F493756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1411 | 956 | 900 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0008525|Ga0501047_0008525_6473_7624 |
| Length | 383 |
| Sequence | MIIAVPQETAEGERRVALVPAAAATLKKAGHDIRVERGAGLSSGFHDSDYERVGASLYDNRAALLAEAETIVQVKAAGANPNNGMQDIGALHGGQTLIGFAEPLTAHDATRALSERGVALLAMELIPRITRAQAMDALSSQANLAGYKAVVKAADLIGQAFPMFITAAGTIQPAKVFIIGAGVAGLQAIATAKRLGAXXXXIDVRPEVKEQVESLGARFVMPPVQASGEGGYAKELTDEQKAQXXXMMADTVADADVVVTTALIPGRPAPRLVTAAMVQRMRSGSVIVDLGAERGGNVEGTEAGKIIDKNGVLLVGAINTASEVAHDASSMYAGNIVKLIQHLTGKNAQQIQWNLEDPIIAGALVCKGGKIVHPQVKKSMGIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 18 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 23 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 29 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 30 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 31 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 32 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 33 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 34 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 35 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 36 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 37 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 38 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 39 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 40 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 41 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 42 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 43 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 44 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 45 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 46 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 47 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 48 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 49 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 50 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 51 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 52 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 53 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 54 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 55 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 56 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 57 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 58 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 59 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 60 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 61 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 62 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 63 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 64 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 65 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 66 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 67 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 68 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 69 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 70 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 71 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 72 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 73 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 74 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 75 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 78 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 79 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 80 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 81 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 82 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 83 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 84 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 85 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 86 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 87 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 88 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 89 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 90 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 91 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 92 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 93 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 94 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 95 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 96 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 97 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 98 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 99 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 100 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 101 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 102 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 103 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 104 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 105 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 106 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 107 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 108 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 109 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 110 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 111 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 112 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 113 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 114 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 115 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 116 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 117 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 118 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 119 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 120 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 121 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 122 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 123 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 124 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 125 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 126 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 127 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 128 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 129 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 130 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 131 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 132 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 133 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 134 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 135 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 136 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 137 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 138 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 139 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 140 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 141 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 142 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 143 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 144 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 145 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 146 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 147 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 148 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 149 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 150 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 151 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 152 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 153 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 154 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 155 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 156 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 157 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 158 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 159 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 160 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 161 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 162 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 163 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 164 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 165 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 166 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 167 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 168 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 169 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 170 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 171 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 172 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 173 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 174 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 175 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 176 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 177 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 178 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 179 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 180 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 181 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 182 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 183 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 184 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 185 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 186 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 187 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 188 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 189 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 190 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 191 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 192 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 193 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 194 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 195 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 196 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 197 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 198 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 199 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 200 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 201 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 202 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 203 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 204 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 205 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 206 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 207 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 208 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 209 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 210 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 211 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 212 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 213 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 214 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 215 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 216 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 217 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 218 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 219 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 220 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 221 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 222 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 223 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 224 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 225 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 226 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 227 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 228 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 229 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 230 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 231 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 232 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 233 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 234 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 235 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 236 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 237 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 238 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 239 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 240 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 241 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 242 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 243 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 244 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 245 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 246 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 247 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 248 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 249 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 250 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 251 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 252 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 253 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 254 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 255 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 256 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 257 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 258 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 259 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 260 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 261 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 262 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 263 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 264 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 265 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 266 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 267 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 268 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 269 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 270 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 271 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 272 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 273 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 274 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 275 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 276 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 277 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 278 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 279 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 280 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 281 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 282 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 283 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 284 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 285 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 286 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 287 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 288 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 289 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 290 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 291 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 292 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 293 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 294 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 295 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 296 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 297 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 298 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 299 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 300 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 301 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 302 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 303 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 304 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 305 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 306 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 307 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 308 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 309 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 310 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 311 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 312 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 313 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 314 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 315 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 316 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 317 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 318 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 319 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 320 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 321 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 322 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 323 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 324 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 325 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 326 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 327 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 328 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 329 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 330 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 331 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 332 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 333 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 334 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 335 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 336 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 337 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 338 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 339 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 340 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 341 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 342 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 343 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 344 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 345 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 346 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 347 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 348 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 349 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 350 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 351 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 352 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 353 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 354 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 355 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 356 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 357 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 358 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 359 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 360 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 361 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 362 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 363 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 364 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 365 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 366 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 367 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 368 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 369 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 370 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 371 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 372 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 373 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 374 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 375 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 376 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 377 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 378 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 379 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 380 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 381 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 382 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 383 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 384 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 385 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 386 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 387 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 388 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 389 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 390 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 391 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 392 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 393 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 394 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 395 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 396 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 397 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 398 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 399 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 400 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 401 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 402 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 403 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 404 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 405 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 406 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 407 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 408 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 409 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 410 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 411 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 412 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 413 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 414 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 415 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 416 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 417 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 418 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 419 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 420 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 421 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 422 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 423 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 424 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 425 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 426 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 427 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 428 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 429 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 430 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 431 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 432 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 433 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 434 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 435 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 436 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 437 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 438 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 439 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 440 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 441 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 442 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 443 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 444 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 445 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 446 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 447 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 448 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 449 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 450 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 451 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 452 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 453 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 454 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 455 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 456 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 457 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 458 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 459 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 460 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 461 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 462 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 463 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 464 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 465 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 466 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 467 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 468 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 469 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 470 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 471 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 472 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 473 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 474 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 475 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 476 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 477 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 478 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 479 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 480 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 481 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 482 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 483 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 484 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 485 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 487 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 488 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 489 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 490 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 491 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 492 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 493 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 494 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 495 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 500 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 501 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 502 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 503 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 504 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 505 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 506 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 507 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 508 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 509 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 510 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 511 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 512 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 513 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 514 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 515 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 516 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 517 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 518 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 520 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 521 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 522 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 523 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 524 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 525 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 526 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 528 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 530 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 531 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 533 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 534 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 535 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 536 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 537 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 538 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 539 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 540 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 541 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 542 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 543 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 544 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 545 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 546 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 547 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 548 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 549 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 550 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 551 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 552 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 553 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 554 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 555 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 556 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 557 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 558 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 559 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 561 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 562 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 563 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 564 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 565 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 566 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 567 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 568 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 569 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 571 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 572 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 573 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 574 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 576 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 577 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 579 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 580 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 581 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 582 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 583 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 584 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 585 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 586 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 587 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 588 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 589 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 590 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 591 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 592 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 593 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 594 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 595 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 596 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 597 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 598 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 599 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 600 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 601 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 602 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 603 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 604 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 605 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 606 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 607 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 608 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 609 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 611 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 612 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 613 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 614 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 616 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 617 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 618 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 619 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 620 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 621 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 622 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 623 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 624 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 625 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 626 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 627 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 628 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 629 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 681 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 682 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 684 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 685 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 689 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 690 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 691 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 692 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 693 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 694 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 695 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 696 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 697 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 698 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 699 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 700 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 701 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 702 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 703 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 704 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 705 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 706 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 707 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 709 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 710 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 711 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 712 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 713 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 714 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 715 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 716 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 717 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 718 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 719 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 720 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 721 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 722 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 723 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 724 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 725 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 726 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 727 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 728 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 729 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 730 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 731 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 732 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 733 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 734 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 735 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 736 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 737 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 738 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 739 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 740 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 741 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 742 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 743 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 744 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 745 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 746 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 747 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 748 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 749 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 750 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 751 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 752 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 753 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 754 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 755 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 756 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 821 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 822 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 823 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 824 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 825 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 826 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 827 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 828 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 829 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 830 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 831 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 832 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 833 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 834 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 835 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 836 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 837 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 838 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 839 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 840 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 841 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 842 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 843 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 844 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 845 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 846 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 847 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 848 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 849 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 850 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 851 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 852 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 853 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 854 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 855 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 856 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 857 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 858 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 859 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 860 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 861 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 862 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 863 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 864 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 865 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 866 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 867 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 868 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 869 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 870 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 871 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 872 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 873 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 874 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 875 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 876 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 877 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 878 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 879 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 880 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 881 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 882 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 883 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 884 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 885 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 886 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 887 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 888 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 889 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 890 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 891 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 892 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 893 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 894 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 899 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 900 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 901 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 902 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 903 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 904 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 905 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 906 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 907 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 908 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 909 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 910 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 911 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 912 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 913 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 914 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 915 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 916 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 917 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 918 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 919 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 920 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 921 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 922 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 923 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 924 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 925 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 926 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 927 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 928 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 929 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 930 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 931 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 932 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 933 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 934 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 935 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 936 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 937 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 938 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 939 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 940 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 941 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 942 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 943 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 944 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 945 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 946 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 947 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 948 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 949 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 950 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 951 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 952 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 953 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 954 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 955 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 956 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.64 |
| Metatranscriptomes | 0.14 |
| Isolates | 36.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.34 |
| Nodule | 28.84 |
| Rhizoplane | 4.32 |
| Rhizosphere | 46.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 2 | JGI25156J39149_1000036 | 3300002705 | Bacteria | 110527 |
| 3 | JGI25162J39368_1000641 | 3300002737 | Bacteria | 24773 |
| 4 | JGI25162J39368_1000669 | 3300002737 | Bacteria | 24197 |
| 5 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 6 | JGI25157J39369_1000124 | 3300002741 | Bacteria | 65844 |
| 7 | JGI25152J39213_1009370 | 3300002773 | Bacteria | 2331 |
| 8 | JGI25150J39212_1002811 | 3300002774 | Bacteria | 4222 |
| 9 | JGI25159J45721_1000032 | 3300002987 | Bacteria | 90158 |
| 10 | JGI25159J45721_1000508 | 3300002987 | Bacteria | 17749 |
| 11 | JGI25151J46595_10003417 | 3300003187 | Bacteria | 8786 |
| 12 | JGI25151J46595_10009531 | 3300003187 | Bacteria | 4587 |
| 13 | JGI25151J46595_10032321 | 3300003187 | Bacteria | 2030 |
| 14 | JGI25165J46597_1000758 | 3300003214 | Bacteria | 24773 |
| 15 | JGI25165J46597_1001693 | 3300003214 | Bacteria | 9952 |
| 16 | JGI25153J46596_10004999 | 3300003215 | Bacteria | 7034 |
| 17 | JGI25153J46596_10038136 | 3300003215 | Bacteria | 1519 |
| 18 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 19 | JGI25160J50197_1000009 | 3300003354 | Bacteria | 282862 |
| 20 | JGI25160J50197_1011868 | 3300003354 | Bacteria | 3057 |
| 21 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 22 | JGI25161J50226_1000120 | 3300003374 | Bacteria | 57896 |
| 23 | JGI25161J50226_1000240 | 3300003374 | Bacteria | 32956 |
| 24 | Ga0006562J51391_1021693 | 3300003578 | Bacteria | 5770 |
| 25 | JGI25404J52841_10000756 | 3300003659 | Bacteria | 5073 |
| 26 | Ga0055526_1001379 | 3300003771 | Bacteria | 17367 |
| 27 | Ga0055526_1002044 | 3300003771 | Bacteria | 13881 |
| 28 | Ga0055526_1002151 | 3300003771 | Bacteria | 13515 |
| 29 | Ga0055526_1018637 | 3300003771 | Bacteria | 2580 |
| 30 | Ga0055524_1002134 | 3300003775 | Bacteria | 10403 |
| 31 | Ga0055524_1003185 | 3300003775 | Bacteria | 8059 |
| 32 | Ga0055524_1004686 | 3300003775 | Bacteria | 6265 |
| 33 | Ga0055524_1005912 | 3300003775 | Bacteria | 5389 |
| 34 | Ga0055536_1002454 | 3300003781 | Bacteria | 10410 |
| 35 | Ga0055536_1012053 | 3300003781 | Bacteria | 3245 |
| 36 | Ga0055528_1000445 | 3300003790 | Bacteria | 33070 |
| 37 | Ga0055528_1000693 | 3300003790 | Bacteria | 24016 |
| 38 | Ga0055528_1002180 | 3300003790 | Bacteria | 10724 |
| 39 | Ga0055528_1015774 | 3300003790 | Bacteria | 2709 |
| 40 | Ga0055528_1021652 | 3300003790 | Bacteria | 2030 |
| 41 | Ga0055528_1023626 | 3300003790 | Bacteria | 1868 |
| 42 | Ga0055540_1002182 | 3300003792 | Bacteria | 10641 |
| 43 | Ga0055540_1002353 | 3300003792 | Bacteria | 10116 |
| 44 | Ga0055540_1003170 | 3300003792 | Bacteria | 8116 |
| 45 | Ga0055531_10002326 | 3300003794 | Bacteria | 12826 |
| 46 | Ga0055531_10011072 | 3300003794 | Bacteria | 4401 |
| 47 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 48 | Ga0055543_1000055 | 3300004625 | Bacteria | 103837 |
| 49 | Ga0055543_1000155 | 3300004625 | Bacteria | 57253 |
| 50 | Ga0065165_1000020 | 3300005262 | Bacteria | 265570 |
| 51 | Ga0065165_1000391 | 3300005262 | Bacteria | 71184 |
| 52 | Ga0065165_1009728 | 3300005262 | Bacteria | 4260 |
| 53 | Ga0070658_10024041 | 3300005327 | Bacteria | 4890 |
| 54 | Ga0070683_100020763 | 3300005329 | Bacteria | 5850 |
| 55 | Ga0068869_100010176 | 3300005334 | Bacteria | 6124 |
| 56 | Ga0070666_10035078 | 3300005335 | Bacteria | 3325 |
| 57 | Ga0070680_100002445 | 3300005336 | Bacteria | 13764 |
| 58 | Ga0070680_100008772 | 3300005336 | Bacteria | 7755 |
| 59 | Ga0070682_100001331 | 3300005337 | Bacteria | 13981 |
| 60 | Ga0070660_100001803 | 3300005339 | Bacteria | 14705 |
| 61 | Ga0070689_100000297 | 3300005340 | Bacteria | 28868 |
| 62 | Ga0070691_10004703 | 3300005341 | Bacteria | 6208 |
| 63 | Ga0070687_100091232 | 3300005343 | Bacteria | 1686 |
| 64 | Ga0070661_100018427 | 3300005344 | Bacteria | 4962 |
| 65 | Ga0070692_10001269 | 3300005345 | Bacteria | 9012 |
| 66 | Ga0070668_100015668 | 3300005347 | Bacteria | 5669 |
| 67 | Ga0070668_100036586 | 3300005347 | Bacteria | 3747 |
| 68 | Ga0070668_100050203 | 3300005347 | Bacteria | 3211 |
| 69 | Ga0070669_100001902 | 3300005353 | Bacteria | 15072 |
| 70 | Ga0070675_100008391 | 3300005354 | Bacteria | 8017 |
| 71 | Ga0070675_100174193 | 3300005354 | Bacteria | 1857 |
| 72 | Ga0070674_100000216 | 3300005356 | Bacteria | 27872 |
| 73 | Ga0070674_100047854 | 3300005356 | Bacteria | 2933 |
| 74 | Ga0070673_100001299 | 3300005364 | Bacteria | 14558 |
| 75 | Ga0070688_100001065 | 3300005365 | Bacteria | 13776 |
| 76 | Ga0070688_100085170 | 3300005365 | Bacteria | 2054 |
| 77 | Ga0070667_100004535 | 3300005367 | Bacteria | 11697 |
| 78 | Ga0070703_10000417 | 3300005406 | Bacteria | 17544 |
| 79 | Ga0070709_10002320 | 3300005434 | Bacteria | 10318 |
| 80 | Ga0070709_10043745 | 3300005434 | Bacteria | 2771 |
| 81 | Ga0070714_100002631 | 3300005435 | Bacteria | 13220 |
| 82 | Ga0070714_100148275 | 3300005435 | Bacteria | 2112 |
| 83 | Ga0070714_100178834 | 3300005435 | Bacteria | 1929 |
| 84 | Ga0070713_100025539 | 3300005436 | Bacteria | 4619 |
| 85 | Ga0070713_100104724 | 3300005436 | Bacteria | 2457 |
| 86 | Ga0070713_100117450 | 3300005436 | Bacteria | 2328 |
| 87 | Ga0070713_100119588 | 3300005436 | Bacteria | 2308 |
| 88 | Ga0070710_10007642 | 3300005437 | Bacteria | 5240 |
| 89 | Ga0070701_10010600 | 3300005438 | Bacteria | 4083 |
| 90 | Ga0070701_10018654 | 3300005438 | Bacteria | 3263 |
| 91 | Ga0070711_100014866 | 3300005439 | Bacteria | 4916 |
| 92 | Ga0070711_100230832 | 3300005439 | Bacteria | 1443 |
| 93 | Ga0070705_100000230 | 3300005440 | Bacteria | 33188 |
| 94 | Ga0070700_100010745 | 3300005441 | Bacteria | 5058 |
| 95 | Ga0070708_100010142 | 3300005445 | Bacteria | 7624 |
| 96 | Ga0070663_100023100 | 3300005455 | Bacteria | 4164 |
| 97 | Ga0070678_100290307 | 3300005456 | Bacteria | 1386 |
| 98 | Ga0070662_100000604 | 3300005457 | Bacteria | 21916 |
| 99 | Ga0070681_10303612 | 3300005458 | Bacteria | 1506 |
| 100 | Ga0070685_10008115 | 3300005466 | Bacteria | 5381 |
| 101 | Ga0070706_100093390 | 3300005467 | Bacteria | 2792 |
| 102 | Ga0070707_100255816 | 3300005468 | Bacteria | 1704 |
| 103 | Ga0070699_100000750 | 3300005518 | Bacteria | 30008 |
| 104 | Ga0070699_100046972 | 3300005518 | Bacteria | 3735 |
| 105 | Ga0070679_100027088 | 3300005530 | Bacteria | 5636 |
| 106 | Ga0070679_100098825 | 3300005530 | Bacteria | 2906 |
| 107 | Ga0070679_100488095 | 3300005530 | Bacteria | 1176 |
| 108 | Ga0070684_100038554 | 3300005535 | Bacteria | 4105 |
| 109 | Ga0070697_100000500 | 3300005536 | Bacteria | 29734 |
| 110 | Ga0070697_100019948 | 3300005536 | Bacteria | 5298 |
| 111 | Ga0070697_100022188 | 3300005536 | Bacteria | 5038 |
| 112 | Ga0068853_100002229 | 3300005539 | Bacteria | 14494 |
| 113 | Ga0070672_100035343 | 3300005543 | Bacteria | 3799 |
| 114 | Ga0070686_100007583 | 3300005544 | Bacteria | 6060 |
| 115 | Ga0070695_100000466 | 3300005545 | Bacteria | 20996 |
| 116 | Ga0070695_100003589 | 3300005545 | Bacteria | 9060 |
| 117 | Ga0070695_100042149 | 3300005545 | Bacteria | 2897 |
| 118 | Ga0070696_100000987 | 3300005546 | Bacteria | 18435 |
| 119 | Ga0070696_100094318 | 3300005546 | Bacteria | 2135 |
| 120 | Ga0070693_100000285 | 3300005547 | Bacteria | 23809 |
| 121 | Ga0070665_100145554 | 3300005548 | Bacteria | 2373 |
| 122 | Ga0070665_100297393 | 3300005548 | Bacteria | 1617 |
| 123 | Ga0070704_100005358 | 3300005549 | Bacteria | 7470 |
| 124 | Ga0070704_100052600 | 3300005549 | Bacteria | 2874 |
| 125 | Ga0070704_100225481 | 3300005549 | Bacteria | 1526 |
| 126 | Ga0068855_100017911 | 3300005563 | Bacteria | 8510 |
| 127 | Ga0068855_100061883 | 3300005563 | Bacteria | 4372 |
| 128 | Ga0068855_100388143 | 3300005563 | Bacteria | 1532 |
| 129 | Ga0070664_100002460 | 3300005564 | Bacteria | 14914 |
| 130 | Ga0068857_100009396 | 3300005577 | Bacteria | 8488 |
| 131 | Ga0068857_100067241 | 3300005577 | Bacteria | 3190 |
| 132 | Ga0068857_100085613 | 3300005577 | Bacteria | 2817 |
| 133 | Ga0068854_100001563 | 3300005578 | Bacteria | 13889 |
| 134 | Ga0068854_100061128 | 3300005578 | Bacteria | 2727 |
| 135 | Ga0070702_100005294 | 3300005615 | Bacteria | 5990 |
| 136 | Ga0070702_100062351 | 3300005615 | Bacteria | 2174 |
| 137 | Ga0068852_100004868 | 3300005616 | Bacteria | 9536 |
| 138 | Ga0068859_100121929 | 3300005617 | Bacteria | 2673 |
| 139 | Ga0068859_100173421 | 3300005617 | Bacteria | 2238 |
| 140 | Ga0068864_100019253 | 3300005618 | Bacteria | 5706 |
| 141 | Ga0068861_100003642 | 3300005719 | Bacteria | 10271 |
| 142 | Ga0068851_10058825 | 3300005834 | Bacteria | 1965 |
| 143 | Ga0068870_10100448 | 3300005840 | Bacteria | 1634 |
| 144 | Ga0068863_100087143 | 3300005841 | Bacteria | 2958 |
| 145 | Ga0068858_100089328 | 3300005842 | Bacteria | 2867 |
| 146 | Ga0068860_100002382 | 3300005843 | Bacteria | 19747 |
| 147 | Ga0068860_100070214 | 3300005843 | Bacteria | 3330 |
| 148 | Ga0068860_100247839 | 3300005843 | Bacteria | 1734 |
| 149 | Ga0068862_100021798 | 3300005844 | Bacteria | 5357 |
| 150 | Ga0081455_10000774 | 3300005937 | Bacteria | 41248 |
| 151 | Ga0081540_1000012 | 3300005983 | Bacteria | 189939 |
| 152 | Ga0081540_1000054 | 3300005983 | Bacteria | 122877 |
| 153 | Ga0081540_1001486 | 3300005983 | Bacteria | 20247 |
| 154 | Ga0081540_1015093 | 3300005983 | Bacteria | 4903 |
| 155 | Ga0070717_10079340 | 3300006028 | Bacteria | 2752 |
| 156 | Ga0075365_10036417 | 3300006038 | Bacteria | 3188 |
| 157 | Ga0075365_10043515 | 3300006038 | Bacteria | 2940 |
| 158 | Ga0075368_10025731 | 3300006042 | Bacteria | 2259 |
| 159 | Ga0075368_10069607 | 3300006042 | Bacteria | 1419 |
| 160 | Ga0075363_100003983 | 3300006048 | Bacteria | 6387 |
| 161 | Ga0075363_100007595 | 3300006048 | Bacteria | 4994 |
| 162 | Ga0075363_100010441 | 3300006048 | Bacteria | 4413 |
| 163 | Ga0075432_10000269 | 3300006058 | Bacteria | 14338 |
| 164 | Ga0070715_10000999 | 3300006163 | Bacteria | 7934 |
| 165 | Ga0070715_10011710 | 3300006163 | Bacteria | 3166 |
| 166 | Ga0070715_10014418 | 3300006163 | Bacteria | 2928 |
| 167 | Ga0070716_100004866 | 3300006173 | Bacteria | 6457 |
| 168 | Ga0070716_100033356 | 3300006173 | Bacteria | 2815 |
| 169 | Ga0070712_100001076 | 3300006175 | Bacteria | 16488 |
| 170 | Ga0070712_100009628 | 3300006175 | Bacteria | 6092 |
| 171 | Ga0070712_100020042 | 3300006175 | Bacteria | 4371 |
| 172 | Ga0075362_10109047 | 3300006177 | Bacteria | 1301 |
| 173 | Ga0075367_10008749 | 3300006178 | Bacteria | 5260 |
| 174 | Ga0075367_10014094 | 3300006178 | Bacteria | 4319 |
| 175 | Ga0075367_10056890 | 3300006178 | Bacteria | 2324 |
| 176 | Ga0075367_10135685 | 3300006178 | Bacteria | 1522 |
| 177 | Ga0075367_10154980 | 3300006178 | Bacteria | 1423 |
| 178 | Ga0075367_10193488 | 3300006178 | Bacteria | 1269 |
| 179 | Ga0075369_10001874 | 3300006186 | Bacteria | 7348 |
| 180 | Ga0075369_10027078 | 3300006186 | Bacteria | 2394 |
| 181 | Ga0075369_10048496 | 3300006186 | Bacteria | 1833 |
| 182 | Ga0075366_10094412 | 3300006195 | Bacteria | 1793 |
| 183 | Ga0075366_10128412 | 3300006195 | Bacteria | 1529 |
| 184 | Ga0097621_100065952 | 3300006237 | Bacteria | 2981 |
| 185 | Ga0075370_10008293 | 3300006353 | Bacteria | 5340 |
| 186 | Ga0075428_100049763 | 3300006844 | Bacteria | 4598 |
| 187 | Ga0075428_100064618 | 3300006844 | Bacteria | 4008 |
| 188 | Ga0075428_100188527 | 3300006844 | Bacteria | 2231 |
| 189 | Ga0075430_100000157 | 3300006846 | Bacteria | 44474 |
| 190 | Ga0075430_100000649 | 3300006846 | Bacteria | 26543 |
| 191 | Ga0075430_100039849 | 3300006846 | Bacteria | 3976 |
| 192 | Ga0075430_100185349 | 3300006846 | Bacteria | 1730 |
| 193 | Ga0075431_100002610 | 3300006847 | Bacteria | 17438 |
| 194 | Ga0075431_100158514 | 3300006847 | Bacteria | 2328 |
| 195 | Ga0075433_10002200 | 3300006852 | Bacteria | 14781 |
| 196 | Ga0075433_10023733 | 3300006852 | Bacteria | 5165 |
| 197 | Ga0075434_100002869 | 3300006871 | Bacteria | 15290 |
| 198 | Ga0075434_100006936 | 3300006871 | Bacteria | 10441 |
| 199 | Ga0075434_100126118 | 3300006871 | Bacteria | 2576 |
| 200 | Ga0075429_100022909 | 3300006880 | Bacteria | 5414 |
| 201 | Ga0068865_100002002 | 3300006881 | Bacteria | 12028 |
| 202 | Ga0075436_100003257 | 3300006914 | Bacteria | 11117 |
| 203 | Ga0097620_100121930 | 3300006931 | Bacteria | 2673 |
| 204 | Ga0097620_100173419 | 3300006931 | Bacteria | 2238 |
| 205 | Ga0079104_1000753 | 3300006946 | Bacteria | 27971 |
| 206 | Ga0075435_100005496 | 3300007076 | Bacteria | 8856 |
| 207 | Ga0075435_100007445 | 3300007076 | Bacteria | 7800 |
| 208 | Ga0075435_100045808 | 3300007076 | Bacteria | 3507 |
| 209 | Ga0075435_100064020 | 3300007076 | Bacteria | 2987 |
| 210 | Ga0075435_100174988 | 3300007076 | Bacteria | 1812 |
| 211 | Ga0105251_10025163 | 3300009011 | Bacteria | 3049 |
| 212 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 213 | Ga0105240_10002229 | 3300009093 | Bacteria | 31523 |
| 214 | Ga0105240_10514096 | 3300009093 | Bacteria | 1330 |
| 215 | Ga0111539_10006105 | 3300009094 | Bacteria | 15549 |
| 216 | Ga0111539_10023165 | 3300009094 | Bacteria | 7626 |
| 217 | Ga0111539_10050865 | 3300009094 | Bacteria | 4936 |
| 218 | Ga0111539_10153054 | 3300009094 | Bacteria | 2699 |
| 219 | Ga0111539_10480252 | 3300009094 | Bacteria | 1447 |
| 220 | Ga0105245_10014514 | 3300009098 | Bacteria | 6860 |
| 221 | Ga0105245_10270717 | 3300009098 | Bacteria | 1657 |
| 222 | Ga0105247_10001618 | 3300009101 | Bacteria | 15945 |
| 223 | Ga0105247_10115198 | 3300009101 | Bacteria | 1734 |
| 224 | Ga0114129_10004123 | 3300009147 | Bacteria | 20534 |
| 225 | Ga0114129_10035514 | 3300009147 | Bacteria | 7041 |
| 226 | Ga0114129_10157778 | 3300009147 | Bacteria | 3102 |
| 227 | Ga0114129_10221122 | 3300009147 | Bacteria | 2554 |
| 228 | Ga0114129_10256366 | 3300009147 | Bacteria | 2346 |
| 229 | Ga0105243_10004747 | 3300009148 | Bacteria | 10687 |
| 230 | Ga0105243_10039405 | 3300009148 | Bacteria | 3683 |
| 231 | Ga0105241_10025603 | 3300009174 | Bacteria | 4386 |
| 232 | Ga0105242_10015301 | 3300009176 | Bacteria | 5958 |
| 233 | Ga0105242_10075995 | 3300009176 | Bacteria | 2799 |
| 234 | Ga0105242_10253878 | 3300009176 | Bacteria | 1586 |
| 235 | Ga0105248_10005005 | 3300009177 | Bacteria | 14642 |
| 236 | Ga0105248_10030678 | 3300009177 | Bacteria | 6004 |
| 237 | Ga0105237_10001429 | 3300009545 | Bacteria | 31570 |
| 238 | Ga0105237_10031663 | 3300009545 | Bacteria | 5357 |
| 239 | Ga0105237_10040231 | 3300009545 | Bacteria | 4715 |
| 240 | Ga0105237_10097844 | 3300009545 | Bacteria | 2925 |
| 241 | Ga0105238_10026348 | 3300009551 | Bacteria | 5926 |
| 242 | Ga0105238_10110065 | 3300009551 | Bacteria | 2736 |
| 243 | Ga0105249_10002348 | 3300009553 | Bacteria | 16441 |
| 244 | Ga0123341_1000016 | 3300009765 | Bacteria | 85309 |
| 245 | Ga0105239_10011981 | 3300010375 | Bacteria | 9669 |
| 246 | Ga0105239_10038823 | 3300010375 | Bacteria | 5217 |
| 247 | Ga0105239_10198289 | 3300010375 | Bacteria | 2248 |
| 248 | Ga0105246_10001570 | 3300011119 | Bacteria | 13599 |
| 249 | Ga0105246_10184823 | 3300011119 | Bacteria | 1608 |
| 250 | Ga0157373_10059900 | 3300013100 | Bacteria | 2697 |
| 251 | Ga0157371_10011141 | 3300013102 | Bacteria | 6957 |
| 252 | Ga0157370_10001824 | 3300013104 | Bacteria | 26237 |
| 253 | Ga0157370_10033099 | 3300013104 | Bacteria | 5040 |
| 254 | Ga0171463_1006 | 3300013249 | Bacteria | 336402 |
| 255 | Ga0157375_10000397 | 3300013308 | Bacteria | 39527 |
| 256 | Ga0157375_10027475 | 3300013308 | Bacteria | 5319 |
| 257 | Ga0157375_10321932 | 3300013308 | Bacteria | 1711 |
| 258 | Ga0163163_10056213 | 3300014325 | Bacteria | 3889 |
| 259 | Ga0163163_10160296 | 3300014325 | Bacteria | 2295 |
| 260 | Ga0157380_10014895 | 3300014326 | Bacteria | 5700 |
| 261 | Ga0182008_10010866 | 3300014497 | Bacteria | 4858 |
| 262 | Ga0157377_10004671 | 3300014745 | Bacteria | 6337 |
| 263 | Ga0157379_10002662 | 3300014968 | Bacteria | 15043 |
| 264 | Ga0157379_10056700 | 3300014968 | Bacteria | 3500 |
| 265 | Ga0157379_10167831 | 3300014968 | Bacteria | 1981 |
| 266 | Ga0157376_10001462 | 3300014969 | Bacteria | 15556 |
| 267 | Ga0157376_10075130 | 3300014969 | Bacteria | 2883 |
| 268 | Ga0157376_10120675 | 3300014969 | Bacteria | 2323 |
| 269 | Ga0182007_10001337 | 3300015262 | Bacteria | 13301 |
| 270 | Ga0183363_1227 | 3300015690 | Bacteria | 10367 |
| 271 | Ga0214544_1000063 | 3300021320 | Bacteria | 129929 |
| 272 | Ga0214542_1000095 | 3300021321 | Bacteria | 116012 |
| 273 | Ga0214543_1000026 | 3300021327 | Bacteria | 220652 |
| 274 | Ga0213874_10004310 | 3300021377 | Bacteria | 3232 |
| 275 | Ga0213876_10000462 | 3300021384 | Bacteria | 32528 |
| 276 | Ga0213876_10001766 | 3300021384 | Bacteria | 13104 |
| 277 | Ga0213875_10004649 | 3300021388 | Bacteria | 7481 |
| 278 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 279 | Ga0209436_100041 | 3300025208 | Bacteria | 74018 |
| 280 | Ga0209672_108136 | 3300025228 | Bacteria | 1573 |
| 281 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 282 | Ga0209437_100174 | 3300025233 | Bacteria | 138811 |
| 283 | Ga0209437_107444 | 3300025233 | Bacteria | 1781 |
| 284 | Ga0207425_1002069 | 3300025245 | Bacteria | 7464 |
| 285 | Ga0207425_1002695 | 3300025245 | Bacteria | 6079 |
| 286 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 287 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 288 | Ga0209677_100286 | 3300025253 | Bacteria | 33495 |
| 289 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 290 | Ga0209129_1000199 | 3300025258 | Bacteria | 77091 |
| 291 | Ga0209129_1001513 | 3300025258 | Bacteria | 12887 |
| 292 | Ga0209129_1001544 | 3300025258 | Bacteria | 12684 |
| 293 | Ga0209129_1002718 | 3300025258 | Bacteria | 8289 |
| 294 | Ga0209129_1009357 | 3300025258 | Bacteria | 2594 |
| 295 | Ga0209129_1014942 | 3300025258 | Bacteria | 1625 |
| 296 | Ga0209233_1000192 | 3300025261 | Bacteria | 127171 |
| 297 | Ga0209233_1000194 | 3300025261 | Bacteria | 126185 |
| 298 | Ga0209233_1000476 | 3300025261 | Bacteria | 24825 |
| 299 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 300 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 301 | Ga0209673_1001773 | 3300025273 | Bacteria | 17916 |
| 302 | Ga0209673_1001909 | 3300025273 | Bacteria | 16692 |
| 303 | Ga0209673_1002125 | 3300025273 | Bacteria | 14804 |
| 304 | Ga0209673_1023295 | 3300025273 | Bacteria | 2113 |
| 305 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 306 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 307 | Ga0209130_1000037 | 3300025284 | Bacteria | 284019 |
| 308 | Ga0209676_1003539 | 3300025292 | Bacteria | 9501 |
| 309 | Ga0209676_1008914 | 3300025292 | Bacteria | 4406 |
| 310 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 311 | Ga0209025_1000196 | 3300025294 | Bacteria | 147356 |
| 312 | Ga0209025_1001009 | 3300025294 | Bacteria | 41686 |
| 313 | Ga0209025_1001184 | 3300025294 | Bacteria | 36925 |
| 314 | Ga0209025_1003594 | 3300025294 | Bacteria | 14475 |
| 315 | Ga0209025_1012061 | 3300025294 | Bacteria | 5597 |
| 316 | Ga0209025_1013072 | 3300025294 | Bacteria | 5248 |
| 317 | Ga0209025_1015920 | 3300025294 | Bacteria | 4487 |
| 318 | Ga0209564_1000086 | 3300025295 | Bacteria | 251385 |
| 319 | Ga0209564_1000281 | 3300025295 | Bacteria | 104019 |
| 320 | Ga0209564_1000937 | 3300025295 | Bacteria | 37831 |
| 321 | Ga0209564_1001052 | 3300025295 | Bacteria | 33676 |
| 322 | Ga0209564_1022032 | 3300025295 | Bacteria | 2266 |
| 323 | Ga0209758_1000576 | 3300025297 | Bacteria | 57318 |
| 324 | Ga0209758_1000637 | 3300025297 | Bacteria | 53635 |
| 325 | Ga0209758_1001377 | 3300025297 | Bacteria | 29000 |
| 326 | Ga0209758_1001843 | 3300025297 | Bacteria | 23265 |
| 327 | Ga0209758_1001862 | 3300025297 | Bacteria | 23127 |
| 328 | Ga0209758_1004801 | 3300025297 | Bacteria | 10922 |
| 329 | Ga0209758_1006689 | 3300025297 | Bacteria | 8138 |
| 330 | Ga0209758_1014154 | 3300025297 | Bacteria | 4272 |
| 331 | Ga0209050_1004517 | 3300025298 | Bacteria | 9355 |
| 332 | Ga0209256_1000321 | 3300025299 | Bacteria | 82735 |
| 333 | Ga0209256_1000348 | 3300025299 | Bacteria | 75070 |
| 334 | Ga0209256_1001295 | 3300025299 | Bacteria | 26989 |
| 335 | Ga0209256_1002621 | 3300025299 | Bacteria | 14217 |
| 336 | Ga0209256_1012480 | 3300025299 | Bacteria | 3246 |
| 337 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 338 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 339 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 340 | Ga0207426_1002020 | 3300025302 | Bacteria | 14306 |
| 341 | Ga0209051_1000236 | 3300025303 | Bacteria | 92738 |
| 342 | Ga0209051_1008523 | 3300025303 | Bacteria | 5416 |
| 343 | Ga0209051_1020077 | 3300025303 | Bacteria | 2893 |
| 344 | Ga0209051_1041942 | 3300025303 | Bacteria | 1622 |
| 345 | Ga0209257_1002011 | 3300025304 | Bacteria | 21749 |
| 346 | Ga0209257_1004633 | 3300025304 | Bacteria | 10437 |
| 347 | Ga0209257_1004844 | 3300025304 | Bacteria | 9958 |
| 348 | Ga0209257_1020335 | 3300025304 | Bacteria | 2458 |
| 349 | Ga0207656_10036067 | 3300025321 | Bacteria | 2074 |
| 350 | Ga0207653_10000614 | 3300025885 | Bacteria | 12421 |
| 351 | Ga0207692_10006578 | 3300025898 | Bacteria | 4721 |
| 352 | Ga0207642_10057946 | 3300025899 | Bacteria | 1785 |
| 353 | Ga0207710_10003659 | 3300025900 | Bacteria | 6816 |
| 354 | Ga0207710_10023003 | 3300025900 | Bacteria | 2676 |
| 355 | Ga0207688_10006040 | 3300025901 | Bacteria | 6590 |
| 356 | Ga0207680_10023917 | 3300025903 | Bacteria | 3344 |
| 357 | Ga0207680_10099149 | 3300025903 | Bacteria | 1869 |
| 358 | Ga0207647_10003262 | 3300025904 | Bacteria | 12184 |
| 359 | Ga0207647_10040176 | 3300025904 | Bacteria | 2947 |
| 360 | Ga0207645_10018030 | 3300025907 | Bacteria | 4653 |
| 361 | Ga0207654_10016041 | 3300025911 | Bacteria | 3896 |
| 362 | Ga0207707_10247143 | 3300025912 | Bacteria | 1550 |
| 363 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 364 | Ga0207695_10018154 | 3300025913 | Bacteria | 8141 |
| 365 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 366 | Ga0207671_10026966 | 3300025914 | Bacteria | 4298 |
| 367 | Ga0207693_10001214 | 3300025915 | Bacteria | 22993 |
| 368 | Ga0207693_10001843 | 3300025915 | Bacteria | 18573 |
| 369 | Ga0207693_10002790 | 3300025915 | Bacteria | 15130 |
| 370 | Ga0207693_10010142 | 3300025915 | Bacteria | 7653 |
| 371 | Ga0207693_10036247 | 3300025915 | Bacteria | 3888 |
| 372 | Ga0207663_10048067 | 3300025916 | Bacteria | 2638 |
| 373 | Ga0207660_10001814 | 3300025917 | Bacteria | 14226 |
| 374 | Ga0207660_10005450 | 3300025917 | Bacteria | 8257 |
| 375 | Ga0207662_10002012 | 3300025918 | Bacteria | 10049 |
| 376 | Ga0207657_10006393 | 3300025919 | Bacteria | 12235 |
| 377 | Ga0207649_10003953 | 3300025920 | Bacteria | 8081 |
| 378 | Ga0207652_10047442 | 3300025921 | Bacteria | 3669 |
| 379 | Ga0207652_10077839 | 3300025921 | Bacteria | 2895 |
| 380 | Ga0207652_10250551 | 3300025921 | Bacteria | 1597 |
| 381 | Ga0207681_10038013 | 3300025923 | Bacteria | 3186 |
| 382 | Ga0207694_10030630 | 3300025924 | Bacteria | 4108 |
| 383 | Ga0207694_10080002 | 3300025924 | Bacteria | 2564 |
| 384 | Ga0207650_10030791 | 3300025925 | Bacteria | 3869 |
| 385 | Ga0207687_10027934 | 3300025927 | Bacteria | 3788 |
| 386 | Ga0207700_10020029 | 3300025928 | Bacteria | 4533 |
| 387 | Ga0207644_10016821 | 3300025931 | Bacteria | 4926 |
| 388 | Ga0207644_10042398 | 3300025931 | Bacteria | 3225 |
| 389 | Ga0207690_10001636 | 3300025932 | Bacteria | 13873 |
| 390 | Ga0207706_10001549 | 3300025933 | Bacteria | 22771 |
| 391 | Ga0207709_10008268 | 3300025935 | Bacteria | 5762 |
| 392 | Ga0207670_10007780 | 3300025936 | Bacteria | 6012 |
| 393 | Ga0207670_10066256 | 3300025936 | Bacteria | 2481 |
| 394 | Ga0207669_10016603 | 3300025937 | Bacteria | 3746 |
| 395 | Ga0207669_10023338 | 3300025937 | Bacteria | 3303 |
| 396 | Ga0207665_10000206 | 3300025939 | Bacteria | 39664 |
| 397 | Ga0207665_10002147 | 3300025939 | Bacteria | 13347 |
| 398 | Ga0207691_10020588 | 3300025940 | Bacteria | 6237 |
| 399 | Ga0207691_10176794 | 3300025940 | Bacteria | 1867 |
| 400 | Ga0207689_10015316 | 3300025942 | Bacteria | 6491 |
| 401 | Ga0207661_10029018 | 3300025944 | Bacteria | 4245 |
| 402 | Ga0207667_10124250 | 3300025949 | Bacteria | 2658 |
| 403 | Ga0207651_10003739 | 3300025960 | Bacteria | 7526 |
| 404 | Ga0207668_10003501 | 3300025972 | Bacteria | 9218 |
| 405 | Ga0207668_10025353 | 3300025972 | Bacteria | 3837 |
| 406 | Ga0207668_10035719 | 3300025972 | Bacteria | 3312 |
| 407 | Ga0207668_10046312 | 3300025972 | Bacteria | 2971 |
| 408 | Ga0207640_10001586 | 3300025981 | Bacteria | 12217 |
| 409 | Ga0207658_10013167 | 3300025986 | Bacteria | 5646 |
| 410 | Ga0207703_10022849 | 3300026035 | Bacteria | 4913 |
| 411 | Ga0207703_10065760 | 3300026035 | Bacteria | 2980 |
| 412 | Ga0207639_10077638 | 3300026041 | Bacteria | 2618 |
| 413 | Ga0207678_10001431 | 3300026067 | Bacteria | 21886 |
| 414 | Ga0207678_10005835 | 3300026067 | Bacteria | 10976 |
| 415 | Ga0207678_10172069 | 3300026067 | Bacteria | 1849 |
| 416 | Ga0207678_10230579 | 3300026067 | Bacteria | 1586 |
| 417 | Ga0207708_10000424 | 3300026075 | Bacteria | 33010 |
| 418 | Ga0207708_10005630 | 3300026075 | Bacteria | 9248 |
| 419 | Ga0207708_10095691 | 3300026075 | Bacteria | 2293 |
| 420 | Ga0207708_10140403 | 3300026075 | Bacteria | 1894 |
| 421 | Ga0207641_10160214 | 3300026088 | Bacteria | 2045 |
| 422 | Ga0207648_10039265 | 3300026089 | Bacteria | 4163 |
| 423 | Ga0207648_10089853 | 3300026089 | Bacteria | 2684 |
| 424 | Ga0207676_10005901 | 3300026095 | Bacteria | 8651 |
| 425 | Ga0207674_10005526 | 3300026116 | Bacteria | 15006 |
| 426 | Ga0207674_10029209 | 3300026116 | Bacteria | 5807 |
| 427 | Ga0207674_10072581 | 3300026116 | Bacteria | 3458 |
| 428 | Ga0207675_100026458 | 3300026118 | Bacteria | 5400 |
| 429 | Ga0207675_100078527 | 3300026118 | Bacteria | 3093 |
| 430 | Ga0207675_100091656 | 3300026118 | Bacteria | 2858 |
| 431 | Ga0207675_100098170 | 3300026118 | Bacteria | 2758 |
| 432 | Ga0207675_100258410 | 3300026118 | Bacteria | 1687 |
| 433 | Ga0207683_10001480 | 3300026121 | Bacteria | 21174 |
| 434 | Ga0207683_10314738 | 3300026121 | Bacteria | 1433 |
| 435 | Ga0207698_10002976 | 3300026142 | Bacteria | 10151 |
| 436 | Ga0209281_1000081 | 3300027111 | Bacteria | 258084 |
| 437 | Ga0209282_1000036 | 3300027666 | Bacteria | 130242 |
| 438 | Ga0209998_10005479 | 3300027717 | Bacteria | 2655 |
| 439 | Ga0209813_10000260 | 3300027866 | Bacteria | 15229 |
| 440 | Ga0207428_10000243 | 3300027907 | Bacteria | 74403 |
| 441 | Ga0207428_10030428 | 3300027907 | Bacteria | 4462 |
| 442 | Ga0268266_10029443 | 3300028379 | Bacteria | 4668 |
| 443 | Ga0268266_10125333 | 3300028379 | Bacteria | 2291 |
| 444 | Ga0268266_10462482 | 3300028379 | Bacteria | 1207 |
| 445 | Ga0268265_10000787 | 3300028380 | Bacteria | 30284 |
| 446 | Ga0268264_10004872 | 3300028381 | Bacteria | 11376 |
| 447 | Ga0265318_10007983 | 3300028577 | Bacteria | 4745 |
| 448 | Ga0307515_10000263 | 3300028794 | Bacteria | 130303 |
| 449 | Ga0307515_10002397 | 3300028794 | Bacteria | 40905 |
| 450 | Ga0307515_10174603 | 3300028794 | Bacteria | 2125 |
| 451 | Ga0265330_10016009 | 3300031235 | Bacteria | 3465 |
| 452 | Ga0265328_10000422 | 3300031239 | Bacteria | 19867 |
| 453 | Ga0265328_10000744 | 3300031239 | Bacteria | 15123 |
| 454 | Ga0265325_10000329 | 3300031241 | Bacteria | 33468 |
| 455 | Ga0265325_10002969 | 3300031241 | Bacteria | 11265 |
| 456 | Ga0265340_10004053 | 3300031247 | Bacteria | 8227 |
| 457 | Ga0265339_10010391 | 3300031249 | Bacteria | 5784 |
| 458 | Ga0265331_10000038 | 3300031250 | Bacteria | 196951 |
| 459 | Ga0265331_10001441 | 3300031250 | Bacteria | 17466 |
| 460 | Ga0265331_10053639 | 3300031250 | Bacteria | 1922 |
| 461 | Ga0265316_10017418 | 3300031344 | Bacteria | 6212 |
| 462 | Ga0265316_10022919 | 3300031344 | Bacteria | 5254 |
| 463 | Ga0265316_10026703 | 3300031344 | Bacteria | 4796 |
| 464 | Ga0265316_10176421 | 3300031344 | Bacteria | 1592 |
| 465 | Ga0307513_10001607 | 3300031456 | Bacteria | 32450 |
| 466 | Ga0307513_10026369 | 3300031456 | Bacteria | 6701 |
| 467 | Ga0265313_10004907 | 3300031595 | Bacteria | 10027 |
| 468 | Ga0265314_10034372 | 3300031711 | Bacteria | 3706 |
| 469 | Ga0265314_10045740 | 3300031711 | Bacteria | 3092 |
| 470 | Ga0265342_10020051 | 3300031712 | Bacteria | 4298 |
| 471 | Ga0265342_10051517 | 3300031712 | Bacteria | 2456 |
| 472 | Ga0316576_10013328 | 3300031727 | Bacteria | 5459 |
| 473 | Ga0307412_10201641 | 3300031911 | Bacteria | 1511 |
| 474 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 475 | Ga0307409_100134705 | 3300031995 | Bacteria | 2118 |
| 476 | Ga0307416_100053617 | 3300032002 | Bacteria | 3236 |
| 477 | Ga0316580_10017791 | 3300032139 | Bacteria | 2186 |
| 478 | Ga0316593_10015250 | 3300032168 | Bacteria | 2309 |
| 479 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 480 | Ga0373938_0003033 | 3300034957 | Bacteria | 2726 |
| 481 | Ga0373938_0003902 | 3300034957 | Bacteria | 2466 |
| 482 | Ga0373926_0013058 | 3300035083 | Bacteria | 2813 |
| 483 | Ga0373934_0054014 | 3300035086 | Bacteria | 1595 |
| 484 | Ga0373940_0001673 | 3300035088 | Bacteria | 4093 |
| 485 | Ga0373940_0019760 | 3300035088 | Bacteria | 1705 |
| 486 | Ga0373944_0001932 | 3300035089 | Bacteria | 5242 |
| 487 | Ga0373944_0014436 | 3300035089 | Bacteria | 2204 |
| 488 | Ga0373952_0013646 | 3300035092 | Bacteria | 1615 |
| 489 | Ga0373923_0001635 | 3300035111 | Bacteria | 6532 |
| 490 | Ga0373939_0003496 | 3300035114 | Bacteria | 3689 |
| 491 | Ga0373941_0022432 | 3300035115 | Bacteria | 1791 |
| 492 | Ga0373945_0002656 | 3300035116 | Bacteria | 5603 |
| 493 | Ga0373954_0015244 | 3300035118 | Bacteria | 3434 |
| 494 | Ga0373943_0000072 | 3300035170 | Bacteria | 35413 |
| 495 | Ga0373943_0018214 | 3300035170 | Bacteria | 3224 |
| 496 | Ga0373946_0016223 | 3300035171 | Bacteria | 2836 |
| 497 | Ga0373946_0084259 | 3300035171 | Bacteria | 1397 |
| 498 | Ga0373955_0018141 | 3300035172 | Bacteria | 3495 |
| 499 | Ga0373961_0008194 | 3300035241 | Bacteria | 2540 |
| 500 | Ga0373961_0014157 | 3300035241 | Bacteria | 2023 |
| 501 | Ga0316574_0002045 | 3300035398 | Bacteria | 9960 |
| 502 | Ga0373931_0007725 | 3300035691 | Bacteria | 5078 |
| 503 | Ga0373931_0018603 | 3300035691 | Bacteria | 3457 |
| 504 | Ga0373931_0031774 | 3300035691 | Bacteria | 2727 |
| 505 | Ga0373935_0000643 | 3300035692 | Bacteria | 18383 |
| 506 | Ga0373927_0000047 | 3300035695 | Bacteria | 87289 |
| 507 | Ga0373927_0000701 | 3300035695 | Bacteria | 25652 |
| 508 | Ga0373927_0002001 | 3300035695 | Bacteria | 15025 |
| 509 | Ga0373927_0009793 | 3300035695 | Bacteria | 6428 |
| 510 | Ga0373927_0024175 | 3300035695 | Bacteria | 3974 |
| 511 | Ga0373933_0011775 | 3300035724 | Bacteria | 4830 |
| 512 | Ga0373947_0000410 | 3300035725 | Bacteria | 24327 |
| 513 | Ga0373947_0009651 | 3300035725 | Bacteria | 5541 |
| 514 | Ga0373947_0038457 | 3300035725 | Bacteria | 2843 |
| 515 | Ga0373947_0046316 | 3300035725 | Bacteria | 2604 |
| 516 | Ga0373937_0009090 | 3300036401 | Bacteria | 8622 |
| 517 | Ga0373937_0297060 | 3300036401 | Bacteria | 1526 |
| 518 | Ga0316582_0035016 | 3300036647 | Bacteria | 3096 |
| 519 | Ga0316582_0078505 | 3300036647 | Bacteria | 2151 |
| 520 | Ga0316584_0007758 | 3300036712 | Bacteria | 7360 |
| 521 | Ga0316584_0012904 | 3300036712 | Bacteria | 5900 |
| 522 | Ga0373925_0002644 | 3300037068 | Bacteria | 14219 |
| 523 | Ga0373925_0006393 | 3300037068 | Bacteria | 8674 |
| 524 | Ga0373925_0009566 | 3300037068 | Bacteria | 7061 |
| 525 | Ga0373925_0012893 | 3300037068 | Bacteria | 6055 |
| 526 | Ga0373925_0073761 | 3300037068 | Bacteria | 2583 |
| 527 | Ga0373925_0085398 | 3300037068 | Bacteria | 2406 |
| 528 | Ga0373925_0243615 | 3300037068 | Bacteria | 1440 |
| 529 | Ga0395899_0115466 | 3300037312 | Bacteria | 1927 |
| 530 | Ga0395900_0028460 | 3300037418 | Bacteria | 5724 |
| 531 | Ga0395898_0028293 | 3300037466 | Bacteria | 5619 |
| 532 | Ga0395898_0126795 | 3300037466 | Bacteria | 2445 |
| 533 | Ga0395905_0003051 | 3300037471 | Bacteria | 18140 |
| 534 | Ga0395905_0006639 | 3300037471 | Bacteria | 11601 |
| 535 | Ga0395905_0056428 | 3300037471 | Bacteria | 3674 |
| 536 | Ga0395905_0222975 | 3300037471 | Bacteria | 1764 |
| 537 | Ga0436364_0046367 | 3300037853 | Bacteria | 3509 |
| 538 | Ga0436364_1092228 | 3300037853 | Bacteria | 3388 |
| 539 | Ga0400489_68725 | 3300039093 | Bacteria | 2322 |
| 540 | Ga0436365_0323217 | 3300039437 | Bacteria | 33413 |
| 541 | Ga0436365_1477108 | 3300039437 | Bacteria | 6537 |
| 542 | Ga0436365_1602908 | 3300039437 | Bacteria | 36718 |
| 543 | Ga0436360_0849847 | 3300039438 | Bacteria | 5383 |
| 544 | Ga0436361_0438619 | 3300039447 | Bacteria | 4351 |
| 545 | Ga0436361_0485827 | 3300039447 | Bacteria | 1702 |
| 546 | Ga0436361_0767272 | 3300039447 | Bacteria | 33690 |
| 547 | Ga0436363_0461300 | 3300039450 | Bacteria | 15419 |
| 548 | Ga0436363_0693641 | 3300039450 | Bacteria | 10508 |
| 549 | Ga0436363_1352461 | 3300039450 | Bacteria | 4464 |
| 550 | Ga0436362_0228906 | 3300039453 | Bacteria | 10261 |
| 551 | Ga0439465_0000653 | 3300041413 | Bacteria | 10596 |
| 552 | Ga0439465_0018348 | 3300041413 | Bacteria | 2186 |
| 553 | Ga0451837_1572201 | 3300041494 | Bacteria | 2541 |
| 554 | Ga0451841_1185357 | 3300041498 | Bacteria | 3815 |
| 555 | Ga0451845_0694601 | 3300041501 | Bacteria | 1860 |
| 556 | Ga0451847_0959938 | 3300041503 | Bacteria | 1830 |
| 557 | Ga0451851_0367807 | 3300041507 | Bacteria | 1835 |
| 558 | Ga0439448_0014036 | 3300042005 | Bacteria | 2414 |
| 559 | Ga0439449_0029037 | 3300042007 | Bacteria | 2061 |
| 560 | Ga0466966_0081721 | 3300044684 | Bacteria | 2011 |
| 561 | Ga0466970_0005373 | 3300044765 | Bacteria | 6354 |
| 562 | Ga0466958_0006903 | 3300045836 | Bacteria | 6209 |
| 563 | Ga0466958_0068069 | 3300045836 | Bacteria | 2176 |
| 564 | Ga0495592_0007326 | 3300046454 | Bacteria | 8253 |
| 565 | Ga0495603_0000028 | 3300046455 | Bacteria | 61042 |
| 566 | Ga0495603_0015561 | 3300046455 | Bacteria | 4603 |
| 567 | Ga0495629_0000102 | 3300046459 | Bacteria | 75235 |
| 568 | Ga0495629_0006971 | 3300046459 | Bacteria | 8333 |
| 569 | Ga0495629_0073461 | 3300046459 | Bacteria | 2388 |
| 570 | Ga0495629_0150303 | 3300046459 | Bacteria | 1619 |
| 571 | Ga0495629_0248076 | 3300046459 | Bacteria | 1225 |
| 572 | Ga0495638_0021031 | 3300046460 | Bacteria | 4304 |
| 573 | Ga0495641_0006124 | 3300046461 | Bacteria | 7883 |
| 574 | Ga0495651_0023338 | 3300046462 | Bacteria | 4810 |
| 575 | Ga0495653_0014996 | 3300046463 | Bacteria | 6320 |
| 576 | Ga0495580_0012694 | 3300046472 | Bacteria | 6458 |
| 577 | Ga0495580_0043578 | 3300046472 | Bacteria | 3193 |
| 578 | Ga0495582_0001962 | 3300046473 | Bacteria | 11548 |
| 579 | Ga0495582_0020327 | 3300046473 | Bacteria | 3633 |
| 580 | Ga0495582_0037204 | 3300046473 | Bacteria | 2677 |
| 581 | Ga0495639_0010090 | 3300046475 | Bacteria | 4060 |
| 582 | Ga0495639_0043402 | 3300046475 | Bacteria | 2031 |
| 583 | Ga0495662_0019662 | 3300046476 | Bacteria | 3267 |
| 584 | Ga0495664_0000901 | 3300046477 | Bacteria | 15252 |
| 585 | Ga0495664_0004771 | 3300046477 | Bacteria | 7417 |
| 586 | Ga0495664_0089837 | 3300046477 | Bacteria | 1847 |
| 587 | Ga0495584_0030161 | 3300046491 | Bacteria | 2748 |
| 588 | Ga0495584_0032726 | 3300046491 | Bacteria | 2631 |
| 589 | Ga0495585_0002116 | 3300046492 | Bacteria | 14511 |
| 590 | Ga0495585_0069453 | 3300046492 | Bacteria | 1923 |
| 591 | Ga0495594_0000227 | 3300046499 | Bacteria | 27180 |
| 592 | Ga0495607_0024450 | 3300046501 | Bacteria | 3766 |
| 593 | Ga0495583_0015009 | 3300046506 | Bacteria | 4238 |
| 594 | Ga0495583_0058568 | 3300046506 | Bacteria | 1729 |
| 595 | Ga0495583_0063670 | 3300046506 | Bacteria | 1638 |
| 596 | Ga0495606_0003402 | 3300046507 | Bacteria | 16897 |
| 597 | Ga0495608_0226102 | 3300046511 | Bacteria | 1172 |
| 598 | Ga0495618_0000287 | 3300046514 | Bacteria | 36354 |
| 599 | Ga0495630_0021339 | 3300046517 | Bacteria | 4782 |
| 600 | Ga0495632_0040659 | 3300046519 | Bacteria | 2340 |
| 601 | Ga0495643_0008740 | 3300046522 | Bacteria | 6385 |
| 602 | Ga0495643_0017019 | 3300046522 | Bacteria | 4260 |
| 603 | Ga0495644_0010699 | 3300046523 | Bacteria | 3534 |
| 604 | Ga0495663_0008914 | 3300046525 | Bacteria | 2781 |
| 605 | Ga0495666_0019308 | 3300046526 | Bacteria | 3384 |
| 606 | Ga0495652_0062228 | 3300046529 | Bacteria | 3147 |
| 607 | Ga0495654_0010022 | 3300046530 | Bacteria | 5176 |
| 608 | Ga0495665_0038089 | 3300046531 | Bacteria | 2564 |
| 609 | Ga0495640_0002682 | 3300046533 | Bacteria | 14305 |
| 610 | Ga0495640_0043955 | 3300046533 | Bacteria | 3108 |
| 611 | Ga0495640_0108934 | 3300046533 | Bacteria | 1812 |
| 612 | Ga0495640_0194562 | 3300046533 | Bacteria | 1288 |
| 613 | Ga0495586_0015886 | 3300046535 | Bacteria | 4005 |
| 614 | Ga0495598_0014879 | 3300046537 | Bacteria | 1952 |
| 615 | Ga0495609_0017793 | 3300046538 | Bacteria | 3298 |
| 616 | Ga0495645_0002472 | 3300046543 | Bacteria | 12553 |
| 617 | Ga0495645_0015673 | 3300046543 | Bacteria | 5393 |
| 618 | Ga0495622_0000895 | 3300046557 | Bacteria | 16229 |
| 619 | Ga0495633_0028700 | 3300046558 | Bacteria | 2709 |
| 620 | Ga0495667_0030221 | 3300046559 | Bacteria | 3642 |
| 621 | Ga0495656_0002538 | 3300046615 | Bacteria | 6083 |
| 622 | Ga0495668_0009867 | 3300046616 | Bacteria | 5824 |
| 623 | Ga0495634_0023428 | 3300046642 | Bacteria | 4340 |
| 624 | Ga0495634_0048787 | 3300046642 | Bacteria | 2849 |
| 625 | Ga0495611_0008117 | 3300046648 | Bacteria | 4453 |
| 626 | Ga0495625_0003234 | 3300046660 | Bacteria | 16490 |
| 627 | Ga0495625_0087585 | 3300046660 | Bacteria | 2158 |
| 628 | Ga0495635_0125003 | 3300046663 | Bacteria | 1754 |
| 629 | Ga0495659_0001627 | 3300046664 | Bacteria | 7542 |
| 630 | Ga0495588_0003666 | 3300046674 | Bacteria | 6721 |
| 631 | Ga0495588_0004914 | 3300046674 | Bacteria | 5929 |
| 632 | Ga0495588_0074379 | 3300046674 | Bacteria | 1769 |
| 633 | Ga0495599_0019040 | 3300046678 | Bacteria | 4280 |
| 634 | Ga0495646_0003085 | 3300046680 | Bacteria | 10335 |
| 635 | Ga0495647_0005435 | 3300046681 | Bacteria | 4173 |
| 636 | Ga0495647_0005579 | 3300046681 | Bacteria | 4131 |
| 637 | Ga0495658_0000986 | 3300046683 | Bacteria | 15097 |
| 638 | Ga0495613_0001425 | 3300046689 | Bacteria | 18237 |
| 639 | Ga0495613_0004448 | 3300046689 | Bacteria | 10502 |
| 640 | Ga0495613_0035006 | 3300046689 | Bacteria | 3728 |
| 641 | Ga0495624_0010460 | 3300046690 | Bacteria | 6396 |
| 642 | Ga0495670_0004365 | 3300046691 | Bacteria | 6935 |
| 643 | Ga0495670_0006459 | 3300046691 | Bacteria | 5759 |
| 644 | Ga0495649_0123799 | 3300046694 | Bacteria | 1366 |
| 645 | Ga0495600_0006862 | 3300046809 | Bacteria | 6943 |
| 646 | Ga0495600_0022575 | 3300046809 | Bacteria | 4041 |
| 647 | Ga0495660_0055669 | 3300046810 | Bacteria | 2140 |
| 648 | Ga0495660_0056700 | 3300046810 | Bacteria | 2116 |
| 649 | Ga0495581_0015667 | 3300047315 | Bacteria | 4399 |
| 650 | Ga0495672_0040829 | 3300047320 | Bacteria | 2811 |
| 651 | Ga0495676_0010391 | 3300047321 | Bacteria | 8446 |
| 652 | Ga0495676_0199183 | 3300047321 | Bacteria | 1392 |
| 653 | Ga0495680_0099771 | 3300047322 | Bacteria | 2164 |
| 654 | Ga0495680_0115820 | 3300047322 | Bacteria | 1983 |
| 655 | Ga0495679_009250 | 3300047446 | Bacteria | 3955 |
| 656 | Ga0495684_0003534 | 3300047471 | Bacteria | 12230 |
| 657 | Ga0495684_0070180 | 3300047471 | Bacteria | 2663 |
| 658 | Ga0495684_0213497 | 3300047471 | Bacteria | 1418 |
| 659 | Ga0495686_0000170 | 3300047472 | Bacteria | 123336 |
| 660 | Ga0495686_0001666 | 3300047472 | Bacteria | 23112 |
| 661 | Ga0495686_0007561 | 3300047472 | Bacteria | 8126 |
| 662 | Ga0495686_0034885 | 3300047472 | Bacteria | 3236 |
| 663 | Ga0495593_0000799 | 3300047673 | Bacteria | 18227 |
| 664 | Ga0495593_0013448 | 3300047673 | Bacteria | 4668 |
| 665 | Ga0495614_0013307 | 3300048089 | Bacteria | 3609 |
| 666 | Ga0496100_0006159 | 3300048903 | Bacteria | 6524 |
| 667 | Ga0496100_0008467 | 3300048903 | Bacteria | 5736 |
| 668 | Ga0496101_0000994 | 3300048904 | Bacteria | 16776 |
| 669 | Ga0496101_0191878 | 3300048904 | Bacteria | 1577 |
| 670 | Ga0496102_0013750 | 3300048905 | Bacteria | 7019 |
| 671 | Ga0496102_0017034 | 3300048905 | Bacteria | 6359 |
| 672 | Ga0496102_0031543 | 3300048905 | Bacteria | 4755 |
| 673 | Ga0496102_0054032 | 3300048905 | Bacteria | 3661 |
| 674 | Ga0496102_0076973 | 3300048905 | Bacteria | 3070 |
| 675 | Ga0496102_0159154 | 3300048905 | Bacteria | 2124 |
| 676 | Ga0496103_0012644 | 3300048906 | Bacteria | 5007 |
| 677 | Ga0496104_0007307 | 3300048907 | Bacteria | 9749 |
| 678 | Ga0496104_0017841 | 3300048907 | Bacteria | 6470 |
| 679 | Ga0496104_0058147 | 3300048907 | Bacteria | 3659 |
| 680 | Ga0496104_0160549 | 3300048907 | Bacteria | 2156 |
| 681 | Ga0496104_0212516 | 3300048907 | Bacteria | 1846 |
| 682 | Ga0496105_0003294 | 3300048908 | Bacteria | 11922 |
| 683 | Ga0496105_0004161 | 3300048908 | Bacteria | 10858 |
| 684 | Ga0496105_0025634 | 3300048908 | Bacteria | 4802 |
| 685 | Ga0496105_0109520 | 3300048908 | Bacteria | 2280 |
| 686 | Ga0496105_0219058 | 3300048908 | Bacteria | 1550 |
| 687 | Ga0496106_0000415 | 3300048909 | Bacteria | 30247 |
| 688 | Ga0496106_0001184 | 3300048909 | Bacteria | 19446 |
| 689 | Ga0496106_0002538 | 3300048909 | Bacteria | 13578 |
| 690 | Ga0496106_0007118 | 3300048909 | Bacteria | 8265 |
| 691 | Ga0496106_0084852 | 3300048909 | Bacteria | 2437 |
| 692 | Ga0496106_0100861 | 3300048909 | Bacteria | 2239 |
| 693 | Ga0496106_0199420 | 3300048909 | Bacteria | 1593 |
| 694 | Ga0496107_0005509 | 3300048910 | Bacteria | 8662 |
| 695 | Ga0496107_0021107 | 3300048910 | Bacteria | 4602 |
| 696 | Ga0496108_0027714 | 3300048911 | Bacteria | 4682 |
| 697 | Ga0496108_0042711 | 3300048911 | Bacteria | 3785 |
| 698 | Ga0496108_0056252 | 3300048911 | Bacteria | 3304 |
| 699 | Ga0496109_0028295 | 3300048912 | Bacteria | 5011 |
| 700 | Ga0496109_0036719 | 3300048912 | Bacteria | 4424 |
| 701 | Ga0496109_0042699 | 3300048912 | Bacteria | 4109 |
| 702 | Ga0496109_0083354 | 3300048912 | Bacteria | 2948 |
| 703 | Ga0496109_0105695 | 3300048912 | Bacteria | 2615 |
| 704 | Ga0496110_0005190 | 3300048913 | Bacteria | 10190 |
| 705 | Ga0496110_0102303 | 3300048913 | Bacteria | 2569 |
| 706 | Ga0496110_0243334 | 3300048913 | Bacteria | 1637 |
| 707 | Ga0496111_0000974 | 3300048914 | Bacteria | 15651 |
| 708 | Ga0496111_0040687 | 3300048914 | Bacteria | 3334 |
| 709 | Ga0496111_0067954 | 3300048914 | Bacteria | 2589 |
| 710 | Ga0496112_0010710 | 3300048915 | Bacteria | 8335 |
| 711 | Ga0496112_0062683 | 3300048915 | Bacteria | 3668 |
| 712 | Ga0496112_0268083 | 3300048915 | Bacteria | 1656 |
| 713 | Ga0496113_0007623 | 3300048916 | Bacteria | 6982 |
| 714 | Ga0496113_0014864 | 3300048916 | Bacteria | 5327 |
| 715 | Ga0496113_0075119 | 3300048916 | Bacteria | 2579 |
| 716 | Ga0496113_0104748 | 3300048916 | Bacteria | 2195 |
| 717 | Ga0496113_0115836 | 3300048916 | Bacteria | 2091 |
| 718 | Ga0496114_0006817 | 3300048917 | Bacteria | 8996 |
| 719 | Ga0496114_0016605 | 3300048917 | Bacteria | 5935 |
| 720 | Ga0496115_0002429 | 3300048918 | Bacteria | 13374 |
| 721 | Ga0496115_0006517 | 3300048918 | Bacteria | 8558 |
| 722 | Ga0496115_0022912 | 3300048918 | Bacteria | 4844 |
| 723 | Ga0496115_0035794 | 3300048918 | Bacteria | 3930 |
| 724 | Ga0496116_0018295 | 3300048919 | Bacteria | 5407 |
| 725 | Ga0496117_0001980 | 3300048920 | Bacteria | 27225 |
| 726 | Ga0496117_0079910 | 3300048920 | Bacteria | 2152 |
| 727 | Ga0496117_0088002 | 3300048920 | Bacteria | 2011 |
| 728 | Ga0496118_0002011 | 3300048921 | Bacteria | 28790 |
| 729 | Ga0496118_0007747 | 3300048921 | Bacteria | 11276 |
| 730 | Ga0496118_0055152 | 3300048921 | Bacteria | 3002 |
| 731 | Ga0496119_0008324 | 3300048922 | Bacteria | 9141 |
| 732 | Ga0496119_0013421 | 3300048922 | Bacteria | 6527 |
| 733 | Ga0496120_0037158 | 3300048923 | Bacteria | 2892 |
| 734 | Ga0496120_0064507 | 3300048923 | Bacteria | 2032 |
| 735 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 736 | Ga0496121_0002604 | 3300048924 | Bacteria | 27252 |
| 737 | Ga0496121_0034233 | 3300048924 | Bacteria | 4575 |
| 738 | Ga0496122_0036587 | 3300048925 | Bacteria | 3965 |
| 739 | Ga0496122_0099541 | 3300048925 | Bacteria | 1948 |
| 740 | Ga0496123_0007564 | 3300048926 | Bacteria | 10184 |
| 741 | Ga0496123_0011402 | 3300048926 | Bacteria | 7707 |
| 742 | Ga0496123_0054107 | 3300048926 | Bacteria | 2645 |
| 743 | Ga0496123_0085424 | 3300048926 | Bacteria | 1898 |
| 744 | Ga0496124_0029558 | 3300048927 | Bacteria | 4880 |
| 745 | Ga0496124_0097388 | 3300048927 | Bacteria | 2388 |
| 746 | Ga0496124_0181864 | 3300048927 | Bacteria | 1617 |
| 747 | Ga0496124_0209418 | 3300048927 | Bacteria | 1476 |
| 748 | Ga0496125_0000345 | 3300048928 | Bacteria | 88357 |
| 749 | Ga0496126_0063976 | 3300048929 | Bacteria | 3295 |
| 750 | Ga0496126_0098962 | 3300048929 | Bacteria | 2555 |
| 751 | Ga0496126_0113574 | 3300048929 | Bacteria | 2357 |
| 752 | Ga0501031_0056435 | 3300049568 | Bacteria | 2558 |
| 753 | Ga0501031_0068652 | 3300049568 | Bacteria | 2309 |
| 754 | Ga0501032_0078550 | 3300049569 | Bacteria | 2197 |
| 755 | Ga0501033_0074376 | 3300049570 | Bacteria | 2494 |
| 756 | Ga0501033_0198617 | 3300049570 | Bacteria | 1433 |
| 757 | Ga0501033_0248350 | 3300049570 | Bacteria | 1262 |
| 758 | Ga0501034_0046048 | 3300049571 | Bacteria | 4407 |
| 759 | Ga0501036_0022959 | 3300049572 | Bacteria | 5252 |
| 760 | Ga0501037_0020197 | 3300049573 | Bacteria | 4920 |
| 761 | Ga0501037_0066811 | 3300049573 | Bacteria | 2619 |
| 762 | Ga0501038_0046815 | 3300049574 | Bacteria | 3749 |
| 763 | Ga0501038_0129396 | 3300049574 | Bacteria | 2074 |
| 764 | Ga0501039_0024956 | 3300049575 | Bacteria | 4592 |
| 765 | Ga0501040_0027436 | 3300049576 | Bacteria | 3834 |
| 766 | Ga0501040_0027664 | 3300049576 | Bacteria | 3819 |
| 767 | Ga0501040_0140853 | 3300049576 | Bacteria | 1699 |
| 768 | Ga0501040_0144591 | 3300049576 | Bacteria | 1676 |
| 769 | Ga0501041_0084329 | 3300049577 | Bacteria | 1958 |
| 770 | Ga0501041_0109868 | 3300049577 | Bacteria | 1710 |
| 771 | Ga0501042_0014861 | 3300049578 | Bacteria | 5319 |
| 772 | Ga0501042_0036726 | 3300049578 | Bacteria | 3476 |
| 773 | Ga0501042_0047685 | 3300049578 | Bacteria | 3055 |
| 774 | Ga0501042_0115695 | 3300049578 | Bacteria | 1931 |
| 775 | Ga0501042_0174390 | 3300049578 | Bacteria | 1551 |
| 776 | Ga0501043_0060715 | 3300049579 | Bacteria | 2968 |
| 777 | Ga0501043_0091664 | 3300049579 | Bacteria | 2389 |
| 778 | Ga0501046_0000011 | 3300049580 | Bacteria | 326457 |
| 779 | Ga0501046_0017428 | 3300049580 | Bacteria | 5995 |
| 780 | Ga0501047_0003112 | 3300049581 | Bacteria | 15739 |
| 781 | Ga0501047_0008525 | 3300049581 | Bacteria | 9670 |
| 782 | Ga0501047_0066723 | 3300049581 | Bacteria | 3469 |
| 783 | Ga0501047_0205144 | 3300049581 | Bacteria | 1831 |
| 784 | Ga0501047_0228588 | 3300049581 | Bacteria | 1715 |
| 785 | Ga0501048_0048180 | 3300049582 | Bacteria | 3040 |
| 786 | Ga0501048_0076781 | 3300049582 | Bacteria | 2357 |
| 787 | Ga0501067_0028443 | 3300049583 | Bacteria | 3097 |
| 788 | Ga0501070_0073856 | 3300049586 | Bacteria | 2822 |
| 789 | Ga0501071_0019517 | 3300049587 | Bacteria | 4704 |
| 790 | Ga0501072_0008899 | 3300049588 | Bacteria | 7630 |
| 791 | Ga0501072_0009194 | 3300049588 | Bacteria | 7507 |
| 792 | Ga0501072_0096875 | 3300049588 | Bacteria | 2344 |
| 793 | Ga0501072_0110117 | 3300049588 | Bacteria | 2192 |
| 794 | Ga0501073_0022029 | 3300049589 | Bacteria | 4591 |
| 795 | Ga0501073_0056594 | 3300049589 | Bacteria | 2743 |
| 796 | Ga0501073_0070584 | 3300049589 | Bacteria | 2433 |
| 797 | Ga0501074_0162271 | 3300049590 | Bacteria | 1596 |
| 798 | Ga0501075_0005390 | 3300049591 | Bacteria | 8749 |
| 799 | Ga0501075_0015874 | 3300049591 | Bacteria | 5415 |
| 800 | Ga0501075_0097011 | 3300049591 | Bacteria | 2237 |
| 801 | Ga0501076_0035201 | 3300049592 | Bacteria | 3918 |
| 802 | Ga0501076_0053841 | 3300049592 | Bacteria | 3189 |
| 803 | Ga0501077_0001899 | 3300049593 | Bacteria | 12650 |
| 804 | Ga0501077_0008697 | 3300049593 | Bacteria | 6296 |
| 805 | Ga0501077_0036555 | 3300049593 | Bacteria | 3129 |
| 806 | Ga0501077_0041003 | 3300049593 | Bacteria | 2948 |
| 807 | Ga0501077_0041982 | 3300049593 | Bacteria | 2911 |
| 808 | Ga0501077_0056108 | 3300049593 | Bacteria | 2500 |
| 809 | Ga0501077_0184410 | 3300049593 | Bacteria | 1326 |
| 810 | Ga0501079_0095152 | 3300049741 | Bacteria | 2308 |
| 811 | Ga0501079_0096444 | 3300049741 | Bacteria | 2292 |
| 812 | Ga0501080_0155653 | 3300049742 | Bacteria | 2111 |
| 813 | Ga0501080_0180660 | 3300049742 | Bacteria | 1942 |
| 814 | Ga0501081_0012642 | 3300049743 | Bacteria | 5549 |
| 815 | Ga0501081_0031811 | 3300049743 | Bacteria | 3576 |
| 816 | Ga0501081_0048299 | 3300049743 | Bacteria | 2929 |
| 817 | Ga0501081_0129408 | 3300049743 | Bacteria | 1803 |
| 818 | Ga0501083_0028095 | 3300049744 | Bacteria | 3879 |
| 819 | Ga0501035_0147201 | 3300049822 | Bacteria | 2045 |
| 820 | Ga0501035_0148693 | 3300049822 | Bacteria | 2033 |
| 821 | Ga0501035_0232442 | 3300049822 | Bacteria | 1571 |
| 822 | Ga0501044_0001188 | 3300049823 | Bacteria | 30861 |
| 823 | Ga0501044_0038076 | 3300049823 | Bacteria | 5022 |
| 824 | Ga0501044_0329846 | 3300049823 | Bacteria | 1449 |
| 825 | Ga0501045_0009672 | 3300049824 | Bacteria | 6746 |
| 826 | Ga0501045_0010352 | 3300049824 | Bacteria | 6532 |
| 827 | nmdc:mga03683_15677_c1 | 3300050489 | Bacteria | 2832 |
| 828 | nmdc:mga03n38_51117_c1 | 3300050490 | Bacteria | 1844 |
| 829 | nmdc:mga00v17_19288_c1 | 3300050491 | Bacteria | 3892 |
| 830 | nmdc:mga00v17_41033_c1 | 3300050491 | Bacteria | 2778 |
| 831 | nmdc:mga00v17_58022_c1 | 3300050491 | Bacteria | 2370 |
| 832 | nmdc:mga0yw44_12432_c1 | 3300050492 | Bacteria | 4437 |
| 833 | nmdc:mga0yw44_2069_c2 | 3300050492 | Bacteria | 1355 |
| 834 | nmdc:mga0k408_44547_c1 | 3300050493 | Bacteria | 2559 |
| 835 | nmdc:mga06z11_118719_c1 | 3300050494 | Bacteria | 1473 |
| 836 | nmdc:mga06z11_130_c1 | 3300050494 | Bacteria | 30483 |
| 837 | nmdc:mga06z11_15567_c1 | 3300050494 | Bacteria | 3398 |
| 838 | nmdc:mga06z11_4963_c1 | 3300050494 | Bacteria | 5283 |
| 839 | nmdc:mga06z11_9654_c1 | 3300050494 | Bacteria | 4075 |
| 840 | nmdc:mga04h51_786_c1 | 3300050495 | Bacteria | 7361 |
| 841 | nmdc:mga05p37_117308_c1 | 3300050507 | Bacteria | 3271 |
| 842 | nmdc:mga05p37_202603_c1 | 3300050507 | Bacteria | 2402 |
| 843 | nmdc:mga05p37_250_c2 | 3300050507 | Bacteria | 22896 |
| 844 | nmdc:mga05p37_490821_c1 | 3300050507 | Bacteria | 1412 |
| 845 | nmdc:mga09592_28457_c1 | 3300050508 | Bacteria | 4643 |
| 846 | nmdc:mga0qj67_13293_c1 | 3300050509 | Bacteria | 6212 |
| 847 | nmdc:mga0qj67_171_c1 | 3300050509 | Bacteria | 43599 |
| 848 | nmdc:mga0qj67_2972_c1 | 3300050509 | Bacteria | 12163 |
| 849 | nmdc:mga0qj67_33816_c1 | 3300050509 | Bacteria | 3991 |
| 850 | nmdc:mga0qj67_71549_c1 | 3300050509 | Bacteria | 2768 |
| 851 | nmdc:mga06r32_13648_c1 | 3300050510 | Bacteria | 7367 |
| 852 | nmdc:mga06r32_249580_c1 | 3300050510 | Bacteria | 1762 |
| 853 | nmdc:mga06r32_82290_c1 | 3300050510 | Bacteria | 3136 |
| 854 | nmdc:mga08y16_16756_c1 | 3300050511 | Bacteria | 7712 |
| 855 | nmdc:mga08y16_23182_c1 | 3300050511 | Bacteria | 6552 |
| 856 | nmdc:mga08y16_337916_c1 | 3300050511 | Bacteria | 1548 |
| 857 | nmdc:mga08y16_7578_c1 | 3300050511 | Bacteria | 11365 |
| 858 | nmdc:mga0n895_11081_c1 | 3300050512 | Bacteria | 8021 |
| 859 | nmdc:mga0n895_160222_c1 | 3300050512 | Bacteria | 2282 |
| 860 | nmdc:mga0n895_174544_c1 | 3300050512 | Bacteria | 2180 |
| 861 | nmdc:mga0n895_346617_c1 | 3300050512 | Bacteria | 1504 |
| 862 | nmdc:mga0n895_580_c1 | 3300050512 | Bacteria | 25141 |
| 863 | nmdc:mga0rr50_1710_c1 | 3300050513 | Bacteria | 12110 |
| 864 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 865 | nmdc:mga0a205_31320_c1 | 3300050515 | Bacteria | 5096 |
| 866 | nmdc:mga0a205_713_c1 | 3300050515 | Bacteria | 26710 |
| 867 | Ga0495601_0001782 | 3300053077 | Bacteria | 11945 |
| 868 | Ga0495601_0004932 | 3300053077 | Bacteria | 7740 |
| 869 | Ga0495601_0008269 | 3300053077 | Bacteria | 6141 |
| 870 | Ga0495612_0000095 | 3300053078 | Bacteria | 38147 |
| 871 | Ga0495595_0003847 | 3300053084 | Bacteria | 5985 |
| 872 | Ga0495595_0132687 | 3300053084 | Bacteria | 1218 |
| 873 | Ga0495619_0000415 | 3300053085 | Bacteria | 28936 |
| 874 | Ga0495619_0001134 | 3300053085 | Bacteria | 17501 |
| 875 | Ga0495619_0022317 | 3300053085 | Bacteria | 4049 |
| 876 | Ga0495619_0036465 | 3300053085 | Bacteria | 3203 |
| 877 | Ga0495619_0079690 | 3300053085 | Bacteria | 2203 |
| 878 | Ga0500562_010861 | 3300053108 | Bacteria | 2310 |
| 879 | Ga0500618_011556 | 3300053125 | Bacteria | 2338 |
| 880 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 881 | Ga0500658_0007610 | 3300053134 | Bacteria | 4001 |
| 882 | Ga0500568_0004679 | 3300053139 | Bacteria | 7273 |
| 883 | Ga0500590_043534 | 3300053148 | Bacteria | 2302 |
| 884 | Ga0500616_0000709 | 3300053153 | Bacteria | 38615 |
| 885 | Ga0500616_0004710 | 3300053153 | Bacteria | 9604 |
| 886 | Ga0500616_0005255 | 3300053153 | Bacteria | 8851 |
| 887 | Ga0500622_0001347 | 3300053156 | Bacteria | 19875 |
| 888 | Ga0500634_0033297 | 3300053161 | Bacteria | 2809 |
| 889 | Ga0500636_0077752 | 3300053177 | Bacteria | 1916 |
| 890 | Ga0501084_0020557 | 3300054114 | Bacteria | 5505 |
| 891 | Ga0501084_0061685 | 3300054114 | Bacteria | 3139 |
| 892 | Ga0501084_0283364 | 3300054114 | Bacteria | 1399 |
| 893 | Ga0501082_0031116 | 3300060353 | Bacteria | 4600 |
| 894 | Ga0501082_0091378 | 3300060353 | Bacteria | 2628 |
| 895 | Ga0501082_0237340 | 3300060353 | Bacteria | 1587 |
| 896 | Ga0530510_0005930 | 3300061734 | Bacteria | 8471 |
| 897 | Ga0530510_0020392 | 3300061734 | Bacteria | 4712 |
| 898 | Ga0530510_0062824 | 3300061734 | Bacteria | 2688 |
| 899 | Ga0530510_0099136 | 3300061734 | Bacteria | 2130 |
| 900 | Ga0530510_0147245 | 3300061734 | Bacteria | 1737 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2835312727 | 2835319379 | 370 |
| 2 | 3300009093 | Ga0105240_10002229 | Ga0105240_1000222928 | 372 |
| 3 | 3300009545 | Ga0105237_10031663 | Ga0105237_100316632 | 372 |
| 4 | 3300025903 | Ga0207680_10099149 | Ga0207680_100991491 | 372 |
| 5 | 3300025913 | Ga0207695_10018154 | Ga0207695_100181548 | 372 |
| 6 | 3300039438 | Ga0436360_0849847 | Ga0436360_0849847_1047_2282 | 372 |
| 7 | 3300049573 | Ga0501037_0020197 | Ga0501037_0020197_2050_3201 | 372 |
| 8 | 3300049581 | Ga0501047_0008525 | Ga0501047_0008525_6473_7624 | 372 |
| 9 | 3300049823 | Ga0501044_0001188 | Ga0501044_0001188_14106_15257 | 372 |
| 10 | iso_pu_bacteria | 2510917026 | 2511170098 | 372 |
| 11 | iso_pu_bacteria | 2842694124 | 2842696072 | 372 |
| 12 | iso_pu_bacteria | 2842698319 | 2842702208 | 372 |
| 13 | 3300005336 | Ga0070680_100002445 | Ga0070680_1000024459 | 373 |
| 14 | 3300005406 | Ga0070703_10000417 | Ga0070703_100004174 | 373 |
| 15 | 3300005438 | Ga0070701_10010600 | Ga0070701_100106003 | 373 |
| 16 | 3300005440 | Ga0070705_100000230 | Ga0070705_1000002309 | 373 |
| 17 | 3300005441 | Ga0070700_100010745 | Ga0070700_1000107452 | 373 |
| 18 | 3300005445 | Ga0070708_100010142 | Ga0070708_1000101428 | 373 |
| 19 | 3300005455 | Ga0070663_100023100 | Ga0070663_1000231003 | 373 |
| 20 | 3300005467 | Ga0070706_100093390 | Ga0070706_1000933901 | 373 |
| 21 | 3300005518 | Ga0070699_100000750 | Ga0070699_1000007509 | 373 |
| 22 | 3300005530 | Ga0070679_100488095 | Ga0070679_1004880951 | 373 |
| 23 | 3300005536 | Ga0070697_100022188 | Ga0070697_1000221882 | 373 |
| 24 | 3300005545 | Ga0070695_100000466 | Ga0070695_1000004669 | 373 |
| 25 | 3300005546 | Ga0070696_100000987 | Ga0070696_10000098711 | 373 |
| 26 | 3300005548 | Ga0070665_100145554 | Ga0070665_1001455543 | 373 |
| 27 | 3300005549 | Ga0070704_100005358 | Ga0070704_1000053583 | 373 |
| 28 | 3300005563 | Ga0068855_100061883 | Ga0068855_1000618833 | 373 |
| 29 | 3300005577 | Ga0068857_100067241 | Ga0068857_1000672412 | 373 |
| 30 | 3300005577 | Ga0068857_100085613 | Ga0068857_1000856133 | 373 |
| 31 | 3300005842 | Ga0068858_100089328 | Ga0068858_1000893283 | 373 |
| 32 | 3300005843 | Ga0068860_100070214 | Ga0068860_1000702143 | 373 |
| 33 | 3300009176 | Ga0105242_10015301 | Ga0105242_100153012 | 373 |
| 34 | 3300025885 | Ga0207653_10000614 | Ga0207653_100006143 | 373 |
| 35 | 3300025917 | Ga0207660_10001814 | Ga0207660_100018143 | 373 |
| 36 | 3300025949 | Ga0207667_10124250 | Ga0207667_101242502 | 373 |
| 37 | 3300026035 | Ga0207703_10022849 | Ga0207703_100228493 | 373 |
| 38 | 3300026067 | Ga0207678_10005835 | Ga0207678_100058357 | 373 |
| 39 | 3300026075 | Ga0207708_10000424 | Ga0207708_100004249 | 373 |
| 40 | 3300026095 | Ga0207676_10005901 | Ga0207676_100059016 | 373 |
| 41 | 3300026116 | Ga0207674_10029209 | Ga0207674_100292094 | 373 |
| 42 | 3300026116 | Ga0207674_10072581 | Ga0207674_100725813 | 373 |
| 43 | 3300026118 | Ga0207675_100078527 | Ga0207675_1000785273 | 373 |
| 44 | 3300028379 | Ga0268266_10125333 | Ga0268266_101253332 | 373 |
| 45 | 3300028380 | Ga0268265_10000787 | Ga0268265_100007879 | 373 |
| 46 | 3300028381 | Ga0268264_10004872 | Ga0268264_100048723 | 373 |
| 47 | 3300031995 | Ga0307409_100134705 | Ga0307409_1001347052 | 373 |
| 48 | 3300032139 | Ga0316580_10017791 | Ga0316580_100177912 | 373 |
| 49 | 3300032168 | Ga0316593_10015250 | Ga0316593_100152503 | 373 |
| 50 | 3300035088 | Ga0373940_0019760 | Ga0373940_0019760_163_1296 | 373 |
| 51 | 3300036647 | Ga0316582_0035016 | Ga0316582_0035016_621_1763 | 373 |
| 52 | 3300037471 | Ga0395905_0056428 | Ga0395905_0056428_787_1920 | 373 |
| 53 | 3300039447 | Ga0436361_0438619 | Ga0436361_0438619_2655_3791 | 373 |
| 54 | 3300042005 | Ga0439448_0014036 | Ga0439448_0014036_616_1746 | 373 |
| 55 | 3300048905 | Ga0496102_0017034 | Ga0496102_0017034_3235_4368 | 373 |
| 56 | 3300048909 | Ga0496106_0000415 | Ga0496106_0000415_15855_16988 | 373 |
| 57 | 3300048909 | Ga0496106_0199420 | Ga0496106_0199420_233_1363 | 373 |
| 58 | 3300048910 | Ga0496107_0021107 | Ga0496107_0021107_1722_2855 | 373 |
| 59 | 3300048913 | Ga0496110_0243334 | Ga0496110_0243334_64_1197 | 373 |
| 60 | 3300048918 | Ga0496115_0022912 | Ga0496115_0022912_360_1493 | 373 |
| 61 | 3300048927 | Ga0496124_0181864 | Ga0496124_0181864_182_1315 | 373 |
| 62 | 3300049570 | Ga0501033_0248350 | Ga0501033_0248350_28_1248 | 373 |
| 63 | 3300049573 | Ga0501037_0066811 | Ga0501037_0066811_45_1175 | 373 |
| 64 | 3300049576 | Ga0501040_0027664 | Ga0501040_0027664_1860_3080 | 373 |
| 65 | 3300049578 | Ga0501042_0047685 | Ga0501042_0047685_740_1960 | 373 |
| 66 | 3300049578 | Ga0501042_0115695 | Ga0501042_0115695_244_1377 | 373 |
| 67 | 3300049579 | Ga0501043_0091664 | Ga0501043_0091664_310_1440 | 373 |
| 68 | 3300049581 | Ga0501047_0003112 | Ga0501047_0003112_11521_12654 | 373 |
| 69 | 3300049581 | Ga0501047_0205144 | Ga0501047_0205144_76_1206 | 373 |
| 70 | 3300049581 | Ga0501047_0228588 | Ga0501047_0228588_181_1365 | 373 |
| 71 | 3300049588 | Ga0501072_0096875 | Ga0501072_0096875_897_2117 | 373 |
| 72 | 3300049589 | Ga0501073_0022029 | Ga0501073_0022029_2600_3730 | 373 |
| 73 | 3300049590 | Ga0501074_0162271 | Ga0501074_0162271_20_1153 | 373 |
| 74 | 3300049593 | Ga0501077_0041003 | Ga0501077_0041003_1707_2840 | 373 |
| 75 | 3300049741 | Ga0501079_0096444 | Ga0501079_0096444_108_1241 | 373 |
| 76 | 3300049742 | Ga0501080_0155653 | Ga0501080_0155653_186_1319 | 373 |
| 77 | 3300049743 | Ga0501081_0048299 | Ga0501081_0048299_860_1993 | 373 |
| 78 | 3300054114 | Ga0501084_0020557 | Ga0501084_0020557_1505_2638 | 373 |
| 79 | 3300060353 | Ga0501082_0031116 | Ga0501082_0031116_1726_2859 | 373 |
| 80 | 3300060353 | Ga0501082_0091378 | Ga0501082_0091378_1432_2565 | 373 |
| 81 | 3300061734 | Ga0530510_0020392 | Ga0530510_0020392_63_1283 | 373 |
| 82 | iso_pu_bacteria | 2671180139 | 2671691824 | 373 |
| 83 | iso_pu_bacteria | 8054563764 | 8054566345 | 373 |
| 84 | 3300005436 | Ga0070713_100117450 | Ga0070713_1001174503 | 374 |
| 85 | 3300005456 | Ga0070678_100290307 | Ga0070678_1002903071 | 374 |
| 86 | 3300005536 | Ga0070697_100000500 | Ga0070697_10000050014 | 374 |
| 87 | 3300005545 | Ga0070695_100042149 | Ga0070695_1000421493 | 374 |
| 88 | 3300005937 | Ga0081455_10000774 | Ga0081455_1000077433 | 374 |
| 89 | 3300006048 | Ga0075363_100010441 | Ga0075363_1000104415 | 374 |
| 90 | 3300006178 | Ga0075367_10056890 | Ga0075367_100568903 | 374 |
| 91 | 3300006178 | Ga0075367_10154980 | Ga0075367_101549802 | 374 |
| 92 | 3300006186 | Ga0075369_10027078 | Ga0075369_100270781 | 374 |
| 93 | 3300006844 | Ga0075428_100188527 | Ga0075428_1001885272 | 374 |
| 94 | 3300006846 | Ga0075430_100039849 | Ga0075430_1000398494 | 374 |
| 95 | 3300006914 | Ga0075436_100003257 | Ga0075436_1000032577 | 374 |
| 96 | 3300007076 | Ga0075435_100007445 | Ga0075435_1000074455 | 374 |
| 97 | 3300009094 | Ga0111539_10153054 | Ga0111539_101530544 | 374 |
| 98 | 3300009101 | Ga0105247_10115198 | Ga0105247_101151982 | 374 |
| 99 | 3300009147 | Ga0114129_10157778 | Ga0114129_101577783 | 374 |
| 100 | 3300009147 | Ga0114129_10221122 | Ga0114129_102211222 | 374 |
| 101 | 3300009147 | Ga0114129_10256366 | Ga0114129_102563661 | 374 |
| 102 | 3300009148 | Ga0105243_10039405 | Ga0105243_100394052 | 374 |
| 103 | 3300009176 | Ga0105242_10253878 | Ga0105242_102538782 | 374 |
| 104 | 3300009545 | Ga0105237_10097844 | Ga0105237_100978444 | 374 |
| 105 | 3300011119 | Ga0105246_10184823 | Ga0105246_101848232 | 374 |
| 106 | 3300014325 | Ga0163163_10160296 | Ga0163163_101602963 | 374 |
| 107 | 3300025921 | Ga0207652_10047442 | Ga0207652_100474423 | 374 |
| 108 | 3300025972 | Ga0207668_10046312 | Ga0207668_100463123 | 374 |
| 109 | 3300026067 | Ga0207678_10172069 | Ga0207678_101720692 | 374 |
| 110 | 3300026067 | Ga0207678_10230579 | Ga0207678_102305792 | 374 |
| 111 | 3300026121 | Ga0207683_10314738 | Ga0207683_103147381 | 374 |
| 112 | 3300027907 | Ga0207428_10030428 | Ga0207428_100304284 | 374 |
| 113 | 3300028577 | Ga0265318_10007983 | Ga0265318_100079834 | 374 |
| 114 | 3300031235 | Ga0265330_10016009 | Ga0265330_100160093 | 374 |
| 115 | 3300031239 | Ga0265328_10000422 | Ga0265328_1000042221 | 374 |
| 116 | 3300031239 | Ga0265328_10000744 | Ga0265328_100007444 | 374 |
| 117 | 3300031241 | Ga0265325_10002969 | Ga0265325_100029695 | 374 |
| 118 | 3300031247 | Ga0265340_10004053 | Ga0265340_100040536 | 374 |
| 119 | 3300031249 | Ga0265339_10010391 | Ga0265339_100103913 | 374 |
| 120 | 3300031250 | Ga0265331_10000038 | Ga0265331_1000003849 | 374 |
| 121 | 3300031250 | Ga0265331_10053639 | Ga0265331_100536393 | 374 |
| 122 | 3300031344 | Ga0265316_10017418 | Ga0265316_100174182 | 374 |
| 123 | 3300031344 | Ga0265316_10022919 | Ga0265316_100229195 | 374 |
| 124 | 3300031344 | Ga0265316_10176421 | Ga0265316_101764211 | 374 |
| 125 | 3300031595 | Ga0265313_10004907 | Ga0265313_100049077 | 374 |
| 126 | 3300031711 | Ga0265314_10034372 | Ga0265314_100343723 | 374 |
| 127 | 3300031711 | Ga0265314_10045740 | Ga0265314_100457403 | 374 |
| 128 | 3300031712 | Ga0265342_10020051 | Ga0265342_100200514 | 374 |
| 129 | 3300031712 | Ga0265342_10051517 | Ga0265342_100515171 | 374 |
| 130 | 3300032002 | Ga0307416_100053617 | Ga0307416_1000536173 | 374 |
| 131 | 3300037471 | Ga0395905_0222975 | Ga0395905_0222975_111_1247 | 374 |
| 132 | 3300039447 | Ga0436361_0485827 | Ga0436361_0485827_43_1176 | 374 |
| 133 | 3300039447 | Ga0436361_0767272 | Ga0436361_0767272_15307_16443 | 374 |
| 134 | 3300044684 | Ga0466966_0081721 | Ga0466966_0081721_742_1872 | 374 |
| 135 | 3300045836 | Ga0466958_0006903 | Ga0466958_0006903_2161_3291 | 374 |
| 136 | 3300047472 | Ga0495686_0000170 | Ga0495686_0000170_118213_119343 | 374 |
| 137 | 3300048904 | Ga0496101_0191878 | Ga0496101_0191878_390_1526 | 374 |
| 138 | 3300048905 | Ga0496102_0031543 | Ga0496102_0031543_188_1318 | 374 |
| 139 | 3300048908 | Ga0496105_0219058 | Ga0496105_0219058_388_1518 | 374 |
| 140 | 3300048915 | Ga0496112_0268083 | Ga0496112_0268083_422_1552 | 374 |
| 141 | 3300049570 | Ga0501033_0074376 | Ga0501033_0074376_213_1343 | 374 |
| 142 | 3300049575 | Ga0501039_0024956 | Ga0501039_0024956_299_1429 | 374 |
| 143 | 3300049580 | Ga0501046_0000011 | Ga0501046_0000011_71331_72467 | 374 |
| 144 | 3300049586 | Ga0501070_0073856 | Ga0501070_0073856_327_1457 | 374 |
| 145 | 3300049588 | Ga0501072_0008899 | Ga0501072_0008899_3801_4931 | 374 |
| 146 | 3300049593 | Ga0501077_0041982 | Ga0501077_0041982_322_1452 | 374 |
| 147 | 3300049593 | Ga0501077_0184410 | Ga0501077_0184410_85_1221 | 374 |
| 148 | 3300049822 | Ga0501035_0147201 | Ga0501035_0147201_182_1321 | 374 |
| 149 | 3300050489 | nmdc:mga03683_15677_c1 | nmdc:mga03683_15677_c1_944_2074 | 374 |
| 150 | 3300050491 | nmdc:mga00v17_58022_c1 | nmdc:mga00v17_58022_c1_974_2104 | 374 |
| 151 | 3300050494 | nmdc:mga06z11_15567_c1 | nmdc:mga06z11_15567_c1_1227_2357 | 374 |
| 152 | 3300050509 | nmdc:mga0qj67_33816_c1 | nmdc:mga0qj67_33816_c1_2080_3216 | 374 |
| 153 | 3300050511 | nmdc:mga08y16_23182_c1 | nmdc:mga08y16_23182_c1_2567_3703 | 374 |
| 154 | 3300050511 | nmdc:mga08y16_337916_c1 | nmdc:mga08y16_337916_c1_290_1426 | 374 |
| 155 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_252559_253692 | 374 |
| 156 | 3300053077 | Ga0495601_0008269 | Ga0495601_0008269_4527_5657 | 374 |
| 157 | 3300053085 | Ga0495619_0022317 | Ga0495619_0022317_639_1769 | 374 |
| 158 | 3300053108 | Ga0500562_010861 | Ga0500562_010861_465_1601 | 374 |
| 159 | 3300053153 | Ga0500616_0004710 | Ga0500616_0004710_3610_4746 | 374 |
| 160 | 3300061734 | Ga0530510_0099136 | Ga0530510_0099136_283_1419 | 374 |
| 161 | 3300003659 | JGI25404J52841_10000756 | JGI25404J52841_100007563 | 375 |
| 162 | 3300005343 | Ga0070687_100091232 | Ga0070687_1000912321 | 375 |
| 163 | 3300005347 | Ga0070668_100036586 | Ga0070668_1000365863 | 375 |
| 164 | 3300005434 | Ga0070709_10002320 | Ga0070709_100023204 | 375 |
| 165 | 3300005435 | Ga0070714_100148275 | Ga0070714_1001482753 | 375 |
| 166 | 3300005435 | Ga0070714_100178834 | Ga0070714_1001788343 | 375 |
| 167 | 3300005436 | Ga0070713_100104724 | Ga0070713_1001047243 | 375 |
| 168 | 3300005436 | Ga0070713_100119588 | Ga0070713_1001195882 | 375 |
| 169 | 3300005439 | Ga0070711_100014866 | Ga0070711_1000148664 | 375 |
| 170 | 3300005439 | Ga0070711_100230832 | Ga0070711_1002308321 | 375 |
| 171 | 3300005458 | Ga0070681_10303612 | Ga0070681_103036121 | 375 |
| 172 | 3300005468 | Ga0070707_100255816 | Ga0070707_1002558161 | 375 |
| 173 | 3300005518 | Ga0070699_100046972 | Ga0070699_1000469723 | 375 |
| 174 | 3300005530 | Ga0070679_100098825 | Ga0070679_1000988253 | 375 |
| 175 | 3300005546 | Ga0070696_100094318 | Ga0070696_1000943183 | 375 |
| 176 | 3300005549 | Ga0070704_100225481 | Ga0070704_1002254812 | 375 |
| 177 | 3300005840 | Ga0068870_10100448 | Ga0068870_101004482 | 375 |
| 178 | 3300005843 | Ga0068860_100247839 | Ga0068860_1002478392 | 375 |
| 179 | 3300005983 | Ga0081540_1000012 | Ga0081540_100001278 | 375 |
| 180 | 3300005983 | Ga0081540_1000054 | Ga0081540_10000549 | 375 |
| 181 | 3300005983 | Ga0081540_1001486 | Ga0081540_10014866 | 375 |
| 182 | 3300006028 | Ga0070717_10079340 | Ga0070717_100793403 | 375 |
| 183 | 3300006038 | Ga0075365_10036417 | Ga0075365_100364173 | 375 |
| 184 | 3300006042 | Ga0075368_10025731 | Ga0075368_100257314 | 375 |
| 185 | 3300006042 | Ga0075368_10069607 | Ga0075368_100696072 | 375 |
| 186 | 3300006048 | Ga0075363_100003983 | Ga0075363_1000039834 | 375 |
| 187 | 3300006058 | Ga0075432_10000269 | Ga0075432_100002696 | 375 |
| 188 | 3300006163 | Ga0070715_10011710 | Ga0070715_100117103 | 375 |
| 189 | 3300006163 | Ga0070715_10014418 | Ga0070715_100144182 | 375 |
| 190 | 3300006173 | Ga0070716_100033356 | Ga0070716_1000333562 | 375 |
| 191 | 3300006175 | Ga0070712_100001076 | Ga0070712_1000010763 | 375 |
| 192 | 3300006175 | Ga0070712_100020042 | Ga0070712_1000200425 | 375 |
| 193 | 3300006178 | Ga0075367_10014094 | Ga0075367_100140945 | 375 |
| 194 | 3300006178 | Ga0075367_10135685 | Ga0075367_101356852 | 375 |
| 195 | 3300006178 | Ga0075367_10193488 | Ga0075367_101934882 | 375 |
| 196 | 3300006186 | Ga0075369_10048496 | Ga0075369_100484962 | 375 |
| 197 | 3300006844 | Ga0075428_100049763 | Ga0075428_1000497633 | 375 |
| 198 | 3300006844 | Ga0075428_100064618 | Ga0075428_1000646183 | 375 |
| 199 | 3300006846 | Ga0075430_100000157 | Ga0075430_10000015719 | 375 |
| 200 | 3300006846 | Ga0075430_100000649 | Ga0075430_10000064925 | 375 |
| 201 | 3300006847 | Ga0075431_100002610 | Ga0075431_10000261017 | 375 |
| 202 | 3300006847 | Ga0075431_100158514 | Ga0075431_1001585143 | 375 |
| 203 | 3300006852 | Ga0075433_10002200 | Ga0075433_100022005 | 375 |
| 204 | 3300006852 | Ga0075433_10023733 | Ga0075433_100237333 | 375 |
| 205 | 3300006871 | Ga0075434_100002869 | Ga0075434_10000286913 | 375 |
| 206 | 3300006871 | Ga0075434_100006936 | Ga0075434_1000069369 | 375 |
| 207 | 3300006871 | Ga0075434_100126118 | Ga0075434_1001261183 | 375 |
| 208 | 3300006880 | Ga0075429_100022909 | Ga0075429_1000229093 | 375 |
| 209 | 3300007076 | Ga0075435_100005496 | Ga0075435_10000549610 | 375 |
| 210 | 3300007076 | Ga0075435_100045808 | Ga0075435_1000458082 | 375 |
| 211 | 3300007076 | Ga0075435_100064020 | Ga0075435_1000640203 | 375 |
| 212 | 3300007076 | Ga0075435_100174988 | Ga0075435_1001749882 | 375 |
| 213 | 3300009094 | Ga0111539_10006105 | Ga0111539_1000610513 | 375 |
| 214 | 3300009094 | Ga0111539_10023165 | Ga0111539_100231653 | 375 |
| 215 | 3300009094 | Ga0111539_10050865 | Ga0111539_100508651 | 375 |
| 216 | 3300009147 | Ga0114129_10004123 | Ga0114129_1000412319 | 375 |
| 217 | 3300009147 | Ga0114129_10035514 | Ga0114129_100355145 | 375 |
| 218 | 3300009553 | Ga0105249_10002348 | Ga0105249_1000234813 | 375 |
| 219 | 3300014969 | Ga0157376_10120675 | Ga0157376_101206753 | 375 |
| 220 | 3300025899 | Ga0207642_10057946 | Ga0207642_100579462 | 375 |
| 221 | 3300025912 | Ga0207707_10247143 | Ga0207707_102471432 | 375 |
| 222 | 3300025915 | Ga0207693_10001214 | Ga0207693_100012143 | 375 |
| 223 | 3300025915 | Ga0207693_10001843 | Ga0207693_100018434 | 375 |
| 224 | 3300025915 | Ga0207693_10010142 | Ga0207693_100101423 | 375 |
| 225 | 3300025915 | Ga0207693_10036247 | Ga0207693_100362474 | 375 |
| 226 | 3300025916 | Ga0207663_10048067 | Ga0207663_100480671 | 375 |
| 227 | 3300025921 | Ga0207652_10077839 | Ga0207652_100778392 | 375 |
| 228 | 3300025921 | Ga0207652_10250551 | Ga0207652_102505512 | 375 |
| 229 | 3300025939 | Ga0207665_10000206 | Ga0207665_100002063 | 375 |
| 230 | 3300026118 | Ga0207675_100026458 | Ga0207675_1000264585 | 375 |
| 231 | 3300027866 | Ga0209813_10000260 | Ga0209813_100002607 | 375 |
| 232 | 3300027907 | Ga0207428_10000243 | Ga0207428_1000024321 | 375 |
| 233 | 3300028379 | Ga0268266_10462482 | Ga0268266_104624821 | 375 |
| 234 | 3300031241 | Ga0265325_10000329 | Ga0265325_100003293 | 375 |
| 235 | 3300034957 | Ga0373938_0003033 | Ga0373938_0003033_546_1685 | 375 |
| 236 | 3300034957 | Ga0373938_0003902 | Ga0373938_0003902_638_1777 | 375 |
| 237 | 3300035083 | Ga0373926_0013058 | Ga0373926_0013058_1099_2229 | 375 |
| 238 | 3300035086 | Ga0373934_0054014 | Ga0373934_0054014_207_1340 | 375 |
| 239 | 3300035088 | Ga0373940_0001673 | Ga0373940_0001673_886_2025 | 375 |
| 240 | 3300035089 | Ga0373944_0001932 | Ga0373944_0001932_3457_4587 | 375 |
| 241 | 3300035089 | Ga0373944_0014436 | Ga0373944_0014436_125_1258 | 375 |
| 242 | 3300035092 | Ga0373952_0013646 | Ga0373952_0013646_237_1376 | 375 |
| 243 | 3300035111 | Ga0373923_0001635 | Ga0373923_0001635_3619_4749 | 375 |
| 244 | 3300035114 | Ga0373939_0003496 | Ga0373939_0003496_327_1466 | 375 |
| 245 | 3300035115 | Ga0373941_0022432 | Ga0373941_0022432_424_1563 | 375 |
| 246 | 3300035116 | Ga0373945_0002656 | Ga0373945_0002656_3985_5115 | 375 |
| 247 | 3300035118 | Ga0373954_0015244 | Ga0373954_0015244_146_1276 | 375 |
| 248 | 3300035170 | Ga0373943_0000072 | Ga0373943_0000072_29582_30715 | 375 |
| 249 | 3300035170 | Ga0373943_0018214 | Ga0373943_0018214_1812_2942 | 375 |
| 250 | 3300035171 | Ga0373946_0084259 | Ga0373946_0084259_17_1147 | 375 |
| 251 | 3300035172 | Ga0373955_0018141 | Ga0373955_0018141_2340_3470 | 375 |
| 252 | 3300035241 | Ga0373961_0008194 | Ga0373961_0008194_782_1921 | 375 |
| 253 | 3300035398 | Ga0316574_0002045 | Ga0316574_0002045_4836_5969 | 375 |
| 254 | 3300035691 | Ga0373931_0007725 | Ga0373931_0007725_2676_3815 | 375 |
| 255 | 3300035691 | Ga0373931_0018603 | Ga0373931_0018603_1947_3086 | 375 |
| 256 | 3300035692 | Ga0373935_0000643 | Ga0373935_0000643_458_1588 | 375 |
| 257 | 3300035695 | Ga0373927_0002001 | Ga0373927_0002001_2332_3462 | 375 |
| 258 | 3300035695 | Ga0373927_0024175 | Ga0373927_0024175_2325_3458 | 375 |
| 259 | 3300035724 | Ga0373933_0011775 | Ga0373933_0011775_3640_4770 | 375 |
| 260 | 3300035725 | Ga0373947_0000410 | Ga0373947_0000410_13432_14562 | 375 |
| 261 | 3300035725 | Ga0373947_0009651 | Ga0373947_0009651_764_1897 | 375 |
| 262 | 3300035725 | Ga0373947_0038457 | Ga0373947_0038457_590_1723 | 375 |
| 263 | 3300036401 | Ga0373937_0009090 | Ga0373937_0009090_4142_5272 | 375 |
| 264 | 3300036647 | Ga0316582_0078505 | Ga0316582_0078505_599_1732 | 375 |
| 265 | 3300036712 | Ga0316584_0007758 | Ga0316584_0007758_3843_4976 | 375 |
| 266 | 3300037068 | Ga0373925_0002644 | Ga0373925_0002644_8038_9168 | 375 |
| 267 | 3300037068 | Ga0373925_0012893 | Ga0373925_0012893_2578_3711 | 375 |
| 268 | 3300037068 | Ga0373925_0085398 | Ga0373925_0085398_217_1350 | 375 |
| 269 | 3300037068 | Ga0373925_0243615 | Ga0373925_0243615_284_1414 | 375 |
| 270 | 3300045836 | Ga0466958_0068069 | Ga0466958_0068069_566_1699 | 375 |
| 271 | 3300046454 | Ga0495592_0007326 | Ga0495592_0007326_1965_3095 | 375 |
| 272 | 3300046455 | Ga0495603_0015561 | Ga0495603_0015561_390_1520 | 375 |
| 273 | 3300046459 | Ga0495629_0000102 | Ga0495629_0000102_73679_74809 | 375 |
| 274 | 3300046459 | Ga0495629_0150303 | Ga0495629_0150303_396_1529 | 375 |
| 275 | 3300046459 | Ga0495629_0248076 | Ga0495629_0248076_37_1170 | 375 |
| 276 | 3300046461 | Ga0495641_0006124 | Ga0495641_0006124_4779_5909 | 375 |
| 277 | 3300046462 | Ga0495651_0023338 | Ga0495651_0023338_26_1156 | 375 |
| 278 | 3300046463 | Ga0495653_0014996 | Ga0495653_0014996_2548_3678 | 375 |
| 279 | 3300046472 | Ga0495580_0043578 | Ga0495580_0043578_185_1318 | 375 |
| 280 | 3300046473 | Ga0495582_0020327 | Ga0495582_0020327_1194_2324 | 375 |
| 281 | 3300046473 | Ga0495582_0037204 | Ga0495582_0037204_595_1725 | 375 |
| 282 | 3300046475 | Ga0495639_0043402 | Ga0495639_0043402_605_1738 | 375 |
| 283 | 3300046477 | Ga0495664_0000901 | Ga0495664_0000901_13580_14713 | 375 |
| 284 | 3300046477 | Ga0495664_0004771 | Ga0495664_0004771_2761_3891 | 375 |
| 285 | 3300046491 | Ga0495584_0030161 | Ga0495584_0030161_1531_2661 | 375 |
| 286 | 3300046492 | Ga0495585_0002116 | Ga0495585_0002116_10754_11884 | 375 |
| 287 | 3300046506 | Ga0495583_0058568 | Ga0495583_0058568_364_1494 | 375 |
| 288 | 3300046511 | Ga0495608_0226102 | Ga0495608_0226102_17_1147 | 375 |
| 289 | 3300046514 | Ga0495618_0000287 | Ga0495618_0000287_24846_25979 | 375 |
| 290 | 3300046517 | Ga0495630_0021339 | Ga0495630_0021339_1784_2914 | 375 |
| 291 | 3300046523 | Ga0495644_0010699 | Ga0495644_0010699_1749_2879 | 375 |
| 292 | 3300046525 | Ga0495663_0008914 | Ga0495663_0008914_1442_2572 | 375 |
| 293 | 3300046526 | Ga0495666_0019308 | Ga0495666_0019308_945_2075 | 375 |
| 294 | 3300046529 | Ga0495652_0062228 | Ga0495652_0062228_1743_2876 | 375 |
| 295 | 3300046531 | Ga0495665_0038089 | Ga0495665_0038089_1062_2195 | 375 |
| 296 | 3300046533 | Ga0495640_0002682 | Ga0495640_0002682_10240_11373 | 375 |
| 297 | 3300046533 | Ga0495640_0043955 | Ga0495640_0043955_1162_2295 | 375 |
| 298 | 3300046533 | Ga0495640_0194562 | Ga0495640_0194562_44_1177 | 375 |
| 299 | 3300046535 | Ga0495586_0015886 | Ga0495586_0015886_2049_3182 | 375 |
| 300 | 3300046537 | Ga0495598_0014879 | Ga0495598_0014879_391_1521 | 375 |
| 301 | 3300046538 | Ga0495609_0017793 | Ga0495609_0017793_318_1448 | 375 |
| 302 | 3300046543 | Ga0495645_0002472 | Ga0495645_0002472_9613_10746 | 375 |
| 303 | 3300046543 | Ga0495645_0015673 | Ga0495645_0015673_2163_3293 | 375 |
| 304 | 3300046558 | Ga0495633_0028700 | Ga0495633_0028700_1386_2516 | 375 |
| 305 | 3300046559 | Ga0495667_0030221 | Ga0495667_0030221_2249_3379 | 375 |
| 306 | 3300046615 | Ga0495656_0002538 | Ga0495656_0002538_4186_5316 | 375 |
| 307 | 3300046642 | Ga0495634_0048787 | Ga0495634_0048787_886_2019 | 375 |
| 308 | 3300046648 | Ga0495611_0008117 | Ga0495611_0008117_2104_3234 | 375 |
| 309 | 3300046664 | Ga0495659_0001627 | Ga0495659_0001627_4245_5375 | 375 |
| 310 | 3300046674 | Ga0495588_0003666 | Ga0495588_0003666_3456_4586 | 375 |
| 311 | 3300046678 | Ga0495599_0019040 | Ga0495599_0019040_2344_3474 | 375 |
| 312 | 3300046680 | Ga0495646_0003085 | Ga0495646_0003085_1771_2901 | 375 |
| 313 | 3300046681 | Ga0495647_0005435 | Ga0495647_0005435_1417_2547 | 375 |
| 314 | 3300046681 | Ga0495647_0005579 | Ga0495647_0005579_1218_2348 | 375 |
| 315 | 3300046683 | Ga0495658_0000986 | Ga0495658_0000986_8481_9611 | 375 |
| 316 | 3300046689 | Ga0495613_0004448 | Ga0495613_0004448_7682_8812 | 375 |
| 317 | 3300046689 | Ga0495613_0035006 | Ga0495613_0035006_300_1430 | 375 |
| 318 | 3300046690 | Ga0495624_0010460 | Ga0495624_0010460_1911_3041 | 375 |
| 319 | 3300046691 | Ga0495670_0006459 | Ga0495670_0006459_2141_3271 | 375 |
| 320 | 3300046809 | Ga0495600_0006862 | Ga0495600_0006862_337_1467 | 375 |
| 321 | 3300047315 | Ga0495581_0015667 | Ga0495581_0015667_1468_2598 | 375 |
| 322 | 3300047321 | Ga0495676_0199183 | Ga0495676_0199183_152_1282 | 375 |
| 323 | 3300047322 | Ga0495680_0115820 | Ga0495680_0115820_201_1334 | 375 |
| 324 | 3300047446 | Ga0495679_009250 | Ga0495679_009250_2516_3646 | 375 |
| 325 | 3300047471 | Ga0495684_0003534 | Ga0495684_0003534_6313_7443 | 375 |
| 326 | 3300047471 | Ga0495684_0070180 | Ga0495684_0070180_76_1209 | 375 |
| 327 | 3300047471 | Ga0495684_0213497 | Ga0495684_0213497_117_1247 | 375 |
| 328 | 3300047673 | Ga0495593_0013448 | Ga0495593_0013448_3049_4179 | 375 |
| 329 | 3300048089 | Ga0495614_0013307 | Ga0495614_0013307_1911_3041 | 375 |
| 330 | 3300048905 | Ga0496102_0076973 | Ga0496102_0076973_213_1346 | 375 |
| 331 | 3300048905 | Ga0496102_0159154 | Ga0496102_0159154_405_1544 | 375 |
| 332 | 3300048907 | Ga0496104_0007307 | Ga0496104_0007307_4465_5604 | 375 |
| 333 | 3300048907 | Ga0496104_0058147 | Ga0496104_0058147_252_1382 | 375 |
| 334 | 3300048907 | Ga0496104_0160549 | Ga0496104_0160549_561_1694 | 375 |
| 335 | 3300048908 | Ga0496105_0004161 | Ga0496105_0004161_2456_3595 | 375 |
| 336 | 3300048908 | Ga0496105_0025634 | Ga0496105_0025634_3092_4231 | 375 |
| 337 | 3300048909 | Ga0496106_0100861 | Ga0496106_0100861_760_1968 | 375 |
| 338 | 3300048912 | Ga0496109_0042699 | Ga0496109_0042699_2175_3314 | 375 |
| 339 | 3300048912 | Ga0496109_0083354 | Ga0496109_0083354_102_1232 | 375 |
| 340 | 3300048914 | Ga0496111_0040687 | Ga0496111_0040687_1662_2801 | 375 |
| 341 | 3300048915 | Ga0496112_0062683 | Ga0496112_0062683_1687_2826 | 375 |
| 342 | 3300048916 | Ga0496113_0007623 | Ga0496113_0007623_1729_2868 | 375 |
| 343 | 3300048916 | Ga0496113_0075119 | Ga0496113_0075119_1171_2310 | 375 |
| 344 | 3300048918 | Ga0496115_0035794 | Ga0496115_0035794_196_1335 | 375 |
| 345 | 3300048929 | Ga0496126_0098962 | Ga0496126_0098962_1381_2517 | 375 |
| 346 | 3300049742 | Ga0501080_0180660 | Ga0501080_0180660_418_1551 | 375 |
| 347 | 3300049744 | Ga0501083_0028095 | Ga0501083_0028095_1297_2430 | 375 |
| 348 | 3300050491 | nmdc:mga00v17_19288_c1 | nmdc:mga00v17_19288_c1_2690_3829 | 375 |
| 349 | 3300050491 | nmdc:mga00v17_41033_c1 | nmdc:mga00v17_41033_c1_667_1800 | 375 |
| 350 | 3300050492 | nmdc:mga0yw44_12432_c1 | nmdc:mga0yw44_12432_c1_590_1723 | 375 |
| 351 | 3300050493 | nmdc:mga0k408_44547_c1 | nmdc:mga0k408_44547_c1_16_1149 | 375 |
| 352 | 3300050494 | nmdc:mga06z11_130_c1 | nmdc:mga06z11_130_c1_25393_26532 | 375 |
| 353 | 3300050494 | nmdc:mga06z11_4963_c1 | nmdc:mga06z11_4963_c1_988_2127 | 375 |
| 354 | 3300050494 | nmdc:mga06z11_9654_c1 | nmdc:mga06z11_9654_c1_1528_2661 | 375 |
| 355 | 3300050495 | nmdc:mga04h51_786_c1 | nmdc:mga04h51_786_c1_1232_2371 | 375 |
| 356 | 3300050507 | nmdc:mga05p37_117308_c1 | nmdc:mga05p37_117308_c1_326_1465 | 375 |
| 357 | 3300050507 | nmdc:mga05p37_202603_c1 | nmdc:mga05p37_202603_c1_519_1658 | 375 |
| 358 | 3300050507 | nmdc:mga05p37_250_c2 | nmdc:mga05p37_250_c2_2498_3628 | 375 |
| 359 | 3300050508 | nmdc:mga09592_28457_c1 | nmdc:mga09592_28457_c1_1502_2632 | 375 |
| 360 | 3300050509 | nmdc:mga0qj67_13293_c1 | nmdc:mga0qj67_13293_c1_4269_5408 | 375 |
| 361 | 3300050509 | nmdc:mga0qj67_171_c1 | nmdc:mga0qj67_171_c1_12919_14052 | 375 |
| 362 | 3300050509 | nmdc:mga0qj67_2972_c1 | nmdc:mga0qj67_2972_c1_2792_3922 | 375 |
| 363 | 3300050510 | nmdc:mga06r32_13648_c1 | nmdc:mga06r32_13648_c1_2308_3438 | 375 |
| 364 | 3300050510 | nmdc:mga06r32_249580_c1 | nmdc:mga06r32_249580_c1_143_1282 | 375 |
| 365 | 3300050510 | nmdc:mga06r32_82290_c1 | nmdc:mga06r32_82290_c1_849_1988 | 375 |
| 366 | 3300050511 | nmdc:mga08y16_16756_c1 | nmdc:mga08y16_16756_c1_4271_5410 | 375 |
| 367 | 3300050511 | nmdc:mga08y16_7578_c1 | nmdc:mga08y16_7578_c1_2806_3936 | 375 |
| 368 | 3300050512 | nmdc:mga0n895_11081_c1 | nmdc:mga0n895_11081_c1_6389_7528 | 375 |
| 369 | 3300050512 | nmdc:mga0n895_160222_c1 | nmdc:mga0n895_160222_c1_249_1382 | 375 |
| 370 | 3300050512 | nmdc:mga0n895_174544_c1 | nmdc:mga0n895_174544_c1_430_1560 | 375 |
| 371 | 3300050512 | nmdc:mga0n895_346617_c1 | nmdc:mga0n895_346617_c1_263_1402 | 375 |
| 372 | 3300050512 | nmdc:mga0n895_580_c1 | nmdc:mga0n895_580_c1_18555_19685 | 375 |
| 373 | 3300050513 | nmdc:mga0rr50_1710_c1 | nmdc:mga0rr50_1710_c1_5324_6454 | 375 |
| 374 | 3300050515 | nmdc:mga0a205_31320_c1 | nmdc:mga0a205_31320_c1_2653_3792 | 375 |
| 375 | 3300050515 | nmdc:mga0a205_713_c1 | nmdc:mga0a205_713_c1_5090_6220 | 375 |
| 376 | 3300053077 | Ga0495601_0001782 | Ga0495601_0001782_2677_3810 | 375 |
| 377 | 3300053077 | Ga0495601_0004932 | Ga0495601_0004932_339_1472 | 375 |
| 378 | 3300053078 | Ga0495612_0000095 | Ga0495612_0000095_26260_27393 | 375 |
| 379 | 3300053084 | Ga0495595_0132687 | Ga0495595_0132687_27_1157 | 375 |
| 380 | 3300053085 | Ga0495619_0000415 | Ga0495619_0000415_3781_4911 | 375 |
| 381 | 3300053085 | Ga0495619_0001134 | Ga0495619_0001134_45_1178 | 375 |
| 382 | 3300053085 | Ga0495619_0036465 | Ga0495619_0036465_1043_2182 | 375 |
| 383 | 3300053085 | Ga0495619_0079690 | Ga0495619_0079690_366_1499 | 375 |
| 384 | 3300053131 | Ga0500652_000019 | Ga0500652_000019_80211_81344 | 375 |
| 385 | 3300053177 | Ga0500636_0077752 | Ga0500636_0077752_425_1558 | 375 |
| 386 | iso_pu_bacteria | 2513237087 | 2513592485 | 375 |
| 387 | iso_pu_bacteria | 2837678835 | 2837680114 | 375 |
| 388 | 3300005578 | Ga0068854_100061128 | Ga0068854_1000611283 | 376 |
| 389 | 3300005983 | Ga0081540_1015093 | Ga0081540_10150933 | 376 |
| 390 | 3300006846 | Ga0075430_100185349 | Ga0075430_1001853491 | 376 |
| 391 | 3300009093 | Ga0105240_10514096 | Ga0105240_105140961 | 376 |
| 392 | 3300009551 | Ga0105238_10026348 | Ga0105238_100263483 | 376 |
| 393 | 3300010375 | Ga0105239_10198289 | Ga0105239_101982891 | 376 |
| 394 | 3300021377 | Ga0213874_10004310 | Ga0213874_100043102 | 376 |
| 395 | 3300025904 | Ga0207647_10040176 | Ga0207647_100401763 | 376 |
| 396 | 3300025924 | Ga0207694_10030630 | Ga0207694_100306303 | 376 |
| 397 | 3300025944 | Ga0207661_10029018 | Ga0207661_100290185 | 376 |
| 398 | 3300025972 | Ga0207668_10035719 | Ga0207668_100357193 | 376 |
| 399 | 3300031456 | Ga0307513_10026369 | Ga0307513_100263694 | 376 |
| 400 | 3300039093 | Ga0400489_68725 | Ga0400489_68725_991_2133 | 376 |
| 401 | 3300039437 | Ga0436365_1477108 | Ga0436365_1477108_4040_5182 | 376 |
| 402 | 3300039450 | Ga0436363_0693641 | Ga0436363_0693641_5990_7129 | 376 |
| 403 | 3300047320 | Ga0495672_0040829 | Ga0495672_0040829_795_2150 | 376 |
| 404 | 3300049570 | Ga0501033_0198617 | Ga0501033_0198617_262_1404 | 376 |
| 405 | 3300049571 | Ga0501034_0046048 | Ga0501034_0046048_1413_2555 | 376 |
| 406 | 3300049581 | Ga0501047_0066723 | Ga0501047_0066723_441_1583 | 376 |
| 407 | 3300049583 | Ga0501067_0028443 | Ga0501067_0028443_1032_2177 | 376 |
| 408 | 3300049589 | Ga0501073_0070584 | Ga0501073_0070584_908_2053 | 376 |
| 409 | 3300049823 | Ga0501044_0329846 | Ga0501044_0329846_45_1235 | 376 |
| 410 | 3300050509 | nmdc:mga0qj67_71549_c1 | nmdc:mga0qj67_71549_c1_63_1205 | 376 |
| 411 | iso_pu_bacteria | 2595698237 | 2596373244 | 376 |
| 412 | iso_pu_bacteria | 2599185236 | 2599720113 | 376 |
| 413 | iso_pu_bacteria | 2928125067 | 2928127233 | 376 |
| 414 | 3300009098 | Ga0105245_10270717 | Ga0105245_102707172 | 377 |
| 415 | 3300031250 | Ga0265331_10001441 | Ga0265331_100014414 | 377 |
| 416 | 3300031344 | Ga0265316_10026703 | Ga0265316_100267034 | 377 |
| 417 | 3300031727 | Ga0316576_10013328 | Ga0316576_100133285 | 377 |
| 418 | 3300035695 | Ga0373927_0009793 | Ga0373927_0009793_217_1473 | 377 |
| 419 | 3300035725 | Ga0373947_0046316 | Ga0373947_0046316_926_2182 | 377 |
| 420 | 3300036712 | Ga0316584_0012904 | Ga0316584_0012904_2416_3561 | 377 |
| 421 | 3300037068 | Ga0373925_0073761 | Ga0373925_0073761_896_2152 | 377 |
| 422 | 3300046455 | Ga0495603_0000028 | Ga0495603_0000028_930_2186 | 377 |
| 423 | 3300046459 | Ga0495629_0006971 | Ga0495629_0006971_549_1805 | 377 |
| 424 | 3300046472 | Ga0495580_0012694 | Ga0495580_0012694_315_1571 | 377 |
| 425 | 3300046473 | Ga0495582_0001962 | Ga0495582_0001962_340_1596 | 377 |
| 426 | 3300046475 | Ga0495639_0010090 | Ga0495639_0010090_1862_3118 | 377 |
| 427 | 3300046499 | Ga0495594_0000227 | Ga0495594_0000227_567_1823 | 377 |
| 428 | 3300046533 | Ga0495640_0108934 | Ga0495640_0108934_235_1491 | 377 |
| 429 | 3300046557 | Ga0495622_0000895 | Ga0495622_0000895_8157_9413 | 377 |
| 430 | 3300046642 | Ga0495634_0023428 | Ga0495634_0023428_1331_2587 | 377 |
| 431 | 3300046663 | Ga0495635_0125003 | Ga0495635_0125003_222_1478 | 377 |
| 432 | 3300046674 | Ga0495588_0004914 | Ga0495588_0004914_3917_5173 | 377 |
| 433 | 3300046689 | Ga0495613_0001425 | Ga0495613_0001425_818_2074 | 377 |
| 434 | 3300047321 | Ga0495676_0010391 | Ga0495676_0010391_1004_2260 | 377 |
| 435 | 3300047322 | Ga0495680_0099771 | Ga0495680_0099771_219_1475 | 377 |
| 436 | 3300047673 | Ga0495593_0000799 | Ga0495593_0000799_15920_17176 | 377 |
| 437 | 3300053084 | Ga0495595_0003847 | Ga0495595_0003847_416_1672 | 377 |
| 438 | iso_pu_bacteria | 2582581866 | 2585392444 | 377 |
| 439 | iso_pu_bacteria | 2585427633 | 2585997164 | 377 |
| 440 | iso_pu_bacteria | 2585427634 | 2586001763 | 377 |
| 441 | iso_pu_bacteria | 2599185352 | 2600194101 | 377 |
| 442 | iso_pu_bacteria | 2643221557 | 2643809756 | 377 |
| 443 | iso_pu_bacteria | 2643221607 | 2644048330 | 377 |
| 444 | iso_pu_bacteria | 2643221610 | 2644063937 | 377 |
| 445 | iso_pu_bacteria | 2643221636 | 2644201692 | 377 |
| 446 | iso_pu_bacteria | 2643221668 | 2644381458 | 377 |
| 447 | iso_pu_bacteria | 2643221675 | 2644415770 | 377 |
| 448 | iso_pu_bacteria | 2643221680 | 2644448810 | 377 |
| 449 | iso_pu_bacteria | 2643221686 | 2644481132 | 377 |
| 450 | iso_pu_bacteria | 2643221723 | 2644676730 | 377 |
| 451 | iso_pu_bacteria | 2643221726 | 2644686796 | 377 |
| 452 | iso_pu_bacteria | 2791355256 | 2793293616 | 377 |
| 453 | iso_pu_bacteria | 2791355262 | 2793333399 | 377 |
| 454 | iso_pu_bacteria | 2854896431 | 2854900218 | 377 |
| 455 | iso_pu_bacteria | 2854916844 | 2854919180 | 377 |
| 456 | iso_pu_bacteria | 2919171160 | 2919173460 | 377 |
| 457 | iso_pu_bacteria | 2920822456 | 2920828472 | 377 |
| 458 | iso_pu_bacteria | 2929138655 | 2929141383 | 377 |
| 459 | iso_pu_bacteria | 2939669807 | 2939672309 | 377 |
| 460 | iso_pu_bacteria | 8056875544 | 8056876175 | 377 |
| 461 | 3300006195 | Ga0075366_10094412 | Ga0075366_100944121 | 378 |
| 462 | 3300048920 | Ga0496117_0079910 | Ga0496117_0079910_138_1280 | 378 |
| 463 | 3300048921 | Ga0496118_0055152 | Ga0496118_0055152_1357_2499 | 378 |
| 464 | 3300048923 | Ga0496120_0037158 | Ga0496120_0037158_49_1191 | 378 |
| 465 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_1009685_1010827 | 378 |
| 466 | 3300048928 | Ga0496125_0000345 | Ga0496125_0000345_79200_80342 | 378 |
| 467 | iso_pu_bacteria | 2508501122 | 2509110243 | 378 |
| 468 | iso_pu_bacteria | 2509276019 | 2509378979 | 378 |
| 469 | iso_pu_bacteria | 2509276019 | 2509379001 | 378 |
| 470 | iso_pu_bacteria | 2509276033 | 2509447925 | 378 |
| 471 | iso_pu_bacteria | 2510065019 | 2510134862 | 378 |
| 472 | iso_pu_bacteria | 2510065057 | 2510303711 | 378 |
| 473 | iso_pu_bacteria | 2510461076 | 2510896268 | 378 |
| 474 | iso_pu_bacteria | 2510917028 | 2511185071 | 378 |
| 475 | iso_pu_bacteria | 2510917030 | 2511195896 | 378 |
| 476 | iso_pu_bacteria | 2511231052 | 2511503008 | 378 |
| 477 | iso_pu_bacteria | 2512047086 | 2512534272 | 378 |
| 478 | iso_pu_bacteria | 2512875026 | 2512973905 | 378 |
| 479 | iso_pu_bacteria | 2513237084 | 2513572626 | 378 |
| 480 | iso_pu_bacteria | 2513237085 | 2513580143 | 378 |
| 481 | iso_pu_bacteria | 2513237086 | 2513587708 | 378 |
| 482 | iso_pu_bacteria | 2513237088 | 2513597195 | 378 |
| 483 | iso_pu_bacteria | 2513237089 | 2513602378 | 378 |
| 484 | iso_pu_bacteria | 2513237091 | 2513617177 | 378 |
| 485 | iso_pu_bacteria | 2513237093 | 2513631299 | 378 |
| 486 | iso_pu_bacteria | 2513237103 | 2513710804 | 378 |
| 487 | iso_pu_bacteria | 2513237138 | 2513868081 | 378 |
| 488 | iso_pu_bacteria | 2513237140 | 2513882918 | 378 |
| 489 | iso_pu_bacteria | 2513237143 | 2513902947 | 378 |
| 490 | iso_pu_bacteria | 2513237144 | 2513908167 | 378 |
| 491 | iso_pu_bacteria | 2513237146 | 2513926965 | 378 |
| 492 | iso_pu_bacteria | 2513237156 | 2513985927 | 378 |
| 493 | iso_pu_bacteria | 2513237159 | 2513998109 | 378 |
| 494 | iso_pu_bacteria | 2513237160 | 2514004021 | 378 |
| 495 | iso_pu_bacteria | 2513237162 | 2514022316 | 378 |
| 496 | iso_pu_bacteria | 2515075009 | 2515113946 | 378 |
| 497 | iso_pu_bacteria | 2515154107 | 2515610320 | 378 |
| 498 | iso_pu_bacteria | 2515154113 | 2515636980 | 378 |
| 499 | iso_pu_bacteria | 2515154114 | 2515643010 | 378 |
| 500 | iso_pu_bacteria | 2515154116 | 2515656759 | 378 |
| 501 | iso_pu_bacteria | 2515154134 | 2515743697 | 378 |
| 502 | iso_pu_bacteria | 2516143018 | 2516205270 | 378 |
| 503 | iso_pu_bacteria | 2516143018 | 2516206525 | 378 |
| 504 | iso_pu_bacteria | 2516653046 | 2516894412 | 378 |
| 505 | iso_pu_bacteria | 2516653077 | 2517037577 | 378 |
| 506 | iso_pu_bacteria | 2516653085 | 2517077864 | 378 |
| 507 | iso_pu_bacteria | 2517093000 | 2517096661 | 378 |
| 508 | iso_pu_bacteria | 2517287029 | 2517410375 | 378 |
| 509 | iso_pu_bacteria | 2517487022 | 2517571033 | 378 |
| 510 | iso_pu_bacteria | 2519899620 | 2520381328 | 378 |
| 511 | iso_pu_bacteria | 2524023207 | 2524451897 | 378 |
| 512 | iso_pu_bacteria | 2529292951 | 2530646974 | 378 |
| 513 | iso_pu_bacteria | 2534681796 | 2535519411 | 378 |
| 514 | iso_pu_bacteria | 2551306084 | 2551675773 | 378 |
| 515 | iso_pu_bacteria | 2551306085 | 2551689081 | 378 |
| 516 | iso_pu_bacteria | 2551306086 | 2551692554 | 378 |
| 517 | iso_pu_bacteria | 2551306087 | 2551701212 | 378 |
| 518 | iso_pu_bacteria | 2551306089 | 2551708864 | 378 |
| 519 | iso_pu_bacteria | 2551306090 | 2551722080 | 378 |
| 520 | iso_pu_bacteria | 2551306091 | 2551724686 | 378 |
| 521 | iso_pu_bacteria | 2551306092 | 2551735154 | 378 |
| 522 | iso_pu_bacteria | 2551306093 | 2551745358 | 378 |
| 523 | iso_pu_bacteria | 2558860100 | 2558860423 | 378 |
| 524 | iso_pu_bacteria | 2582581283 | 2585168052 | 378 |
| 525 | iso_pu_bacteria | 2582581294 | 2585202450 | 378 |
| 526 | iso_pu_bacteria | 2582581298 | 2585224766 | 378 |
| 527 | iso_pu_bacteria | 2582581299 | 2585227850 | 378 |
| 528 | iso_pu_bacteria | 2582581304 | 2585257858 | 378 |
| 529 | iso_pu_bacteria | 2582581306 | 2585269743 | 378 |
| 530 | iso_pu_bacteria | 2582581865 | 2585388595 | 378 |
| 531 | iso_pu_bacteria | 2582581867 | 2585402239 | 378 |
| 532 | iso_pu_bacteria | 2585427526 | 2585529059 | 378 |
| 533 | iso_pu_bacteria | 2585427528 | 2585540999 | 378 |
| 534 | iso_pu_bacteria | 2585427529 | 2585547322 | 378 |
| 535 | iso_pu_bacteria | 2585427590 | 2585822461 | 378 |
| 536 | iso_pu_bacteria | 2585427593 | 2585839761 | 378 |
| 537 | iso_pu_bacteria | 2599185170 | 2599420541 | 378 |
| 538 | iso_pu_bacteria | 2615840624 | 2616295580 | 378 |
| 539 | iso_pu_bacteria | 2643221599 | 2644006474 | 378 |
| 540 | iso_pu_bacteria | 2643221634 | 2644195923 | 378 |
| 541 | iso_pu_bacteria | 2643221643 | 2644241883 | 378 |
| 542 | iso_pu_bacteria | 2643221688 | 2644496386 | 378 |
| 543 | iso_pu_bacteria | 2643221689 | 2644500179 | 378 |
| 544 | iso_pu_bacteria | 2690316117 | 2692314484 | 378 |
| 545 | iso_pu_bacteria | 2718217882 | 2719182614 | 378 |
| 546 | iso_pu_bacteria | 2718217927 | 2719387287 | 378 |
| 547 | iso_pu_bacteria | 2718217997 | 2719666929 | 378 |
| 548 | iso_pu_bacteria | 2718218009 | 2719733333 | 378 |
| 549 | iso_pu_bacteria | 2718218199 | 2720493349 | 378 |
| 550 | iso_pu_bacteria | 2718218232 | 2720614823 | 378 |
| 551 | iso_pu_bacteria | 2718218233 | 2720621595 | 378 |
| 552 | iso_pu_bacteria | 2718218235 | 2720632923 | 378 |
| 553 | iso_pu_bacteria | 2718218269 | 2720776647 | 378 |
| 554 | iso_pu_bacteria | 2718218363 | 2721148727 | 378 |
| 555 | iso_pu_bacteria | 2718218365 | 2721160112 | 378 |
| 556 | iso_pu_bacteria | 2718218366 | 2721165541 | 378 |
| 557 | iso_pu_bacteria | 2718218423 | 2721400922 | 378 |
| 558 | iso_pu_bacteria | 2721755514 | 2722841711 | 378 |
| 559 | iso_pu_bacteria | 2721755556 | 2723028236 | 378 |
| 560 | iso_pu_bacteria | 2721755684 | 2723561864 | 378 |
| 561 | iso_pu_bacteria | 2721755685 | 2723568495 | 378 |
| 562 | iso_pu_bacteria | 2721755809 | 2724039735 | 378 |
| 563 | iso_pu_bacteria | 2721755810 | 2724046089 | 378 |
| 564 | iso_pu_bacteria | 2721755819 | 2724091254 | 378 |
| 565 | iso_pu_bacteria | 2721755822 | 2724105760 | 378 |
| 566 | iso_pu_bacteria | 2721755823 | 2724111587 | 378 |
| 567 | iso_pu_bacteria | 2724679232 | 2725945448 | 378 |
| 568 | iso_pu_bacteria | 2728369352 | 2730109172 | 378 |
| 569 | iso_pu_bacteria | 2728369365 | 2730165849 | 378 |
| 570 | iso_pu_bacteria | 2728369397 | 2730299744 | 378 |
| 571 | iso_pu_bacteria | 2738541333 | 2739035556 | 378 |
| 572 | iso_pu_bacteria | 2765235942 | 2766065302 | 378 |
| 573 | iso_pu_bacteria | 2791355082 | 2792579918 | 378 |
| 574 | iso_pu_bacteria | 2791355082 | 2792582533 | 378 |
| 575 | iso_pu_bacteria | 2791355092 | 2792625701 | 378 |
| 576 | iso_pu_bacteria | 2791355259 | 2793313056 | 378 |
| 577 | iso_pu_bacteria | 2791355260 | 2793319704 | 378 |
| 578 | iso_pu_bacteria | 2791355261 | 2793327790 | 378 |
| 579 | iso_pu_bacteria | 2791355264 | 2793347388 | 378 |
| 580 | iso_pu_bacteria | 2791355265 | 2793353720 | 378 |
| 581 | iso_pu_bacteria | 2791355266 | 2793359682 | 378 |
| 582 | iso_pu_bacteria | 2791355267 | 2793369435 | 378 |
| 583 | iso_pu_bacteria | 2802428858 | 2802717878 | 378 |
| 584 | iso_pu_bacteria | 2802428859 | 2802725271 | 378 |
| 585 | iso_pu_bacteria | 2802428860 | 2802730605 | 378 |
| 586 | iso_pu_bacteria | 2802428861 | 2802737952 | 378 |
| 587 | iso_pu_bacteria | 2802428862 | 2802744178 | 378 |
| 588 | iso_pu_bacteria | 2802428863 | 2802753137 | 378 |
| 589 | iso_pu_bacteria | 2802429268 | 2804753339 | 378 |
| 590 | iso_pu_bacteria | 2802429268 | 2804755539 | 378 |
| 591 | iso_pu_bacteria | 2802429605 | 2805929425 | 378 |
| 592 | iso_pu_bacteria | 2802429606 | 2805935394 | 378 |
| 593 | iso_pu_bacteria | 2802429633 | 2806044542 | 378 |
| 594 | iso_pu_bacteria | 2802429634 | 2806052743 | 378 |
| 595 | iso_pu_bacteria | 2802429635 | 2806059043 | 378 |
| 596 | iso_pu_bacteria | 2802429636 | 2806068294 | 378 |
| 597 | iso_pu_bacteria | 2802429637 | 2806074414 | 378 |
| 598 | iso_pu_bacteria | 2837651117 | 2837654203 | 378 |
| 599 | iso_pu_bacteria | 2838016132 | 2838019126 | 378 |
| 600 | iso_pu_bacteria | 2838022645 | 2838024283 | 378 |
| 601 | iso_pu_bacteria | 2838035591 | 2838040785 | 378 |
| 602 | iso_pu_bacteria | 2838042994 | 2838047358 | 378 |
| 603 | iso_pu_bacteria | 2838048938 | 2838051156 | 378 |
| 604 | iso_pu_bacteria | 2838061910 | 2838063867 | 378 |
| 605 | iso_pu_bacteria | 2838068647 | 2838073351 | 378 |
| 606 | iso_pu_bacteria | 2838074704 | 2838077452 | 378 |
| 607 | iso_pu_bacteria | 2838661181 | 2838664826 | 378 |
| 608 | iso_pu_bacteria | 2838668709 | 2838671118 | 378 |
| 609 | iso_pu_bacteria | 2838680041 | 2838684942 | 378 |
| 610 | iso_pu_bacteria | 2838686498 | 2838691301 | 378 |
| 611 | iso_pu_bacteria | 2838694306 | 2838699221 | 378 |
| 612 | iso_pu_bacteria | 2838701080 | 2838703703 | 378 |
| 613 | iso_pu_bacteria | 2838707686 | 2838712702 | 378 |
| 614 | iso_pu_bacteria | 2838729681 | 2838735784 | 378 |
| 615 | iso_pu_bacteria | 2838742623 | 2838748686 | 378 |
| 616 | iso_pu_bacteria | 2841851746 | 2841853879 | 378 |
| 617 | iso_pu_bacteria | 2841864319 | 2841868152 | 378 |
| 618 | iso_pu_bacteria | 2842077413 | 2842082179 | 378 |
| 619 | iso_pu_bacteria | 2842110456 | 2842113416 | 378 |
| 620 | iso_pu_bacteria | 2842118031 | 2842123102 | 378 |
| 621 | iso_pu_bacteria | 2842146304 | 2842151212 | 378 |
| 622 | iso_pu_bacteria | 2842156927 | 2842162603 | 378 |
| 623 | iso_pu_bacteria | 2842163707 | 2842169969 | 378 |
| 624 | iso_pu_bacteria | 2842180545 | 2842185040 | 378 |
| 625 | iso_pu_bacteria | 2842192696 | 2842198243 | 378 |
| 626 | iso_pu_bacteria | 2842198810 | 2842199825 | 378 |
| 627 | iso_pu_bacteria | 2842205361 | 2842208324 | 378 |
| 628 | iso_pu_bacteria | 2842217011 | 2842220060 | 378 |
| 629 | iso_pu_bacteria | 2842229732 | 2842235587 | 378 |
| 630 | iso_pu_bacteria | 2842237096 | 2842241996 | 378 |
| 631 | iso_pu_bacteria | 2842243621 | 2842249379 | 378 |
| 632 | iso_pu_bacteria | 2842250916 | 2842256268 | 378 |
| 633 | iso_pu_bacteria | 2842257432 | 2842263484 | 378 |
| 634 | iso_pu_bacteria | 2842264693 | 2842266627 | 378 |
| 635 | iso_pu_bacteria | 2842271015 | 2842275776 | 378 |
| 636 | iso_pu_bacteria | 2842278818 | 2842281667 | 378 |
| 637 | iso_pu_bacteria | 2842285085 | 2842288779 | 378 |
| 638 | iso_pu_bacteria | 2842291075 | 2842296179 | 378 |
| 639 | iso_pu_bacteria | 2842304105 | 2842308240 | 378 |
| 640 | iso_pu_bacteria | 2842311132 | 2842315615 | 378 |
| 641 | iso_pu_bacteria | 2842317721 | 2842321368 | 378 |
| 642 | iso_pu_bacteria | 2842341865 | 2842345023 | 378 |
| 643 | iso_pu_bacteria | 2842363717 | 2842369142 | 378 |
| 644 | iso_pu_bacteria | 2842370503 | 2842375619 | 378 |
| 645 | iso_pu_bacteria | 2842377471 | 2842382579 | 378 |
| 646 | iso_pu_bacteria | 2842384541 | 2842389980 | 378 |
| 647 | iso_pu_bacteria | 2842395702 | 2842398491 | 378 |
| 648 | iso_pu_bacteria | 2842402390 | 2842406554 | 378 |
| 649 | iso_pu_bacteria | 2842409023 | 2842413019 | 378 |
| 650 | iso_pu_bacteria | 2842415677 | 2842419662 | 378 |
| 651 | iso_pu_bacteria | 2842422224 | 2842426986 | 378 |
| 652 | iso_pu_bacteria | 2842428310 | 2842429946 | 378 |
| 653 | iso_pu_bacteria | 2842434925 | 2842436394 | 378 |
| 654 | iso_pu_bacteria | 2842441272 | 2842444097 | 378 |
| 655 | iso_pu_bacteria | 2842447887 | 2842451049 | 378 |
| 656 | iso_pu_bacteria | 2842462802 | 2842464367 | 378 |
| 657 | iso_pu_bacteria | 2842469257 | 2842470723 | 378 |
| 658 | iso_pu_bacteria | 2842489311 | 2842493296 | 378 |
| 659 | iso_pu_bacteria | 2842495871 | 2842499134 | 378 |
| 660 | iso_pu_bacteria | 2842521101 | 2842523213 | 378 |
| 661 | iso_pu_bacteria | 2844454524 | 2844457475 | 378 |
| 662 | iso_pu_bacteria | 2847417321 | 2847420463 | 378 |
| 663 | iso_pu_bacteria | 2848992105 | 2848995335 | 378 |
| 664 | iso_pu_bacteria | 2850079185 | 2850082321 | 378 |
| 665 | iso_pu_bacteria | 2850079185 | 2850085794 | 378 |
| 666 | iso_pu_bacteria | 2855825444 | 2855827047 | 378 |
| 667 | iso_pu_bacteria | 2855839649 | 2855842444 | 378 |
| 668 | iso_pu_bacteria | 2855872281 | 2855878410 | 378 |
| 669 | iso_pu_bacteria | 2857516855 | 2857518884 | 378 |
| 670 | iso_pu_bacteria | 2858800743 | 2858803260 | 378 |
| 671 | iso_pu_bacteria | 2891048133 | 2891051103 | 378 |
| 672 | iso_pu_bacteria | 2896384573 | 2896390018 | 378 |
| 673 | iso_pu_bacteria | 2913295892 | 2913299856 | 378 |
| 674 | iso_pu_bacteria | 2915980308 | 2915980581 | 378 |
| 675 | iso_pu_bacteria | 2915986958 | 2915987331 | 378 |
| 676 | iso_pu_bacteria | 2915993759 | 2915994927 | 378 |
| 677 | iso_pu_bacteria | 2916000859 | 2916006999 | 378 |
| 678 | iso_pu_bacteria | 2916007675 | 2916012236 | 378 |
| 679 | iso_pu_bacteria | 2916014648 | 2916016901 | 378 |
| 680 | iso_pu_bacteria | 2916021584 | 2916027764 | 378 |
| 681 | iso_pu_bacteria | 2916028427 | 2916030223 | 378 |
| 682 | iso_pu_bacteria | 2916035215 | 2916036780 | 378 |
| 683 | iso_pu_bacteria | 2916041962 | 2916044637 | 378 |
| 684 | iso_pu_bacteria | 2916048683 | 2916052653 | 378 |
| 685 | iso_pu_bacteria | 2916055098 | 2916058349 | 378 |
| 686 | iso_pu_bacteria | 2916061851 | 2916067806 | 378 |
| 687 | iso_pu_bacteria | 2916068649 | 2916074200 | 378 |
| 688 | iso_pu_bacteria | 2916076590 | 2916081350 | 378 |
| 689 | iso_pu_bacteria | 2919100787 | 2919104580 | 378 |
| 690 | iso_pu_bacteria | 2920760137 | 2920760738 | 378 |
| 691 | iso_pu_bacteria | 2921201388 | 2921208080 | 378 |
| 692 | iso_pu_bacteria | 2921208531 | 2921212812 | 378 |
| 693 | iso_pu_bacteria | 2921237296 | 2921241883 | 378 |
| 694 | iso_pu_bacteria | 2921244191 | 2921244235 | 378 |
| 695 | iso_pu_bacteria | 2921250672 | 2921252521 | 378 |
| 696 | iso_pu_bacteria | 2921257292 | 2921260614 | 378 |
| 697 | iso_pu_bacteria | 2921263974 | 2921265984 | 378 |
| 698 | iso_pu_bacteria | 2921282425 | 2921287750 | 378 |
| 699 | iso_pu_bacteria | 2921289301 | 2921292857 | 378 |
| 700 | iso_pu_bacteria | 2923556063 | 2923558766 | 378 |
| 701 | iso_pu_bacteria | 2924144063 | 2924148802 | 378 |
| 702 | iso_pu_bacteria | 2924150972 | 2924152155 | 378 |
| 703 | iso_pu_bacteria | 2924158325 | 2924164091 | 378 |
| 704 | iso_pu_bacteria | 2924165586 | 2924172823 | 378 |
| 705 | iso_pu_bacteria | 2924172951 | 2924174441 | 378 |
| 706 | iso_pu_bacteria | 2924179722 | 2924184011 | 378 |
| 707 | iso_pu_bacteria | 2924186466 | 2924192943 | 378 |
| 708 | iso_pu_bacteria | 2924193448 | 2924193791 | 378 |
| 709 | iso_pu_bacteria | 2924200457 | 2924206682 | 378 |
| 710 | iso_pu_bacteria | 2924207177 | 2924213114 | 378 |
| 711 | iso_pu_bacteria | 2924221636 | 2924223998 | 378 |
| 712 | iso_pu_bacteria | 2924228884 | 2924232065 | 378 |
| 713 | iso_pu_bacteria | 2933016740 | 2933020958 | 378 |
| 714 | iso_pu_bacteria | 2933570622 | 2933574689 | 378 |
| 715 | iso_pu_bacteria | 2933586486 | 2933589294 | 378 |
| 716 | iso_pu_bacteria | 2933599457 | 2933603519 | 378 |
| 717 | iso_pu_bacteria | 2935894831 | 2935899717 | 378 |
| 718 | iso_pu_bacteria | 2935901341 | 2935907536 | 378 |
| 719 | iso_pu_bacteria | 2936367885 | 2936374852 | 378 |
| 720 | iso_pu_bacteria | 2936375103 | 2936380544 | 378 |
| 721 | iso_pu_bacteria | 2936381700 | 2936382285 | 378 |
| 722 | iso_pu_bacteria | 2936996657 | 2937000067 | 378 |
| 723 | iso_pu_bacteria | 2937002841 | 2937006972 | 378 |
| 724 | iso_pu_bacteria | 2937009748 | 2937015442 | 378 |
| 725 | iso_pu_bacteria | 2937016420 | 2937018161 | 378 |
| 726 | iso_pu_bacteria | 2937023124 | 2937024365 | 378 |
| 727 | iso_pu_bacteria | 2937029754 | 2937032976 | 378 |
| 728 | iso_pu_bacteria | 2937036028 | 2937042242 | 378 |
| 729 | iso_pu_bacteria | 2937042894 | 2937046712 | 378 |
| 730 | iso_pu_bacteria | 2937049772 | 2937052328 | 378 |
| 731 | iso_pu_bacteria | 2937056579 | 2937063137 | 378 |
| 732 | iso_pu_bacteria | 2937063883 | 2937067572 | 378 |
| 733 | iso_pu_bacteria | 2937071275 | 2937071386 | 378 |
| 734 | iso_pu_bacteria | 2937078374 | 2937078648 | 378 |
| 735 | iso_pu_bacteria | 2937084907 | 2937086242 | 378 |
| 736 | iso_pu_bacteria | 2937091812 | 2937092907 | 378 |
| 737 | iso_pu_bacteria | 2937098957 | 2937104729 | 378 |
| 738 | iso_pu_bacteria | 2937106411 | 2937109952 | 378 |
| 739 | iso_pu_bacteria | 2937113482 | 2937114560 | 378 |
| 740 | iso_pu_bacteria | 2937119839 | 2937123713 | 378 |
| 741 | iso_pu_bacteria | 2937126314 | 2937129309 | 378 |
| 742 | iso_pu_bacteria | 2957375807 | 2957376914 | 378 |
| 743 | iso_pu_bacteria | 2957382221 | 2957386070 | 378 |
| 744 | iso_pu_bacteria | 2957388812 | 2957390154 | 378 |
| 745 | iso_pu_bacteria | 2957395598 | 2957396782 | 378 |
| 746 | iso_pu_bacteria | 2957402308 | 2957406251 | 378 |
| 747 | iso_pu_bacteria | 2957408893 | 2957409004 | 378 |
| 748 | iso_pu_bacteria | 2957415311 | 2957422046 | 378 |
| 749 | iso_pu_bacteria | 2957422303 | 2957429541 | 378 |
| 750 | iso_pu_bacteria | 2957430029 | 2957430546 | 378 |
| 751 | iso_pu_bacteria | 2957437181 | 2957437406 | 378 |
| 752 | iso_pu_bacteria | 2957443900 | 2957444360 | 378 |
| 753 | iso_pu_bacteria | 2957450854 | 2957452765 | 378 |
| 754 | iso_pu_bacteria | 2957457609 | 2957463084 | 378 |
| 755 | iso_pu_bacteria | 2957464669 | 2957468210 | 378 |
| 756 | iso_pu_bacteria | 2957471148 | 2957471944 | 378 |
| 757 | iso_pu_bacteria | 2957478035 | 2957481005 | 378 |
| 758 | iso_pu_bacteria | 2957484790 | 2957488464 | 378 |
| 759 | iso_pu_bacteria | 2957491536 | 2957495258 | 378 |
| 760 | iso_pu_bacteria | 2957498199 | 2957501892 | 378 |
| 761 | iso_pu_bacteria | 2957505466 | 2957512831 | 378 |
| 762 | iso_pu_bacteria | 2960584000 | 2960584778 | 378 |
| 763 | iso_pu_bacteria | 2960591022 | 2960591296 | 378 |
| 764 | iso_pu_bacteria | 2960597568 | 2960598763 | 378 |
| 765 | iso_pu_bacteria | 2960603979 | 2960610201 | 378 |
| 766 | iso_pu_bacteria | 2960610863 | 2960617264 | 378 |
| 767 | iso_pu_bacteria | 2960617483 | 2960618744 | 378 |
| 768 | iso_pu_bacteria | 2960624210 | 2960629538 | 378 |
| 769 | iso_pu_bacteria | 2960631154 | 2960632548 | 378 |
| 770 | iso_pu_bacteria | 2960637947 | 2960639563 | 378 |
| 771 | iso_pu_bacteria | 2960645483 | 2960649376 | 378 |
| 772 | iso_pu_bacteria | 2960652885 | 2960653041 | 378 |
| 773 | iso_pu_bacteria | 2960660292 | 2960662941 | 378 |
| 774 | iso_pu_bacteria | 2960667422 | 2960671483 | 378 |
| 775 | iso_pu_bacteria | 2960674078 | 2960674692 | 378 |
| 776 | iso_pu_bacteria | 2960680706 | 2960681378 | 378 |
| 777 | iso_pu_bacteria | 2960687367 | 2960687919 | 378 |
| 778 | iso_pu_bacteria | 2960693952 | 2960697151 | 378 |
| 779 | iso_pu_bacteria | 2964607997 | 2964610870 | 378 |
| 780 | iso_pu_bacteria | 2964615318 | 2964620389 | 378 |
| 781 | iso_pu_bacteria | 2964621998 | 2964625994 | 378 |
| 782 | iso_pu_bacteria | 2964628898 | 2964632478 | 378 |
| 783 | iso_pu_bacteria | 2964636051 | 2964641714 | 378 |
| 784 | iso_pu_bacteria | 2964643177 | 2964647228 | 378 |
| 785 | iso_pu_bacteria | 2964649959 | 2964650875 | 378 |
| 786 | iso_pu_bacteria | 2964656573 | 2964658987 | 378 |
| 787 | iso_pu_bacteria | 2964663802 | 2964668844 | 378 |
| 788 | iso_pu_bacteria | 2964670856 | 2964677565 | 378 |
| 789 | iso_pu_bacteria | 2964678106 | 2964681778 | 378 |
| 790 | iso_pu_bacteria | 2964685014 | 2964686322 | 378 |
| 791 | iso_pu_bacteria | 2964691889 | 2964693213 | 378 |
| 792 | iso_pu_bacteria | 2964698721 | 2964705179 | 378 |
| 793 | iso_pu_bacteria | 2964705432 | 2964706207 | 378 |
| 794 | iso_pu_bacteria | 2964712639 | 2964719102 | 378 |
| 795 | iso_pu_bacteria | 2964719344 | 2964724798 | 378 |
| 796 | iso_pu_bacteria | 2967664464 | 2967666697 | 378 |
| 797 | iso_pu_bacteria | 2967671571 | 2967676593 | 378 |
| 798 | iso_pu_bacteria | 2967678726 | 2967679431 | 378 |
| 799 | iso_pu_bacteria | 2967686174 | 2967686527 | 378 |
| 800 | iso_pu_bacteria | 2967693043 | 2967696146 | 378 |
| 801 | iso_pu_bacteria | 2967699805 | 2967700449 | 378 |
| 802 | iso_pu_bacteria | 2967706974 | 2967708397 | 378 |
| 803 | iso_pu_bacteria | 2967714385 | 2967715794 | 378 |
| 804 | iso_pu_bacteria | 2967721400 | 2967721983 | 378 |
| 805 | iso_pu_bacteria | 2967728569 | 2967732468 | 378 |
| 806 | iso_pu_bacteria | 2967735183 | 2967735400 | 378 |
| 807 | iso_pu_bacteria | 2967742019 | 2967746887 | 378 |
| 808 | iso_pu_bacteria | 2967748971 | 2967750107 | 378 |
| 809 | iso_pu_bacteria | 2967755722 | 2967759030 | 378 |
| 810 | iso_pu_bacteria | 2967762386 | 2967769037 | 378 |
| 811 | iso_pu_bacteria | 2967769361 | 2967774574 | 378 |
| 812 | iso_pu_bacteria | 2967775926 | 2967781351 | 378 |
| 813 | iso_pu_bacteria | 2970019648 | 2970024948 | 378 |
| 814 | iso_pu_bacteria | 2970026789 | 2970030242 | 378 |
| 815 | iso_pu_bacteria | 2970033650 | 2970040630 | 378 |
| 816 | iso_pu_bacteria | 2970040964 | 2970044344 | 378 |
| 817 | iso_pu_bacteria | 2970047711 | 2970052774 | 378 |
| 818 | iso_pu_bacteria | 2970054988 | 2970061079 | 378 |
| 819 | iso_pu_bacteria | 2970061556 | 2970062339 | 378 |
| 820 | iso_pu_bacteria | 2970068827 | 2970069468 | 378 |
| 821 | iso_pu_bacteria | 2970076120 | 2970079103 | 378 |
| 822 | iso_pu_bacteria | 2970082768 | 2970083411 | 378 |
| 823 | iso_pu_bacteria | 2970088815 | 2970095524 | 378 |
| 824 | iso_pu_bacteria | 2970095765 | 2970099107 | 378 |
| 825 | iso_pu_bacteria | 2970102677 | 2970108852 | 378 |
| 826 | iso_pu_bacteria | 2970109326 | 2970115279 | 378 |
| 827 | iso_pu_bacteria | 2970116247 | 2970119581 | 378 |
| 828 | iso_pu_bacteria | 2970122695 | 2970126446 | 378 |
| 829 | iso_pu_bacteria | 2970129317 | 2970134321 | 378 |
| 830 | iso_pu_bacteria | 2970136068 | 2970140696 | 378 |
| 831 | iso_pu_bacteria | 2970143518 | 2970144561 | 378 |
| 832 | iso_pu_bacteria | 2970149975 | 2970155624 | 378 |
| 833 | iso_pu_bacteria | 2970156795 | 2970160280 | 378 |
| 834 | iso_pu_bacteria | 2970164137 | 2970165869 | 378 |
| 835 | iso_pu_bacteria | 2970170962 | 2970173369 | 378 |
| 836 | iso_pu_bacteria | 2970177841 | 2970179863 | 378 |
| 837 | iso_pu_bacteria | 2970184632 | 2970191410 | 378 |
| 838 | iso_pu_bacteria | 2970191845 | 2970195658 | 378 |
| 839 | iso_pu_bacteria | 2977516862 | 2977522091 | 378 |
| 840 | iso_pu_bacteria | 2977523885 | 2977530061 | 378 |
| 841 | iso_pu_bacteria | 2977530762 | 2977532458 | 378 |
| 842 | iso_pu_bacteria | 2977537788 | 2977540991 | 378 |
| 843 | iso_pu_bacteria | 2977544691 | 2977551103 | 378 |
| 844 | iso_pu_bacteria | 2977551784 | 2977556871 | 378 |
| 845 | iso_pu_bacteria | 2977558990 | 2977565620 | 378 |
| 846 | iso_pu_bacteria | 2977565890 | 2977569133 | 378 |
| 847 | iso_pu_bacteria | 2977572785 | 2977577988 | 378 |
| 848 | iso_pu_bacteria | 2977579622 | 2977579734 | 378 |
| 849 | iso_pu_bacteria | 2989771324 | 2989773545 | 378 |
| 850 | iso_pu_bacteria | 2995392953 | 2995395858 | 378 |
| 851 | iso_pu_bacteria | 2996887358 | 2996889221 | 378 |
| 852 | iso_pu_bacteria | 2996893221 | 2996894716 | 378 |
| 853 | iso_pu_bacteria | 3005409236 | 3005415471 | 378 |
| 854 | iso_pu_bacteria | 3005452660 | 3005455590 | 378 |
| 855 | iso_pu_bacteria | 639633055 | 639650015 | 378 |
| 856 | iso_pu_bacteria | 643692032 | 643823489 | 378 |
| 857 | iso_pu_bacteria | 643692032 | 643827102 | 378 |
| 858 | iso_pu_bacteria | 648276728 | 648735829 | 378 |
| 859 | iso_pu_bacteria | 8003992118 | 8003994985 | 378 |
| 860 | iso_pu_bacteria | 8003999396 | 8004002749 | 378 |
| 861 | iso_pu_bacteria | 8005258706 | 8005264201 | 378 |
| 862 | iso_pu_bacteria | 8005275841 | 8005282033 | 378 |
| 863 | iso_pu_bacteria | 8005282627 | 8005287152 | 378 |
| 864 | iso_pu_bacteria | 8005289223 | 8005294248 | 378 |
| 865 | iso_pu_bacteria | 8005301065 | 8005306659 | 378 |
| 866 | iso_pu_bacteria | 8005307578 | 8005309405 | 378 |
| 867 | iso_pu_bacteria | 8005321885 | 8005323748 | 378 |
| 868 | iso_pu_bacteria | 8005376324 | 8005382769 | 378 |
| 869 | iso_pu_bacteria | 8005382845 | 8005383825 | 378 |
| 870 | iso_pu_bacteria | 8005395548 | 8005401151 | 378 |
| 871 | iso_pu_bacteria | 8005430974 | 8005434104 | 378 |
| 872 | iso_pu_bacteria | 8005460587 | 8005464633 | 378 |
| 873 | iso_pu_bacteria | 8005497431 | 8005501682 | 378 |
| 874 | iso_pu_bacteria | 8005542996 | 8005547100 | 378 |
| 875 | iso_pu_bacteria | 8005556819 | 8005559148 | 378 |
| 876 | iso_pu_bacteria | 8005563573 | 8005566793 | 378 |
| 877 | iso_pu_bacteria | 8005570704 | 8005574929 | 378 |
| 878 | iso_pu_bacteria | 8005619151 | 8005623036 | 378 |
| 879 | iso_pu_bacteria | 8005626139 | 8005631659 | 378 |
| 880 | iso_pu_bacteria | 8005668836 | 8005673104 | 378 |
| 881 | iso_pu_bacteria | 8005688590 | 8005693645 | 378 |
| 882 | iso_pu_bacteria | 8005695170 | 8005700883 | 378 |
| 883 | iso_pu_bacteria | 8018127388 | 8018133600 | 378 |
| 884 | iso_pu_bacteria | 8018163183 | 8018170236 | 378 |
| 885 | iso_pu_bacteria | 8018176218 | 8018178447 | 378 |
| 886 | iso_pu_bacteria | 8023680758 | 8023687530 | 378 |
| 887 | iso_pu_bacteria | 8024479707 | 8024481967 | 378 |
| 888 | iso_pu_bacteria | 8024501048 | 8024505921 | 378 |
| 889 | iso_pu_bacteria | 8049293176 | 8049295954 | 378 |
| 890 | iso_pu_bacteria | 8049293176 | 8049298764 | 378 |
| 891 | iso_pu_bacteria | 8056375014 | 8056381600 | 378 |
| 892 | iso_pu_bacteria | 8056382006 | 8056387040 | 378 |
| 893 | iso_pu_bacteria | 8057874678 | 8057877007 | 378 |
| 894 | 3300005354 | Ga0070675_100174193 | Ga0070675_1001741932 | 379 |
| 895 | 3300005545 | Ga0070695_100003589 | Ga0070695_1000035893 | 379 |
| 896 | 3300005549 | Ga0070704_100052600 | Ga0070704_1000526003 | 379 |
| 897 | 3300005563 | Ga0068855_100388143 | Ga0068855_1003881431 | 379 |
| 898 | 3300005615 | Ga0070702_100062351 | Ga0070702_1000623512 | 379 |
| 899 | 3300005617 | Ga0068859_100173421 | Ga0068859_1001734213 | 379 |
| 900 | 3300006931 | Ga0097620_100173419 | Ga0097620_1001734193 | 379 |
| 901 | 3300010375 | Ga0105239_10038823 | Ga0105239_100388235 | 379 |
| 902 | 3300013308 | Ga0157375_10321932 | Ga0157375_103219323 | 379 |
| 903 | 3300014968 | Ga0157379_10167831 | Ga0157379_101678313 | 379 |
| 904 | 3300021384 | Ga0213876_10000462 | Ga0213876_1000046222 | 379 |
| 905 | 3300021384 | Ga0213876_10001766 | Ga0213876_100017666 | 379 |
| 906 | 3300021388 | Ga0213875_10004649 | Ga0213875_100046493 | 379 |
| 907 | 3300025900 | Ga0207710_10023003 | Ga0207710_100230031 | 379 |
| 908 | 3300026075 | Ga0207708_10095691 | Ga0207708_100956912 | 379 |
| 909 | 3300026089 | Ga0207648_10089853 | Ga0207648_100898532 | 379 |
| 910 | 3300026118 | Ga0207675_100091656 | Ga0207675_1000916563 | 379 |
| 911 | 3300028794 | Ga0307515_10174603 | Ga0307515_101746032 | 379 |
| 912 | 3300037471 | Ga0395905_0006639 | Ga0395905_0006639_10199_11350 | 379 |
| 913 | 3300037853 | Ga0436364_0046367 | Ga0436364_0046367_1897_3057 | 379 |
| 914 | 3300037853 | Ga0436364_1092228 | Ga0436364_1092228_1776_2936 | 379 |
| 915 | 3300039437 | Ga0436365_0323217 | Ga0436365_0323217_14508_15668 | 379 |
| 916 | 3300039437 | Ga0436365_1602908 | Ga0436365_1602908_17287_18447 | 379 |
| 917 | 3300039450 | Ga0436363_0461300 | Ga0436363_0461300_2724_3884 | 379 |
| 918 | 3300039450 | Ga0436363_1352461 | Ga0436363_1352461_998_2158 | 379 |
| 919 | 3300039453 | Ga0436362_0228906 | Ga0436362_0228906_3441_4601 | 379 |
| 920 | 3300046491 | Ga0495584_0032726 | Ga0495584_0032726_1418_2581 | 379 |
| 921 | 3300048905 | Ga0496102_0013750 | Ga0496102_0013750_414_1577 | 379 |
| 922 | 3300048907 | Ga0496104_0212516 | Ga0496104_0212516_483_1646 | 379 |
| 923 | 3300048909 | Ga0496106_0084852 | Ga0496106_0084852_1244_2407 | 379 |
| 924 | 3300048912 | Ga0496109_0036719 | Ga0496109_0036719_2336_3499 | 379 |
| 925 | 3300048916 | Ga0496113_0115836 | Ga0496113_0115836_730_1893 | 379 |
| 926 | 3300049568 | Ga0501031_0068652 | Ga0501031_0068652_314_1477 | 379 |
| 927 | 3300049574 | Ga0501038_0046815 | Ga0501038_0046815_771_1934 | 379 |
| 928 | 3300049577 | Ga0501041_0084329 | Ga0501041_0084329_282_1445 | 379 |
| 929 | 3300049578 | Ga0501042_0174390 | Ga0501042_0174390_228_1391 | 379 |
| 930 | 3300049580 | Ga0501046_0017428 | Ga0501046_0017428_890_2053 | 379 |
| 931 | 3300049591 | Ga0501075_0015874 | Ga0501075_0015874_2772_3935 | 379 |
| 932 | 3300049592 | Ga0501076_0053841 | Ga0501076_0053841_927_2090 | 379 |
| 933 | 3300049593 | Ga0501077_0001899 | Ga0501077_0001899_9162_10325 | 379 |
| 934 | 3300049824 | Ga0501045_0009672 | Ga0501045_0009672_4132_5295 | 379 |
| 935 | 3300050507 | nmdc:mga05p37_490821_c1 | nmdc:mga05p37_490821_c1_61_1224 | 379 |
| 936 | 3300053153 | Ga0500616_0000709 | Ga0500616_0000709_22322_23620 | 379 |
| 937 | 3300054114 | Ga0501084_0283364 | Ga0501084_0283364_58_1221 | 379 |
| 938 | 3300061734 | Ga0530510_0005930 | Ga0530510_0005930_35_1198 | 379 |
| 939 | 3300061734 | Ga0530510_0147245 | Ga0530510_0147245_279_1442 | 379 |
| 940 | iso_pu_bacteria | 2989349275 | 2989354619 | 379 |
| 941 | 3300025297 | Ga0209758_1006689 | Ga0209758_10066892 | 380 |
| 942 | 3300025940 | Ga0207691_10176794 | Ga0207691_101767942 | 380 |
| 943 | 3300026075 | Ga0207708_10140403 | Ga0207708_101404032 | 380 |
| 944 | 3300026118 | Ga0207675_100258410 | Ga0207675_1002584102 | 380 |
| 945 | 3300031911 | Ga0307412_10201641 | Ga0307412_102016412 | 380 |
| 946 | 3300035171 | Ga0373946_0016223 | Ga0373946_0016223_279_1421 | 380 |
| 947 | 3300035695 | Ga0373927_0000047 | Ga0373927_0000047_7548_8741 | 380 |
| 948 | 3300035695 | Ga0373927_0000701 | Ga0373927_0000701_14144_15286 | 380 |
| 949 | 3300037068 | Ga0373925_0006393 | Ga0373925_0006393_6877_8019 | 380 |
| 950 | 3300037068 | Ga0373925_0009566 | Ga0373925_0009566_574_1767 | 380 |
| 951 | 3300037471 | Ga0395905_0003051 | Ga0395905_0003051_7335_8561 | 380 |
| 952 | 3300046460 | Ga0495638_0021031 | Ga0495638_0021031_1242_2399 | 380 |
| 953 | 3300048914 | Ga0496111_0000974 | Ga0496111_0000974_553_1851 | 380 |
| 954 | 3300048926 | Ga0496123_0007564 | Ga0496123_0007564_5197_6495 | 380 |
| 955 | 3300049576 | Ga0501040_0144591 | Ga0501040_0144591_393_1646 | 380 |
| 956 | 3300049588 | Ga0501072_0110117 | Ga0501072_0110117_442_1659 | 380 |
| 957 | 3300049591 | Ga0501075_0097011 | Ga0501075_0097011_114_1352 | 380 |
| 958 | 3300049822 | Ga0501035_0232442 | Ga0501035_0232442_176_1393 | 380 |
| 959 | 3300002987 | JGI25159J45721_1000032 | JGI25159J45721_100003241 | 381 |
| 960 | 3300003187 | JGI25151J46595_10009531 | JGI25151J46595_100095315 | 381 |
| 961 | 3300003354 | JGI25160J50197_1000009 | JGI25160J50197_100000943 | 381 |
| 962 | 3300003354 | JGI25160J50197_1011868 | JGI25160J50197_10118682 | 381 |
| 963 | 3300003374 | JGI25161J50226_1000240 | JGI25161J50226_100024010 | 381 |
| 964 | 3300003771 | Ga0055526_1001379 | Ga0055526_10013794 | 381 |
| 965 | 3300003775 | Ga0055524_1004686 | Ga0055524_10046866 | 381 |
| 966 | 3300003775 | Ga0055524_1005912 | Ga0055524_10059124 | 381 |
| 967 | 3300003781 | Ga0055536_1002454 | Ga0055536_100245410 | 381 |
| 968 | 3300003781 | Ga0055536_1012053 | Ga0055536_10120533 | 381 |
| 969 | 3300003790 | Ga0055528_1023626 | Ga0055528_10236262 | 381 |
| 970 | 3300003792 | Ga0055540_1003170 | Ga0055540_10031703 | 381 |
| 971 | 3300003794 | Ga0055531_10002326 | Ga0055531_1000232610 | 381 |
| 972 | 3300003794 | Ga0055531_10011072 | Ga0055531_100110723 | 381 |
| 973 | 3300004625 | Ga0055543_1000055 | Ga0055543_100005544 | 381 |
| 974 | 3300005262 | Ga0065165_1000020 | Ga0065165_1000020226 | 381 |
| 975 | 3300005327 | Ga0070658_10024041 | Ga0070658_100240416 | 381 |
| 976 | 3300005329 | Ga0070683_100020763 | Ga0070683_1000207635 | 381 |
| 977 | 3300005334 | Ga0068869_100010176 | Ga0068869_1000101766 | 381 |
| 978 | 3300005335 | Ga0070666_10035078 | Ga0070666_100350783 | 381 |
| 979 | 3300005336 | Ga0070680_100008772 | Ga0070680_1000087728 | 381 |
| 980 | 3300005337 | Ga0070682_100001331 | Ga0070682_10000133116 | 381 |
| 981 | 3300005339 | Ga0070660_100001803 | Ga0070660_1000018033 | 381 |
| 982 | 3300005340 | Ga0070689_100000297 | Ga0070689_10000029717 | 381 |
| 983 | 3300005341 | Ga0070691_10004703 | Ga0070691_100047036 | 381 |
| 984 | 3300005344 | Ga0070661_100018427 | Ga0070661_1000184275 | 381 |
| 985 | 3300005345 | Ga0070692_10001269 | Ga0070692_100012693 | 381 |
| 986 | 3300005347 | Ga0070668_100015668 | Ga0070668_1000156682 | 381 |
| 987 | 3300005347 | Ga0070668_100050203 | Ga0070668_1000502033 | 381 |
| 988 | 3300005353 | Ga0070669_100001902 | Ga0070669_1000019027 | 381 |
| 989 | 3300005354 | Ga0070675_100008391 | Ga0070675_1000083918 | 381 |
| 990 | 3300005356 | Ga0070674_100000216 | Ga0070674_10000021615 | 381 |
| 991 | 3300005356 | Ga0070674_100047854 | Ga0070674_1000478544 | 381 |
| 992 | 3300005364 | Ga0070673_100001299 | Ga0070673_10000129916 | 381 |
| 993 | 3300005365 | Ga0070688_100001065 | Ga0070688_1000010655 | 381 |
| 994 | 3300005365 | Ga0070688_100085170 | Ga0070688_1000851702 | 381 |
| 995 | 3300005367 | Ga0070667_100004535 | Ga0070667_1000045353 | 381 |
| 996 | 3300005434 | Ga0070709_10043745 | Ga0070709_100437453 | 381 |
| 997 | 3300005435 | Ga0070714_100002631 | Ga0070714_1000026317 | 381 |
| 998 | 3300005436 | Ga0070713_100025539 | Ga0070713_1000255394 | 381 |
| 999 | 3300005437 | Ga0070710_10007642 | Ga0070710_100076426 | 381 |
| 1000 | 3300005438 | Ga0070701_10018654 | Ga0070701_100186543 | 381 |
| 1001 | 3300005457 | Ga0070662_100000604 | Ga0070662_10000060415 | 381 |
| 1002 | 3300005466 | Ga0070685_10008115 | Ga0070685_100081154 | 381 |
| 1003 | 3300005530 | Ga0070679_100027088 | Ga0070679_1000270883 | 381 |
| 1004 | 3300005535 | Ga0070684_100038554 | Ga0070684_1000385543 | 381 |
| 1005 | 3300005536 | Ga0070697_100019948 | Ga0070697_1000199482 | 381 |
| 1006 | 3300005539 | Ga0068853_100002229 | Ga0068853_10000222915 | 381 |
| 1007 | 3300005543 | Ga0070672_100035343 | Ga0070672_1000353433 | 381 |
| 1008 | 3300005544 | Ga0070686_100007583 | Ga0070686_1000075835 | 381 |
| 1009 | 3300005547 | Ga0070693_100000285 | Ga0070693_10000028517 | 381 |
| 1010 | 3300005563 | Ga0068855_100017911 | Ga0068855_10001791110 | 381 |
| 1011 | 3300005564 | Ga0070664_100002460 | Ga0070664_10000246017 | 381 |
| 1012 | 3300005577 | Ga0068857_100009396 | Ga0068857_1000093969 | 381 |
| 1013 | 3300005578 | Ga0068854_100001563 | Ga0068854_1000015635 | 381 |
| 1014 | 3300005615 | Ga0070702_100005294 | Ga0070702_1000052945 | 381 |
| 1015 | 3300005616 | Ga0068852_100004868 | Ga0068852_1000048687 | 381 |
| 1016 | 3300005617 | Ga0068859_100121929 | Ga0068859_1001219293 | 381 |
| 1017 | 3300005618 | Ga0068864_100019253 | Ga0068864_1000192532 | 381 |
| 1018 | 3300005719 | Ga0068861_100003642 | Ga0068861_1000036422 | 381 |
| 1019 | 3300005841 | Ga0068863_100087143 | Ga0068863_1000871432 | 381 |
| 1020 | 3300005843 | Ga0068860_100002382 | Ga0068860_10000238217 | 381 |
| 1021 | 3300005844 | Ga0068862_100021798 | Ga0068862_1000217982 | 381 |
| 1022 | 3300006038 | Ga0075365_10043515 | Ga0075365_100435151 | 381 |
| 1023 | 3300006163 | Ga0070715_10000999 | Ga0070715_100009995 | 381 |
| 1024 | 3300006173 | Ga0070716_100004866 | Ga0070716_1000048667 | 381 |
| 1025 | 3300006175 | Ga0070712_100009628 | Ga0070712_1000096283 | 381 |
| 1026 | 3300006237 | Ga0097621_100065952 | Ga0097621_1000659523 | 381 |
| 1027 | 3300006881 | Ga0068865_100002002 | Ga0068865_10000200215 | 381 |
| 1028 | 3300006931 | Ga0097620_100121930 | Ga0097620_1001219303 | 381 |
| 1029 | 3300009011 | Ga0105251_10025163 | Ga0105251_100251632 | 381 |
| 1030 | 3300009094 | Ga0111539_10480252 | Ga0111539_104802521 | 381 |
| 1031 | 3300009098 | Ga0105245_10014514 | Ga0105245_100145143 | 381 |
| 1032 | 3300009101 | Ga0105247_10001618 | Ga0105247_100016182 | 381 |
| 1033 | 3300009148 | Ga0105243_10004747 | Ga0105243_100047473 | 381 |
| 1034 | 3300009174 | Ga0105241_10025603 | Ga0105241_100256035 | 381 |
| 1035 | 3300009176 | Ga0105242_10075995 | Ga0105242_100759953 | 381 |
| 1036 | 3300009177 | Ga0105248_10005005 | Ga0105248_1000500517 | 381 |
| 1037 | 3300009177 | Ga0105248_10030678 | Ga0105248_100306783 | 381 |
| 1038 | 3300009545 | Ga0105237_10040231 | Ga0105237_100402314 | 381 |
| 1039 | 3300009551 | Ga0105238_10110065 | Ga0105238_101100653 | 381 |
| 1040 | 3300011119 | Ga0105246_10001570 | Ga0105246_100015706 | 381 |
| 1041 | 3300013100 | Ga0157373_10059900 | Ga0157373_100599003 | 381 |
| 1042 | 3300013102 | Ga0157371_10011141 | Ga0157371_100111415 | 381 |
| 1043 | 3300013104 | Ga0157370_10033099 | Ga0157370_100330995 | 381 |
| 1044 | 3300013249 | Ga0171463_1006 | Ga0171463_1006278 | 381 |
| 1045 | 3300013308 | Ga0157375_10000397 | Ga0157375_1000039713 | 381 |
| 1046 | 3300013308 | Ga0157375_10027475 | Ga0157375_100274755 | 381 |
| 1047 | 3300014325 | Ga0163163_10056213 | Ga0163163_100562133 | 381 |
| 1048 | 3300014326 | Ga0157380_10014895 | Ga0157380_100148951 | 381 |
| 1049 | 3300014745 | Ga0157377_10004671 | Ga0157377_100046718 | 381 |
| 1050 | 3300014968 | Ga0157379_10002662 | Ga0157379_100026623 | 381 |
| 1051 | 3300014968 | Ga0157379_10056700 | Ga0157379_100567003 | 381 |
| 1052 | 3300014969 | Ga0157376_10001462 | Ga0157376_1000146213 | 381 |
| 1053 | 3300014969 | Ga0157376_10075130 | Ga0157376_100751303 | 381 |
| 1054 | 3300015690 | Ga0183363_1227 | Ga0183363_12273 | 381 |
| 1055 | 3300025258 | Ga0209129_1002718 | Ga0209129_10027187 | 381 |
| 1056 | 3300025284 | Ga0209130_1000037 | Ga0209130_1000037225 | 381 |
| 1057 | 3300025292 | Ga0209676_1003539 | Ga0209676_10035396 | 381 |
| 1058 | 3300025292 | Ga0209676_1008914 | Ga0209676_10089143 | 381 |
| 1059 | 3300025294 | Ga0209025_1000196 | Ga0209025_1000196107 | 381 |
| 1060 | 3300025294 | Ga0209025_1013072 | Ga0209025_10130723 | 381 |
| 1061 | 3300025295 | Ga0209564_1000086 | Ga0209564_100008645 | 381 |
| 1062 | 3300025297 | Ga0209758_1000576 | Ga0209758_100057628 | 381 |
| 1063 | 3300025299 | Ga0209256_1000321 | Ga0209256_100032114 | 381 |
| 1064 | 3300025299 | Ga0209256_1002621 | Ga0209256_10026212 | 381 |
| 1065 | 3300025299 | Ga0209256_1012480 | Ga0209256_10124802 | 381 |
| 1066 | 3300025302 | Ga0207426_1000048 | Ga0207426_1000048265 | 381 |
| 1067 | 3300025302 | Ga0207426_1002020 | Ga0207426_10020207 | 381 |
| 1068 | 3300025303 | Ga0209051_1008523 | Ga0209051_10085234 | 381 |
| 1069 | 3300025303 | Ga0209051_1041942 | Ga0209051_10419421 | 381 |
| 1070 | 3300025304 | Ga0209257_1004633 | Ga0209257_10046338 | 381 |
| 1071 | 3300025304 | Ga0209257_1004844 | Ga0209257_10048443 | 381 |
| 1072 | 3300025898 | Ga0207692_10006578 | Ga0207692_100065785 | 381 |
| 1073 | 3300025900 | Ga0207710_10003659 | Ga0207710_100036598 | 381 |
| 1074 | 3300025901 | Ga0207688_10006040 | Ga0207688_100060407 | 381 |
| 1075 | 3300025903 | Ga0207680_10023917 | Ga0207680_100239173 | 381 |
| 1076 | 3300025904 | Ga0207647_10003262 | Ga0207647_100032624 | 381 |
| 1077 | 3300025907 | Ga0207645_10018030 | Ga0207645_100180304 | 381 |
| 1078 | 3300025911 | Ga0207654_10016041 | Ga0207654_100160413 | 381 |
| 1079 | 3300025914 | Ga0207671_10026966 | Ga0207671_100269663 | 381 |
| 1080 | 3300025915 | Ga0207693_10002790 | Ga0207693_1000279015 | 381 |
| 1081 | 3300025917 | Ga0207660_10005450 | Ga0207660_100054505 | 381 |
| 1082 | 3300025918 | Ga0207662_10002012 | Ga0207662_1000201213 | 381 |
| 1083 | 3300025919 | Ga0207657_10006393 | Ga0207657_100063934 | 381 |
| 1084 | 3300025920 | Ga0207649_10003953 | Ga0207649_100039534 | 381 |
| 1085 | 3300025924 | Ga0207694_10080002 | Ga0207694_100800023 | 381 |
| 1086 | 3300025925 | Ga0207650_10030791 | Ga0207650_100307913 | 381 |
| 1087 | 3300025927 | Ga0207687_10027934 | Ga0207687_100279343 | 381 |
| 1088 | 3300025928 | Ga0207700_10020029 | Ga0207700_100200294 | 381 |
| 1089 | 3300025931 | Ga0207644_10016821 | Ga0207644_100168215 | 381 |
| 1090 | 3300025931 | Ga0207644_10042398 | Ga0207644_100423983 | 381 |
| 1091 | 3300025932 | Ga0207690_10001636 | Ga0207690_1000163615 | 381 |
| 1092 | 3300025933 | Ga0207706_10001549 | Ga0207706_1000154915 | 381 |
| 1093 | 3300025935 | Ga0207709_10008268 | Ga0207709_100082683 | 381 |
| 1094 | 3300025936 | Ga0207670_10007780 | Ga0207670_100077803 | 381 |
| 1095 | 3300025936 | Ga0207670_10066256 | Ga0207670_100662562 | 381 |
| 1096 | 3300025937 | Ga0207669_10016603 | Ga0207669_100166032 | 381 |
| 1097 | 3300025937 | Ga0207669_10023338 | Ga0207669_100233384 | 381 |
| 1098 | 3300025939 | Ga0207665_10002147 | Ga0207665_100021475 | 381 |
| 1099 | 3300025940 | Ga0207691_10020588 | Ga0207691_100205885 | 381 |
| 1100 | 3300025942 | Ga0207689_10015316 | Ga0207689_100153163 | 381 |
| 1101 | 3300025960 | Ga0207651_10003739 | Ga0207651_100037398 | 381 |
| 1102 | 3300025972 | Ga0207668_10003501 | Ga0207668_1000350112 | 381 |
| 1103 | 3300025972 | Ga0207668_10025353 | Ga0207668_100253533 | 381 |
| 1104 | 3300025981 | Ga0207640_10001586 | Ga0207640_100015863 | 381 |
| 1105 | 3300025986 | Ga0207658_10013167 | Ga0207658_100131675 | 381 |
| 1106 | 3300026035 | Ga0207703_10065760 | Ga0207703_100657602 | 381 |
| 1107 | 3300026041 | Ga0207639_10077638 | Ga0207639_100776383 | 381 |
| 1108 | 3300026067 | Ga0207678_10001431 | Ga0207678_1000143114 | 381 |
| 1109 | 3300026075 | Ga0207708_10005630 | Ga0207708_100056308 | 381 |
| 1110 | 3300026088 | Ga0207641_10160214 | Ga0207641_101602143 | 381 |
| 1111 | 3300026089 | Ga0207648_10039265 | Ga0207648_100392653 | 381 |
| 1112 | 3300026116 | Ga0207674_10005526 | Ga0207674_1000552615 | 381 |
| 1113 | 3300026121 | Ga0207683_10001480 | Ga0207683_1000148014 | 381 |
| 1114 | 3300026142 | Ga0207698_10002976 | Ga0207698_100029764 | 381 |
| 1115 | 3300027717 | Ga0209998_10005479 | Ga0209998_100054793 | 381 |
| 1116 | 3300028379 | Ga0268266_10029443 | Ga0268266_100294433 | 381 |
| 1117 | 3300035241 | Ga0373961_0014157 | Ga0373961_0014157_41_1258 | 381 |
| 1118 | 3300035691 | Ga0373931_0031774 | Ga0373931_0031774_1162_2379 | 381 |
| 1119 | 3300037312 | Ga0395899_0115466 | Ga0395899_0115466_210_1379 | 381 |
| 1120 | 3300037418 | Ga0395900_0028460 | Ga0395900_0028460_240_1409 | 381 |
| 1121 | 3300037466 | Ga0395898_0028293 | Ga0395898_0028293_4302_5471 | 381 |
| 1122 | 3300037466 | Ga0395898_0126795 | Ga0395898_0126795_757_1986 | 381 |
| 1123 | 3300048903 | Ga0496100_0006159 | Ga0496100_0006159_753_1991 | 381 |
| 1124 | 3300048903 | Ga0496100_0008467 | Ga0496100_0008467_1744_2961 | 381 |
| 1125 | 3300048904 | Ga0496101_0000994 | Ga0496101_0000994_11527_12765 | 381 |
| 1126 | 3300048905 | Ga0496102_0054032 | Ga0496102_0054032_2233_3450 | 381 |
| 1127 | 3300048906 | Ga0496103_0012644 | Ga0496103_0012644_3451_4668 | 381 |
| 1128 | 3300048907 | Ga0496104_0017841 | Ga0496104_0017841_3970_5187 | 381 |
| 1129 | 3300048908 | Ga0496105_0003294 | Ga0496105_0003294_5927_7165 | 381 |
| 1130 | 3300048909 | Ga0496106_0002538 | Ga0496106_0002538_3989_5227 | 381 |
| 1131 | 3300048909 | Ga0496106_0007118 | Ga0496106_0007118_4273_5490 | 381 |
| 1132 | 3300048910 | Ga0496107_0005509 | Ga0496107_0005509_3293_4531 | 381 |
| 1133 | 3300048911 | Ga0496108_0027714 | Ga0496108_0027714_876_2105 | 381 |
| 1134 | 3300048911 | Ga0496108_0042711 | Ga0496108_0042711_2098_3336 | 381 |
| 1135 | 3300048911 | Ga0496108_0056252 | Ga0496108_0056252_927_2144 | 381 |
| 1136 | 3300048912 | Ga0496109_0105695 | Ga0496109_0105695_290_1528 | 381 |
| 1137 | 3300048913 | Ga0496110_0005190 | Ga0496110_0005190_3655_4872 | 381 |
| 1138 | 3300048913 | Ga0496110_0102303 | Ga0496110_0102303_755_1984 | 381 |
| 1139 | 3300048914 | Ga0496111_0067954 | Ga0496111_0067954_1161_2378 | 381 |
| 1140 | 3300048915 | Ga0496112_0010710 | Ga0496112_0010710_4857_6086 | 381 |
| 1141 | 3300048916 | Ga0496113_0014864 | Ga0496113_0014864_799_2016 | 381 |
| 1142 | 3300048916 | Ga0496113_0104748 | Ga0496113_0104748_23_1252 | 381 |
| 1143 | 3300048917 | Ga0496114_0006817 | Ga0496114_0006817_6981_8198 | 381 |
| 1144 | 3300048917 | Ga0496114_0016605 | Ga0496114_0016605_749_1987 | 381 |
| 1145 | 3300048918 | Ga0496115_0002429 | Ga0496115_0002429_5504_6742 | 381 |
| 1146 | 3300048918 | Ga0496115_0006517 | Ga0496115_0006517_4566_5783 | 381 |
| 1147 | 3300049572 | Ga0501036_0022959 | Ga0501036_0022959_3231_4457 | 381 |
| 1148 | 3300049576 | Ga0501040_0027436 | Ga0501040_0027436_1757_2983 | 381 |
| 1149 | 3300049576 | Ga0501040_0140853 | Ga0501040_0140853_205_1413 | 381 |
| 1150 | 3300049577 | Ga0501041_0109868 | Ga0501041_0109868_254_1441 | 381 |
| 1151 | 3300049578 | Ga0501042_0014861 | Ga0501042_0014861_2848_4074 | 381 |
| 1152 | 3300049578 | Ga0501042_0036726 | Ga0501042_0036726_1530_2717 | 381 |
| 1153 | 3300049579 | Ga0501043_0060715 | Ga0501043_0060715_1554_2741 | 381 |
| 1154 | 3300049582 | Ga0501048_0048180 | Ga0501048_0048180_1095_2321 | 381 |
| 1155 | 3300049582 | Ga0501048_0076781 | Ga0501048_0076781_260_1447 | 381 |
| 1156 | 3300049587 | Ga0501071_0019517 | Ga0501071_0019517_2120_3346 | 381 |
| 1157 | 3300049588 | Ga0501072_0009194 | Ga0501072_0009194_2662_3888 | 381 |
| 1158 | 3300049589 | Ga0501073_0056594 | Ga0501073_0056594_421_1647 | 381 |
| 1159 | 3300049591 | Ga0501075_0005390 | Ga0501075_0005390_6921_8147 | 381 |
| 1160 | 3300049592 | Ga0501076_0035201 | Ga0501076_0035201_1410_2636 | 381 |
| 1161 | 3300049593 | Ga0501077_0008697 | Ga0501077_0008697_621_1847 | 381 |
| 1162 | 3300049593 | Ga0501077_0036555 | Ga0501077_0036555_666_1883 | 381 |
| 1163 | 3300049593 | Ga0501077_0056108 | Ga0501077_0056108_1251_2438 | 381 |
| 1164 | 3300049741 | Ga0501079_0095152 | Ga0501079_0095152_170_1396 | 381 |
| 1165 | 3300049743 | Ga0501081_0012642 | Ga0501081_0012642_3975_5201 | 381 |
| 1166 | 3300049743 | Ga0501081_0031811 | Ga0501081_0031811_1182_2369 | 381 |
| 1167 | 3300049743 | Ga0501081_0129408 | Ga0501081_0129408_250_1458 | 381 |
| 1168 | 3300049824 | Ga0501045_0010352 | Ga0501045_0010352_223_1449 | 381 |
| 1169 | 3300050492 | nmdc:mga0yw44_2069_c2 | nmdc:mga0yw44_2069_c2_34_1305 | 381 |
| 1170 | 3300053125 | Ga0500618_011556 | Ga0500618_011556_519_1880 | 381 |
| 1171 | 3300053161 | Ga0500634_0033297 | Ga0500634_0033297_757_1908 | 381 |
| 1172 | 3300054114 | Ga0501084_0061685 | Ga0501084_0061685_520_1746 | 381 |
| 1173 | 3300060353 | Ga0501082_0237340 | Ga0501082_0237340_278_1486 | 381 |
| 1174 | 3300061734 | Ga0530510_0062824 | Ga0530510_0062824_1285_2511 | 381 |
| 1175 | 3300002773 | JGI25152J39213_1009370 | JGI25152J39213_10093703 | 382 |
| 1176 | 3300002774 | JGI25150J39212_1002811 | JGI25150J39212_10028113 | 382 |
| 1177 | 3300002987 | JGI25159J45721_1000508 | JGI25159J45721_10005089 | 382 |
| 1178 | 3300003187 | JGI25151J46595_10003417 | JGI25151J46595_100034176 | 382 |
| 1179 | 3300003187 | JGI25151J46595_10032321 | JGI25151J46595_100323213 | 382 |
| 1180 | 3300003215 | JGI25153J46596_10004999 | JGI25153J46596_100049991 | 382 |
| 1181 | 3300003215 | JGI25153J46596_10038136 | JGI25153J46596_100381362 | 382 |
| 1182 | 3300003374 | JGI25161J50226_1000120 | JGI25161J50226_100012026 | 382 |
| 1183 | 3300003771 | Ga0055526_1002044 | Ga0055526_10020447 | 382 |
| 1184 | 3300003771 | Ga0055526_1002151 | Ga0055526_10021513 | 382 |
| 1185 | 3300003771 | Ga0055526_1018637 | Ga0055526_10186373 | 382 |
| 1186 | 3300003775 | Ga0055524_1002134 | Ga0055524_10021349 | 382 |
| 1187 | 3300003775 | Ga0055524_1003185 | Ga0055524_10031857 | 382 |
| 1188 | 3300003790 | Ga0055528_1000445 | Ga0055528_100044519 | 382 |
| 1189 | 3300003790 | Ga0055528_1000693 | Ga0055528_10006939 | 382 |
| 1190 | 3300003790 | Ga0055528_1002180 | Ga0055528_10021804 | 382 |
| 1191 | 3300003790 | Ga0055528_1015774 | Ga0055528_10157742 | 382 |
| 1192 | 3300003790 | Ga0055528_1021652 | Ga0055528_10216522 | 382 |
| 1193 | 3300003792 | Ga0055540_1002182 | Ga0055540_10021827 | 382 |
| 1194 | 3300003792 | Ga0055540_1002353 | Ga0055540_10023532 | 382 |
| 1195 | 3300004625 | Ga0055543_1000155 | Ga0055543_100015524 | 382 |
| 1196 | 3300005262 | Ga0065165_1009728 | Ga0065165_10097282 | 382 |
| 1197 | 3300005548 | Ga0070665_100297393 | Ga0070665_1002973932 | 382 |
| 1198 | 3300006048 | Ga0075363_100007595 | Ga0075363_1000075955 | 382 |
| 1199 | 3300006177 | Ga0075362_10109047 | Ga0075362_101090471 | 382 |
| 1200 | 3300006178 | Ga0075367_10008749 | Ga0075367_100087494 | 382 |
| 1201 | 3300006186 | Ga0075369_10001874 | Ga0075369_100018745 | 382 |
| 1202 | 3300006195 | Ga0075366_10128412 | Ga0075366_101284121 | 382 |
| 1203 | 3300006353 | Ga0075370_10008293 | Ga0075370_100082934 | 382 |
| 1204 | 3300006946 | Ga0079104_1000753 | Ga0079104_100075314 | 382 |
| 1205 | 3300009765 | Ga0123341_1000016 | Ga0123341_100001666 | 382 |
| 1206 | 3300021320 | Ga0214544_1000063 | Ga0214544_100006343 | 382 |
| 1207 | 3300021321 | Ga0214542_1000095 | Ga0214542_100009533 | 382 |
| 1208 | 3300021327 | Ga0214543_1000026 | Ga0214543_100002633 | 382 |
| 1209 | 3300025208 | Ga0209436_100041 | Ga0209436_1000419 | 382 |
| 1210 | 3300025245 | Ga0207425_1002069 | Ga0207425_10020696 | 382 |
| 1211 | 3300025245 | Ga0207425_1002695 | Ga0207425_10026951 | 382 |
| 1212 | 3300025258 | Ga0209129_1000199 | Ga0209129_100019914 | 382 |
| 1213 | 3300025258 | Ga0209129_1001513 | Ga0209129_100151311 | 382 |
| 1214 | 3300025258 | Ga0209129_1001544 | Ga0209129_10015443 | 382 |
| 1215 | 3300025258 | Ga0209129_1009357 | Ga0209129_10093573 | 382 |
| 1216 | 3300025258 | Ga0209129_1014942 | Ga0209129_10149421 | 382 |
| 1217 | 3300025273 | Ga0209673_1000037 | Ga0209673_1000037125 | 382 |
| 1218 | 3300025273 | Ga0209673_1000060 | Ga0209673_1000060230 | 382 |
| 1219 | 3300025273 | Ga0209673_1001773 | Ga0209673_100177312 | 382 |
| 1220 | 3300025273 | Ga0209673_1001909 | Ga0209673_10019094 | 382 |
| 1221 | 3300025273 | Ga0209673_1002125 | Ga0209673_10021254 | 382 |
| 1222 | 3300025273 | Ga0209673_1023295 | Ga0209673_10232953 | 382 |
| 1223 | 3300025284 | Ga0209130_1000030 | Ga0209130_1000030150 | 382 |
| 1224 | 3300025294 | Ga0209025_1001009 | Ga0209025_100100920 | 382 |
| 1225 | 3300025294 | Ga0209025_1001184 | Ga0209025_100118413 | 382 |
| 1226 | 3300025294 | Ga0209025_1003594 | Ga0209025_10035946 | 382 |
| 1227 | 3300025294 | Ga0209025_1012061 | Ga0209025_10120613 | 382 |
| 1228 | 3300025294 | Ga0209025_1015920 | Ga0209025_10159202 | 382 |
| 1229 | 3300025295 | Ga0209564_1000281 | Ga0209564_100028173 | 382 |
| 1230 | 3300025295 | Ga0209564_1000937 | Ga0209564_100093722 | 382 |
| 1231 | 3300025295 | Ga0209564_1001052 | Ga0209564_100105211 | 382 |
| 1232 | 3300025295 | Ga0209564_1022032 | Ga0209564_10220321 | 382 |
| 1233 | 3300025297 | Ga0209758_1000637 | Ga0209758_100063722 | 382 |
| 1234 | 3300025297 | Ga0209758_1001377 | Ga0209758_100137725 | 382 |
| 1235 | 3300025297 | Ga0209758_1001843 | Ga0209758_100184312 | 382 |
| 1236 | 3300025297 | Ga0209758_1001862 | Ga0209758_100186211 | 382 |
| 1237 | 3300025297 | Ga0209758_1004801 | Ga0209758_10048017 | 382 |
| 1238 | 3300025297 | Ga0209758_1014154 | Ga0209758_10141544 | 382 |
| 1239 | 3300025298 | Ga0209050_1004517 | Ga0209050_10045173 | 382 |
| 1240 | 3300025299 | Ga0209256_1000348 | Ga0209256_100034817 | 382 |
| 1241 | 3300025299 | Ga0209256_1001295 | Ga0209256_10012956 | 382 |
| 1242 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047250 | 382 |
| 1243 | 3300025303 | Ga0209051_1000236 | Ga0209051_100023677 | 382 |
| 1244 | 3300025303 | Ga0209051_1020077 | Ga0209051_10200772 | 382 |
| 1245 | 3300025304 | Ga0209257_1002011 | Ga0209257_10020113 | 382 |
| 1246 | 3300025304 | Ga0209257_1020335 | Ga0209257_10203353 | 382 |
| 1247 | 3300025923 | Ga0207681_10038013 | Ga0207681_100380133 | 382 |
| 1248 | 3300026118 | Ga0207675_100098170 | Ga0207675_1000981703 | 382 |
| 1249 | 3300027111 | Ga0209281_1000081 | Ga0209281_1000081165 | 382 |
| 1250 | 3300027666 | Ga0209282_1000036 | Ga0209282_100003673 | 382 |
| 1251 | 3300028794 | Ga0307515_10000263 | Ga0307515_1000026391 | 382 |
| 1252 | 3300028794 | Ga0307515_10002397 | Ga0307515_1000239714 | 382 |
| 1253 | 3300031456 | Ga0307513_10001607 | Ga0307513_1000160718 | 382 |
| 1254 | 3300031967 | Ga0315914_1000002 | Ga0315914_1000002271 | 382 |
| 1255 | 3300033464 | Ga0315915_1000005 | Ga0315915_1000005271 | 382 |
| 1256 | 3300041413 | Ga0439465_0000653 | Ga0439465_0000653_5579_6760 | 382 |
| 1257 | 3300041413 | Ga0439465_0018348 | Ga0439465_0018348_112_1260 | 382 |
| 1258 | 3300041494 | Ga0451837_1572201 | Ga0451837_1572201_402_1550 | 382 |
| 1259 | 3300041498 | Ga0451841_1185357 | Ga0451841_1185357_1989_3137 | 382 |
| 1260 | 3300041501 | Ga0451845_0694601 | Ga0451845_0694601_299_1447 | 382 |
| 1261 | 3300041503 | Ga0451847_0959938 | Ga0451847_0959938_269_1417 | 382 |
| 1262 | 3300041507 | Ga0451851_0367807 | Ga0451851_0367807_594_1742 | 382 |
| 1263 | 3300042007 | Ga0439449_0029037 | Ga0439449_0029037_353_1534 | 382 |
| 1264 | 3300046492 | Ga0495585_0069453 | Ga0495585_0069453_583_1731 | 382 |
| 1265 | 3300046501 | Ga0495607_0024450 | Ga0495607_0024450_1275_2423 | 382 |
| 1266 | 3300046506 | Ga0495583_0015009 | Ga0495583_0015009_2766_3914 | 382 |
| 1267 | 3300046506 | Ga0495583_0063670 | Ga0495583_0063670_148_1296 | 382 |
| 1268 | 3300046519 | Ga0495632_0040659 | Ga0495632_0040659_505_1653 | 382 |
| 1269 | 3300046522 | Ga0495643_0008740 | Ga0495643_0008740_1790_2938 | 382 |
| 1270 | 3300046522 | Ga0495643_0017019 | Ga0495643_0017019_2605_3753 | 382 |
| 1271 | 3300046530 | Ga0495654_0010022 | Ga0495654_0010022_2823_3971 | 382 |
| 1272 | 3300046616 | Ga0495668_0009867 | Ga0495668_0009867_1727_2875 | 382 |
| 1273 | 3300046660 | Ga0495625_0003234 | Ga0495625_0003234_5793_6941 | 382 |
| 1274 | 3300046660 | Ga0495625_0087585 | Ga0495625_0087585_56_1204 | 382 |
| 1275 | 3300046691 | Ga0495670_0004365 | Ga0495670_0004365_4844_5992 | 382 |
| 1276 | 3300046694 | Ga0495649_0123799 | Ga0495649_0123799_39_1187 | 382 |
| 1277 | 3300046810 | Ga0495660_0055669 | Ga0495660_0055669_897_2045 | 382 |
| 1278 | 3300046810 | Ga0495660_0056700 | Ga0495660_0056700_758_1906 | 382 |
| 1279 | 3300047472 | Ga0495686_0034885 | Ga0495686_0034885_150_1298 | 382 |
| 1280 | 3300048909 | Ga0496106_0001184 | Ga0496106_0001184_12578_13726 | 382 |
| 1281 | 3300048920 | Ga0496117_0088002 | Ga0496117_0088002_332_1480 | 382 |
| 1282 | 3300048921 | Ga0496118_0007747 | Ga0496118_0007747_5304_6452 | 382 |
| 1283 | 3300048924 | Ga0496121_0034233 | Ga0496121_0034233_2162_3310 | 382 |
| 1284 | 3300048927 | Ga0496124_0209418 | Ga0496124_0209418_303_1451 | 382 |
| 1285 | 3300048929 | Ga0496126_0113574 | Ga0496126_0113574_1188_2336 | 382 |
| 1286 | 3300049574 | Ga0501038_0129396 | Ga0501038_0129396_826_2064 | 382 |
| 1287 | 3300050490 | nmdc:mga03n38_51117_c1 | nmdc:mga03n38_51117_c1_123_1271 | 382 |
| 1288 | 3300050494 | nmdc:mga06z11_118719_c1 | nmdc:mga06z11_118719_c1_118_1266 | 382 |
| 1289 | 3300053134 | Ga0500658_0007610 | Ga0500658_0007610_1391_2539 | 382 |
| 1290 | 3300053139 | Ga0500568_0004679 | Ga0500568_0004679_605_1810 | 382 |
| 1291 | 3300053153 | Ga0500616_0005255 | Ga0500616_0005255_3359_4564 | 382 |
| 1292 | 3300053156 | Ga0500622_0001347 | Ga0500622_0001347_5561_6709 | 382 |
| 1293 | iso_pu_bacteria | 2643221618 | 2644108466 | 382 |
| 1294 | iso_pu_bacteria | 2643221626 | 2644145512 | 382 |
| 1295 | iso_pu_bacteria | 2643221655 | 2644312411 | 382 |
| 1296 | iso_pu_bacteria | 2643221659 | 2644336039 | 382 |
| 1297 | iso_pu_bacteria | 2643221698 | 2644546896 | 382 |
| 1298 | iso_pu_bacteria | 2643221712 | 2644618094 | 382 |
| 1299 | iso_pu_bacteria | 2941499720 | 2941501680 | 382 |
| 1300 | iso_pu_bacteria | 3003930520 | 3003934945 | 382 |
| 1301 | 3300025294 | Ga0209025_1000052 | Ga0209025_1000052170 | 383 |
| 1302 | 3300036401 | Ga0373937_0297060 | Ga0373937_0297060_210_1469 | 383 |
| 1303 | 3300048908 | Ga0496105_0109520 | Ga0496105_0109520_68_1327 | 383 |
| 1304 | 3300048912 | Ga0496109_0028295 | Ga0496109_0028295_2173_3432 | 383 |
| 1305 | 3300048922 | Ga0496119_0008324 | Ga0496119_0008324_401_1708 | 383 |
| 1306 | 3300048925 | Ga0496122_0099541 | Ga0496122_0099541_185_1636 | 383 |
| 1307 | 3300048926 | Ga0496123_0085424 | Ga0496123_0085424_546_1877 | 383 |
| 1308 | 3300049568 | Ga0501031_0056435 | Ga0501031_0056435_1102_2259 | 383 |
| 1309 | 3300049569 | Ga0501032_0078550 | Ga0501032_0078550_203_1360 | 383 |
| 1310 | 3300049822 | Ga0501035_0148693 | Ga0501035_0148693_686_1843 | 383 |
| 1311 | 3300049823 | Ga0501044_0038076 | Ga0501044_0038076_1825_2982 | 383 |
| 1312 | iso_pu_bacteria | 2510917022 | 2511136548 | 383 |
| 1313 | iso_pu_bacteria | 2524023209 | 2524460056 | 383 |
| 1314 | iso_pu_bacteria | 2534681786 | 2535486916 | 383 |
| 1315 | iso_pu_bacteria | 2582581307 | 2585274295 | 383 |
| 1316 | iso_pu_bacteria | 2582581308 | 2585280291 | 383 |
| 1317 | iso_pu_bacteria | 2582581315 | 2585322569 | 383 |
| 1318 | iso_pu_bacteria | 2582581316 | 2585335183 | 383 |
| 1319 | iso_pu_bacteria | 2585427527 | 2585532520 | 383 |
| 1320 | iso_pu_bacteria | 2585427530 | 2585554463 | 383 |
| 1321 | iso_pu_bacteria | 2585427531 | 2585560744 | 383 |
| 1322 | iso_pu_bacteria | 2585427608 | 2585898949 | 383 |
| 1323 | iso_pu_bacteria | 2585427609 | 2585903458 | 383 |
| 1324 | iso_pu_bacteria | 2585428125 | 2587981423 | 383 |
| 1325 | iso_pu_bacteria | 2615840626 | 2616307409 | 383 |
| 1326 | iso_pu_bacteria | 2615840698 | 2616554953 | 383 |
| 1327 | iso_pu_bacteria | 2617270742 | 2617383406 | 383 |
| 1328 | iso_pu_bacteria | 2667528174 | 2671112201 | 383 |
| 1329 | iso_pu_bacteria | 2757320392 | 2757572557 | 383 |
| 1330 | iso_pu_bacteria | 2758568016 | 2758642345 | 383 |
| 1331 | iso_pu_bacteria | 2775507266 | 2778176019 | 383 |
| 1332 | iso_pu_bacteria | 2818991448 | 2819609592 | 383 |
| 1333 | iso_pu_bacteria | 2818991453 | 2819639690 | 383 |
| 1334 | iso_pu_bacteria | 2838029111 | 2838033140 | 383 |
| 1335 | iso_pu_bacteria | 2842298080 | 2842298719 | 383 |
| 1336 | iso_pu_bacteria | 2842357229 | 2842359413 | 383 |
| 1337 | iso_pu_bacteria | 2842475841 | 2842479873 | 383 |
| 1338 | iso_pu_bacteria | 2842482326 | 2842483379 | 383 |
| 1339 | iso_pu_bacteria | 2842502639 | 2842507049 | 383 |
| 1340 | iso_pu_bacteria | 2842509118 | 2842510744 | 383 |
| 1341 | iso_pu_bacteria | 2852387548 | 2852391230 | 383 |
| 1342 | iso_pu_bacteria | 2854911287 | 2854912695 | 383 |
| 1343 | iso_pu_bacteria | 2915650412 | 2915653414 | 383 |
| 1344 | iso_pu_bacteria | 2919408235 | 2919410687 | 383 |
| 1345 | iso_pu_bacteria | 3005416602 | 3005418478 | 383 |
| 1346 | iso_pu_bacteria | 8005314921 | 8005318630 | 383 |
| 1347 | iso_pu_bacteria | 8005484373 | 8005488485 | 383 |
| 1348 | iso_pu_bacteria | 8005645114 | 8005648952 | 383 |
| 1349 | iso_pu_bacteria | 8005682033 | 8005682192 | 383 |
| 1350 | iso_pu_bacteria | 8024486573 | 8024487000 | 383 |
| 1351 | iso_pu_bacteria | 8046767195 | 8046773212 | 383 |
| 1352 | iso_pu_bacteria | 8057575449 | 8057581051 | 383 |
| 1353 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_1000012148 | 387 |
| 1354 | 3300002705 | JGI25156J39149_1000036 | JGI25156J39149_100003632 | 387 |
| 1355 | 3300002737 | JGI25162J39368_1000641 | JGI25162J39368_100064116 | 387 |
| 1356 | 3300002737 | JGI25162J39368_1000669 | JGI25162J39368_100066916 | 387 |
| 1357 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_100003324 | 387 |
| 1358 | 3300002741 | JGI25157J39369_1000124 | JGI25157J39369_100012417 | 387 |
| 1359 | 3300003214 | JGI25165J46597_1000758 | JGI25165J46597_10007586 | 387 |
| 1360 | 3300003214 | JGI25165J46597_1001693 | JGI25165J46597_10016939 | 387 |
| 1361 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_100000693 | 387 |
| 1362 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_100000493 | 387 |
| 1363 | 3300003578 | Ga0006562J51391_1021693 | Ga0006562J51391_10216933 | 387 |
| 1364 | 3300004625 | Ga0055543_1000002 | Ga0055543_1000002241 | 387 |
| 1365 | 3300005262 | Ga0065165_1000391 | Ga0065165_100039169 | 387 |
| 1366 | 3300005834 | Ga0068851_10058825 | Ga0068851_100588252 | 387 |
| 1367 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019150 | 387 |
| 1368 | 3300009545 | Ga0105237_10001429 | Ga0105237_1000142923 | 387 |
| 1369 | 3300010375 | Ga0105239_10011981 | Ga0105239_100119813 | 387 |
| 1370 | 3300013104 | Ga0157370_10001824 | Ga0157370_1000182418 | 387 |
| 1371 | 3300014497 | Ga0182008_10010866 | Ga0182008_100108663 | 387 |
| 1372 | 3300015262 | Ga0182007_10001337 | Ga0182007_100013376 | 387 |
| 1373 | 3300025206 | Ga0209435_100005 | Ga0209435_100005148 | 387 |
| 1374 | 3300025228 | Ga0209672_108136 | Ga0209672_1081361 | 387 |
| 1375 | 3300025233 | Ga0209437_100078 | Ga0209437_100078171 | 387 |
| 1376 | 3300025233 | Ga0209437_100174 | Ga0209437_1001749 | 387 |
| 1377 | 3300025233 | Ga0209437_107444 | Ga0209437_1074442 | 387 |
| 1378 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011148 | 387 |
| 1379 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008148 | 387 |
| 1380 | 3300025253 | Ga0209677_100286 | Ga0209677_10028614 | 387 |
| 1381 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004148 | 387 |
| 1382 | 3300025261 | Ga0209233_1000192 | Ga0209233_10001929 | 387 |
| 1383 | 3300025261 | Ga0209233_1000194 | Ga0209233_10001949 | 387 |
| 1384 | 3300025261 | Ga0209233_1000476 | Ga0209233_100047616 | 387 |
| 1385 | 3300025284 | Ga0209130_1000032 | Ga0209130_100003289 | 387 |
| 1386 | 3300025302 | Ga0207426_1000077 | Ga0207426_100007789 | 387 |
| 1387 | 3300025321 | Ga0207656_10036067 | Ga0207656_100360672 | 387 |
| 1388 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049152 | 387 |
| 1389 | 3300025914 | Ga0207671_10000107 | Ga0207671_1000010717 | 387 |
| 1390 | 3300044765 | Ga0466970_0005373 | Ga0466970_0005373_209_1381 | 387 |
| 1391 | 3300046459 | Ga0495629_0073461 | Ga0495629_0073461_57_1220 | 387 |
| 1392 | 3300046476 | Ga0495662_0019662 | Ga0495662_0019662_1676_2839 | 387 |
| 1393 | 3300046477 | Ga0495664_0089837 | Ga0495664_0089837_69_1232 | 387 |
| 1394 | 3300046507 | Ga0495606_0003402 | Ga0495606_0003402_3966_5129 | 387 |
| 1395 | 3300046674 | Ga0495588_0074379 | Ga0495588_0074379_349_1512 | 387 |
| 1396 | 3300046809 | Ga0495600_0022575 | Ga0495600_0022575_1309_2472 | 387 |
| 1397 | 3300047472 | Ga0495686_0001666 | Ga0495686_0001666_9129_10292 | 387 |
| 1398 | 3300047472 | Ga0495686_0007561 | Ga0495686_0007561_3225_4388 | 387 |
| 1399 | 3300048919 | Ga0496116_0018295 | Ga0496116_0018295_330_1502 | 387 |
| 1400 | 3300048920 | Ga0496117_0001980 | Ga0496117_0001980_18837_20009 | 387 |
| 1401 | 3300048921 | Ga0496118_0002011 | Ga0496118_0002011_19817_20989 | 387 |
| 1402 | 3300048922 | Ga0496119_0013421 | Ga0496119_0013421_3779_4951 | 387 |
| 1403 | 3300048923 | Ga0496120_0064507 | Ga0496120_0064507_485_1657 | 387 |
| 1404 | 3300048924 | Ga0496121_0002604 | Ga0496121_0002604_7237_8409 | 387 |
| 1405 | 3300048925 | Ga0496122_0036587 | Ga0496122_0036587_712_1884 | 387 |
| 1406 | 3300048926 | Ga0496123_0011402 | Ga0496123_0011402_561_1733 | 387 |
| 1407 | 3300048926 | Ga0496123_0054107 | Ga0496123_0054107_1242_2405 | 387 |
| 1408 | 3300048927 | Ga0496124_0029558 | Ga0496124_0029558_636_1799 | 387 |
| 1409 | 3300048927 | Ga0496124_0097388 | Ga0496124_0097388_357_1529 | 387 |
| 1410 | 3300048929 | Ga0496126_0063976 | Ga0496126_0063976_1064_2236 | 387 |
| 1411 | 3300053148 | Ga0500590_043534 | Ga0500590_043534_822_1985 | 387 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9888 | 4 | 373 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9838 | 4 | 370 |
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9799 | 4 | 373 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9782 | 4 | 370 |
| 3p2y-assembly1.cif.gz_A-2 | crystal structure of alanine dehydrogenase/pyridine nucleotide transhydrogenase from mycobacterium smegmatis | 0.9727 | 4 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9909 | 168 | 200 | 3.50.50.60 |
| 4dioB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9889 | 5 | 137 | 3.40.50.720 |
| af_Q54H99_9_164_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9726 | 168 | 199 | 3.50.50.60 |
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9702 | 168 | 200 | 3.50.50.60 |
| 1x13B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9683 | 1 | 137 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MTW3-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9986 | 32 | 125 |
GO:0005886
GO:0006740 GO:0050661 |
| AF-A0A526Y3I6-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9984 | 83 | 205 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
| AF-A0A527Z3W9-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9966 | 32 | 116 |
GO:0005886
GO:0006740 GO:0050661 |
| AF-A0A3S4IYE5-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9965 | 124 | 208 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
| AF-H0HQ53-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9964 | 4 | 142 |
GO:0005886
GO:0006740 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar