375
285 3300046491 Ga0495584_0030161 Ga0495584_0030161_1531_2661 375
286 3300046492 Ga0495585_0002116 Ga0495585_0002116_10754_11884 375
287 3300046506 Ga0495583_0058568 Ga0495583_0058568_364_1494 375
288 3300046511 Ga0495608_0226102 Ga0495608_0226102_17_1147 375
289 3300046514 Ga0495618_0000287 Ga0495618_0000287_24846_25979 375
290 3300046517 Ga0495630_0021339 Ga0495630_0021339_1784_2914 375
291 3300046523 Ga0495644_0010699 Ga0495644_0010699_1749_2879 375
292 3300046525 Ga0495663_0008914 Ga0495663_0008914_1442_2572 375
293 3300046526 Ga0495666_0019308 Ga0495666_0019308_945_2075 375
294 3300046529 Ga0495652_0062228 Ga0495652_0062228_1743_2876 375
295 3300046531 Ga0495665_0038089 Ga0495665_0038089_1062_2195 375
296 3300046533 Ga0495640_0002682 Ga0495640_0002682_10240_11373 375
297 3300046533 Ga0495640_0043955 Ga0495640_0043955_1162_2295 375
298 3300046533 Ga0495640_0194562 Ga0495640_0194562_44_1177 375
299 3300046535 Ga0495586_0015886 Ga0495586_0015886_2049_3182 375
300 3300046537 Ga0495598_0014879 Ga0495598_0014879_391_1521 375
301 3300046538 Ga0495609_0017793 Ga0495609_0017793_318_1448 375
302 3300046543 Ga0495645_0002472 Ga0495645_0002472_9613_10746 375
303 3300046543 Ga0495645_0015673 Ga0495645_0015673_2163_3293 375
304 3300046558 Ga0495633_0028700 Ga0495633_0028700_1386_2516 375
305 3300046559 Ga0495667_0030221 Ga0495667_0030221_2249_3379 375
306 3300046615 Ga0495656_0002538 Ga0495656_0002538_4186_5316 375
307 3300046642 Ga0495634_0048787 Ga0495634_0048787_886_2019 375
308 3300046648 Ga0495611_0008117 Ga0495611_0008117_2104_3234 375
309 3300046664 Ga0495659_0001627 Ga0495659_0001627_4245_5375 375
310 3300046674 Ga0495588_0003666 Ga0495588_0003666_3456_4586 375
311 3300046678 Ga0495599_0019040 Ga0495599_0019040_2344_3474 375
312 3300046680 Ga0495646_0003085 Ga0495646_0003085_1771_2901 375
313 3300046681 Ga0495647_0005435 Ga0495647_0005435_1417_2547 375
314 3300046681 Ga0495647_0005579 Ga0495647_0005579_1218_2348 375
315 3300046683 Ga0495658_0000986 Ga0495658_0000986_8481_9611 375
316 3300046689 Ga0495613_0004448 Ga0495613_0004448_7682_8812 375
317 3300046689 Ga0495613_0035006 Ga0495613_0035006_300_1430 375
318 3300046690 Ga0495624_0010460 Ga0495624_0010460_1911_3041 375
319 3300046691 Ga0495670_0006459 Ga0495670_0006459_2141_3271 375
320 3300046809 Ga0495600_0006862 Ga0495600_0006862_337_1467 375
321 3300047315 Ga0495581_0015667 Ga0495581_0015667_1468_2598 375
322 3300047321 Ga0495676_0199183 Ga0495676_0199183_152_1282 375
323 3300047322 Ga0495680_0115820 Ga0495680_0115820_201_1334 375
324 3300047446 Ga0495679_009250 Ga0495679_009250_2516_3646 375
325 3300047471 Ga0495684_0003534 Ga0495684_0003534_6313_7443 375
326 3300047471 Ga0495684_0070180 Ga0495684_0070180_76_1209 375
327 3300047471 Ga0495684_0213497 Ga0495684_0213497_117_1247 375
328 3300047673 Ga0495593_0013448 Ga0495593_0013448_3049_4179 375
329 3300048089 Ga0495614_0013307 Ga0495614_0013307_1911_3041 375
330 3300048905 Ga0496102_0076973 Ga0496102_0076973_213_1346 375
331 3300048905 Ga0496102_0159154 Ga0496102_0159154_405_1544 375
332 3300048907 Ga0496104_0007307 Ga0496104_0007307_4465_5604 375
333 3300048907 Ga0496104_0058147 Ga0496104_0058147_252_1382 375
334 3300048907 Ga0496104_0160549 Ga0496104_0160549_561_1694 375
335 3300048908 Ga0496105_0004161 Ga0496105_0004161_2456_3595 375
336 3300048908 Ga0496105_0025634 Ga0496105_0025634_3092_4231 375
337 3300048909 Ga0496106_0100861 Ga0496106_0100861_760_1968 375
338 3300048912 Ga0496109_0042699 Ga0496109_0042699_2175_3314 375
339 3300048912 Ga0496109_0083354 Ga0496109_0083354_102_1232 375
340 3300048914 Ga0496111_0040687 Ga0496111_0040687_1662_2801 375
341 3300048915 Ga0496112_0062683 Ga0496112_0062683_1687_2826 375
342 3300048916 Ga0496113_0007623 Ga0496113_0007623_1729_2868 375
343 3300048916 Ga0496113_0075119 Ga0496113_0075119_1171_2310 375
344 3300048918 Ga0496115_0035794 Ga0496115_0035794_196_1335 375
345 3300048929 Ga0496126_0098962 Ga0496126_0098962_1381_2517 375
346 3300049742 Ga0501080_0180660 Ga0501080_0180660_418_1551 375
347 3300049744 Ga0501083_0028095 Ga0501083_0028095_1297_2430 375
348 3300050491 nmdc:mga00v17_19288_c1 nmdc:mga00v17_19288_c1_2690_3829 375
349 3300050491 nmdc:mga00v17_41033_c1 nmdc:mga00v17_41033_c1_667_1800 375
350 3300050492 nmdc:mga0yw44_12432_c1 nmdc:mga0yw44_12432_c1_590_1723 375
351 3300050493 nmdc:mga0k408_44547_c1 nmdc:mga0k408_44547_c1_16_1149 375
352 3300050494 nmdc:mga06z11_130_c1 nmdc:mga06z11_130_c1_25393_26532 375
353 3300050494 nmdc:mga06z11_4963_c1 nmdc:mga06z11_4963_c1_988_2127 375
354 3300050494 nmdc:mga06z11_9654_c1 nmdc:mga06z11_9654_c1_1528_2661 375
355 3300050495 nmdc:mga04h51_786_c1 nmdc:mga04h51_786_c1_1232_2371 375
356 3300050507 nmdc:mga05p37_117308_c1 nmdc:mga05p37_117308_c1_326_1465 375
357 3300050507 nmdc:mga05p37_202603_c1 nmdc:mga05p37_202603_c1_519_1658 375
358 3300050507 nmdc:mga05p37_250_c2 nmdc:mga05p37_250_c2_2498_3628 375
359 3300050508 nmdc:mga09592_28457_c1 nmdc:mga09592_28457_c1_1502_2632 375
360 3300050509 nmdc:mga0qj67_13293_c1 nmdc:mga0qj67_13293_c1_4269_5408 375
361 3300050509 nmdc:mga0qj67_171_c1 nmdc:mga0qj67_171_c1_12919_14052 375
362 3300050509 nmdc:mga0qj67_2972_c1 nmdc:mga0qj67_2972_c1_2792_3922 375
363 3300050510 nmdc:mga06r32_13648_c1 nmdc:mga06r32_13648_c1_2308_3438 375
364 3300050510 nmdc:mga06r32_249580_c1 nmdc:mga06r32_249580_c1_143_1282 375
365 3300050510 nmdc:mga06r32_82290_c1 nmdc:mga06r32_82290_c1_849_1988 375
366 3300050511 nmdc:mga08y16_16756_c1 nmdc:mga08y16_16756_c1_4271_5410 375
367 3300050511 nmdc:mga08y16_7578_c1 nmdc:mga08y16_7578_c1_2806_3936 375
368 3300050512 nmdc:mga0n895_11081_c1 nmdc:mga0n895_11081_c1_6389_7528 375
369 3300050512 nmdc:mga0n895_160222_c1 nmdc:mga0n895_160222_c1_249_1382 375
370 3300050512 nmdc:mga0n895_174544_c1 nmdc:mga0n895_174544_c1_430_1560 375
371 3300050512 nmdc:mga0n895_346617_c1 nmdc:mga0n895_346617_c1_263_1402 375
372 3300050512 nmdc:mga0n895_580_c1 nmdc:mga0n895_580_c1_18555_19685 375
373 3300050513 nmdc:mga0rr50_1710_c1 nmdc:mga0rr50_1710_c1_5324_6454 375
374 3300050515 nmdc:mga0a205_31320_c1 nmdc:mga0a205_31320_c1_2653_3792 375
375 3300050515 nmdc:mga0a205_713_c1 nmdc:mga0a205_713_c1_5090_6220 375
376 3300053077 Ga0495601_0001782 Ga0495601_0001782_2677_3810 375
377 3300053077 Ga0495601_0004932 Ga0495601_0004932_339_1472 375
378 3300053078 Ga0495612_0000095 Ga0495612_0000095_26260_27393 375
379 3300053084 Ga0495595_0132687 Ga0495595_0132687_27_1157 375
380 3300053085 Ga0495619_0000415 Ga0495619_0000415_3781_4911 375
381 3300053085 Ga0495619_0001134 Ga0495619_0001134_45_1178 375
382 3300053085 Ga0495619_0036465 Ga0495619_0036465_1043_2182 375
383 3300053085 Ga0495619_0079690 Ga0495619_0079690_366_1499 375
384 3300053131 Ga0500652_000019 Ga0500652_000019_80211_81344 375
385 3300053177 Ga0500636_0077752 Ga0500636_0077752_425_1558 375
386 iso_pu_bacteria 2513237087 2513592485 375
387 iso_pu_bacteria 2837678835 2837680114 375
388 3300005578 Ga0068854_100061128 Ga0068854_1000611283 376
389 3300005983 Ga0081540_1015093 Ga0081540_10150933 376
390 3300006846 Ga0075430_100185349 Ga0075430_1001853491 376
391 3300009093 Ga0105240_10514096 Ga0105240_105140961 376
392 3300009551 Ga0105238_10026348 Ga0105238_100263483 376
393 3300010375 Ga0105239_10198289 Ga0105239_101982891 376
394 3300021377 Ga0213874_10004310 Ga0213874_100043102 376
395 3300025904 Ga0207647_10040176 Ga0207647_100401763 376
396 3300025924 Ga0207694_10030630 Ga0207694_100306303 376
397 3300025944 Ga0207661_10029018 Ga0207661_100290185 376
398 3300025972 Ga0207668_10035719 Ga0207668_100357193 376
399 3300031456 Ga0307513_10026369 Ga0307513_100263694 376
400 3300039093 Ga0400489_68725 Ga0400489_68725_991_2133 376
401 3300039437 Ga0436365_1477108 Ga0436365_1477108_4040_5182 376
402 3300039450 Ga0436363_0693641 Ga0436363_0693641_5990_7129 376
403 3300047320 Ga0495672_0040829 Ga0495672_0040829_795_2150 376
404 3300049570 Ga0501033_0198617 Ga0501033_0198617_262_1404 376
405 3300049571 Ga0501034_0046048 Ga0501034_0046048_1413_2555 376
406 3300049581 Ga0501047_0066723 Ga0501047_0066723_441_1583 376
407 3300049583 Ga0501067_0028443 Ga0501067_0028443_1032_2177 376
408 3300049589 Ga0501073_0070584 Ga0501073_0070584_908_2053 376
409 3300049823 Ga0501044_0329846 Ga0501044_0329846_45_1235 376
410 3300050509 nmdc:mga0qj67_71549_c1 nmdc:mga0qj67_71549_c1_63_1205 376
411 iso_pu_bacteria 2595698237 2596373244 376
412 iso_pu_bacteria 2599185236 2599720113 376
413 iso_pu_bacteria 2928125067 2928127233 376
414 3300009098 Ga0105245_10270717 Ga0105245_102707172 377
415 3300031250 Ga0265331_10001441 Ga0265331_100014414 377
416 3300031344 Ga0265316_10026703 Ga0265316_100267034 377
417 3300031727 Ga0316576_10013328 Ga0316576_100133285 377
418 3300035695 Ga0373927_0009793 Ga0373927_0009793_217_1473 377
419 3300035725 Ga0373947_0046316 Ga0373947_0046316_926_2182 377
420 3300036712 Ga0316584_0012904 Ga0316584_0012904_2416_3561 377
421 3300037068 Ga0373925_0073761 Ga0373925_0073761_896_2152 377
422 3300046455 Ga0495603_0000028 Ga0495603_0000028_930_2186 377
423 3300046459 Ga0495629_0006971 Ga0495629_0006971_549_1805 377
424 3300046472 Ga0495580_0012694 Ga0495580_0012694_315_1571 377
425 3300046473 Ga0495582_0001962 Ga0495582_0001962_340_1596 377
426 3300046475 Ga0495639_0010090 Ga0495639_0010090_1862_3118 377
427 3300046499 Ga0495594_0000227 Ga0495594_0000227_567_1823 377
428 3300046533 Ga0495640_0108934 Ga0495640_0108934_235_1491 377
429 3300046557 Ga0495622_0000895 Ga0495622_0000895_8157_9413 377
430 3300046642 Ga0495634_0023428 Ga0495634_0023428_1331_2587 377
431 3300046663 Ga0495635_0125003 Ga0495635_0125003_222_1478 377
432 3300046674 Ga0495588_0004914 Ga0495588_0004914_3917_5173 377
433 3300046689 Ga0495613_0001425 Ga0495613_0001425_818_2074 377
434 3300047321 Ga0495676_0010391 Ga0495676_0010391_1004_2260 377
435 3300047322 Ga0495680_0099771 Ga0495680_0099771_219_1475 377
436 3300047673 Ga0495593_0000799 Ga0495593_0000799_15920_17176 377
437 3300053084 Ga0495595_0003847 Ga0495595_0003847_416_1672 377
438 iso_pu_bacteria 2582581866 2585392444 377
439 iso_pu_bacteria 2585427633 2585997164 377
440 iso_pu_bacteria 2585427634 2586001763 377
441 iso_pu_bacteria 2599185352 2600194101 377
442 iso_pu_bacteria 2643221557 2643809756 377
443 iso_pu_bacteria 2643221607 2644048330 377
444 iso_pu_bacteria 2643221610 2644063937 377
445 iso_pu_bacteria 2643221636 2644201692 377
446 iso_pu_bacteria 2643221668 2644381458 377
447 iso_pu_bacteria 2643221675 2644415770 377
448 iso_pu_bacteria 2643221680 2644448810 377
449 iso_pu_bacteria 2643221686 2644481132 377
450 iso_pu_bacteria 2643221723 2644676730 377
451 iso_pu_bacteria 2643221726 2644686796 377
452 iso_pu_bacteria 2791355256 2793293616 377
453 iso_pu_bacteria 2791355262 2793333399 377
454 iso_pu_bacteria 2854896431 2854900218 377
455 iso_pu_bacteria 2854916844 2854919180 377
456 iso_pu_bacteria 2919171160 2919173460 377
457 iso_pu_bacteria 2920822456 2920828472 377
458 iso_pu_bacteria 2929138655 2929141383 377
459 iso_pu_bacteria 2939669807 2939672309 377
460 iso_pu_bacteria 8056875544 8056876175 377
461 3300006195 Ga0075366_10094412 Ga0075366_100944121 378
462 3300048920 Ga0496117_0079910 Ga0496117_0079910_138_1280 378
463 3300048921 Ga0496118_0055152 Ga0496118_0055152_1357_2499 378
464 3300048923 Ga0496120_0037158 Ga0496120_0037158_49_1191 378
465 3300048924 Ga0496121_0000003 Ga0496121_0000003_1009685_1010827 378
466 3300048928 Ga0496125_0000345 Ga0496125_0000345_79200_80342 378
467 iso_pu_bacteria 2508501122 2509110243 378
468 iso_pu_bacteria 2509276019 2509378979 378
469 iso_pu_bacteria 2509276019 2509379001 378
470 iso_pu_bacteria 2509276033 2509447925 378
471 iso_pu_bacteria 2510065019 2510134862 378
472 iso_pu_bacteria 2510065057 2510303711 378
473 iso_pu_bacteria 2510461076 2510896268 378
474 iso_pu_bacteria 2510917028 2511185071 378
475 iso_pu_bacteria 2510917030 2511195896 378
476 iso_pu_bacteria 2511231052 2511503008 378
477 iso_pu_bacteria 2512047086 2512534272 378
478 iso_pu_bacteria 2512875026 2512973905 378
479 iso_pu_bacteria 2513237084 2513572626 378
480 iso_pu_bacteria 2513237085 2513580143 378
481 iso_pu_bacteria 2513237086 2513587708 378
482 iso_pu_bacteria 2513237088 2513597195 378
483 iso_pu_bacteria 2513237089 2513602378 378
484 iso_pu_bacteria 2513237091 2513617177 378
485 iso_pu_bacteria 2513237093 2513631299 378
486 iso_pu_bacteria 2513237103 2513710804 378
487 iso_pu_bacteria 2513237138 2513868081 378
488 iso_pu_bacteria 2513237140 2513882918 378
489 iso_pu_bacteria 2513237143 2513902947 378
490 iso_pu_bacteria 2513237144 2513908167 378
491 iso_pu_bacteria 2513237146 2513926965 378
492 iso_pu_bacteria 2513237156 2513985927 378
493 iso_pu_bacteria 2513237159 2513998109 378
494 iso_pu_bacteria 2513237160 2514004021 378
495 iso_pu_bacteria 2513237162 2514022316 378
496 iso_pu_bacteria 2515075009 2515113946 378
497 iso_pu_bacteria 2515154107 2515610320 378
498 iso_pu_bacteria 2515154113 2515636980 378
499 iso_pu_bacteria 2515154114 2515643010 378
500 iso_pu_bacteria 2515154116 2515656759 378
501 iso_pu_bacteria 2515154134 2515743697 378
502 iso_pu_bacteria 2516143018 2516205270 378
503 iso_pu_bacteria 2516143018 2516206525 378
504 iso_pu_bacteria 2516653046 2516894412 378
505 iso_pu_bacteria 2516653077 2517037577 378
506 iso_pu_bacteria 2516653085 2517077864 378
507 iso_pu_bacteria 2517093000 2517096661 378
508 iso_pu_bacteria 2517287029 2517410375 378
509 iso_pu_bacteria 2517487022 2517571033 378
510 iso_pu_bacteria 2519899620 2520381328 378
511 iso_pu_bacteria 2524023207 2524451897 378
512 iso_pu_bacteria 2529292951 2530646974 378
513 iso_pu_bacteria 2534681796 2535519411 378
514 iso_pu_bacteria 2551306084 2551675773 378
515 iso_pu_bacteria 2551306085 2551689081 378
516 iso_pu_bacteria 2551306086 2551692554 378
517 iso_pu_bacteria 2551306087 2551701212 378
518 iso_pu_bacteria 2551306089 2551708864 378
519 iso_pu_bacteria 2551306090 2551722080 378
520 iso_pu_bacteria 2551306091 2551724686 378
521 iso_pu_bacteria 2551306092 2551735154 378
522 iso_pu_bacteria 2551306093 2551745358 378
523 iso_pu_bacteria 2558860100 2558860423 378
524 iso_pu_bacteria 2582581283 2585168052 378
525 iso_pu_bacteria 2582581294 2585202450 378
526 iso_pu_bacteria 2582581298 2585224766 378
527 iso_pu_bacteria 2582581299 2585227850 378
528 iso_pu_bacteria 2582581304 2585257858 378
529 iso_pu_bacteria 2582581306 2585269743 378
530 iso_pu_bacteria 2582581865 2585388595 378
531 iso_pu_bacteria 2582581867 2585402239 378
532 iso_pu_bacteria 2585427526 2585529059 378
533 iso_pu_bacteria 2585427528 2585540999 378
534 iso_pu_bacteria 2585427529 2585547322 378
535 iso_pu_bacteria 2585427590 2585822461 378
536 iso_pu_bacteria 2585427593 2585839761 378
537 iso_pu_bacteria 2599185170 2599420541 378
538 iso_pu_bacteria 2615840624 2616295580 378
539 iso_pu_bacteria 2643221599 2644006474 378
540 iso_pu_bacteria 2643221634 2644195923 378
541 iso_pu_bacteria 2643221643 2644241883 378
542 iso_pu_bacteria 2643221688 2644496386 378
543 iso_pu_bacteria 2643221689 2644500179 378
544 iso_pu_bacteria 2690316117 2692314484 378
545 iso_pu_bacteria 2718217882 2719182614 378
546 iso_pu_bacteria 2718217927 2719387287 378
547 iso_pu_bacteria 2718217997 2719666929 378
548 iso_pu_bacteria 2718218009 2719733333 378
549 iso_pu_bacteria 2718218199 2720493349 378
550 iso_pu_bacteria 2718218232 2720614823 378
551 iso_pu_bacteria 2718218233 2720621595 378
552 iso_pu_bacteria 2718218235 2720632923 378
553 iso_pu_bacteria 2718218269 2720776647 378
554 iso_pu_bacteria 2718218363 2721148727 378
555 iso_pu_bacteria 2718218365 2721160112 378
556 iso_pu_bacteria 2718218366 2721165541 378
557 iso_pu_bacteria 2718218423 2721400922 378
558 iso_pu_bacteria 2721755514 2722841711 378
559 iso_pu_bacteria 2721755556 2723028236 378
560 iso_pu_bacteria 2721755684 2723561864 378
561 iso_pu_bacteria 2721755685 2723568495 378
562 iso_pu_bacteria 2721755809 2724039735 378
563 iso_pu_bacteria 2721755810 2724046089 378
564 iso_pu_bacteria 2721755819 2724091254 378
565 iso_pu_bacteria 2721755822 2724105760 378
566 iso_pu_bacteria 2721755823 2724111587 378
567 iso_pu_bacteria 2724679232 2725945448 378
568 iso_pu_bacteria 2728369352 2730109172 378
569 iso_pu_bacteria 2728369365 2730165849 378
570 iso_pu_bacteria 2728369397 2730299744 378
571 iso_pu_bacteria 2738541333 2739035556 378
572 iso_pu_bacteria 2765235942 2766065302 378
573 iso_pu_bacteria 2791355082 2792579918 378
574 iso_pu_bacteria 2791355082 2792582533 378
575 iso_pu_bacteria 2791355092 2792625701 378
576 iso_pu_bacteria 2791355259 2793313056 378
577 iso_pu_bacteria 2791355260 2793319704 378
578 iso_pu_bacteria 2791355261 2793327790 378
579 iso_pu_bacteria 2791355264 2793347388 378
580 iso_pu_bacteria 2791355265 2793353720 378
581 iso_pu_bacteria 2791355266 2793359682 378
582 iso_pu_bacteria 2791355267 2793369435 378
583 iso_pu_bacteria 2802428858 2802717878 378
584 iso_pu_bacteria 2802428859 2802725271 378
585 iso_pu_bacteria 2802428860 2802730605 378
586 iso_pu_bacteria 2802428861 2802737952 378
587 iso_pu_bacteria 2802428862 2802744178 378
588 iso_pu_bacteria 2802428863 2802753137 378
589 iso_pu_bacteria 2802429268 2804753339 378
590 iso_pu_bacteria 2802429268 2804755539 378
591 iso_pu_bacteria 2802429605 2805929425 378
592 iso_pu_bacteria 2802429606 2805935394 378
593 iso_pu_bacteria 2802429633 2806044542 378
594 iso_pu_bacteria 2802429634 2806052743 378
595 iso_pu_bacteria 2802429635 2806059043 378
596 iso_pu_bacteria 2802429636 2806068294 378
597 iso_pu_bacteria 2802429637 2806074414 378
598 iso_pu_bacteria 2837651117 2837654203 378
599 iso_pu_bacteria 2838016132 2838019126 378
600 iso_pu_bacteria 2838022645 2838024283 378
601 iso_pu_bacteria 2838035591 2838040785 378
602 iso_pu_bacteria 2838042994 2838047358 378
603 iso_pu_bacteria 2838048938 2838051156 378
604 iso_pu_bacteria 2838061910 2838063867 378
605 iso_pu_bacteria 2838068647 2838073351 378
606 iso_pu_bacteria 2838074704 2838077452 378
607 iso_pu_bacteria 2838661181 2838664826 378
608 iso_pu_bacteria 2838668709 2838671118 378
609 iso_pu_bacteria 2838680041 2838684942 378
610 iso_pu_bacteria 2838686498 2838691301 378
611 iso_pu_bacteria 2838694306 2838699221 378
612 iso_pu_bacteria 2838701080 2838703703 378
613 iso_pu_bacteria 2838707686 2838712702 378
614 iso_pu_bacteria 2838729681 2838735784 378
615 iso_pu_bacteria 2838742623 2838748686 378
616 iso_pu_bacteria 2841851746 2841853879 378
617 iso_pu_bacteria 2841864319 2841868152 378
618 iso_pu_bacteria 2842077413 2842082179 378
619 iso_pu_bacteria 2842110456 2842113416 378
620 iso_pu_bacteria 2842118031 2842123102 378
621 iso_pu_bacteria 2842146304 2842151212 378
622 iso_pu_bacteria 2842156927 2842162603 378
623 iso_pu_bacteria 2842163707 2842169969 378
624 iso_pu_bacteria 2842180545 2842185040 378
625 iso_pu_bacteria 2842192696 2842198243 378
626 iso_pu_bacteria 2842198810 2842199825 378
627 iso_pu_bacteria 2842205361 2842208324 378
628 iso_pu_bacteria 2842217011 2842220060 378
629 iso_pu_bacteria 2842229732 2842235587 378
630 iso_pu_bacteria 2842237096 2842241996 378
631 iso_pu_bacteria 2842243621 2842249379 378
632 iso_pu_bacteria 2842250916 2842256268 378
633 iso_pu_bacteria 2842257432 2842263484 378
634 iso_pu_bacteria 2842264693 2842266627 378
635 iso_pu_bacteria 2842271015 2842275776 378
636 iso_pu_bacteria 2842278818 2842281667 378
637 iso_pu_bacteria 2842285085 2842288779 378
638 iso_pu_bacteria 2842291075 2842296179 378
639 iso_pu_bacteria 2842304105 2842308240 378
640 iso_pu_bacteria 2842311132 2842315615 378
641 iso_pu_bacteria 2842317721 2842321368 378
642 iso_pu_bacteria 2842341865 2842345023 378
643 iso_pu_bacteria 2842363717 2842369142 378
644 iso_pu_bacteria 2842370503 2842375619 378
645 iso_pu_bacteria 2842377471 2842382579 378
646 iso_pu_bacteria 2842384541 2842389980 378
647 iso_pu_bacteria 2842395702 2842398491 378
648 iso_pu_bacteria 2842402390 2842406554 378
649 iso_pu_bacteria 2842409023 2842413019 378
650 iso_pu_bacteria 2842415677 2842419662 378
651 iso_pu_bacteria 2842422224 2842426986 378
652 iso_pu_bacteria 2842428310 2842429946 378
653 iso_pu_bacteria 2842434925 2842436394 378
654 iso_pu_bacteria 2842441272 2842444097 378
655 iso_pu_bacteria 2842447887 2842451049 378
656 iso_pu_bacteria 2842462802 2842464367 378
657 iso_pu_bacteria 2842469257 2842470723 378
658 iso_pu_bacteria 2842489311 2842493296 378
659 iso_pu_bacteria 2842495871 2842499134 378
660 iso_pu_bacteria 2842521101 2842523213 378
661 iso_pu_bacteria 2844454524 2844457475 378
662 iso_pu_bacteria 2847417321 2847420463 378
663 iso_pu_bacteria 2848992105 2848995335 378
664 iso_pu_bacteria 2850079185 2850082321 378
665 iso_pu_bacteria 2850079185 2850085794 378
666 iso_pu_bacteria 2855825444 2855827047 378
667 iso_pu_bacteria 2855839649 2855842444 378
668 iso_pu_bacteria 2855872281 2855878410 378
669 iso_pu_bacteria 2857516855 2857518884 378
670 iso_pu_bacteria 2858800743 2858803260 378
671 iso_pu_bacteria 2891048133 2891051103 378
672 iso_pu_bacteria 2896384573 2896390018 378
673 iso_pu_bacteria 2913295892 2913299856 378
674 iso_pu_bacteria 2915980308 2915980581 378
675 iso_pu_bacteria 2915986958 2915987331 378
676 iso_pu_bacteria 2915993759 2915994927 378
677 iso_pu_bacteria 2916000859 2916006999 378
678 iso_pu_bacteria 2916007675 2916012236 378
679 iso_pu_bacteria 2916014648 2916016901 378
680 iso_pu_bacteria 2916021584 2916027764 378
681 iso_pu_bacteria 2916028427 2916030223 378
682 iso_pu_bacteria 2916035215 2916036780 378
683 iso_pu_bacteria 2916041962 2916044637 378
684 iso_pu_bacteria 2916048683 2916052653 378
685 iso_pu_bacteria 2916055098 2916058349 378
686 iso_pu_bacteria 2916061851 2916067806 378
687 iso_pu_bacteria 2916068649 2916074200 378
688 iso_pu_bacteria 2916076590 2916081350 378
689 iso_pu_bacteria 2919100787 2919104580 378
690 iso_pu_bacteria 2920760137 2920760738 378
691 iso_pu_bacteria 2921201388 2921208080 378
692 iso_pu_bacteria 2921208531 2921212812 378
693 iso_pu_bacteria 2921237296 2921241883 378
694 iso_pu_bacteria 2921244191 2921244235 378
695 iso_pu_bacteria 2921250672 2921252521 378
696 iso_pu_bacteria 2921257292 2921260614 378
697 iso_pu_bacteria 2921263974 2921265984 378
698 iso_pu_bacteria 2921282425 2921287750 378
699 iso_pu_bacteria 2921289301 2921292857 378
700 iso_pu_bacteria 2923556063 2923558766 378
701 iso_pu_bacteria 2924144063 2924148802 378
702 iso_pu_bacteria 2924150972 2924152155 378
703 iso_pu_bacteria 2924158325 2924164091 378
704 iso_pu_bacteria 2924165586 2924172823 378
705 iso_pu_bacteria 2924172951 2924174441 378
706 iso_pu_bacteria 2924179722 2924184011 378
707 iso_pu_bacteria 2924186466 2924192943 378
708 iso_pu_bacteria 2924193448 2924193791 378
709 iso_pu_bacteria 2924200457 2924206682 378
710 iso_pu_bacteria 2924207177 2924213114 378
711 iso_pu_bacteria 2924221636 2924223998 378
712 iso_pu_bacteria 2924228884 2924232065 378
713 iso_pu_bacteria 2933016740 2933020958 378
714 iso_pu_bacteria 2933570622 2933574689 378
715 iso_pu_bacteria 2933586486 2933589294 378
716 iso_pu_bacteria 2933599457 2933603519 378
717 iso_pu_bacteria 2935894831 2935899717 378
718 iso_pu_bacteria 2935901341 2935907536 378
719 iso_pu_bacteria 2936367885 2936374852 378
720 iso_pu_bacteria 2936375103 2936380544 378
721 iso_pu_bacteria 2936381700 2936382285 378
722 iso_pu_bacteria 2936996657 2937000067 378
723 iso_pu_bacteria 2937002841 2937006972 378
724 iso_pu_bacteria 2937009748 2937015442 378
725 iso_pu_bacteria 2937016420 2937018161 378
726 iso_pu_bacteria 2937023124 2937024365 378
727 iso_pu_bacteria 2937029754 2937032976 378
728 iso_pu_bacteria 2937036028 2937042242 378
729 iso_pu_bacteria 2937042894 2937046712 378
730 iso_pu_bacteria 2937049772 2937052328 378
731 iso_pu_bacteria 2937056579 2937063137 378
732 iso_pu_bacteria 2937063883 2937067572 378
733 iso_pu_bacteria 2937071275 2937071386 378
734 iso_pu_bacteria 2937078374 2937078648 378
735 iso_pu_bacteria 2937084907 2937086242 378
736 iso_pu_bacteria 2937091812 2937092907 378
737 iso_pu_bacteria 2937098957 2937104729 378
738 iso_pu_bacteria 2937106411 2937109952 378
739 iso_pu_bacteria 2937113482 2937114560 378
740 iso_pu_bacteria 2937119839 2937123713 378
741 iso_pu_bacteria 2937126314 2937129309 378
742 iso_pu_bacteria 2957375807 2957376914 378
743 iso_pu_bacteria 2957382221 2957386070 378
744 iso_pu_bacteria 2957388812 2957390154 378
745 iso_pu_bacteria 2957395598 2957396782 378
746 iso_pu_bacteria 2957402308 2957406251 378
747 iso_pu_bacteria 2957408893 2957409004 378
748 iso_pu_bacteria 2957415311 2957422046 378
749 iso_pu_bacteria 2957422303 2957429541 378
750 iso_pu_bacteria 2957430029 2957430546 378
751 iso_pu_bacteria 2957437181 2957437406 378
752 iso_pu_bacteria 2957443900 2957444360 378
753 iso_pu_bacteria 2957450854 2957452765 378
754 iso_pu_bacteria 2957457609 2957463084 378
755 iso_pu_bacteria 2957464669 2957468210 378
756 iso_pu_bacteria 2957471148 2957471944 378
757 iso_pu_bacteria 2957478035 2957481005 378
758 iso_pu_bacteria 2957484790 2957488464 378
759 iso_pu_bacteria 2957491536 2957495258 378
760 iso_pu_bacteria 2957498199 2957501892 378
761 iso_pu_bacteria 2957505466 2957512831 378
762 iso_pu_bacteria 2960584000 2960584778 378
763 iso_pu_bacteria 2960591022 2960591296 378
764 iso_pu_bacteria 2960597568 2960598763 378
765 iso_pu_bacteria 2960603979 2960610201 378
766 iso_pu_bacteria 2960610863 2960617264 378
767 iso_pu_bacteria 2960617483 2960618744 378
768 iso_pu_bacteria 2960624210 2960629538 378
769 iso_pu_bacteria 2960631154 2960632548 378
770 iso_pu_bacteria 2960637947 2960639563 378
771 iso_pu_bacteria 2960645483 2960649376 378
772 iso_pu_bacteria 2960652885 2960653041 378
773 iso_pu_bacteria 2960660292 2960662941 378
774 iso_pu_bacteria 2960667422 2960671483 378
775 iso_pu_bacteria 2960674078 2960674692 378
776 iso_pu_bacteria 2960680706 2960681378 378
777 iso_pu_bacteria 2960687367 2960687919 378
778 iso_pu_bacteria 2960693952 2960697151 378
779 iso_pu_bacteria 2964607997 2964610870 378
780 iso_pu_bacteria 2964615318 2964620389 378
781 iso_pu_bacteria 2964621998 2964625994 378
782 iso_pu_bacteria 2964628898 2964632478 378
783 iso_pu_bacteria 2964636051 2964641714 378
784 iso_pu_bacteria 2964643177 2964647228 378
785 iso_pu_bacteria 2964649959 2964650875 378
786 iso_pu_bacteria 2964656573 2964658987 378
787 iso_pu_bacteria 2964663802 2964668844 378
788 iso_pu_bacteria 2964670856 2964677565 378
789 iso_pu_bacteria 2964678106 2964681778 378
790 iso_pu_bacteria 2964685014 2964686322 378
791 iso_pu_bacteria 2964691889 2964693213 378
792 iso_pu_bacteria 2964698721 2964705179 378
793 iso_pu_bacteria 2964705432 2964706207 378
794 iso_pu_bacteria 2964712639 2964719102 378
795 iso_pu_bacteria 2964719344 2964724798 378
796 iso_pu_bacteria 2967664464 2967666697 378
797 iso_pu_bacteria 2967671571 2967676593 378
798 iso_pu_bacteria 2967678726 2967679431 378
799 iso_pu_bacteria 2967686174 2967686527 378
800 iso_pu_bacteria 2967693043 2967696146 378
801 iso_pu_bacteria 2967699805 2967700449 378
802 iso_pu_bacteria 2967706974 2967708397 378
803 iso_pu_bacteria 2967714385 2967715794 378
804 iso_pu_bacteria 2967721400 2967721983 378
805 iso_pu_bacteria 2967728569 2967732468 378
806 iso_pu_bacteria 2967735183 2967735400 378
807 iso_pu_bacteria 2967742019 2967746887 378
808 iso_pu_bacteria 2967748971 2967750107 378
809 iso_pu_bacteria 2967755722 2967759030 378
810 iso_pu_bacteria 2967762386 2967769037 378
811 iso_pu_bacteria 2967769361 2967774574 378
812 iso_pu_bacteria 2967775926 2967781351 378
813 iso_pu_bacteria 2970019648 2970024948 378
814 iso_pu_bacteria 2970026789 2970030242 378
815 iso_pu_bacteria 2970033650 2970040630 378
816 iso_pu_bacteria 2970040964 2970044344 378
817 iso_pu_bacteria 2970047711 2970052774 378
818 iso_pu_bacteria 2970054988 2970061079 378
819 iso_pu_bacteria 2970061556 2970062339 378
820 iso_pu_bacteria 2970068827 2970069468 378
821 iso_pu_bacteria 2970076120 2970079103 378
822 iso_pu_bacteria 2970082768 2970083411 378
823 iso_pu_bacteria 2970088815 2970095524 378
824 iso_pu_bacteria 2970095765 2970099107 378
825 iso_pu_bacteria 2970102677 2970108852 378
826 iso_pu_bacteria 2970109326 2970115279 378
827 iso_pu_bacteria 2970116247 2970119581 378
828 iso_pu_bacteria 2970122695 2970126446 378
829 iso_pu_bacteria 2970129317 2970134321 378
830 iso_pu_bacteria 2970136068 2970140696 378
831 iso_pu_bacteria 2970143518 2970144561 378
832 iso_pu_bacteria 2970149975 2970155624 378
833 iso_pu_bacteria 2970156795 2970160280 378
834 iso_pu_bacteria 2970164137 2970165869 378
835 iso_pu_bacteria 2970170962 2970173369 378
836 iso_pu_bacteria 2970177841 2970179863 378
837 iso_pu_bacteria 2970184632 2970191410 378
838 iso_pu_bacteria 2970191845 2970195658 378
839 iso_pu_bacteria 2977516862 2977522091 378
840 iso_pu_bacteria 2977523885 2977530061 378
841 iso_pu_bacteria 2977530762 2977532458 378
842 iso_pu_bacteria 2977537788 2977540991 378
843 iso_pu_bacteria 2977544691 2977551103 378
844 iso_pu_bacteria 2977551784 2977556871 378
845 iso_pu_bacteria 2977558990 2977565620 378
846 iso_pu_bacteria 2977565890 2977569133 378
847 iso_pu_bacteria 2977572785 2977577988 378
848 iso_pu_bacteria 2977579622 2977579734 378
849 iso_pu_bacteria 2989771324 2989773545 378
850 iso_pu_bacteria 2995392953 2995395858 378
851 iso_pu_bacteria 2996887358 2996889221 378
852 iso_pu_bacteria 2996893221 2996894716 378
853 iso_pu_bacteria 3005409236 3005415471 378
854 iso_pu_bacteria 3005452660 3005455590 378
855 iso_pu_bacteria 639633055 639650015 378
856 iso_pu_bacteria 643692032 643823489 378
857 iso_pu_bacteria 643692032 643827102 378
858 iso_pu_bacteria 648276728 648735829 378
859 iso_pu_bacteria 8003992118 8003994985 378
860 iso_pu_bacteria 8003999396 8004002749 378
861 iso_pu_bacteria 8005258706 8005264201 378
862 iso_pu_bacteria 8005275841 8005282033 378
863 iso_pu_bacteria 8005282627 8005287152 378
864 iso_pu_bacteria 8005289223 8005294248 378
865 iso_pu_bacteria 8005301065 8005306659 378
866 iso_pu_bacteria 8005307578 8005309405 378
867 iso_pu_bacteria 8005321885 8005323748 378
868 iso_pu_bacteria 8005376324 8005382769 378
869 iso_pu_bacteria 8005382845 8005383825 378
870 iso_pu_bacteria 8005395548 8005401151 378
871 iso_pu_bacteria 8005430974 8005434104 378
872 iso_pu_bacteria 8005460587 8005464633 378
873 iso_pu_bacteria 8005497431 8005501682 378
874 iso_pu_bacteria 8005542996 8005547100 378
875 iso_pu_bacteria 8005556819 8005559148 378
876 iso_pu_bacteria 8005563573 8005566793 378
877 iso_pu_bacteria 8005570704 8005574929 378
878 iso_pu_bacteria 8005619151 8005623036 378
879 iso_pu_bacteria 8005626139 8005631659 378
880 iso_pu_bacteria 8005668836 8005673104 378
881 iso_pu_bacteria 8005688590 8005693645 378
882 iso_pu_bacteria 8005695170 8005700883 378
883 iso_pu_bacteria 8018127388 8018133600 378
884 iso_pu_bacteria 8018163183 8018170236 378
885 iso_pu_bacteria 8018176218 8018178447 378
886 iso_pu_bacteria 8023680758 8023687530 378
887 iso_pu_bacteria 8024479707 8024481967 378
888 iso_pu_bacteria 8024501048 8024505921 378
889 iso_pu_bacteria 8049293176 8049295954 378
890 iso_pu_bacteria 8049293176 8049298764 378
891 iso_pu_bacteria 8056375014 8056381600 378
892 iso_pu_bacteria 8056382006 8056387040 378
893 iso_pu_bacteria 8057874678 8057877007 378
894 3300005354 Ga0070675_100174193 Ga0070675_1001741932 379
895 3300005545 Ga0070695_100003589 Ga0070695_1000035893 379
896 3300005549 Ga0070704_100052600 Ga0070704_1000526003 379
897 3300005563 Ga0068855_100388143 Ga0068855_1003881431 379
898 3300005615 Ga0070702_100062351 Ga0070702_1000623512 379
899 3300005617 Ga0068859_100173421 Ga0068859_1001734213 379
900 3300006931 Ga0097620_100173419 Ga0097620_1001734193 379
901 3300010375 Ga0105239_10038823 Ga0105239_100388235 379
902 3300013308 Ga0157375_10321932 Ga0157375_103219323 379
903 3300014968 Ga0157379_10167831 Ga0157379_101678313 379
904 3300021384 Ga0213876_10000462 Ga0213876_1000046222 379
905 3300021384 Ga0213876_10001766 Ga0213876_100017666 379
906 3300021388 Ga0213875_10004649 Ga0213875_100046493 379
907 3300025900 Ga0207710_10023003 Ga0207710_100230031 379
908 3300026075 Ga0207708_10095691 Ga0207708_100956912 379
909 3300026089 Ga0207648_10089853 Ga0207648_100898532 379
910 3300026118 Ga0207675_100091656 Ga0207675_1000916563 379
911 3300028794 Ga0307515_10174603 Ga0307515_101746032 379
912 3300037471 Ga0395905_0006639 Ga0395905_0006639_10199_11350 379
913 3300037853 Ga0436364_0046367 Ga0436364_0046367_1897_3057 379
914 3300037853 Ga0436364_1092228 Ga0436364_1092228_1776_2936 379
915 3300039437 Ga0436365_0323217 Ga0436365_0323217_14508_15668 379
916 3300039437 Ga0436365_1602908 Ga0436365_1602908_17287_18447 379
917 3300039450 Ga0436363_0461300 Ga0436363_0461300_2724_3884 379
918 3300039450 Ga0436363_1352461 Ga0436363_1352461_998_2158 379
919 3300039453 Ga0436362_0228906 Ga0436362_0228906_3441_4601 379
920 3300046491 Ga0495584_0032726 Ga0495584_0032726_1418_2581 379
921 3300048905 Ga0496102_0013750 Ga0496102_0013750_414_1577 379
922 3300048907 Ga0496104_0212516 Ga0496104_0212516_483_1646 379
923 3300048909 Ga0496106_0084852 Ga0496106_0084852_1244_2407 379
924 3300048912 Ga0496109_0036719 Ga0496109_0036719_2336_3499 379
925 3300048916 Ga0496113_0115836 Ga0496113_0115836_730_1893 379
926 3300049568 Ga0501031_0068652 Ga0501031_0068652_314_1477 379
927 3300049574 Ga0501038_0046815 Ga0501038_0046815_771_1934 379
928 3300049577 Ga0501041_0084329 Ga0501041_0084329_282_1445 379
929 3300049578 Ga0501042_0174390 Ga0501042_0174390_228_1391 379
930 3300049580 Ga0501046_0017428 Ga0501046_0017428_890_2053 379
931 3300049591 Ga0501075_0015874 Ga0501075_0015874_2772_3935 379
932 3300049592 Ga0501076_0053841 Ga0501076_0053841_927_2090 379
933 3300049593 Ga0501077_0001899 Ga0501077_0001899_9162_10325 379
934 3300049824 Ga0501045_0009672 Ga0501045_0009672_4132_5295 379
935 3300050507 nmdc:mga05p37_490821_c1 nmdc:mga05p37_490821_c1_61_1224 379
936 3300053153 Ga0500616_0000709 Ga0500616_0000709_22322_23620 379
937 3300054114 Ga0501084_0283364 Ga0501084_0283364_58_1221 379
938 3300061734 Ga0530510_0005930 Ga0530510_0005930_35_1198 379
939 3300061734 Ga0530510_0147245 Ga0530510_0147245_279_1442 379
940 iso_pu_bacteria 2989349275 2989354619 379
941 3300025297 Ga0209758_1006689 Ga0209758_10066892 380
942 3300025940 Ga0207691_10176794 Ga0207691_101767942 380
943 3300026075 Ga0207708_10140403 Ga0207708_101404032 380
944 3300026118 Ga0207675_100258410 Ga0207675_1002584102 380
945 3300031911 Ga0307412_10201641 Ga0307412_102016412 380
946 3300035171 Ga0373946_0016223 Ga0373946_0016223_279_1421 380
947 3300035695 Ga0373927_0000047 Ga0373927_0000047_7548_8741 380
948 3300035695 Ga0373927_0000701 Ga0373927_0000701_14144_15286 380
949 3300037068 Ga0373925_0006393 Ga0373925_0006393_6877_8019 380
950 3300037068 Ga0373925_0009566 Ga0373925_0009566_574_1767 380
951 3300037471 Ga0395905_0003051 Ga0395905_0003051_7335_8561 380
952 3300046460 Ga0495638_0021031 Ga0495638_0021031_1242_2399 380
953 3300048914 Ga0496111_0000974 Ga0496111_0000974_553_1851 380
954 3300048926 Ga0496123_0007564 Ga0496123_0007564_5197_6495 380
955 3300049576 Ga0501040_0144591 Ga0501040_0144591_393_1646 380
956 3300049588 Ga0501072_0110117 Ga0501072_0110117_442_1659 380
957 3300049591 Ga0501075_0097011 Ga0501075_0097011_114_1352 380
958 3300049822 Ga0501035_0232442 Ga0501035_0232442_176_1393 380
959 3300002987 JGI25159J45721_1000032 JGI25159J45721_100003241 381
960 3300003187 JGI25151J46595_10009531 JGI25151J46595_100095315 381
961 3300003354 JGI25160J50197_1000009 JGI25160J50197_100000943 381
962 3300003354 JGI25160J50197_1011868 JGI25160J50197_10118682 381
963 3300003374 JGI25161J50226_1000240 JGI25161J50226_100024010 381
964 3300003771 Ga0055526_1001379 Ga0055526_10013794 381
965 3300003775 Ga0055524_1004686 Ga0055524_10046866 381
966 3300003775 Ga0055524_1005912 Ga0055524_10059124 381
967 3300003781 Ga0055536_1002454 Ga0055536_100245410 381
968 3300003781 Ga0055536_1012053 Ga0055536_10120533 381
969 3300003790 Ga0055528_1023626 Ga0055528_10236262 381
970 3300003792 Ga0055540_1003170 Ga0055540_10031703 381
971 3300003794 Ga0055531_10002326 Ga0055531_1000232610 381
972 3300003794 Ga0055531_10011072 Ga0055531_100110723 381
973 3300004625 Ga0055543_1000055 Ga0055543_100005544 381
974 3300005262 Ga0065165_1000020 Ga0065165_1000020226 381
975 3300005327 Ga0070658_10024041 Ga0070658_100240416 381
976 3300005329 Ga0070683_100020763 Ga0070683_1000207635 381
977 3300005334 Ga0068869_100010176 Ga0068869_1000101766 381
978 3300005335 Ga0070666_10035078 Ga0070666_100350783 381
979 3300005336 Ga0070680_100008772 Ga0070680_1000087728 381
980 3300005337 Ga0070682_100001331 Ga0070682_10000133116 381
981 3300005339 Ga0070660_100001803 Ga0070660_1000018033 381
982 3300005340 Ga0070689_100000297 Ga0070689_10000029717 381
983 3300005341 Ga0070691_10004703 Ga0070691_100047036 381
984 3300005344 Ga0070661_100018427 Ga0070661_1000184275 381
985 3300005345 Ga0070692_10001269 Ga0070692_100012693 381
986 3300005347 Ga0070668_100015668 Ga0070668_1000156682 381
987 3300005347 Ga0070668_100050203 Ga0070668_1000502033 381
988 3300005353 Ga0070669_100001902 Ga0070669_1000019027 381
989 3300005354 Ga0070675_100008391 Ga0070675_1000083918 381
990 3300005356 Ga0070674_100000216 Ga0070674_10000021615 381
991 3300005356 Ga0070674_100047854 Ga0070674_1000478544 381
992 3300005364 Ga0070673_100001299 Ga0070673_10000129916 381
993 3300005365 Ga0070688_100001065 Ga0070688_1000010655 381
994 3300005365 Ga0070688_100085170 Ga0070688_1000851702 381
995 3300005367 Ga0070667_100004535 Ga0070667_1000045353 381
996 3300005434 Ga0070709_10043745 Ga0070709_100437453 381
997 3300005435 Ga0070714_100002631 Ga0070714_1000026317 381
998 3300005436 Ga0070713_100025539 Ga0070713_1000255394 381
999 3300005437 Ga0070710_10007642 Ga0070710_100076426 381
1000 3300005438 Ga0070701_10018654 Ga0070701_100186543 381
1001 3300005457 Ga0070662_100000604 Ga0070662_10000060415 381
1002 3300005466 Ga0070685_10008115 Ga0070685_100081154 381
1003 3300005530 Ga0070679_100027088 Ga0070679_1000270883 381
1004 3300005535 Ga0070684_100038554 Ga0070684_1000385543 381
1005 3300005536 Ga0070697_100019948 Ga0070697_1000199482 381
1006 3300005539 Ga0068853_100002229 Ga0068853_10000222915 381
1007 3300005543 Ga0070672_100035343 Ga0070672_1000353433 381
1008 3300005544 Ga0070686_100007583 Ga0070686_1000075835 381
1009 3300005547 Ga0070693_100000285 Ga0070693_10000028517 381
1010 3300005563 Ga0068855_100017911 Ga0068855_10001791110 381
1011 3300005564 Ga0070664_100002460 Ga0070664_10000246017 381
1012 3300005577 Ga0068857_100009396 Ga0068857_1000093969 381
1013 3300005578 Ga0068854_100001563 Ga0068854_1000015635 381
1014 3300005615 Ga0070702_100005294 Ga0070702_1000052945 381
1015 3300005616 Ga0068852_100004868 Ga0068852_1000048687 381
1016 3300005617 Ga0068859_100121929 Ga0068859_1001219293 381
1017 3300005618 Ga0068864_100019253 Ga0068864_1000192532 381
1018 3300005719 Ga0068861_100003642 Ga0068861_1000036422 381
1019 3300005841 Ga0068863_100087143 Ga0068863_1000871432 381
1020 3300005843 Ga0068860_100002382 Ga0068860_10000238217 381
1021 3300005844 Ga0068862_100021798 Ga0068862_1000217982 381
1022 3300006038 Ga0075365_10043515 Ga0075365_100435151 381
1023 3300006163 Ga0070715_10000999 Ga0070715_100009995 381
1024 3300006173 Ga0070716_100004866 Ga0070716_1000048667 381
1025 3300006175 Ga0070712_100009628 Ga0070712_1000096283 381
1026 3300006237 Ga0097621_100065952 Ga0097621_1000659523 381
1027 3300006881 Ga0068865_100002002 Ga0068865_10000200215 381
1028 3300006931 Ga0097620_100121930 Ga0097620_1001219303 381
1029 3300009011 Ga0105251_10025163 Ga0105251_100251632 381
1030 3300009094 Ga0111539_10480252 Ga0111539_104802521 381
1031 3300009098 Ga0105245_10014514 Ga0105245_100145143 381
1032 3300009101 Ga0105247_10001618 Ga0105247_100016182 381
1033 3300009148 Ga0105243_10004747 Ga0105243_100047473 381
1034 3300009174 Ga0105241_10025603 Ga0105241_100256035 381
1035 3300009176 Ga0105242_10075995 Ga0105242_100759953 381
1036 3300009177 Ga0105248_10005005 Ga0105248_1000500517 381
1037 3300009177 Ga0105248_10030678 Ga0105248_100306783 381
1038 3300009545 Ga0105237_10040231 Ga0105237_100402314 381
1039 3300009551 Ga0105238_10110065 Ga0105238_101100653 381
1040 3300011119 Ga0105246_10001570 Ga0105246_100015706 381
1041 3300013100 Ga0157373_10059900 Ga0157373_100599003 381
1042 3300013102 Ga0157371_10011141 Ga0157371_100111415 381
1043 3300013104 Ga0157370_10033099 Ga0157370_100330995 381
1044 3300013249 Ga0171463_1006 Ga0171463_1006278 381
1045 3300013308 Ga0157375_10000397 Ga0157375_1000039713 381
1046 3300013308 Ga0157375_10027475 Ga0157375_100274755 381
1047 3300014325 Ga0163163_10056213 Ga0163163_100562133 381
1048 3300014326 Ga0157380_10014895 Ga0157380_100148951 381
1049 3300014745 Ga0157377_10004671 Ga0157377_100046718 381
1050 3300014968 Ga0157379_10002662 Ga0157379_100026623 381
1051 3300014968 Ga0157379_10056700 Ga0157379_100567003 381
1052 3300014969 Ga0157376_10001462 Ga0157376_1000146213 381
1053 3300014969 Ga0157376_10075130 Ga0157376_100751303 381
1054 3300015690 Ga0183363_1227 Ga0183363_12273 381
1055 3300025258 Ga0209129_1002718 Ga0209129_10027187 381
1056 3300025284 Ga0209130_1000037 Ga0209130_1000037225 381
1057 3300025292 Ga0209676_1003539 Ga0209676_10035396 381
1058 3300025292 Ga0209676_1008914 Ga0209676_10089143 381
1059 3300025294 Ga0209025_1000196 Ga0209025_1000196107 381
1060 3300025294 Ga0209025_1013072 Ga0209025_10130723 381
1061 3300025295 Ga0209564_1000086 Ga0209564_100008645 381
1062 3300025297 Ga0209758_1000576 Ga0209758_100057628 381
1063 3300025299 Ga0209256_1000321 Ga0209256_100032114 381
1064 3300025299 Ga0209256_1002621 Ga0209256_10026212 381
1065 3300025299 Ga0209256_1012480 Ga0209256_10124802 381
1066 3300025302 Ga0207426_1000048 Ga0207426_1000048265 381
1067 3300025302 Ga0207426_1002020 Ga0207426_10020207 381
1068 3300025303 Ga0209051_1008523 Ga0209051_10085234 381
1069 3300025303 Ga0209051_1041942 Ga0209051_10419421 381
1070 3300025304 Ga0209257_1004633 Ga0209257_10046338 381
1071 3300025304 Ga0209257_1004844 Ga0209257_10048443 381
1072 3300025898 Ga0207692_10006578 Ga0207692_100065785 381
1073 3300025900 Ga0207710_10003659 Ga0207710_100036598 381
1074 3300025901 Ga0207688_10006040 Ga0207688_100060407 381
1075 3300025903 Ga0207680_10023917 Ga0207680_100239173 381
1076 3300025904 Ga0207647_10003262 Ga0207647_100032624 381
1077 3300025907 Ga0207645_10018030 Ga0207645_100180304 381
1078 3300025911 Ga0207654_10016041 Ga0207654_100160413 381
1079 3300025914 Ga0207671_10026966 Ga0207671_100269663 381
1080 3300025915 Ga0207693_10002790 Ga0207693_1000279015 381
1081 3300025917 Ga0207660_10005450 Ga0207660_100054505 381
1082 3300025918 Ga0207662_10002012 Ga0207662_1000201213 381
1083 3300025919 Ga0207657_10006393 Ga0207657_100063934 381
1084 3300025920 Ga0207649_10003953 Ga0207649_100039534 381
1085 3300025924 Ga0207694_10080002 Ga0207694_100800023 381
1086 3300025925 Ga0207650_10030791 Ga0207650_100307913 381
1087 3300025927 Ga0207687_10027934 Ga0207687_100279343 381
1088 3300025928 Ga0207700_10020029 Ga0207700_100200294 381
1089 3300025931 Ga0207644_10016821 Ga0207644_100168215 381
1090 3300025931 Ga0207644_10042398 Ga0207644_100423983 381
1091 3300025932 Ga0207690_10001636 Ga0207690_1000163615 381
1092 3300025933 Ga0207706_10001549 Ga0207706_1000154915 381
1093 3300025935 Ga0207709_10008268 Ga0207709_100082683 381
1094 3300025936 Ga0207670_10007780 Ga0207670_100077803 381
1095 3300025936 Ga0207670_10066256 Ga0207670_100662562 381
1096 3300025937 Ga0207669_10016603 Ga0207669_100166032 381
1097 3300025937 Ga0207669_10023338 Ga0207669_100233384 381
1098 3300025939 Ga0207665_10002147 Ga0207665_100021475 381
1099 3300025940 Ga0207691_10020588 Ga0207691_100205885 381
1100 3300025942 Ga0207689_10015316 Ga0207689_100153163 381
1101 3300025960 Ga0207651_10003739 Ga0207651_100037398 381
1102 3300025972 Ga0207668_10003501 Ga0207668_1000350112 381
1103 3300025972 Ga0207668_10025353 Ga0207668_100253533 381
1104 3300025981 Ga0207640_10001586 Ga0207640_100015863 381
1105 3300025986 Ga0207658_10013167 Ga0207658_100131675 381
1106 3300026035 Ga0207703_10065760 Ga0207703_100657602 381
1107 3300026041 Ga0207639_10077638 Ga0207639_100776383 381
1108 3300026067 Ga0207678_10001431 Ga0207678_1000143114 381
1109 3300026075 Ga0207708_10005630 Ga0207708_100056308 381
1110 3300026088 Ga0207641_10160214 Ga0207641_101602143 381
1111 3300026089 Ga0207648_10039265 Ga0207648_100392653 381
1112 3300026116 Ga0207674_10005526 Ga0207674_1000552615 381
1113 3300026121 Ga0207683_10001480 Ga0207683_1000148014 381
1114 3300026142 Ga0207698_10002976 Ga0207698_100029764 381
1115 3300027717 Ga0209998_10005479 Ga0209998_100054793 381
1116 3300028379 Ga0268266_10029443 Ga0268266_100294433 381
1117 3300035241 Ga0373961_0014157 Ga0373961_0014157_41_1258 381
1118 3300035691 Ga0373931_0031774 Ga0373931_0031774_1162_2379 381
1119 3300037312 Ga0395899_0115466 Ga0395899_0115466_210_1379 381
1120 3300037418 Ga0395900_0028460 Ga0395900_0028460_240_1409 381
1121 3300037466 Ga0395898_0028293 Ga0395898_0028293_4302_5471 381
1122 3300037466 Ga0395898_0126795 Ga0395898_0126795_757_1986 381
1123 3300048903 Ga0496100_0006159 Ga0496100_0006159_753_1991 381
1124 3300048903 Ga0496100_0008467 Ga0496100_0008467_1744_2961 381
1125 3300048904 Ga0496101_0000994 Ga0496101_0000994_11527_12765 381
1126 3300048905 Ga0496102_0054032 Ga0496102_0054032_2233_3450 381
1127 3300048906 Ga0496103_0012644 Ga0496103_0012644_3451_4668 381
1128 3300048907 Ga0496104_0017841 Ga0496104_0017841_3970_5187 381
1129 3300048908 Ga0496105_0003294 Ga0496105_0003294_5927_7165 381
1130 3300048909 Ga0496106_0002538 Ga0496106_0002538_3989_5227 381
1131 3300048909 Ga0496106_0007118 Ga0496106_0007118_4273_5490 381
1132 3300048910 Ga0496107_0005509 Ga0496107_0005509_3293_4531 381
1133 3300048911 Ga0496108_0027714 Ga0496108_0027714_876_2105 381
1134 3300048911 Ga0496108_0042711 Ga0496108_0042711_2098_3336 381
1135 3300048911 Ga0496108_0056252 Ga0496108_0056252_927_2144 381
1136 3300048912 Ga0496109_0105695 Ga0496109_0105695_290_1528 381
1137 3300048913 Ga0496110_0005190 Ga0496110_0005190_3655_4872 381
1138 3300048913 Ga0496110_0102303 Ga0496110_0102303_755_1984 381
1139 3300048914 Ga0496111_0067954 Ga0496111_0067954_1161_2378 381
1140 3300048915 Ga0496112_0010710 Ga0496112_0010710_4857_6086 381
1141 3300048916 Ga0496113_0014864 Ga0496113_0014864_799_2016 381
1142 3300048916 Ga0496113_0104748 Ga0496113_0104748_23_1252 381
1143 3300048917 Ga0496114_0006817 Ga0496114_0006817_6981_8198 381
1144 3300048917 Ga0496114_0016605 Ga0496114_0016605_749_1987 381
1145 3300048918 Ga0496115_0002429 Ga0496115_0002429_5504_6742 381
1146 3300048918 Ga0496115_0006517 Ga0496115_0006517_4566_5783 381
1147 3300049572 Ga0501036_0022959 Ga0501036_0022959_3231_4457 381
1148 3300049576 Ga0501040_0027436 Ga0501040_0027436_1757_2983 381
1149 3300049576 Ga0501040_0140853 Ga0501040_0140853_205_1413 381
1150 3300049577 Ga0501041_0109868 Ga0501041_0109868_254_1441 381
1151 3300049578 Ga0501042_0014861 Ga0501042_0014861_2848_4074 381
1152 3300049578 Ga0501042_0036726 Ga0501042_0036726_1530_2717 381
1153 3300049579 Ga0501043_0060715 Ga0501043_0060715_1554_2741 381
1154 3300049582 Ga0501048_0048180 Ga0501048_0048180_1095_2321 381
1155 3300049582 Ga0501048_0076781 Ga0501048_0076781_260_1447 381
1156 3300049587 Ga0501071_0019517 Ga0501071_0019517_2120_3346 381
1157 3300049588 Ga0501072_0009194 Ga0501072_0009194_2662_3888 381
1158 3300049589 Ga0501073_0056594 Ga0501073_0056594_421_1647 381
1159 3300049591 Ga0501075_0005390 Ga0501075_0005390_6921_8147 381
1160 3300049592 Ga0501076_0035201 Ga0501076_0035201_1410_2636 381
1161 3300049593 Ga0501077_0008697 Ga0501077_0008697_621_1847 381
1162 3300049593 Ga0501077_0036555 Ga0501077_0036555_666_1883 381
1163 3300049593 Ga0501077_0056108 Ga0501077_0056108_1251_2438 381
1164 3300049741 Ga0501079_0095152 Ga0501079_0095152_170_1396 381
1165 3300049743 Ga0501081_0012642 Ga0501081_0012642_3975_5201 381
1166 3300049743 Ga0501081_0031811 Ga0501081_0031811_1182_2369 381
1167 3300049743 Ga0501081_0129408 Ga0501081_0129408_250_1458 381
1168 3300049824 Ga0501045_0010352 Ga0501045_0010352_223_1449 381
1169 3300050492 nmdc:mga0yw44_2069_c2 nmdc:mga0yw44_2069_c2_34_1305 381
1170 3300053125 Ga0500618_011556 Ga0500618_011556_519_1880 381
1171 3300053161 Ga0500634_0033297 Ga0500634_0033297_757_1908 381
1172 3300054114 Ga0501084_0061685 Ga0501084_0061685_520_1746 381
1173 3300060353 Ga0501082_0237340 Ga0501082_0237340_278_1486 381
1174 3300061734 Ga0530510_0062824 Ga0530510_0062824_1285_2511 381
1175 3300002773 JGI25152J39213_1009370 JGI25152J39213_10093703 382
1176 3300002774 JGI25150J39212_1002811 JGI25150J39212_10028113 382
1177 3300002987 JGI25159J45721_1000508 JGI25159J45721_10005089 382
1178 3300003187 JGI25151J46595_10003417 JGI25151J46595_100034176 382
1179 3300003187 JGI25151J46595_10032321 JGI25151J46595_100323213 382
1180 3300003215 JGI25153J46596_10004999 JGI25153J46596_100049991 382
1181 3300003215 JGI25153J46596_10038136 JGI25153J46596_100381362 382
1182 3300003374 JGI25161J50226_1000120 JGI25161J50226_100012026 382
1183 3300003771 Ga0055526_1002044 Ga0055526_10020447 382
1184 3300003771 Ga0055526_1002151 Ga0055526_10021513 382
1185 3300003771 Ga0055526_1018637 Ga0055526_10186373 382
1186 3300003775 Ga0055524_1002134 Ga0055524_10021349 382
1187 3300003775 Ga0055524_1003185 Ga0055524_10031857 382
1188 3300003790 Ga0055528_1000445 Ga0055528_100044519 382
1189 3300003790 Ga0055528_1000693 Ga0055528_10006939 382
1190 3300003790 Ga0055528_1002180 Ga0055528_10021804 382
1191 3300003790 Ga0055528_1015774 Ga0055528_10157742 382
1192 3300003790 Ga0055528_1021652 Ga0055528_10216522 382
1193 3300003792 Ga0055540_1002182 Ga0055540_10021827 382
1194 3300003792 Ga0055540_1002353 Ga0055540_10023532 382
1195 3300004625 Ga0055543_1000155 Ga0055543_100015524 382
1196 3300005262 Ga0065165_1009728 Ga0065165_10097282 382
1197 3300005548 Ga0070665_100297393 Ga0070665_1002973932 382
1198 3300006048 Ga0075363_100007595 Ga0075363_1000075955 382
1199 3300006177 Ga0075362_10109047 Ga0075362_101090471 382
1200 3300006178 Ga0075367_10008749 Ga0075367_100087494 382
1201 3300006186 Ga0075369_10001874 Ga0075369_100018745 382
1202 3300006195 Ga0075366_10128412 Ga0075366_101284121 382
1203 3300006353 Ga0075370_10008293 Ga0075370_100082934 382
1204 3300006946 Ga0079104_1000753 Ga0079104_100075314 382
1205 3300009765 Ga0123341_1000016 Ga0123341_100001666 382
1206 3300021320 Ga0214544_1000063 Ga0214544_100006343 382
1207 3300021321 Ga0214542_1000095 Ga0214542_100009533 382
1208 3300021327 Ga0214543_1000026 Ga0214543_100002633 382
1209 3300025208 Ga0209436_100041 Ga0209436_1000419 382
1210 3300025245 Ga0207425_1002069 Ga0207425_10020696 382
1211 3300025245 Ga0207425_1002695 Ga0207425_10026951 382
1212 3300025258 Ga0209129_1000199 Ga0209129_100019914 382
1213 3300025258 Ga0209129_1001513 Ga0209129_100151311 382
1214 3300025258 Ga0209129_1001544 Ga0209129_10015443 382
1215 3300025258 Ga0209129_1009357 Ga0209129_10093573 382
1216 3300025258 Ga0209129_1014942 Ga0209129_10149421 382
1217 3300025273 Ga0209673_1000037 Ga0209673_1000037125 382
1218 3300025273 Ga0209673_1000060 Ga0209673_1000060230 382
1219 3300025273 Ga0209673_1001773 Ga0209673_100177312 382
1220 3300025273 Ga0209673_1001909 Ga0209673_10019094 382
1221 3300025273 Ga0209673_1002125 Ga0209673_10021254 382
1222 3300025273 Ga0209673_1023295 Ga0209673_10232953 382
1223 3300025284 Ga0209130_1000030 Ga0209130_1000030150 382
1224 3300025294 Ga0209025_1001009 Ga0209025_100100920 382
1225 3300025294 Ga0209025_1001184 Ga0209025_100118413 382
1226 3300025294 Ga0209025_1003594 Ga0209025_10035946 382
1227 3300025294 Ga0209025_1012061 Ga0209025_10120613 382
1228 3300025294 Ga0209025_1015920 Ga0209025_10159202 382
1229 3300025295 Ga0209564_1000281 Ga0209564_100028173 382
1230 3300025295 Ga0209564_1000937 Ga0209564_100093722 382
1231 3300025295 Ga0209564_1001052 Ga0209564_100105211 382
1232 3300025295 Ga0209564_1022032 Ga0209564_10220321 382
1233 3300025297 Ga0209758_1000637 Ga0209758_100063722 382
1234 3300025297 Ga0209758_1001377 Ga0209758_100137725 382
1235 3300025297 Ga0209758_1001843 Ga0209758_100184312 382
1236 3300025297 Ga0209758_1001862 Ga0209758_100186211 382
1237 3300025297 Ga0209758_1004801 Ga0209758_10048017 382
1238 3300025297 Ga0209758_1014154 Ga0209758_10141544 382
1239 3300025298 Ga0209050_1004517 Ga0209050_10045173 382
1240 3300025299 Ga0209256_1000348 Ga0209256_100034817 382
1241 3300025299 Ga0209256_1001295 Ga0209256_10012956 382
1242 3300025302 Ga0207426_1000047 Ga0207426_1000047250 382
1243 3300025303 Ga0209051_1000236 Ga0209051_100023677 382
1244 3300025303 Ga0209051_1020077 Ga0209051_10200772 382
1245 3300025304 Ga0209257_1002011 Ga0209257_10020113 382
1246 3300025304 Ga0209257_1020335 Ga0209257_10203353 382
1247 3300025923 Ga0207681_10038013 Ga0207681_100380133 382
1248 3300026118 Ga0207675_100098170 Ga0207675_1000981703 382
1249 3300027111 Ga0209281_1000081 Ga0209281_1000081165 382
1250 3300027666 Ga0209282_1000036 Ga0209282_100003673 382
1251 3300028794 Ga0307515_10000263 Ga0307515_1000026391 382
1252 3300028794 Ga0307515_10002397 Ga0307515_1000239714 382
1253 3300031456 Ga0307513_10001607 Ga0307513_1000160718 382
1254 3300031967 Ga0315914_1000002 Ga0315914_1000002271 382
1255 3300033464 Ga0315915_1000005 Ga0315915_1000005271 382
1256 3300041413 Ga0439465_0000653 Ga0439465_0000653_5579_6760 382
1257 3300041413 Ga0439465_0018348 Ga0439465_0018348_112_1260 382
1258 3300041494 Ga0451837_1572201 Ga0451837_1572201_402_1550 382
1259 3300041498 Ga0451841_1185357 Ga0451841_1185357_1989_3137 382
1260 3300041501 Ga0451845_0694601 Ga0451845_0694601_299_1447 382
1261 3300041503 Ga0451847_0959938 Ga0451847_0959938_269_1417 382
1262 3300041507 Ga0451851_0367807 Ga0451851_0367807_594_1742 382
1263 3300042007 Ga0439449_0029037 Ga0439449_0029037_353_1534 382
1264 3300046492 Ga0495585_0069453 Ga0495585_0069453_583_1731 382
1265 3300046501 Ga0495607_0024450 Ga0495607_0024450_1275_2423 382
1266 3300046506 Ga0495583_0015009 Ga0495583_0015009_2766_3914 382
1267 3300046506 Ga0495583_0063670 Ga0495583_0063670_148_1296 382
1268 3300046519 Ga0495632_0040659 Ga0495632_0040659_505_1653 382
1269 3300046522 Ga0495643_0008740 Ga0495643_0008740_1790_2938 382
1270 3300046522 Ga0495643_0017019 Ga0495643_0017019_2605_3753 382
1271 3300046530 Ga0495654_0010022 Ga0495654_0010022_2823_3971 382
1272 3300046616 Ga0495668_0009867 Ga0495668_0009867_1727_2875 382
1273 3300046660 Ga0495625_0003234 Ga0495625_0003234_5793_6941 382
1274 3300046660 Ga0495625_0087585 Ga0495625_0087585_56_1204 382
1275 3300046691 Ga0495670_0004365 Ga0495670_0004365_4844_5992 382
1276 3300046694 Ga0495649_0123799 Ga0495649_0123799_39_1187 382
1277 3300046810 Ga0495660_0055669 Ga0495660_0055669_897_2045 382
1278 3300046810 Ga0495660_0056700 Ga0495660_0056700_758_1906 382
1279 3300047472 Ga0495686_0034885 Ga0495686_0034885_150_1298 382
1280 3300048909 Ga0496106_0001184 Ga0496106_0001184_12578_13726 382
1281 3300048920 Ga0496117_0088002 Ga0496117_0088002_332_1480 382
1282 3300048921 Ga0496118_0007747 Ga0496118_0007747_5304_6452 382
1283 3300048924 Ga0496121_0034233 Ga0496121_0034233_2162_3310 382
1284 3300048927 Ga0496124_0209418 Ga0496124_0209418_303_1451 382
1285 3300048929 Ga0496126_0113574 Ga0496126_0113574_1188_2336 382
1286 3300049574 Ga0501038_0129396 Ga0501038_0129396_826_2064 382
1287 3300050490 nmdc:mga03n38_51117_c1 nmdc:mga03n38_51117_c1_123_1271 382
1288 3300050494 nmdc:mga06z11_118719_c1 nmdc:mga06z11_118719_c1_118_1266 382
1289 3300053134 Ga0500658_0007610 Ga0500658_0007610_1391_2539 382
1290 3300053139 Ga0500568_0004679 Ga0500568_0004679_605_1810 382
1291 3300053153 Ga0500616_0005255 Ga0500616_0005255_3359_4564 382
1292 3300053156 Ga0500622_0001347 Ga0500622_0001347_5561_6709 382
1293 iso_pu_bacteria 2643221618 2644108466 382
1294 iso_pu_bacteria 2643221626 2644145512 382
1295 iso_pu_bacteria 2643221655 2644312411 382
1296 iso_pu_bacteria 2643221659 2644336039 382
1297 iso_pu_bacteria 2643221698 2644546896 382
1298 iso_pu_bacteria 2643221712 2644618094 382
1299 iso_pu_bacteria 2941499720 2941501680 382
1300 iso_pu_bacteria 3003930520 3003934945 382
1301 3300025294 Ga0209025_1000052 Ga0209025_1000052170 383
1302 3300036401 Ga0373937_0297060 Ga0373937_0297060_210_1469 383
1303 3300048908 Ga0496105_0109520 Ga0496105_0109520_68_1327 383
1304 3300048912 Ga0496109_0028295 Ga0496109_0028295_2173_3432 383
1305 3300048922 Ga0496119_0008324 Ga0496119_0008324_401_1708 383
1306 3300048925 Ga0496122_0099541 Ga0496122_0099541_185_1636 383
1307 3300048926 Ga0496123_0085424 Ga0496123_0085424_546_1877 383
1308 3300049568 Ga0501031_0056435 Ga0501031_0056435_1102_2259 383
1309 3300049569 Ga0501032_0078550 Ga0501032_0078550_203_1360 383
1310 3300049822 Ga0501035_0148693 Ga0501035_0148693_686_1843 383
1311 3300049823 Ga0501044_0038076 Ga0501044_0038076_1825_2982 383
1312 iso_pu_bacteria 2510917022 2511136548 383
1313 iso_pu_bacteria 2524023209 2524460056 383
1314 iso_pu_bacteria 2534681786 2535486916 383
1315 iso_pu_bacteria 2582581307 2585274295 383
1316 iso_pu_bacteria 2582581308 2585280291 383
1317 iso_pu_bacteria 2582581315 2585322569 383
1318 iso_pu_bacteria 2582581316 2585335183 383
1319 iso_pu_bacteria 2585427527 2585532520 383
1320 iso_pu_bacteria 2585427530 2585554463 383
1321 iso_pu_bacteria 2585427531 2585560744 383
1322 iso_pu_bacteria 2585427608 2585898949 383
1323 iso_pu_bacteria 2585427609 2585903458 383
1324 iso_pu_bacteria 2585428125 2587981423 383
1325 iso_pu_bacteria 2615840626 2616307409 383
1326 iso_pu_bacteria 2615840698 2616554953 383
1327 iso_pu_bacteria 2617270742 2617383406 383
1328 iso_pu_bacteria 2667528174 2671112201 383
1329 iso_pu_bacteria 2757320392 2757572557 383
1330 iso_pu_bacteria 2758568016 2758642345 383
1331 iso_pu_bacteria 2775507266 2778176019 383
1332 iso_pu_bacteria 2818991448 2819609592 383
1333 iso_pu_bacteria 2818991453 2819639690 383
1334 iso_pu_bacteria 2838029111 2838033140 383
1335 iso_pu_bacteria 2842298080 2842298719 383
1336 iso_pu_bacteria 2842357229 2842359413 383
1337 iso_pu_bacteria 2842475841 2842479873 383
1338 iso_pu_bacteria 2842482326 2842483379 383
1339 iso_pu_bacteria 2842502639 2842507049 383
1340 iso_pu_bacteria 2842509118 2842510744 383
1341 iso_pu_bacteria 2852387548 2852391230 383
1342 iso_pu_bacteria 2854911287 2854912695 383
1343 iso_pu_bacteria 2915650412 2915653414 383
1344 iso_pu_bacteria 2919408235 2919410687 383
1345 iso_pu_bacteria 3005416602 3005418478 383
1346 iso_pu_bacteria 8005314921 8005318630 383
1347 iso_pu_bacteria 8005484373 8005488485 383
1348 iso_pu_bacteria 8005645114 8005648952 383
1349 iso_pu_bacteria 8005682033 8005682192 383
1350 iso_pu_bacteria 8024486573 8024487000 383
1351 iso_pu_bacteria 8046767195 8046773212 383
1352 iso_pu_bacteria 8057575449 8057581051 383
1353 3300002704 JGI25155J39150_1000012 JGI25155J39150_1000012148 387
1354 3300002705 JGI25156J39149_1000036 JGI25156J39149_100003632 387
1355 3300002737 JGI25162J39368_1000641 JGI25162J39368_100064116 387
1356 3300002737 JGI25162J39368_1000669 JGI25162J39368_100066916 387
1357 3300002738 JGI25154J39366_1000033 JGI25154J39366_100003324 387
1358 3300002741 JGI25157J39369_1000124 JGI25157J39369_100012417 387
1359 3300003214 JGI25165J46597_1000758 JGI25165J46597_10007586 387
1360 3300003214 JGI25165J46597_1001693 JGI25165J46597_10016939 387
1361 3300003354 JGI25160J50197_1000006 JGI25160J50197_100000693 387
1362 3300003374 JGI25161J50226_1000004 JGI25161J50226_100000493 387
1363 3300003578 Ga0006562J51391_1021693 Ga0006562J51391_10216933 387
1364 3300004625 Ga0055543_1000002 Ga0055543_1000002241 387
1365 3300005262 Ga0065165_1000391 Ga0065165_100039169 387
1366 3300005834 Ga0068851_10058825 Ga0068851_100588252 387
1367 3300009093 Ga0105240_10000019 Ga0105240_10000019150 387
1368 3300009545 Ga0105237_10001429 Ga0105237_1000142923 387
1369 3300010375 Ga0105239_10011981 Ga0105239_100119813 387
1370 3300013104 Ga0157370_10001824 Ga0157370_1000182418 387
1371 3300014497 Ga0182008_10010866 Ga0182008_100108663 387
1372 3300015262 Ga0182007_10001337 Ga0182007_100013376 387
1373 3300025206 Ga0209435_100005 Ga0209435_100005148 387
1374 3300025228 Ga0209672_108136 Ga0209672_1081361 387
1375 3300025233 Ga0209437_100078 Ga0209437_100078171 387
1376 3300025233 Ga0209437_100174 Ga0209437_1001749 387
1377 3300025233 Ga0209437_107444 Ga0209437_1074442 387
1378 3300025246 Ga0209646_1000011 Ga0209646_1000011148 387
1379 3300025250 Ga0209026_1000008 Ga0209026_1000008148 387
1380 3300025253 Ga0209677_100286 Ga0209677_10028614 387
1381 3300025256 Ga0209759_1000004 Ga0209759_1000004148 387
1382 3300025261 Ga0209233_1000192 Ga0209233_10001929 387
1383 3300025261 Ga0209233_1000194 Ga0209233_10001949 387
1384 3300025261 Ga0209233_1000476 Ga0209233_100047616 387
1385 3300025284 Ga0209130_1000032 Ga0209130_100003289 387
1386 3300025302 Ga0207426_1000077 Ga0207426_100007789 387
1387 3300025321 Ga0207656_10036067 Ga0207656_100360672 387
1388 3300025913 Ga0207695_10000049 Ga0207695_10000049152 387
1389 3300025914 Ga0207671_10000107 Ga0207671_1000010717 387
1390 3300044765 Ga0466970_0005373 Ga0466970_0005373_209_1381 387
1391 3300046459 Ga0495629_0073461 Ga0495629_0073461_57_1220 387
1392 3300046476 Ga0495662_0019662 Ga0495662_0019662_1676_2839 387
1393 3300046477 Ga0495664_0089837 Ga0495664_0089837_69_1232 387
1394 3300046507 Ga0495606_0003402 Ga0495606_0003402_3966_5129 387
1395 3300046674 Ga0495588_0074379 Ga0495588_0074379_349_1512 387
1396 3300046809 Ga0495600_0022575 Ga0495600_0022575_1309_2472 387
1397 3300047472 Ga0495686_0001666 Ga0495686_0001666_9129_10292 387
1398 3300047472 Ga0495686_0007561 Ga0495686_0007561_3225_4388 387
1399 3300048919 Ga0496116_0018295 Ga0496116_0018295_330_1502 387
1400 3300048920 Ga0496117_0001980 Ga0496117_0001980_18837_20009 387
1401 3300048921 Ga0496118_0002011 Ga0496118_0002011_19817_20989 387
1402 3300048922 Ga0496119_0013421 Ga0496119_0013421_3779_4951 387
1403 3300048923 Ga0496120_0064507 Ga0496120_0064507_485_1657 387
1404 3300048924 Ga0496121_0002604 Ga0496121_0002604_7237_8409 387
1405 3300048925 Ga0496122_0036587 Ga0496122_0036587_712_1884 387
1406 3300048926 Ga0496123_0011402 Ga0496123_0011402_561_1733 387
1407 3300048926 Ga0496123_0054107 Ga0496123_0054107_1242_2405 387
1408 3300048927 Ga0496124_0029558 Ga0496124_0029558_636_1799 387
1409 3300048927 Ga0496124_0097388 Ga0496124_0097388_357_1529 387
1410 3300048929 Ga0496126_0063976 Ga0496126_0063976_1064_2236 387
1411 3300053148 Ga0500590_043534 Ga0500590_043534_822_1985 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

149

374

0.96

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

4

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9888 4 373
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9838 4 370
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9799 4 373
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9782 4 370
3p2y-assembly1.cif.gz_A-2 crystal structure of alanine dehydrogenase/pyridine nucleotide transhydrogenase from mycobacterium smegmatis 0.9727 4 362
ID Description Score Start End Superfamily
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9909 168 200 3.50.50.60
4dioB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9889 5 137 3.40.50.720
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9726 168 199 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9702 168 200 3.50.50.60
1x13B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9683 1 137 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5R2MTW3-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9986 32 125 GO:0005886
GO:0006740
GO:0050661
AF-A0A526Y3I6-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9984 83 205 GO:0005886
GO:0006740
GO:0016491
GO:0050661
AF-A0A527Z3W9-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9966 32 116 GO:0005886
GO:0006740
GO:0050661
AF-A0A3S4IYE5-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9965 124 208 GO:0005886
GO:0006740
GO:0016491
GO:0050661
AF-H0HQ53-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9964 4 142 GO:0005886
GO:0006740
GO:0050661

Feature Viewer

pLDDT pTM Quality
93.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map