F493757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1411 | 479 | 2822 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300061719|Ga0466962_0131908|Ga0466962_0131908_49_963 |
| Length | 304 |
| Sequence | MPGLVPGIHALMPFNKEDVDGRDKPGHDEKRDRGRNTMSESFLKNPLALFDIRGKTAIVTGASGAFGALAAKTLAGAGANVVLAASKQADLDRISGECQGLGAKTATVAARPDSEENCQKIVDAAVKVFGGVDILVVAGGLNKVSKIVDQKYDDFLDVMDANVNQSWLMARAAGKQMLAQGRGGKVILTSSARGLLGHPAGYTAYCASKSAVDGITKALGCEWGETGITVNALGPTVFRSPLTAWMYEDTERAQTVRKGFLARVPKGRLGEPEDLAGPLLFLASKASDFYTGHILYADGGYTAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 18 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 140 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 158 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 261 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 262 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 286 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 299 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 306 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 311 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 319 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 418 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 449 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 465 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 468 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 469 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 471 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 474 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 477 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 478 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 479 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0.07 |
| Rhizoplane | 7.8 |
| Rhizosphere | 88.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466962_0131908 | 3300061719 | Bacteria | 1208 |
| 2 | 2214544921 | 2209111006 | Bacteria | 20123 |
| 3 | ARcpr5oldR_c000060 | 3300000041 | Bacteria | 20201 |
| 4 | ARSoilYngRDRAFT_c00026 | 3300000042 | Bacteria | 22507 |
| 5 | ARcpr5yngRDRAFT_c000062 | 3300000043 | Bacteria | 17597 |
| 6 | ARSoilOldRDRAFT_c000014 | 3300000044 | Bacteria | 41686 |
| 7 | ARCol0oldRDRAFT_c00135 | 3300000045 | Bacteria | 6631 |
| 8 | ARCol0yngRDRAFT_1000075 | 3300000652 | Bacteria | 18624 |
| 9 | JGI24739J22299_10001621 | 3300001989 | Bacteria | 8543 |
| 10 | JGI24737J22298_10002215 | 3300001990 | Bacteria | 6928 |
| 11 | JGI24737J22298_10003103 | 3300001990 | Bacteria | 5888 |
| 12 | JGI24743J22301_10005752 | 3300001991 | Bacteria | 2083 |
| 13 | JGI24750J21931_1000414 | 3300002070 | Bacteria | 7081 |
| 14 | JGI24748J21848_1012436 | 3300002074 | Bacteria | 1004 |
| 15 | JGI24744J21845_10005703 | 3300002077 | Bacteria | 2579 |
| 16 | JGI24034J26672_10003479 | 3300002239 | Bacteria | 2198 |
| 17 | JGI25405J52794_10002656 | 3300003911 | Bacteria | 3094 |
| 18 | JGI25405J52794_10009957 | 3300003911 | Bacteria | 1803 |
| 19 | Ga0065717_1001992 | 3300005276 | Bacteria | 4001 |
| 20 | Ga0065716_1000064 | 3300005277 | Bacteria | 3112 |
| 21 | Ga0065704_10089598 | 3300005289 | Bacteria | 2846 |
| 22 | Ga0065712_10004414 | 3300005290 | Bacteria | 8856 |
| 23 | Ga0065715_10003211 | 3300005293 | Bacteria | 6280 |
| 24 | Ga0065715_10089057 | 3300005293 | Bacteria | 15452 |
| 25 | Ga0065707_10168922 | 3300005295 | Bacteria | 1500 |
| 26 | Ga0070658_10016413 | 3300005327 | Bacteria | 5925 |
| 27 | Ga0070658_10080771 | 3300005327 | Bacteria | 2671 |
| 28 | Ga0070658_10384811 | 3300005327 | Bacteria | 1204 |
| 29 | Ga0070676_10004642 | 3300005328 | Bacteria | 7256 |
| 30 | Ga0070676_10114479 | 3300005328 | Bacteria | 1684 |
| 31 | Ga0070683_100013090 | 3300005329 | Bacteria | 7224 |
| 32 | Ga0070683_100247020 | 3300005329 | Bacteria | 1697 |
| 33 | Ga0070683_100420727 | 3300005329 | Bacteria | 1274 |
| 34 | Ga0070683_100476657 | 3300005329 | Bacteria | 1191 |
| 35 | Ga0070690_100006650 | 3300005330 | Bacteria | 6568 |
| 36 | Ga0070690_100014960 | 3300005330 | Bacteria | 4615 |
| 37 | Ga0070690_100042844 | 3300005330 | Bacteria | 2868 |
| 38 | Ga0070670_100015971 | 3300005331 | Bacteria | 6442 |
| 39 | Ga0070670_100044755 | 3300005331 | Bacteria | 3805 |
| 40 | Ga0070670_100045922 | 3300005331 | Bacteria | 3755 |
| 41 | Ga0070670_100381056 | 3300005331 | Bacteria | 1242 |
| 42 | Ga0070677_10001512 | 3300005333 | Bacteria | 7364 |
| 43 | Ga0068869_100012157 | 3300005334 | Bacteria | 5677 |
| 44 | Ga0070666_10115017 | 3300005335 | Bacteria | 1863 |
| 45 | Ga0070666_10141668 | 3300005335 | Bacteria | 1675 |
| 46 | Ga0070666_10168732 | 3300005335 | Bacteria | 1532 |
| 47 | Ga0070680_100117959 | 3300005336 | Bacteria | 2213 |
| 48 | Ga0070680_100119686 | 3300005336 | Bacteria | 2197 |
| 49 | Ga0070680_100211920 | 3300005336 | Bacteria | 1634 |
| 50 | Ga0070680_100366804 | 3300005336 | Bacteria | 1225 |
| 51 | Ga0070682_100010796 | 3300005337 | Bacteria | 5195 |
| 52 | Ga0070682_100060305 | 3300005337 | Bacteria | 2399 |
| 53 | Ga0070682_100253187 | 3300005337 | Bacteria | 1271 |
| 54 | Ga0070682_100261130 | 3300005337 | Bacteria | 1253 |
| 55 | Ga0068868_100008008 | 3300005338 | Bacteria | 7552 |
| 56 | Ga0068868_100464130 | 3300005338 | Bacteria | 1103 |
| 57 | Ga0070660_100018941 | 3300005339 | Bacteria | 5039 |
| 58 | Ga0070660_100019654 | 3300005339 | Bacteria | 4953 |
| 59 | Ga0070660_100082499 | 3300005339 | Bacteria | 2524 |
| 60 | Ga0070660_100112362 | 3300005339 | Bacteria | 2168 |
| 61 | Ga0070689_100008904 | 3300005340 | Bacteria | 7097 |
| 62 | Ga0070691_10008977 | 3300005341 | Bacteria | 4573 |
| 63 | Ga0070691_10054822 | 3300005341 | Bacteria | 1909 |
| 64 | Ga0070687_100000508 | 3300005343 | Bacteria | 13021 |
| 65 | Ga0070687_100003462 | 3300005343 | Bacteria | 6133 |
| 66 | Ga0070661_100026333 | 3300005344 | Bacteria | 4182 |
| 67 | Ga0070661_100083424 | 3300005344 | Bacteria | 2360 |
| 68 | Ga0070661_100551902 | 3300005344 | Bacteria | 927 |
| 69 | Ga0070692_10009171 | 3300005345 | Bacteria | 4449 |
| 70 | Ga0070692_10089731 | 3300005345 | Bacteria | 1669 |
| 71 | Ga0070668_100048995 | 3300005347 | Bacteria | 3250 |
| 72 | Ga0070668_100195731 | 3300005347 | Bacteria | 1658 |
| 73 | Ga0070669_100004442 | 3300005353 | Bacteria | 10112 |
| 74 | Ga0070675_100010960 | 3300005354 | Bacteria | 7095 |
| 75 | Ga0070675_100063520 | 3300005354 | Bacteria | 3052 |
| 76 | Ga0070671_100009960 | 3300005355 | Bacteria | 7632 |
| 77 | Ga0070671_100015285 | 3300005355 | Bacteria | 6198 |
| 78 | Ga0070671_100034762 | 3300005355 | Bacteria | 4173 |
| 79 | Ga0070671_100042377 | 3300005355 | Bacteria | 3783 |
| 80 | Ga0070671_100116676 | 3300005355 | Bacteria | 2244 |
| 81 | Ga0070671_100127818 | 3300005355 | Bacteria | 2140 |
| 82 | Ga0070674_100038698 | 3300005356 | Bacteria | 3216 |
| 83 | Ga0070674_100067551 | 3300005356 | Bacteria | 2515 |
| 84 | Ga0070674_100176136 | 3300005356 | Bacteria | 1634 |
| 85 | Ga0070673_100010845 | 3300005364 | Bacteria | 6192 |
| 86 | Ga0070673_100027965 | 3300005364 | Bacteria | 4187 |
| 87 | Ga0070673_100048450 | 3300005364 | Bacteria | 3313 |
| 88 | Ga0070673_100058113 | 3300005364 | Bacteria | 3057 |
| 89 | Ga0070688_100021684 | 3300005365 | Bacteria | 3755 |
| 90 | Ga0070688_100064577 | 3300005365 | Bacteria | 2323 |
| 91 | Ga0070659_100009719 | 3300005366 | Bacteria | 7065 |
| 92 | Ga0070659_100717367 | 3300005366 | Bacteria | 866 |
| 93 | Ga0070667_100053888 | 3300005367 | Bacteria | 3395 |
| 94 | Ga0070667_100538288 | 3300005367 | Bacteria | 1073 |
| 95 | Ga0070703_10004977 | 3300005406 | Bacteria | 3708 |
| 96 | Ga0070703_10005901 | 3300005406 | Bacteria | 3430 |
| 97 | Ga0070703_10011121 | 3300005406 | Bacteria | 2542 |
| 98 | Ga0070709_10029207 | 3300005434 | Bacteria | 3296 |
| 99 | Ga0070709_10030267 | 3300005434 | Bacteria | 3247 |
| 100 | Ga0070709_10063573 | 3300005434 | Bacteria | 2358 |
| 101 | Ga0070709_10114227 | 3300005434 | Bacteria | 1820 |
| 102 | Ga0070709_10244267 | 3300005434 | Unclassified | 1290 |
| 103 | Ga0070714_100025708 | 3300005435 | Bacteria | 4861 |
| 104 | Ga0070714_100094055 | 3300005435 | Bacteria | 2630 |
| 105 | Ga0070714_100569741 | 3300005435 | Bacteria | 1085 |
| 106 | Ga0070713_100010962 | 3300005436 | Bacteria | 6574 |
| 107 | Ga0070713_100095164 | 3300005436 | Bacteria | 2569 |
| 108 | Ga0070713_100219392 | 3300005436 | Bacteria | 1725 |
| 109 | Ga0070713_100288106 | 3300005436 | Bacteria | 1508 |
| 110 | Ga0070713_100355787 | 3300005436 | Bacteria | 1359 |
| 111 | Ga0070713_100618880 | 3300005436 | Bacteria | 1030 |
| 112 | Ga0070713_100623566 | 3300005436 | Bacteria | 1026 |
| 113 | Ga0070710_10016552 | 3300005437 | Bacteria | 3755 |
| 114 | Ga0070710_10165267 | 3300005437 | Bacteria | 1375 |
| 115 | Ga0070710_10334057 | 3300005437 | Bacteria | 998 |
| 116 | Ga0070701_10004735 | 3300005438 | Bacteria | 5554 |
| 117 | Ga0070701_10041946 | 3300005438 | Bacteria | 2333 |
| 118 | Ga0070701_10048811 | 3300005438 | Bacteria | 2186 |
| 119 | Ga0070711_100015125 | 3300005439 | Bacteria | 4878 |
| 120 | Ga0070711_100035735 | 3300005439 | Bacteria | 3325 |
| 121 | Ga0070711_100075991 | 3300005439 | Bacteria | 2380 |
| 122 | Ga0070711_100088873 | 3300005439 | Bacteria | 2221 |
| 123 | Ga0070711_100159402 | 3300005439 | Bacteria | 1709 |
| 124 | Ga0070711_100364562 | 3300005439 | Unclassified | 1164 |
| 125 | Ga0070705_100017130 | 3300005440 | Bacteria | 3778 |
| 126 | Ga0070705_100137652 | 3300005440 | Bacteria | 1602 |
| 127 | Ga0070700_100010230 | 3300005441 | Bacteria | 5175 |
| 128 | Ga0070700_100019075 | 3300005441 | Bacteria | 3953 |
| 129 | Ga0070700_100038447 | 3300005441 | Bacteria | 2916 |
| 130 | Ga0070694_100006188 | 3300005444 | Bacteria | 7266 |
| 131 | Ga0070694_100246189 | 3300005444 | Bacteria | 1350 |
| 132 | Ga0070708_100064041 | 3300005445 | Bacteria | 3293 |
| 133 | Ga0070708_100792935 | 3300005445 | Bacteria | 891 |
| 134 | Ga0070663_100023888 | 3300005455 | Bacteria | 4104 |
| 135 | Ga0070663_100082896 | 3300005455 | Bacteria | 2360 |
| 136 | Ga0070663_100199867 | 3300005455 | Bacteria | 1559 |
| 137 | Ga0070663_100280405 | 3300005455 | Bacteria | 1328 |
| 138 | Ga0070678_100007085 | 3300005456 | Bacteria | 6630 |
| 139 | Ga0070678_100375668 | 3300005456 | Bacteria | 1228 |
| 140 | Ga0070678_100419311 | 3300005456 | Bacteria | 1166 |
| 141 | Ga0070662_100053178 | 3300005457 | Bacteria | 2930 |
| 142 | Ga0070662_100124026 | 3300005457 | Bacteria | 1983 |
| 143 | Ga0070662_100190308 | 3300005457 | Bacteria | 1622 |
| 144 | Ga0070681_10030704 | 3300005458 | Bacteria | 5392 |
| 145 | Ga0070681_10042345 | 3300005458 | Bacteria | 4563 |
| 146 | Ga0070681_10058918 | 3300005458 | Bacteria | 3820 |
| 147 | Ga0070681_10257357 | 3300005458 | Bacteria | 1658 |
| 148 | Ga0068867_100030148 | 3300005459 | Bacteria | 3912 |
| 149 | Ga0068867_100464101 | 3300005459 | Bacteria | 1082 |
| 150 | Ga0070685_10003206 | 3300005466 | Bacteria | 8326 |
| 151 | Ga0070685_10022671 | 3300005466 | Bacteria | 3426 |
| 152 | Ga0070685_10079920 | 3300005466 | Bacteria | 1958 |
| 153 | Ga0070706_100783231 | 3300005467 | Bacteria | 883 |
| 154 | Ga0070707_100699583 | 3300005468 | Bacteria | 976 |
| 155 | Ga0074259_10498539 | 3300005507 | Bacteria | 1565 |
| 156 | Ga0070679_100016311 | 3300005530 | Bacteria | 7160 |
| 157 | Ga0070679_100034201 | 3300005530 | Bacteria | 5037 |
| 158 | Ga0070679_100071215 | 3300005530 | Bacteria | 3467 |
| 159 | Ga0070679_100199105 | 3300005530 | Bacteria | 1970 |
| 160 | Ga0070679_100500161 | 3300005530 | Bacteria | 1159 |
| 161 | Ga0070684_100019448 | 3300005535 | Bacteria | 5618 |
| 162 | Ga0070684_100031373 | 3300005535 | Bacteria | 4523 |
| 163 | Ga0070684_100100549 | 3300005535 | Bacteria | 2582 |
| 164 | Ga0070684_100150484 | 3300005535 | Bacteria | 2108 |
| 165 | Ga0070684_100672373 | 3300005535 | Bacteria | 964 |
| 166 | Ga0070697_100162182 | 3300005536 | Bacteria | 1889 |
| 167 | Ga0070697_100199875 | 3300005536 | Bacteria | 1699 |
| 168 | Ga0070697_100212243 | 3300005536 | Bacteria | 1648 |
| 169 | Ga0068853_100007915 | 3300005539 | Bacteria | 8523 |
| 170 | Ga0068853_100320027 | 3300005539 | Bacteria | 1438 |
| 171 | Ga0070672_100002557 | 3300005543 | Bacteria | 11597 |
| 172 | Ga0070686_100011589 | 3300005544 | Bacteria | 5004 |
| 173 | Ga0070686_100014959 | 3300005544 | Bacteria | 4482 |
| 174 | Ga0070686_100067461 | 3300005544 | Bacteria | 2331 |
| 175 | Ga0070686_100305966 | 3300005544 | Bacteria | 1180 |
| 176 | Ga0070686_100318544 | 3300005544 | Bacteria | 1159 |
| 177 | Ga0070695_100004179 | 3300005545 | Bacteria | 8443 |
| 178 | Ga0070695_100150537 | 3300005545 | Bacteria | 1623 |
| 179 | Ga0070696_100017134 | 3300005546 | Bacteria | 4889 |
| 180 | Ga0070696_100029007 | 3300005546 | Bacteria | 3778 |
| 181 | Ga0070696_100034849 | 3300005546 | Bacteria | 3464 |
| 182 | Ga0070696_100220956 | 3300005546 | Bacteria | 1421 |
| 183 | Ga0070693_100000598 | 3300005547 | Bacteria | 16004 |
| 184 | Ga0070693_100073417 | 3300005547 | Bacteria | 2021 |
| 185 | Ga0070665_100131167 | 3300005548 | Bacteria | 2508 |
| 186 | Ga0070665_100374236 | 3300005548 | Bacteria | 1431 |
| 187 | Ga0070665_100402492 | 3300005548 | Bacteria | 1377 |
| 188 | Ga0070704_100001411 | 3300005549 | Bacteria | 12808 |
| 189 | Ga0070704_100001845 | 3300005549 | Bacteria | 11678 |
| 190 | Ga0068855_100105869 | 3300005563 | Bacteria | 3234 |
| 191 | Ga0068855_100142314 | 3300005563 | Bacteria | 2732 |
| 192 | Ga0070664_100022064 | 3300005564 | Bacteria | 5251 |
| 193 | Ga0070664_100114112 | 3300005564 | Bacteria | 2360 |
| 194 | Ga0068857_100003946 | 3300005577 | Bacteria | 12488 |
| 195 | Ga0068857_100114348 | 3300005577 | Bacteria | 2427 |
| 196 | Ga0068857_100151095 | 3300005577 | Bacteria | 2104 |
| 197 | Ga0068854_100040125 | 3300005578 | Bacteria | 3301 |
| 198 | Ga0068856_100028987 | 3300005614 | Bacteria | 5409 |
| 199 | Ga0068856_100089119 | 3300005614 | Bacteria | 3068 |
| 200 | Ga0068856_100188149 | 3300005614 | Bacteria | 2078 |
| 201 | Ga0070702_100004124 | 3300005615 | Bacteria | 6599 |
| 202 | Ga0068852_100015213 | 3300005616 | Bacteria | 5956 |
| 203 | Ga0068852_100032088 | 3300005616 | Bacteria | 4344 |
| 204 | Ga0068852_100355922 | 3300005616 | Bacteria | 1431 |
| 205 | Ga0068859_100015209 | 3300005617 | Bacteria | 7724 |
| 206 | Ga0068859_100061305 | 3300005617 | Bacteria | 3790 |
| 207 | Ga0068859_100445031 | 3300005617 | Bacteria | 1392 |
| 208 | Ga0068864_100059186 | 3300005618 | Bacteria | 3314 |
| 209 | Ga0068864_100094360 | 3300005618 | Bacteria | 2644 |
| 210 | Ga0068864_100155145 | 3300005618 | Bacteria | 2077 |
| 211 | Ga0068866_10006784 | 3300005718 | Bacteria | 4778 |
| 212 | Ga0068866_10314560 | 3300005718 | Bacteria | 983 |
| 213 | Ga0068861_100009598 | 3300005719 | Bacteria | 6685 |
| 214 | Ga0068861_100018479 | 3300005719 | Bacteria | 4967 |
| 215 | Ga0068851_10064045 | 3300005834 | Bacteria | 1889 |
| 216 | Ga0068870_10001856 | 3300005840 | Bacteria | 8692 |
| 217 | Ga0068870_10016062 | 3300005840 | Bacteria | 3568 |
| 218 | Ga0068863_100004842 | 3300005841 | Bacteria | 13256 |
| 219 | Ga0068863_100014861 | 3300005841 | Bacteria | 7480 |
| 220 | Ga0068863_100280571 | 3300005841 | Bacteria | 1614 |
| 221 | Ga0068863_100512135 | 3300005841 | Bacteria | 1182 |
| 222 | Ga0068858_100009730 | 3300005842 | Bacteria | 9155 |
| 223 | Ga0068858_100031089 | 3300005842 | Bacteria | 4958 |
| 224 | Ga0068858_100172483 | 3300005842 | Bacteria | 2040 |
| 225 | Ga0068858_100233107 | 3300005842 | Bacteria | 1745 |
| 226 | Ga0068858_100595353 | 3300005842 | Bacteria | 1072 |
| 227 | Ga0068860_100031612 | 3300005843 | Bacteria | 5088 |
| 228 | Ga0068860_100049035 | 3300005843 | Bacteria | 4024 |
| 229 | Ga0068860_100058904 | 3300005843 | Bacteria | 3652 |
| 230 | Ga0068860_100141624 | 3300005843 | Bacteria | 2312 |
| 231 | Ga0068862_100001842 | 3300005844 | Bacteria | 19225 |
| 232 | Ga0068862_100033969 | 3300005844 | Bacteria | 4314 |
| 233 | Ga0081455_10000406 | 3300005937 | Bacteria | 56681 |
| 234 | Ga0081455_10001669 | 3300005937 | Bacteria | 26910 |
| 235 | Ga0081455_10009887 | 3300005937 | Bacteria | 9760 |
| 236 | Ga0081455_10058719 | 3300005937 | Bacteria | 3253 |
| 237 | Ga0081455_10152020 | 3300005937 | Unclassified | 1784 |
| 238 | Ga0081455_10156129 | 3300005937 | Bacteria | 1754 |
| 239 | Ga0081455_10350336 | 3300005937 | Bacteria | 1042 |
| 240 | Ga0081455_10380543 | 3300005937 | Bacteria | 986 |
| 241 | Ga0081538_10011077 | 3300005981 | Bacteria | 7333 |
| 242 | Ga0081540_1001987 | 3300005983 | Bacteria | 17059 |
| 243 | Ga0081540_1020979 | 3300005983 | Bacteria | 3909 |
| 244 | Ga0070717_10000378 | 3300006028 | Bacteria | 28453 |
| 245 | Ga0070717_10029289 | 3300006028 | Bacteria | 4415 |
| 246 | Ga0070717_10054790 | 3300006028 | Bacteria | 3289 |
| 247 | Ga0070717_10422148 | 3300006028 | Bacteria | 1200 |
| 248 | Ga0075365_10004370 | 3300006038 | Bacteria | 7473 |
| 249 | Ga0075365_10016802 | 3300006038 | Bacteria | 4462 |
| 250 | Ga0075365_10125659 | 3300006038 | Bacteria | 1772 |
| 251 | Ga0075368_10065421 | 3300006042 | Bacteria | 1461 |
| 252 | Ga0075432_10002074 | 3300006058 | Bacteria | 6671 |
| 253 | Ga0075432_10029530 | 3300006058 | Bacteria | 1893 |
| 254 | Ga0075432_10044944 | 3300006058 | Bacteria | 1549 |
| 255 | Ga0070715_10006900 | 3300006163 | Bacteria | 3882 |
| 256 | Ga0070715_10113238 | 3300006163 | Bacteria | 1283 |
| 257 | Ga0070716_100051663 | 3300006173 | Bacteria | 2337 |
| 258 | Ga0070712_100002271 | 3300006175 | Bacteria | 11835 |
| 259 | Ga0070712_100011210 | 3300006175 | Bacteria | 5676 |
| 260 | Ga0070712_100013459 | 3300006175 | Bacteria | 5229 |
| 261 | Ga0070712_100035403 | 3300006175 | Bacteria | 3389 |
| 262 | Ga0070712_100097488 | 3300006175 | Bacteria | 2167 |
| 263 | Ga0070712_100418994 | 3300006175 | Bacteria | 1109 |
| 264 | Ga0075367_10009844 | 3300006178 | Bacteria | 5008 |
| 265 | Ga0075367_10016048 | 3300006178 | Bacteria | 4083 |
| 266 | Ga0075367_10259558 | 3300006178 | Bacteria | 1091 |
| 267 | Ga0075427_10003100 | 3300006194 | Bacteria | 2272 |
| 268 | Ga0097621_100002928 | 3300006237 | Bacteria | 11735 |
| 269 | Ga0097621_100078920 | 3300006237 | Bacteria | 2735 |
| 270 | Ga0068871_100012296 | 3300006358 | Bacteria | 6306 |
| 271 | Ga0068871_100019961 | 3300006358 | Bacteria | 5125 |
| 272 | Ga0068871_100085640 | 3300006358 | Bacteria | 2617 |
| 273 | Ga0075428_100001601 | 3300006844 | Bacteria | 24210 |
| 274 | Ga0075430_100001162 | 3300006846 | Bacteria | 21045 |
| 275 | Ga0075430_100314640 | 3300006846 | Bacteria | 1294 |
| 276 | Ga0075431_100022376 | 3300006847 | Bacteria | 6460 |
| 277 | Ga0075431_100207372 | 3300006847 | Bacteria | 2003 |
| 278 | Ga0075431_100378249 | 3300006847 | Bacteria | 1420 |
| 279 | Ga0075433_10000068 | 3300006852 | Bacteria | 45762 |
| 280 | Ga0075433_10050889 | 3300006852 | Bacteria | 3606 |
| 281 | Ga0075433_10074428 | 3300006852 | Bacteria | 2989 |
| 282 | Ga0075433_10077350 | 3300006852 | Bacteria | 2931 |
| 283 | Ga0075434_100002956 | 3300006871 | Bacteria | 15111 |
| 284 | Ga0075434_100005563 | 3300006871 | Bacteria | 11480 |
| 285 | Ga0075434_100031778 | 3300006871 | Bacteria | 5205 |
| 286 | Ga0075434_100064642 | 3300006871 | Bacteria | 3643 |
| 287 | Ga0075434_100072623 | 3300006871 | Bacteria | 3433 |
| 288 | Ga0075434_100371993 | 3300006871 | Bacteria | 1450 |
| 289 | Ga0075434_100457181 | 3300006871 | Bacteria | 1298 |
| 290 | Ga0075434_100609247 | 3300006871 | Bacteria | 1111 |
| 291 | Ga0075429_100002047 | 3300006880 | Bacteria | 16779 |
| 292 | Ga0068865_100005119 | 3300006881 | Bacteria | 7936 |
| 293 | Ga0068865_100064480 | 3300006881 | Unclassified | 2578 |
| 294 | Ga0068865_100150586 | 3300006881 | Bacteria | 1765 |
| 295 | Ga0075436_100024355 | 3300006914 | Bacteria | 4160 |
| 296 | Ga0075436_100075157 | 3300006914 | Bacteria | 2339 |
| 297 | Ga0097620_100015209 | 3300006931 | Bacteria | 7724 |
| 298 | Ga0097620_100061307 | 3300006931 | Bacteria | 3790 |
| 299 | Ga0097620_100445004 | 3300006931 | Bacteria | 1392 |
| 300 | Ga0075435_100052519 | 3300007076 | Bacteria | 3285 |
| 301 | Ga0075435_100115258 | 3300007076 | Bacteria | 2237 |
| 302 | Ga0075435_100139329 | 3300007076 | Bacteria | 2034 |
| 303 | Ga0075435_100288024 | 3300007076 | Unclassified | 1403 |
| 304 | Ga0075435_100424800 | 3300007076 | Bacteria | 1145 |
| 305 | Ga0075435_100481841 | 3300007076 | Bacteria | 1072 |
| 306 | Ga0099794_10004391 | 3300007265 | Bacteria | 5529 |
| 307 | Ga0099794_10129173 | 3300007265 | Bacteria | 1275 |
| 308 | Ga0099795_10142778 | 3300007788 | Bacteria | 975 |
| 309 | Ga0105250_10101164 | 3300009092 | Bacteria | 1176 |
| 310 | Ga0105240_10176065 | 3300009093 | Bacteria | 2529 |
| 311 | Ga0111539_10001284 | 3300009094 | Bacteria | 33560 |
| 312 | Ga0111539_10002543 | 3300009094 | Bacteria | 24151 |
| 313 | Ga0111539_10032584 | 3300009094 | Bacteria | 6327 |
| 314 | Ga0111539_10057660 | 3300009094 | Bacteria | 4611 |
| 315 | Ga0111539_10136568 | 3300009094 | Bacteria | 2872 |
| 316 | Ga0111539_10322462 | 3300009094 | Bacteria | 1798 |
| 317 | Ga0105245_10031015 | 3300009098 | Bacteria | 4728 |
| 318 | Ga0105245_10070005 | 3300009098 | Bacteria | 3182 |
| 319 | Ga0105247_10021856 | 3300009101 | Bacteria | 3849 |
| 320 | Ga0105247_10028136 | 3300009101 | Bacteria | 3400 |
| 321 | Ga0105247_10142348 | 3300009101 | Bacteria | 1573 |
| 322 | Ga0114129_10004127 | 3300009147 | Bacteria | 20519 |
| 323 | Ga0114129_10015793 | 3300009147 | Bacteria | 10735 |
| 324 | Ga0114129_10100651 | 3300009147 | Bacteria | 3999 |
| 325 | Ga0105243_10008339 | 3300009148 | Bacteria | 7960 |
| 326 | Ga0105243_10054689 | 3300009148 | Bacteria | 3170 |
| 327 | Ga0105241_10004472 | 3300009174 | Bacteria | 10341 |
| 328 | Ga0105241_10038688 | 3300009174 | Bacteria | 3596 |
| 329 | Ga0105242_10017926 | 3300009176 | Bacteria | 5529 |
| 330 | Ga0105242_10244928 | 3300009176 | Bacteria | 1613 |
| 331 | Ga0105242_10273591 | 3300009176 | Bacteria | 1531 |
| 332 | Ga0105242_10274991 | 3300009176 | Bacteria | 1527 |
| 333 | Ga0105242_10524666 | 3300009176 | Bacteria | 1131 |
| 334 | Ga0105248_10010313 | 3300009177 | Bacteria | 10284 |
| 335 | Ga0105248_10059103 | 3300009177 | Bacteria | 4306 |
| 336 | Ga0105248_10153891 | 3300009177 | Bacteria | 2594 |
| 337 | Ga0105248_10615194 | 3300009177 | Bacteria | 1226 |
| 338 | Ga0105237_10027346 | 3300009545 | Bacteria | 5823 |
| 339 | Ga0105237_10042509 | 3300009545 | Bacteria | 4582 |
| 340 | Ga0105237_10057323 | 3300009545 | Bacteria | 3899 |
| 341 | Ga0105237_10091666 | 3300009545 | Bacteria | 3028 |
| 342 | Ga0105237_10092507 | 3300009545 | Bacteria | 3013 |
| 343 | Ga0105237_10096344 | 3300009545 | Bacteria | 2949 |
| 344 | Ga0105238_10029419 | 3300009551 | Bacteria | 5596 |
| 345 | Ga0105238_10051215 | 3300009551 | Bacteria | 4153 |
| 346 | Ga0105238_10066723 | 3300009551 | Bacteria | 3599 |
| 347 | Ga0105238_10182256 | 3300009551 | Bacteria | 2077 |
| 348 | Ga0105249_10011749 | 3300009553 | Bacteria | 7698 |
| 349 | Ga0105249_10032599 | 3300009553 | Bacteria | 4714 |
| 350 | Ga0105249_10206037 | 3300009553 | Bacteria | 1927 |
| 351 | Ga0105249_10867003 | 3300009553 | Bacteria | 969 |
| 352 | Ga0099796_10011403 | 3300010159 | Bacteria | 2479 |
| 353 | Ga0099796_10030202 | 3300010159 | Bacteria | 1756 |
| 354 | Ga0105239_10037971 | 3300010375 | Bacteria | 5278 |
| 355 | Ga0105239_10305211 | 3300010375 | Bacteria | 1793 |
| 356 | Ga0105239_10606125 | 3300010375 | Bacteria | 1249 |
| 357 | Ga0105246_10012998 | 3300011119 | Bacteria | 5210 |
| 358 | Ga0105246_10019263 | 3300011119 | Bacteria | 4358 |
| 359 | Ga0105246_10330543 | 3300011119 | Bacteria | 1242 |
| 360 | Ga0157344_1002048 | 3300012476 | Bacteria | 1033 |
| 361 | Ga0157341_1003625 | 3300012494 | Bacteria | 1086 |
| 362 | Ga0157373_10030696 | 3300013100 | Bacteria | 3867 |
| 363 | Ga0157373_10076812 | 3300013100 | Bacteria | 2357 |
| 364 | Ga0157371_10017224 | 3300013102 | Bacteria | 5372 |
| 365 | Ga0157371_10232139 | 3300013102 | Bacteria | 1326 |
| 366 | Ga0157369_10057951 | 3300013105 | Bacteria | 4178 |
| 367 | Ga0157369_10201591 | 3300013105 | Bacteria | 2088 |
| 368 | Ga0157369_10249485 | 3300013105 | Bacteria | 1853 |
| 369 | Ga0157369_10343645 | 3300013105 | Bacteria | 1550 |
| 370 | Ga0157374_10012525 | 3300013296 | Bacteria | 7383 |
| 371 | Ga0157374_10103562 | 3300013296 | Bacteria | 2731 |
| 372 | Ga0157374_10655161 | 3300013296 | Bacteria | 1062 |
| 373 | Ga0157378_10122934 | 3300013297 | Bacteria | 2394 |
| 374 | Ga0163162_10009600 | 3300013306 | Bacteria | 9414 |
| 375 | Ga0163162_10039557 | 3300013306 | Bacteria | 4713 |
| 376 | Ga0163162_10168070 | 3300013306 | Bacteria | 2317 |
| 377 | Ga0163162_10351515 | 3300013306 | Bacteria | 1607 |
| 378 | Ga0157372_10027001 | 3300013307 | Bacteria | 6250 |
| 379 | Ga0157372_10098006 | 3300013307 | Bacteria | 3344 |
| 380 | Ga0157372_10208706 | 3300013307 | Bacteria | 2263 |
| 381 | Ga0157372_10406561 | 3300013307 | Bacteria | 1586 |
| 382 | Ga0157372_10534766 | 3300013307 | Bacteria | 1366 |
| 383 | Ga0157375_10134684 | 3300013308 | Bacteria | 2593 |
| 384 | Ga0157375_10255882 | 3300013308 | Bacteria | 1912 |
| 385 | Ga0163163_10002001 | 3300014325 | Bacteria | 17220 |
| 386 | Ga0163163_10051014 | 3300014325 | Bacteria | 4077 |
| 387 | Ga0163163_10265684 | 3300014325 | Bacteria | 1767 |
| 388 | Ga0163163_10364894 | 3300014325 | Bacteria | 1501 |
| 389 | Ga0163163_10388359 | 3300014325 | Bacteria | 1453 |
| 390 | Ga0163163_10741757 | 3300014325 | Bacteria | 1045 |
| 391 | Ga0157380_10095681 | 3300014326 | Bacteria | 2461 |
| 392 | Ga0157377_10002093 | 3300014745 | Bacteria | 8772 |
| 393 | Ga0157377_10213676 | 3300014745 | Bacteria | 1231 |
| 394 | Ga0157379_10018091 | 3300014968 | Bacteria | 6210 |
| 395 | Ga0157379_10137078 | 3300014968 | Bacteria | 2205 |
| 396 | Ga0157379_10215837 | 3300014968 | Bacteria | 1738 |
| 397 | Ga0157379_10245089 | 3300014968 | Bacteria | 1626 |
| 398 | Ga0157379_10416148 | 3300014968 | Bacteria | 1237 |
| 399 | Ga0157376_10040045 | 3300014969 | Bacteria | 3827 |
| 400 | Ga0157376_10229335 | 3300014969 | Bacteria | 1724 |
| 401 | Ga0157376_10249255 | 3300014969 | Bacteria | 1658 |
| 402 | Ga0157376_10386395 | 3300014969 | Bacteria | 1350 |
| 403 | Ga0182007_10002819 | 3300015262 | Bacteria | 8466 |
| 404 | Ga0163161_10005218 | 3300017792 | Bacteria | 9040 |
| 405 | Ga0163161_10236031 | 3300017792 | Bacteria | 1420 |
| 406 | Ga0163161_10276350 | 3300017792 | Bacteria | 1316 |
| 407 | Ga0206353_10140707 | 3300020082 | Bacteria | 1050 |
| 408 | Ga0224572_1001529 | 3300024225 | Bacteria | 3457 |
| 409 | Ga0228598_1024548 | 3300024227 | Bacteria | 1186 |
| 410 | Ga0209233_1019820 | 3300025261 | Bacteria | 1778 |
| 411 | Ga0207666_1000366 | 3300025271 | Bacteria | 6107 |
| 412 | Ga0207666_1001084 | 3300025271 | Bacteria | 3218 |
| 413 | Ga0207673_1000238 | 3300025290 | Bacteria | 5615 |
| 414 | Ga0207697_10000659 | 3300025315 | Bacteria | 19592 |
| 415 | Ga0207697_10131896 | 3300025315 | Bacteria | 1080 |
| 416 | Ga0207696_1052480 | 3300025711 | Bacteria | 1162 |
| 417 | Ga0207653_10001549 | 3300025885 | Bacteria | 7443 |
| 418 | Ga0207653_10016283 | 3300025885 | Bacteria | 2335 |
| 419 | Ga0207653_10086770 | 3300025885 | Bacteria | 1091 |
| 420 | Ga0207682_10003189 | 3300025893 | Bacteria | 7181 |
| 421 | Ga0207692_10006112 | 3300025898 | Bacteria | 4872 |
| 422 | Ga0207692_10021377 | 3300025898 | Bacteria | 2960 |
| 423 | Ga0207692_10060138 | 3300025898 | Bacteria | 1964 |
| 424 | Ga0207692_10085824 | 3300025898 | Bacteria | 1694 |
| 425 | Ga0207642_10049737 | 3300025899 | Bacteria | 1886 |
| 426 | Ga0207642_10210196 | 3300025899 | Bacteria | 1081 |
| 427 | Ga0207710_10012928 | 3300025900 | Bacteria | 3516 |
| 428 | Ga0207710_10046390 | 3300025900 | Bacteria | 1940 |
| 429 | Ga0207710_10061053 | 3300025900 | Bacteria | 1710 |
| 430 | Ga0207688_10000981 | 3300025901 | Bacteria | 14555 |
| 431 | Ga0207688_10003210 | 3300025901 | Bacteria | 8924 |
| 432 | Ga0207688_10024956 | 3300025901 | Bacteria | 3280 |
| 433 | Ga0207688_10047876 | 3300025901 | Bacteria | 2388 |
| 434 | Ga0207680_10053858 | 3300025903 | Bacteria | 2417 |
| 435 | Ga0207647_10005149 | 3300025904 | Bacteria | 9621 |
| 436 | Ga0207647_10017110 | 3300025904 | Bacteria | 4935 |
| 437 | Ga0207647_10026615 | 3300025904 | Bacteria | 3782 |
| 438 | Ga0207647_10114025 | 3300025904 | Bacteria | 1597 |
| 439 | Ga0207685_10000850 | 3300025905 | Bacteria | 5728 |
| 440 | Ga0207685_10088572 | 3300025905 | Bacteria | 1298 |
| 441 | Ga0207699_10006806 | 3300025906 | Bacteria | 5560 |
| 442 | Ga0207699_10074999 | 3300025906 | Bacteria | 2080 |
| 443 | Ga0207699_10079238 | 3300025906 | Bacteria | 2032 |
| 444 | Ga0207645_10001680 | 3300025907 | Bacteria | 18004 |
| 445 | Ga0207645_10014284 | 3300025907 | Bacteria | 5319 |
| 446 | Ga0207645_10172531 | 3300025907 | Unclassified | 1418 |
| 447 | Ga0207643_10000136 | 3300025908 | Bacteria | 49812 |
| 448 | Ga0207643_10001619 | 3300025908 | Bacteria | 12690 |
| 449 | Ga0207705_10045339 | 3300025909 | Bacteria | 3160 |
| 450 | Ga0207705_10073636 | 3300025909 | Bacteria | 2478 |
| 451 | Ga0207684_10293027 | 3300025910 | Bacteria | 1403 |
| 452 | Ga0207654_10030573 | 3300025911 | Bacteria | 2958 |
| 453 | Ga0207707_10136957 | 3300025912 | Bacteria | 2141 |
| 454 | Ga0207671_10058000 | 3300025914 | Bacteria | 2870 |
| 455 | Ga0207671_10101085 | 3300025914 | Bacteria | 2184 |
| 456 | Ga0207671_10131048 | 3300025914 | Bacteria | 1924 |
| 457 | Ga0207671_10173793 | 3300025914 | Bacteria | 1674 |
| 458 | Ga0207693_10004015 | 3300025915 | Bacteria | 12508 |
| 459 | Ga0207693_10004220 | 3300025915 | Bacteria | 12189 |
| 460 | Ga0207693_10006069 | 3300025915 | Bacteria | 10006 |
| 461 | Ga0207693_10006883 | 3300025915 | Bacteria | 9392 |
| 462 | Ga0207693_10009217 | 3300025915 | Bacteria | 8057 |
| 463 | Ga0207693_10021355 | 3300025915 | Bacteria | 5145 |
| 464 | Ga0207693_10041913 | 3300025915 | Bacteria | 3603 |
| 465 | Ga0207693_10046350 | 3300025915 | Bacteria | 3415 |
| 466 | Ga0207693_10078370 | 3300025915 | Bacteria | 2586 |
| 467 | Ga0207693_10111122 | 3300025915 | Bacteria | 2149 |
| 468 | Ga0207663_10040902 | 3300025916 | Bacteria | 2821 |
| 469 | Ga0207663_10147583 | 3300025916 | Bacteria | 1646 |
| 470 | Ga0207663_10207243 | 3300025916 | Bacteria | 1418 |
| 471 | Ga0207663_10248828 | 3300025916 | Bacteria | 1307 |
| 472 | Ga0207660_10004668 | 3300025917 | Bacteria | 8925 |
| 473 | Ga0207660_10039771 | 3300025917 | Bacteria | 3289 |
| 474 | Ga0207660_10177115 | 3300025917 | Bacteria | 1654 |
| 475 | Ga0207660_10226617 | 3300025917 | Bacteria | 1468 |
| 476 | Ga0207662_10000154 | 3300025918 | Bacteria | 32501 |
| 477 | Ga0207662_10000164 | 3300025918 | Bacteria | 31404 |
| 478 | Ga0207662_10017874 | 3300025918 | Bacteria | 4015 |
| 479 | Ga0207657_10011001 | 3300025919 | Bacteria | 8995 |
| 480 | Ga0207657_10019204 | 3300025919 | Bacteria | 6498 |
| 481 | Ga0207657_10026615 | 3300025919 | Bacteria | 5309 |
| 482 | Ga0207657_10070086 | 3300025919 | Bacteria | 2972 |
| 483 | Ga0207657_10101574 | 3300025919 | Bacteria | 2387 |
| 484 | Ga0207649_10103318 | 3300025920 | Bacteria | 1890 |
| 485 | Ga0207649_10421886 | 3300025920 | Bacteria | 1002 |
| 486 | Ga0207652_10085136 | 3300025921 | Bacteria | 2770 |
| 487 | Ga0207652_10119322 | 3300025921 | Bacteria | 2346 |
| 488 | Ga0207652_10147825 | 3300025921 | Bacteria | 2103 |
| 489 | Ga0207652_10254321 | 3300025921 | Bacteria | 1584 |
| 490 | Ga0207646_10244096 | 3300025922 | Bacteria | 1622 |
| 491 | Ga0207646_10350010 | 3300025922 | Bacteria | 1335 |
| 492 | Ga0207681_10123602 | 3300025923 | Bacteria | 1902 |
| 493 | Ga0207681_10137814 | 3300025923 | Unclassified | 1813 |
| 494 | Ga0207694_10042102 | 3300025924 | Bacteria | 3522 |
| 495 | Ga0207694_10224596 | 3300025924 | Unclassified | 1532 |
| 496 | Ga0207650_10008674 | 3300025925 | Bacteria | 6945 |
| 497 | Ga0207650_10039708 | 3300025925 | Bacteria | 3440 |
| 498 | Ga0207650_10085293 | 3300025925 | Bacteria | 2402 |
| 499 | Ga0207650_10092858 | 3300025925 | Bacteria | 2309 |
| 500 | Ga0207650_10214521 | 3300025925 | Bacteria | 1547 |
| 501 | Ga0207659_10002828 | 3300025926 | Bacteria | 10358 |
| 502 | Ga0207687_10028673 | 3300025927 | Bacteria | 3740 |
| 503 | Ga0207687_10034829 | 3300025927 | Bacteria | 3422 |
| 504 | Ga0207687_10053586 | 3300025927 | Bacteria | 2819 |
| 505 | Ga0207700_10000118 | 3300025928 | Bacteria | 46756 |
| 506 | Ga0207700_10029464 | 3300025928 | Bacteria | 3874 |
| 507 | Ga0207700_10225268 | 3300025928 | Bacteria | 1591 |
| 508 | Ga0207700_10254586 | 3300025928 | Bacteria | 1501 |
| 509 | Ga0207700_10573149 | 3300025928 | Bacteria | 1003 |
| 510 | Ga0207700_10719611 | 3300025928 | Bacteria | 892 |
| 511 | Ga0207664_10025513 | 3300025929 | Bacteria | 4455 |
| 512 | Ga0207664_10035107 | 3300025929 | Bacteria | 3867 |
| 513 | Ga0207664_10092926 | 3300025929 | Bacteria | 2477 |
| 514 | Ga0207664_10675070 | 3300025929 | Bacteria | 929 |
| 515 | Ga0207644_10001008 | 3300025931 | Bacteria | 18010 |
| 516 | Ga0207644_10005274 | 3300025931 | Bacteria | 8436 |
| 517 | Ga0207644_10055379 | 3300025931 | Bacteria | 2858 |
| 518 | Ga0207644_10118046 | 3300025931 | Bacteria | 2015 |
| 519 | Ga0207644_10185171 | 3300025931 | Bacteria | 1634 |
| 520 | Ga0207690_10005061 | 3300025932 | Bacteria | 7786 |
| 521 | Ga0207690_10034348 | 3300025932 | Bacteria | 3267 |
| 522 | Ga0207706_10003055 | 3300025933 | Bacteria | 16113 |
| 523 | Ga0207706_10008247 | 3300025933 | Bacteria | 9613 |
| 524 | Ga0207706_10031726 | 3300025933 | Bacteria | 4705 |
| 525 | Ga0207706_10038669 | 3300025933 | Bacteria | 4232 |
| 526 | Ga0207706_10041161 | 3300025933 | Bacteria | 4096 |
| 527 | Ga0207706_10054909 | 3300025933 | Bacteria | 3515 |
| 528 | Ga0207686_10049555 | 3300025934 | Bacteria | 2607 |
| 529 | Ga0207686_10087877 | 3300025934 | Unclassified | 2045 |
| 530 | Ga0207686_10405827 | 3300025934 | Bacteria | 1039 |
| 531 | Ga0207709_10016937 | 3300025935 | Bacteria | 4061 |
| 532 | Ga0207709_10028591 | 3300025935 | Bacteria | 3224 |
| 533 | Ga0207709_10084501 | 3300025935 | Bacteria | 2055 |
| 534 | Ga0207670_10007415 | 3300025936 | Bacteria | 6121 |
| 535 | Ga0207670_10009236 | 3300025936 | Bacteria | 5613 |
| 536 | Ga0207670_10018498 | 3300025936 | Bacteria | 4236 |
| 537 | Ga0207669_10002625 | 3300025937 | Bacteria | 7693 |
| 538 | Ga0207669_10031057 | 3300025937 | Bacteria | 2979 |
| 539 | Ga0207669_10031384 | 3300025937 | Bacteria | 2968 |
| 540 | Ga0207669_10209153 | 3300025937 | Bacteria | 1422 |
| 541 | Ga0207704_10003098 | 3300025938 | Bacteria | 7514 |
| 542 | Ga0207704_10336434 | 3300025938 | Bacteria | 1170 |
| 543 | Ga0207665_10025306 | 3300025939 | Bacteria | 3916 |
| 544 | Ga0207665_10030390 | 3300025939 | Bacteria | 3569 |
| 545 | Ga0207665_10067137 | 3300025939 | Bacteria | 2442 |
| 546 | Ga0207665_10100954 | 3300025939 | Bacteria | 2014 |
| 547 | Ga0207665_10182806 | 3300025939 | Bacteria | 1519 |
| 548 | Ga0207691_10000812 | 3300025940 | Bacteria | 31085 |
| 549 | Ga0207691_10002456 | 3300025940 | Bacteria | 18130 |
| 550 | Ga0207691_10206046 | 3300025940 | Bacteria | 1710 |
| 551 | Ga0207711_10044922 | 3300025941 | Bacteria | 3773 |
| 552 | Ga0207711_10136770 | 3300025941 | Bacteria | 2201 |
| 553 | Ga0207711_10188980 | 3300025941 | Bacteria | 1876 |
| 554 | Ga0207711_10289120 | 3300025941 | Bacteria | 1510 |
| 555 | Ga0207711_10441143 | 3300025941 | Bacteria | 1211 |
| 556 | Ga0207689_10000427 | 3300025942 | Bacteria | 39477 |
| 557 | Ga0207689_10009817 | 3300025942 | Bacteria | 8250 |
| 558 | Ga0207689_10063205 | 3300025942 | Bacteria | 3045 |
| 559 | Ga0207661_10031070 | 3300025944 | Bacteria | 4120 |
| 560 | Ga0207661_10217548 | 3300025944 | Bacteria | 1687 |
| 561 | Ga0207661_10467352 | 3300025944 | Bacteria | 1150 |
| 562 | Ga0207679_10000853 | 3300025945 | Bacteria | 19597 |
| 563 | Ga0207667_10058200 | 3300025949 | Bacteria | 4055 |
| 564 | Ga0207667_10204823 | 3300025949 | Bacteria | 2023 |
| 565 | Ga0207667_10298671 | 3300025949 | Bacteria | 1645 |
| 566 | Ga0207651_10003200 | 3300025960 | Bacteria | 8002 |
| 567 | Ga0207651_10004120 | 3300025960 | Bacteria | 7260 |
| 568 | Ga0207651_10035784 | 3300025960 | Bacteria | 3233 |
| 569 | Ga0207712_10008478 | 3300025961 | Bacteria | 6499 |
| 570 | Ga0207712_10067643 | 3300025961 | Bacteria | 2558 |
| 571 | Ga0207668_10013229 | 3300025972 | Bacteria | 5073 |
| 572 | Ga0207668_10031378 | 3300025972 | Bacteria | 3499 |
| 573 | Ga0207668_10106179 | 3300025972 | Bacteria | 2097 |
| 574 | Ga0207668_10142169 | 3300025972 | Bacteria | 1847 |
| 575 | Ga0207640_10005942 | 3300025981 | Bacteria | 6662 |
| 576 | Ga0207640_10089427 | 3300025981 | Bacteria | 2128 |
| 577 | Ga0207640_10377592 | 3300025981 | Bacteria | 1147 |
| 578 | Ga0207658_10116096 | 3300025986 | Bacteria | 2125 |
| 579 | Ga0207658_10340440 | 3300025986 | Bacteria | 1303 |
| 580 | Ga0207658_10345981 | 3300025986 | Bacteria | 1293 |
| 581 | Ga0207658_10693355 | 3300025986 | Bacteria | 920 |
| 582 | Ga0207677_10020473 | 3300026023 | Bacteria | 4018 |
| 583 | Ga0207677_10047073 | 3300026023 | Bacteria | 2893 |
| 584 | Ga0207677_10293589 | 3300026023 | Bacteria | 1340 |
| 585 | Ga0207703_10024162 | 3300026035 | Bacteria | 4782 |
| 586 | Ga0207703_10038967 | 3300026035 | Bacteria | 3796 |
| 587 | Ga0207703_10056116 | 3300026035 | Bacteria | 3207 |
| 588 | Ga0207703_10139047 | 3300026035 | Bacteria | 2106 |
| 589 | Ga0207639_10032499 | 3300026041 | Bacteria | 3841 |
| 590 | Ga0207678_10005504 | 3300026067 | Bacteria | 11320 |
| 591 | Ga0207678_10008889 | 3300026067 | Bacteria | 8846 |
| 592 | Ga0207678_10009330 | 3300026067 | Bacteria | 8637 |
| 593 | Ga0207678_10024014 | 3300026067 | Bacteria | 5328 |
| 594 | Ga0207708_10001137 | 3300026075 | Bacteria | 19993 |
| 595 | Ga0207708_10001264 | 3300026075 | Bacteria | 19041 |
| 596 | Ga0207708_10011789 | 3300026075 | Bacteria | 6511 |
| 597 | Ga0207708_10081153 | 3300026075 | Bacteria | 2492 |
| 598 | Ga0207702_10020210 | 3300026078 | Bacteria | 5516 |
| 599 | Ga0207702_10128387 | 3300026078 | Bacteria | 2279 |
| 600 | Ga0207702_10227326 | 3300026078 | Bacteria | 1742 |
| 601 | Ga0207641_10017044 | 3300026088 | Bacteria | 5945 |
| 602 | Ga0207641_10035250 | 3300026088 | Bacteria | 4167 |
| 603 | Ga0207641_10556088 | 3300026088 | Bacteria | 1119 |
| 604 | Ga0207648_10002630 | 3300026089 | Bacteria | 19221 |
| 605 | Ga0207648_10035051 | 3300026089 | Bacteria | 4424 |
| 606 | Ga0207648_10393955 | 3300026089 | Bacteria | 1254 |
| 607 | Ga0207676_10066657 | 3300026095 | Bacteria | 2872 |
| 608 | Ga0207676_10152751 | 3300026095 | Bacteria | 1990 |
| 609 | Ga0207674_10004609 | 3300026116 | Bacteria | 16553 |
| 610 | Ga0207674_10036803 | 3300026116 | Bacteria | 5095 |
| 611 | Ga0207674_10092714 | 3300026116 | Bacteria | 3010 |
| 612 | Ga0207674_10175216 | 3300026116 | Bacteria | 2097 |
| 613 | Ga0207675_100003315 | 3300026118 | Bacteria | 15757 |
| 614 | Ga0207675_100011227 | 3300026118 | Bacteria | 8389 |
| 615 | Ga0207675_100022088 | 3300026118 | Bacteria | 5924 |
| 616 | Ga0207675_100411237 | 3300026118 | Bacteria | 1335 |
| 617 | Ga0207675_100619076 | 3300026118 | Bacteria | 1087 |
| 618 | Ga0207683_10008982 | 3300026121 | Bacteria | 8515 |
| 619 | Ga0207698_10036199 | 3300026142 | Bacteria | 3620 |
| 620 | Ga0207698_10120755 | 3300026142 | Bacteria | 2217 |
| 621 | Ga0209971_1018376 | 3300027682 | Bacteria | 1659 |
| 622 | Ga0209966_1002117 | 3300027695 | Bacteria | 3310 |
| 623 | Ga0209998_10000576 | 3300027717 | Bacteria | 9890 |
| 624 | Ga0209998_10034804 | 3300027717 | Bacteria | 1127 |
| 625 | Ga0209998_10035834 | 3300027717 | Bacteria | 1113 |
| 626 | Ga0209974_10018091 | 3300027876 | Bacteria | 2336 |
| 627 | Ga0207428_10000150 | 3300027907 | Bacteria | 94699 |
| 628 | Ga0207428_10000594 | 3300027907 | Bacteria | 42742 |
| 629 | Ga0207428_10001449 | 3300027907 | Bacteria | 24817 |
| 630 | Ga0268266_10161989 | 3300028379 | Bacteria | 2025 |
| 631 | Ga0268266_10302644 | 3300028379 | Bacteria | 1492 |
| 632 | Ga0268266_10511300 | 3300028379 | Bacteria | 1147 |
| 633 | Ga0268265_10010005 | 3300028380 | Bacteria | 6403 |
| 634 | Ga0268265_10024707 | 3300028380 | Bacteria | 4255 |
| 635 | Ga0268264_10029947 | 3300028381 | Bacteria | 4462 |
| 636 | Ga0268264_10055972 | 3300028381 | Bacteria | 3296 |
| 637 | Ga0268264_10059135 | 3300028381 | Bacteria | 3210 |
| 638 | Ga0268264_10264596 | 3300028381 | Bacteria | 1604 |
| 639 | Ga0268264_10365138 | 3300028381 | Bacteria | 1378 |
| 640 | Ga0265337_1000084 | 3300028556 | Bacteria | 45523 |
| 641 | Ga0265318_10055752 | 3300028577 | Bacteria | 1478 |
| 642 | Ga0265336_10046681 | 3300028666 | Bacteria | 1316 |
| 643 | Ga0265338_10006542 | 3300028800 | Bacteria | 14807 |
| 644 | Ga0265338_10170721 | 3300028800 | Bacteria | 1668 |
| 645 | Ga0265763_1000682 | 3300030763 | Bacteria | 2182 |
| 646 | Ga0265760_10034437 | 3300031090 | Bacteria | 1498 |
| 647 | Ga0265330_10039971 | 3300031235 | Bacteria | 2083 |
| 648 | Ga0265332_10045527 | 3300031238 | Bacteria | 1891 |
| 649 | Ga0265328_10035237 | 3300031239 | Bacteria | 1851 |
| 650 | Ga0265320_10032836 | 3300031240 | Bacteria | 2654 |
| 651 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 652 | Ga0265325_10000630 | 3300031241 | Bacteria | 25635 |
| 653 | Ga0265325_10013896 | 3300031241 | Bacteria | 4569 |
| 654 | Ga0265325_10060087 | 3300031241 | Bacteria | 1932 |
| 655 | Ga0265325_10060873 | 3300031241 | Bacteria | 1916 |
| 656 | Ga0265325_10112940 | 3300031241 | Bacteria | 1318 |
| 657 | Ga0265329_10045592 | 3300031242 | Bacteria | 1401 |
| 658 | Ga0265340_10001253 | 3300031247 | Bacteria | 14589 |
| 659 | Ga0265340_10007664 | 3300031247 | Bacteria | 5856 |
| 660 | Ga0265340_10010658 | 3300031247 | Bacteria | 4913 |
| 661 | Ga0265340_10015110 | 3300031247 | Bacteria | 4016 |
| 662 | Ga0265339_10000133 | 3300031249 | Bacteria | 60726 |
| 663 | Ga0265339_10004348 | 3300031249 | Bacteria | 9673 |
| 664 | Ga0265339_10004657 | 3300031249 | Bacteria | 9320 |
| 665 | Ga0265339_10112074 | 3300031249 | Bacteria | 1410 |
| 666 | Ga0265339_10194858 | 3300031249 | Bacteria | 1002 |
| 667 | Ga0265331_10024291 | 3300031250 | Bacteria | 3068 |
| 668 | Ga0265331_10031897 | 3300031250 | Bacteria | 2616 |
| 669 | Ga0265331_10051405 | 3300031250 | Bacteria | 1972 |
| 670 | Ga0265316_10016679 | 3300031344 | Bacteria | 6366 |
| 671 | Ga0265316_10026680 | 3300031344 | Bacteria | 4799 |
| 672 | Ga0265316_10328348 | 3300031344 | Bacteria | 1110 |
| 673 | Ga0265313_10000491 | 3300031595 | Bacteria | 41687 |
| 674 | Ga0265313_10000868 | 3300031595 | Bacteria | 30518 |
| 675 | Ga0265313_10015380 | 3300031595 | Bacteria | 4459 |
| 676 | Ga0265313_10028881 | 3300031595 | Bacteria | 2876 |
| 677 | Ga0307508_10000049 | 3300031616 | Bacteria | 137413 |
| 678 | Ga0316575_10006591 | 3300031665 | Bacteria | 4182 |
| 679 | Ga0316579_10031010 | 3300031691 | Bacteria | 2445 |
| 680 | Ga0265314_10002573 | 3300031711 | Bacteria | 18388 |
| 681 | Ga0265314_10004582 | 3300031711 | Bacteria | 12763 |
| 682 | Ga0265314_10085258 | 3300031711 | Bacteria | 2072 |
| 683 | Ga0265314_10111772 | 3300031711 | Bacteria | 1735 |
| 684 | Ga0265342_10000093 | 3300031712 | Bacteria | 98424 |
| 685 | Ga0265342_10001600 | 3300031712 | Bacteria | 20914 |
| 686 | Ga0265342_10009354 | 3300031712 | Bacteria | 6916 |
| 687 | Ga0265342_10045417 | 3300031712 | Bacteria | 2644 |
| 688 | Ga0307516_10164851 | 3300031730 | Bacteria | 1962 |
| 689 | Ga0307516_10179878 | 3300031730 | Bacteria | 1849 |
| 690 | Ga0316583_10000400 | 3300032133 | Bacteria | 12645 |
| 691 | Ga0316583_10032496 | 3300032133 | Bacteria | 1855 |
| 692 | Ga0307507_10174228 | 3300033179 | Bacteria | 1554 |
| 693 | Ga0373930_0000835 | 3300034816 | Bacteria | 4367 |
| 694 | Ga0373930_0006760 | 3300034816 | Bacteria | 1952 |
| 695 | Ga0373948_0000254 | 3300034817 | Bacteria | 6429 |
| 696 | Ga0373948_0037241 | 3300034817 | Bacteria | 1005 |
| 697 | Ga0373950_0000189 | 3300034818 | Bacteria | 8659 |
| 698 | Ga0373950_0007445 | 3300034818 | Bacteria | 1700 |
| 699 | Ga0373950_0021088 | 3300034818 | Bacteria | 1151 |
| 700 | Ga0373958_0000784 | 3300034819 | Bacteria | 4072 |
| 701 | Ga0373958_0014447 | 3300034819 | Bacteria | 1381 |
| 702 | Ga0373958_0041796 | 3300034819 | Bacteria | 940 |
| 703 | Ga0373959_0000739 | 3300034820 | Bacteria | 5585 |
| 704 | Ga0373959_0032426 | 3300034820 | Bacteria | 1061 |
| 705 | Ga0373926_0000978 | 3300035083 | Bacteria | 8306 |
| 706 | Ga0373926_0009827 | 3300035083 | Bacteria | 3199 |
| 707 | Ga0373926_0052869 | 3300035083 | Bacteria | 1469 |
| 708 | Ga0373928_0000170 | 3300035084 | Bacteria | 12621 |
| 709 | Ga0373928_0002877 | 3300035084 | Bacteria | 3320 |
| 710 | Ga0373929_0000249 | 3300035085 | Bacteria | 9931 |
| 711 | Ga0373929_0018901 | 3300035085 | Bacteria | 1374 |
| 712 | Ga0373929_0020499 | 3300035085 | Bacteria | 1333 |
| 713 | Ga0373934_0035483 | 3300035086 | Bacteria | 1962 |
| 714 | Ga0373934_0112996 | 3300035086 | Bacteria | 1102 |
| 715 | Ga0373940_0000372 | 3300035088 | Bacteria | 6761 |
| 716 | Ga0373940_0005705 | 3300035088 | Bacteria | 2715 |
| 717 | Ga0373944_0019794 | 3300035089 | Bacteria | 1934 |
| 718 | Ga0373949_0001262 | 3300035090 | Bacteria | 7384 |
| 719 | Ga0373949_0002117 | 3300035090 | Bacteria | 5219 |
| 720 | Ga0373949_0003612 | 3300035090 | Bacteria | 3645 |
| 721 | Ga0373949_0004664 | 3300035090 | Bacteria | 3117 |
| 722 | Ga0373951_0000237 | 3300035091 | Bacteria | 18672 |
| 723 | Ga0373951_0002947 | 3300035091 | Bacteria | 4221 |
| 724 | Ga0373951_0003252 | 3300035091 | Bacteria | 3976 |
| 725 | Ga0373952_0001204 | 3300035092 | Bacteria | 4714 |
| 726 | Ga0373923_0007009 | 3300035111 | Bacteria | 3936 |
| 727 | Ga0373923_0012224 | 3300035111 | Bacteria | 3167 |
| 728 | Ga0373923_0034032 | 3300035111 | Bacteria | 2066 |
| 729 | Ga0373932_0000358 | 3300035112 | Bacteria | 14048 |
| 730 | Ga0373932_0004563 | 3300035112 | Bacteria | 3270 |
| 731 | Ga0373932_0011645 | 3300035112 | Bacteria | 2153 |
| 732 | Ga0373936_0000247 | 3300035113 | Bacteria | 17940 |
| 733 | Ga0373936_0008984 | 3300035113 | Bacteria | 3768 |
| 734 | Ga0373936_0014000 | 3300035113 | Bacteria | 3063 |
| 735 | Ga0373939_0001671 | 3300035114 | Bacteria | 5362 |
| 736 | Ga0373939_0005026 | 3300035114 | Bacteria | 3142 |
| 737 | Ga0373939_0005227 | 3300035114 | Bacteria | 3086 |
| 738 | Ga0373939_0069815 | 3300035114 | Bacteria | 1141 |
| 739 | Ga0373941_0132022 | 3300035115 | Bacteria | 900 |
| 740 | Ga0373945_0000745 | 3300035116 | Bacteria | 9494 |
| 741 | Ga0373945_0002295 | 3300035116 | Bacteria | 5983 |
| 742 | Ga0373945_0007669 | 3300035116 | Bacteria | 3499 |
| 743 | Ga0373945_0011100 | 3300035116 | Bacteria | 2973 |
| 744 | Ga0373945_0033341 | 3300035116 | Bacteria | 1829 |
| 745 | Ga0373953_0004566 | 3300035117 | Bacteria | 4419 |
| 746 | Ga0373953_0011967 | 3300035117 | Bacteria | 3060 |
| 747 | Ga0373953_0022051 | 3300035117 | Bacteria | 2397 |
| 748 | Ga0373954_0000594 | 3300035118 | Bacteria | 13743 |
| 749 | Ga0373954_0017468 | 3300035118 | Bacteria | 3223 |
| 750 | Ga0373954_0042143 | 3300035118 | Bacteria | 2128 |
| 751 | Ga0373954_0210637 | 3300035118 | Bacteria | 955 |
| 752 | Ga0373956_0014225 | 3300035119 | Bacteria | 3322 |
| 753 | Ga0373956_0020803 | 3300035119 | Bacteria | 2796 |
| 754 | Ga0373956_0038030 | 3300035119 | Bacteria | 2128 |
| 755 | Ga0373956_0058744 | 3300035119 | Bacteria | 1739 |
| 756 | Ga0373957_0005882 | 3300035120 | Bacteria | 3832 |
| 757 | Ga0373957_0015861 | 3300035120 | Bacteria | 2600 |
| 758 | Ga0373957_0022379 | 3300035120 | Bacteria | 2252 |
| 759 | Ga0373957_0026572 | 3300035120 | Bacteria | 2095 |
| 760 | Ga0373957_0072208 | 3300035120 | Bacteria | 1351 |
| 761 | Ga0373960_0000983 | 3300035121 | Bacteria | 6136 |
| 762 | Ga0373960_0003870 | 3300035121 | Bacteria | 3409 |
| 763 | Ga0373960_0004631 | 3300035121 | Bacteria | 3158 |
| 764 | Ga0373960_0028890 | 3300035121 | Bacteria | 1533 |
| 765 | Ga0373943_0000765 | 3300035170 | Bacteria | 14011 |
| 766 | Ga0373943_0002206 | 3300035170 | Bacteria | 8854 |
| 767 | Ga0373943_0027440 | 3300035170 | Bacteria | 2675 |
| 768 | Ga0373943_0051014 | 3300035170 | Bacteria | 2036 |
| 769 | Ga0373943_0081660 | 3300035170 | Bacteria | 1658 |
| 770 | Ga0373943_0103620 | 3300035170 | Bacteria | 1491 |
| 771 | Ga0373946_0005621 | 3300035171 | Bacteria | 4528 |
| 772 | Ga0373946_0007520 | 3300035171 | Bacteria | 3985 |
| 773 | Ga0373946_0008750 | 3300035171 | Bacteria | 3716 |
| 774 | Ga0373946_0029382 | 3300035171 | Bacteria | 2187 |
| 775 | Ga0373946_0047124 | 3300035171 | Bacteria | 1790 |
| 776 | Ga0373946_0079515 | 3300035171 | Bacteria | 1432 |
| 777 | Ga0373955_0000588 | 3300035172 | Bacteria | 15451 |
| 778 | Ga0373955_0000790 | 3300035172 | Bacteria | 13580 |
| 779 | Ga0373955_0006281 | 3300035172 | Bacteria | 5411 |
| 780 | Ga0373955_0007878 | 3300035172 | Bacteria | 4916 |
| 781 | Ga0373955_0052325 | 3300035172 | Bacteria | 2227 |
| 782 | Ga0373955_0053290 | 3300035172 | Bacteria | 2208 |
| 783 | Ga0373955_0160972 | 3300035172 | Bacteria | 1325 |
| 784 | Ga0373955_0198559 | 3300035172 | Bacteria | 1194 |
| 785 | Ga0373942_0009149 | 3300035207 | Bacteria | 2314 |
| 786 | Ga0373961_0000267 | 3300035241 | Bacteria | 23637 |
| 787 | Ga0373961_0011660 | 3300035241 | Bacteria | 2184 |
| 788 | Ga0373961_0014287 | 3300035241 | Bacteria | 2015 |
| 789 | Ga0373961_0040159 | 3300035241 | Bacteria | 1347 |
| 790 | Ga0373962_0000465 | 3300035242 | Bacteria | 8943 |
| 791 | Ga0373962_0022349 | 3300035242 | Bacteria | 1676 |
| 792 | Ga0373924_0000311 | 3300035410 | Bacteria | 14970 |
| 793 | Ga0373924_0011298 | 3300035410 | Bacteria | 3314 |
| 794 | Ga0373924_0014516 | 3300035410 | Bacteria | 2979 |
| 795 | Ga0373924_0024512 | 3300035410 | Bacteria | 2378 |
| 796 | Ga0373924_0025071 | 3300035410 | Bacteria | 2355 |
| 797 | Ga0373924_0033787 | 3300035410 | Bacteria | 2067 |
| 798 | Ga0373924_0056803 | 3300035410 | Bacteria | 1631 |
| 799 | Ga0373931_0000813 | 3300035691 | Bacteria | 13072 |
| 800 | Ga0373931_0003284 | 3300035691 | Bacteria | 7239 |
| 801 | Ga0373931_0044083 | 3300035691 | Bacteria | 2351 |
| 802 | Ga0373935_0000142 | 3300035692 | Bacteria | 32758 |
| 803 | Ga0373935_0007148 | 3300035692 | Bacteria | 6664 |
| 804 | Ga0373935_0009871 | 3300035692 | Bacteria | 5718 |
| 805 | Ga0373935_0025943 | 3300035692 | Bacteria | 3612 |
| 806 | Ga0373935_0032442 | 3300035692 | Bacteria | 3246 |
| 807 | Ga0373935_0114203 | 3300035692 | Bacteria | 1796 |
| 808 | Ga0373935_0201129 | 3300035692 | Bacteria | 1376 |
| 809 | Ga0373935_0210028 | 3300035692 | Bacteria | 1348 |
| 810 | Ga0373935_0292511 | 3300035692 | Bacteria | 1149 |
| 811 | Ga0373935_0297661 | 3300035692 | Bacteria | 1140 |
| 812 | Ga0373935_0540772 | 3300035692 | Bacteria | 848 |
| 813 | Ga0373927_0002697 | 3300035695 | Bacteria | 12932 |
| 814 | Ga0373927_0003928 | 3300035695 | Bacteria | 10541 |
| 815 | Ga0373927_0011494 | 3300035695 | Bacteria | 5898 |
| 816 | Ga0373927_0019711 | 3300035695 | Bacteria | 4422 |
| 817 | Ga0373927_0035816 | 3300035695 | Bacteria | 3228 |
| 818 | Ga0373927_0057174 | 3300035695 | Bacteria | 2522 |
| 819 | Ga0373927_0218229 | 3300035695 | Bacteria | 1253 |
| 820 | Ga0373933_0001807 | 3300035724 | Bacteria | 12403 |
| 821 | Ga0373933_0001809 | 3300035724 | Bacteria | 12395 |
| 822 | Ga0373933_0001937 | 3300035724 | Bacteria | 11941 |
| 823 | Ga0373933_0002756 | 3300035724 | Bacteria | 9806 |
| 824 | Ga0373933_0020681 | 3300035724 | Bacteria | 3731 |
| 825 | Ga0373933_0021016 | 3300035724 | Bacteria | 3703 |
| 826 | Ga0373947_0000334 | 3300035725 | Bacteria | 26518 |
| 827 | Ga0373947_0006737 | 3300035725 | Bacteria | 6664 |
| 828 | Ga0373947_0084587 | 3300035725 | Bacteria | 1969 |
| 829 | Ga0373947_0115396 | 3300035725 | Bacteria | 1701 |
| 830 | Ga0373937_0000802 | 3300036401 | Bacteria | 26864 |
| 831 | Ga0373937_0001597 | 3300036401 | Bacteria | 19048 |
| 832 | Ga0373937_0001602 | 3300036401 | Bacteria | 19014 |
| 833 | Ga0373937_0001751 | 3300036401 | Bacteria | 18265 |
| 834 | Ga0373937_0004661 | 3300036401 | Bacteria | 11646 |
| 835 | Ga0373937_0005134 | 3300036401 | Bacteria | 11160 |
| 836 | Ga0373937_0012412 | 3300036401 | Bacteria | 7492 |
| 837 | Ga0373937_0054149 | 3300036401 | Bacteria | 3681 |
| 838 | Ga0373937_0180034 | 3300036401 | Bacteria | 1985 |
| 839 | Ga0373925_0000152 | 3300037068 | Bacteria | 74035 |
| 840 | Ga0373925_0003524 | 3300037068 | Bacteria | 12079 |
| 841 | Ga0373925_0028860 | 3300037068 | Bacteria | 4067 |
| 842 | Ga0373925_0061971 | 3300037068 | Bacteria | 2811 |
| 843 | Ga0373925_0122106 | 3300037068 | Bacteria | 2023 |
| 844 | Ga0373925_0245655 | 3300037068 | Bacteria | 1434 |
| 845 | Ga0373925_0248056 | 3300037068 | Bacteria | 1427 |
| 846 | Ga0395899_0011380 | 3300037312 | Bacteria | 6814 |
| 847 | Ga0395899_0100109 | 3300037312 | Bacteria | 2093 |
| 848 | Ga0395900_0003511 | 3300037418 | Bacteria | 16927 |
| 849 | Ga0395900_0030157 | 3300037418 | Bacteria | 5567 |
| 850 | Ga0395900_0056684 | 3300037418 | Bacteria | 4033 |
| 851 | Ga0395898_0089239 | 3300037466 | Bacteria | 2967 |
| 852 | Ga0395898_0137489 | 3300037466 | Bacteria | 2339 |
| 853 | Ga0395901_0010954 | 3300038443 | Bacteria | 9186 |
| 854 | Ga0395901_0013418 | 3300038443 | Bacteria | 8328 |
| 855 | Ga0242420_002050 | 3300038996 | Bacteria | 2817 |
| 856 | Ga0400483_151746 | 3300039062 | Bacteria | 3517 |
| 857 | Ga0400483_161457 | 3300039062 | Bacteria | 1137 |
| 858 | Ga0436365_0274179 | 3300039437 | Bacteria | 967 |
| 859 | Ga0436365_0859425 | 3300039437 | Bacteria | 689 |
| 860 | Ga0436361_0161168 | 3300039447 | Bacteria | 1252 |
| 861 | Ga0436363_0176166 | 3300039450 | Bacteria | 1299 |
| 862 | Ga0436363_0963225 | 3300039450 | Bacteria | 1834 |
| 863 | Ga0436363_1590609 | 3300039450 | Bacteria | 3055 |
| 864 | Ga0439450_006195 | 3300042008 | Bacteria | 2143 |
| 865 | Ga0439464_0008939 | 3300042439 | Bacteria | 2628 |
| 866 | Ga0451577_0091412 | 3300042876 | Bacteria | 2717 |
| 867 | Ga0453683_0083480 | 3300044673 | Bacteria | 2002 |
| 868 | Ga0466963_0039766 | 3300044694 | Bacteria | 3081 |
| 869 | Ga0466963_0041028 | 3300044694 | Bacteria | 3034 |
| 870 | Ga0466963_0245160 | 3300044694 | Bacteria | 1257 |
| 871 | Ga0453684_0226771 | 3300044712 | Bacteria | 2160 |
| 872 | Ga0466957_0044609 | 3300044842 | Bacteria | 2687 |
| 873 | Ga0451576_0166909 | 3300045051 | Bacteria | 2297 |
| 874 | Ga0466967_0779464 | 3300045976 | Bacteria | 949 |
| 875 | Ga0495617_003311 | 3300046452 | Bacteria | 6097 |
| 876 | Ga0495617_017730 | 3300046452 | Bacteria | 2406 |
| 877 | Ga0495592_0000009 | 3300046454 | Bacteria | 171624 |
| 878 | Ga0495592_0002207 | 3300046454 | Bacteria | 13728 |
| 879 | Ga0495592_0002869 | 3300046454 | Bacteria | 12255 |
| 880 | Ga0495592_0007893 | 3300046454 | Bacteria | 7980 |
| 881 | Ga0495603_0001273 | 3300046455 | Bacteria | 14676 |
| 882 | Ga0495603_0057352 | 3300046455 | Bacteria | 2304 |
| 883 | Ga0495603_0093529 | 3300046455 | Bacteria | 1757 |
| 884 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 885 | Ga0495629_0003539 | 3300046459 | Bacteria | 11804 |
| 886 | Ga0495629_0012950 | 3300046459 | Bacteria | 6032 |
| 887 | Ga0495629_0022806 | 3300046459 | Bacteria | 4460 |
| 888 | Ga0495629_0193599 | 3300046459 | Bacteria | 1407 |
| 889 | Ga0495638_0000150 | 3300046460 | Bacteria | 109804 |
| 890 | Ga0495638_0001385 | 3300046460 | Bacteria | 22107 |
| 891 | Ga0495638_0031505 | 3300046460 | Bacteria | 3407 |
| 892 | Ga0495641_0019956 | 3300046461 | Bacteria | 3415 |
| 893 | Ga0495641_0110335 | 3300046461 | Bacteria | 1227 |
| 894 | Ga0495651_0001594 | 3300046462 | Bacteria | 17547 |
| 895 | Ga0495651_0002062 | 3300046462 | Bacteria | 15531 |
| 896 | Ga0495651_0009198 | 3300046462 | Bacteria | 7587 |
| 897 | Ga0495651_0014698 | 3300046462 | Bacteria | 6053 |
| 898 | Ga0495651_0065667 | 3300046462 | Bacteria | 2770 |
| 899 | Ga0495651_0401222 | 3300046462 | Bacteria | 895 |
| 900 | Ga0495653_0001255 | 3300046463 | Bacteria | 19638 |
| 901 | Ga0495653_0019067 | 3300046463 | Bacteria | 5565 |
| 902 | Ga0495653_0045135 | 3300046463 | Bacteria | 3418 |
| 903 | Ga0495653_0069592 | 3300046463 | Bacteria | 2636 |
| 904 | Ga0495653_0178884 | 3300046463 | Bacteria | 1457 |
| 905 | Ga0495580_0014189 | 3300046472 | Bacteria | 6051 |
| 906 | Ga0495580_0131424 | 3300046472 | Bacteria | 1736 |
| 907 | Ga0495580_0225035 | 3300046472 | Bacteria | 1288 |
| 908 | Ga0495582_0003737 | 3300046473 | Bacteria | 8576 |
| 909 | Ga0495605_0000743 | 3300046474 | Bacteria | 23930 |
| 910 | Ga0495639_0009238 | 3300046475 | Bacteria | 4225 |
| 911 | Ga0495639_0093976 | 3300046475 | Bacteria | 1410 |
| 912 | Ga0495662_0014404 | 3300046476 | Bacteria | 3846 |
| 913 | Ga0495662_0022251 | 3300046476 | Bacteria | 3062 |
| 914 | Ga0495662_0029602 | 3300046476 | Bacteria | 2643 |
| 915 | Ga0495662_0067798 | 3300046476 | Bacteria | 1727 |
| 916 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 917 | Ga0495664_0000375 | 3300046477 | Bacteria | 21707 |
| 918 | Ga0495664_0029112 | 3300046477 | Bacteria | 3228 |
| 919 | Ga0495664_0076558 | 3300046477 | Bacteria | 2002 |
| 920 | Ga0495664_0141693 | 3300046477 | Bacteria | 1457 |
| 921 | Ga0495584_0031215 | 3300046491 | Bacteria | 2697 |
| 922 | Ga0495584_0052960 | 3300046491 | Bacteria | 2042 |
| 923 | Ga0495584_0064460 | 3300046491 | Bacteria | 1842 |
| 924 | Ga0495585_0005673 | 3300046492 | Bacteria | 7836 |
| 925 | Ga0495585_0050299 | 3300046492 | Bacteria | 2312 |
| 926 | Ga0495585_0188433 | 3300046492 | Bacteria | 1057 |
| 927 | Ga0495594_0008513 | 3300046499 | Bacteria | 5288 |
| 928 | Ga0495594_0028509 | 3300046499 | Bacteria | 3013 |
| 929 | Ga0495594_0045999 | 3300046499 | Bacteria | 2396 |
| 930 | Ga0495594_0122516 | 3300046499 | Bacteria | 1470 |
| 931 | Ga0495594_0165116 | 3300046499 | Bacteria | 1259 |
| 932 | Ga0495607_0007593 | 3300046501 | Bacteria | 7479 |
| 933 | Ga0495607_0008723 | 3300046501 | Bacteria | 6908 |
| 934 | Ga0495607_0125793 | 3300046501 | Bacteria | 1340 |
| 935 | Ga0495607_0150619 | 3300046501 | Bacteria | 1191 |
| 936 | Ga0495583_0075433 | 3300046506 | Bacteria | 1475 |
| 937 | Ga0495608_0000032 | 3300046511 | Bacteria | 144093 |
| 938 | Ga0495608_0000180 | 3300046511 | Bacteria | 45181 |
| 939 | Ga0495608_0003555 | 3300046511 | Bacteria | 11163 |
| 940 | Ga0495608_0011097 | 3300046511 | Bacteria | 6276 |
| 941 | Ga0495608_0026249 | 3300046511 | Bacteria | 3972 |
| 942 | Ga0495610_0003832 | 3300046512 | Bacteria | 11456 |
| 943 | Ga0495616_0001634 | 3300046513 | Bacteria | 15368 |
| 944 | Ga0495616_0043539 | 3300046513 | Bacteria | 2280 |
| 945 | Ga0495618_0000114 | 3300046514 | Bacteria | 59201 |
| 946 | Ga0495618_0003664 | 3300046514 | Bacteria | 9525 |
| 947 | Ga0495618_0029503 | 3300046514 | Bacteria | 3423 |
| 948 | Ga0495618_0052091 | 3300046514 | Bacteria | 2586 |
| 949 | Ga0495618_0065232 | 3300046514 | Bacteria | 2314 |
| 950 | Ga0495620_0013168 | 3300046515 | Bacteria | 4244 |
| 951 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 952 | Ga0495628_0001064 | 3300046516 | Bacteria | 25180 |
| 953 | Ga0495628_0074879 | 3300046516 | Bacteria | 2636 |
| 954 | Ga0495628_0103074 | 3300046516 | Bacteria | 2200 |
| 955 | Ga0495630_0000658 | 3300046517 | Bacteria | 24993 |
| 956 | Ga0495630_0012700 | 3300046517 | Bacteria | 6119 |
| 957 | Ga0495630_0037134 | 3300046517 | Bacteria | 3642 |
| 958 | Ga0495630_0046355 | 3300046517 | Bacteria | 3249 |
| 959 | Ga0495630_0066937 | 3300046517 | Bacteria | 2700 |
| 960 | Ga0495630_0114588 | 3300046517 | Bacteria | 2043 |
| 961 | Ga0495630_0427865 | 3300046517 | Bacteria | 1014 |
| 962 | Ga0495630_0429262 | 3300046517 | Bacteria | 1012 |
| 963 | Ga0495631_0110537 | 3300046518 | Bacteria | 1182 |
| 964 | Ga0495632_0002399 | 3300046519 | Bacteria | 14292 |
| 965 | Ga0495632_0011697 | 3300046519 | Bacteria | 5108 |
| 966 | Ga0495637_0124883 | 3300046520 | Bacteria | 987 |
| 967 | Ga0495643_0003688 | 3300046522 | Bacteria | 11102 |
| 968 | Ga0495644_0000690 | 3300046523 | Bacteria | 13986 |
| 969 | Ga0495644_0009397 | 3300046523 | Bacteria | 3771 |
| 970 | Ga0495644_0039008 | 3300046523 | Bacteria | 1791 |
| 971 | Ga0495644_0121256 | 3300046523 | Bacteria | 995 |
| 972 | Ga0495644_0178707 | 3300046523 | Bacteria | 816 |
| 973 | Ga0495648_0000824 | 3300046524 | Bacteria | 32707 |
| 974 | Ga0495663_0099245 | 3300046525 | Bacteria | 957 |
| 975 | Ga0495666_0039577 | 3300046526 | Bacteria | 2288 |
| 976 | Ga0495666_0121951 | 3300046526 | Bacteria | 1220 |
| 977 | Ga0495666_0135713 | 3300046526 | Bacteria | 1148 |
| 978 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 979 | Ga0495652_0001634 | 3300046529 | Bacteria | 24442 |
| 980 | Ga0495652_0020229 | 3300046529 | Bacteria | 5916 |
| 981 | Ga0495652_0030318 | 3300046529 | Bacteria | 4744 |
| 982 | Ga0495652_0046041 | 3300046529 | Bacteria | 3746 |
| 983 | Ga0495652_0118894 | 3300046529 | Bacteria | 2111 |
| 984 | Ga0495652_0255980 | 3300046529 | Bacteria | 1295 |
| 985 | Ga0495654_0003511 | 3300046530 | Bacteria | 9574 |
| 986 | Ga0495665_0009815 | 3300046531 | Bacteria | 5182 |
| 987 | Ga0495665_0018587 | 3300046531 | Bacteria | 3734 |
| 988 | Ga0495665_0022210 | 3300046531 | Bacteria | 3412 |
| 989 | Ga0495640_0000016 | 3300046533 | Bacteria | 144076 |
| 990 | Ga0495640_0003068 | 3300046533 | Bacteria | 13447 |
| 991 | Ga0495640_0003848 | 3300046533 | Bacteria | 12041 |
| 992 | Ga0495640_0012588 | 3300046533 | Bacteria | 6458 |
| 993 | Ga0495640_0042809 | 3300046533 | Bacteria | 3157 |
| 994 | Ga0495640_0044226 | 3300046533 | Bacteria | 3097 |
| 995 | Ga0495640_0064334 | 3300046533 | Bacteria | 2480 |
| 996 | Ga0495586_0023543 | 3300046535 | Bacteria | 3290 |
| 997 | Ga0495587_0000018 | 3300046536 | Bacteria | 166488 |
| 998 | Ga0495587_0000894 | 3300046536 | Bacteria | 19740 |
| 999 | Ga0495587_0001375 | 3300046536 | Bacteria | 16171 |
| 1000 | Ga0495587_0020330 | 3300046536 | Bacteria | 4099 |
| 1001 | Ga0495587_0076549 | 3300046536 | Bacteria | 1943 |
| 1002 | Ga0495598_0000140 | 3300046537 | Bacteria | 12324 |
| 1003 | Ga0495609_0067124 | 3300046538 | Bacteria | 1580 |
| 1004 | Ga0495621_0014113 | 3300046539 | Bacteria | 2523 |
| 1005 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 1006 | Ga0495645_0000368 | 3300046543 | Bacteria | 31407 |
| 1007 | Ga0495622_0000475 | 3300046557 | Bacteria | 25362 |
| 1008 | Ga0495622_0042530 | 3300046557 | Bacteria | 2112 |
| 1009 | Ga0495622_0177991 | 3300046557 | Bacteria | 954 |
| 1010 | Ga0495633_0002619 | 3300046558 | Bacteria | 12591 |
| 1011 | Ga0495633_0057612 | 3300046558 | Bacteria | 1825 |
| 1012 | Ga0495667_0000348 | 3300046559 | Bacteria | 29268 |
| 1013 | Ga0495667_0000924 | 3300046559 | Bacteria | 18995 |
| 1014 | Ga0495667_0003684 | 3300046559 | Bacteria | 10313 |
| 1015 | Ga0495667_0012454 | 3300046559 | Bacteria | 5767 |
| 1016 | Ga0495667_0058752 | 3300046559 | Bacteria | 2525 |
| 1017 | Ga0495667_0087941 | 3300046559 | Bacteria | 2014 |
| 1018 | Ga0495656_0003815 | 3300046615 | Bacteria | 5124 |
| 1019 | Ga0495656_0034213 | 3300046615 | Bacteria | 2079 |
| 1020 | Ga0495656_0083205 | 3300046615 | Bacteria | 1449 |
| 1021 | Ga0495634_0002858 | 3300046642 | Bacteria | 14172 |
| 1022 | Ga0495634_0022289 | 3300046642 | Bacteria | 4463 |
| 1023 | Ga0495634_0070470 | 3300046642 | Bacteria | 2304 |
| 1024 | Ga0495634_0157692 | 3300046642 | Bacteria | 1432 |
| 1025 | Ga0495611_0017687 | 3300046648 | Bacteria | 3052 |
| 1026 | Ga0495635_0000025 | 3300046663 | Bacteria | 144645 |
| 1027 | Ga0495635_0006673 | 3300046663 | Bacteria | 8060 |
| 1028 | Ga0495635_0027534 | 3300046663 | Bacteria | 3953 |
| 1029 | Ga0495635_0041863 | 3300046663 | Bacteria | 3164 |
| 1030 | Ga0495635_0065217 | 3300046663 | Bacteria | 2499 |
| 1031 | Ga0495635_0079906 | 3300046663 | Bacteria | 2238 |
| 1032 | Ga0495635_0095517 | 3300046663 | Bacteria | 2032 |
| 1033 | Ga0495635_0099769 | 3300046663 | Bacteria | 1984 |
| 1034 | Ga0495659_0019320 | 3300046664 | Bacteria | 2280 |
| 1035 | Ga0495659_0034592 | 3300046664 | Bacteria | 1777 |
| 1036 | Ga0495661_0000231 | 3300046665 | Bacteria | 64275 |
| 1037 | Ga0495661_0018462 | 3300046665 | Bacteria | 4586 |
| 1038 | Ga0495661_0080871 | 3300046665 | Bacteria | 1874 |
| 1039 | Ga0495588_0036586 | 3300046674 | Bacteria | 2491 |
| 1040 | Ga0495657_0000702 | 3300046675 | Bacteria | 30077 |
| 1041 | Ga0495657_0004204 | 3300046675 | Bacteria | 11525 |
| 1042 | Ga0495657_0024030 | 3300046675 | Bacteria | 4345 |
| 1043 | Ga0495657_0032715 | 3300046675 | Bacteria | 3627 |
| 1044 | Ga0495657_0162450 | 3300046675 | Bacteria | 1381 |
| 1045 | Ga0495657_0167661 | 3300046675 | Bacteria | 1354 |
| 1046 | Ga0495599_0000067 | 3300046678 | Bacteria | 72171 |
| 1047 | Ga0495599_0003519 | 3300046678 | Bacteria | 9173 |
| 1048 | Ga0495599_0004649 | 3300046678 | Bacteria | 8140 |
| 1049 | Ga0495599_0007202 | 3300046678 | Bacteria | 6738 |
| 1050 | Ga0495623_0003596 | 3300046679 | Bacteria | 10253 |
| 1051 | Ga0495623_0004477 | 3300046679 | Bacteria | 9179 |
| 1052 | Ga0495623_0007246 | 3300046679 | Bacteria | 7198 |
| 1053 | Ga0495646_0000056 | 3300046680 | Bacteria | 57248 |
| 1054 | Ga0495646_0003759 | 3300046680 | Bacteria | 9488 |
| 1055 | Ga0495646_0005604 | 3300046680 | Bacteria | 7944 |
| 1056 | Ga0495646_0032527 | 3300046680 | Bacteria | 3246 |
| 1057 | Ga0495646_0098444 | 3300046680 | Bacteria | 1680 |
| 1058 | Ga0495647_0009175 | 3300046681 | Bacteria | 3342 |
| 1059 | Ga0495647_0014464 | 3300046681 | Bacteria | 2750 |
| 1060 | Ga0495647_0070924 | 3300046681 | Bacteria | 1394 |
| 1061 | Ga0495647_0081062 | 3300046681 | Bacteria | 1316 |
| 1062 | Ga0495658_0000926 | 3300046683 | Bacteria | 15656 |
| 1063 | Ga0495658_0019706 | 3300046683 | Bacteria | 3525 |
| 1064 | Ga0495658_0023629 | 3300046683 | Bacteria | 3265 |
| 1065 | Ga0495658_0060775 | 3300046683 | Bacteria | 2168 |
| 1066 | Ga0495669_0096300 | 3300046684 | Bacteria | 1371 |
| 1067 | Ga0495613_0008018 | 3300046689 | Bacteria | 7856 |
| 1068 | Ga0495613_0013064 | 3300046689 | Bacteria | 6171 |
| 1069 | Ga0495613_0059072 | 3300046689 | Bacteria | 2812 |
| 1070 | Ga0495613_0109731 | 3300046689 | Bacteria | 1989 |
| 1071 | Ga0495613_0133870 | 3300046689 | Bacteria | 1774 |
| 1072 | Ga0495624_0003694 | 3300046690 | Bacteria | 11307 |
| 1073 | Ga0495624_0046492 | 3300046690 | Bacteria | 2759 |
| 1074 | Ga0495624_0060680 | 3300046690 | Bacteria | 2370 |
| 1075 | Ga0495624_0142085 | 3300046690 | Bacteria | 1470 |
| 1076 | Ga0495624_0219090 | 3300046690 | Bacteria | 1154 |
| 1077 | Ga0495624_0249052 | 3300046690 | Bacteria | 1074 |
| 1078 | Ga0495670_0006044 | 3300046691 | Bacteria | 5932 |
| 1079 | Ga0495670_0024717 | 3300046691 | Bacteria | 2970 |
| 1080 | Ga0495670_0100383 | 3300046691 | Bacteria | 1490 |
| 1081 | Ga0495670_0263001 | 3300046691 | Bacteria | 921 |
| 1082 | Ga0495671_0022458 | 3300046692 | Bacteria | 3306 |
| 1083 | Ga0495649_0002592 | 3300046694 | Bacteria | 12636 |
| 1084 | Ga0495649_0112213 | 3300046694 | Bacteria | 1445 |
| 1085 | Ga0495589_0008275 | 3300046794 | Bacteria | 5431 |
| 1086 | Ga0495600_0000009 | 3300046809 | Bacteria | 143981 |
| 1087 | Ga0495600_0024963 | 3300046809 | Bacteria | 3850 |
| 1088 | Ga0495600_0037632 | 3300046809 | Bacteria | 3146 |
| 1089 | Ga0495581_0014737 | 3300047315 | Bacteria | 4535 |
| 1090 | Ga0495581_0032334 | 3300047315 | Bacteria | 3030 |
| 1091 | Ga0495581_0052618 | 3300047315 | Bacteria | 2352 |
| 1092 | Ga0495581_0062029 | 3300047315 | Bacteria | 2160 |
| 1093 | Ga0495581_0092986 | 3300047315 | Bacteria | 1750 |
| 1094 | Ga0495581_0125439 | 3300047315 | Bacteria | 1495 |
| 1095 | Ga0495604_0000026 | 3300047317 | Bacteria | 143987 |
| 1096 | Ga0495604_0000241 | 3300047317 | Bacteria | 48922 |
| 1097 | Ga0495604_0002437 | 3300047317 | Bacteria | 14887 |
| 1098 | Ga0495604_0003490 | 3300047317 | Bacteria | 12534 |
| 1099 | Ga0495604_0009438 | 3300047317 | Bacteria | 7715 |
| 1100 | Ga0495604_0020497 | 3300047317 | Bacteria | 5281 |
| 1101 | Ga0495604_0274315 | 3300047317 | Bacteria | 1141 |
| 1102 | Ga0495674_0000954 | 3300047319 | Bacteria | 27631 |
| 1103 | Ga0495674_0005968 | 3300047319 | Bacteria | 11686 |
| 1104 | Ga0495674_0035711 | 3300047319 | Bacteria | 4481 |
| 1105 | Ga0495674_0092322 | 3300047319 | Bacteria | 2584 |
| 1106 | Ga0495674_0099261 | 3300047319 | Bacteria | 2479 |
| 1107 | Ga0495674_0100361 | 3300047319 | Bacteria | 2463 |
| 1108 | Ga0495672_0000750 | 3300047320 | Bacteria | 35506 |
| 1109 | Ga0495676_0015354 | 3300047321 | Bacteria | 6823 |
| 1110 | Ga0495676_0048928 | 3300047321 | Bacteria | 3404 |
| 1111 | Ga0495680_0001881 | 3300047322 | Bacteria | 22066 |
| 1112 | Ga0495680_0004941 | 3300047322 | Bacteria | 12619 |
| 1113 | Ga0495680_0005395 | 3300047322 | Bacteria | 12049 |
| 1114 | Ga0495680_0007514 | 3300047322 | Bacteria | 9981 |
| 1115 | Ga0495680_0011972 | 3300047322 | Bacteria | 7656 |
| 1116 | Ga0495680_0013738 | 3300047322 | Bacteria | 7048 |
| 1117 | Ga0495680_0019796 | 3300047322 | Bacteria | 5675 |
| 1118 | Ga0495680_0070395 | 3300047322 | Bacteria | 2667 |
| 1119 | Ga0495680_0092948 | 3300047322 | Bacteria | 2258 |
| 1120 | Ga0495680_0162010 | 3300047322 | Bacteria | 1624 |
| 1121 | Ga0495675_0000179 | 3300047444 | Bacteria | 46398 |
| 1122 | Ga0495675_0012831 | 3300047444 | Bacteria | 5280 |
| 1123 | Ga0495675_0054320 | 3300047444 | Bacteria | 2542 |
| 1124 | Ga0495675_0073000 | 3300047444 | Bacteria | 2164 |
| 1125 | Ga0495673_0000406 | 3300047469 | Bacteria | 50318 |
| 1126 | Ga0495681_0011965 | 3300047470 | Bacteria | 5125 |
| 1127 | Ga0495684_0000018 | 3300047471 | Bacteria | 156009 |
| 1128 | Ga0495684_0002950 | 3300047471 | Bacteria | 13397 |
| 1129 | Ga0495684_0029433 | 3300047471 | Bacteria | 4215 |
| 1130 | Ga0495684_0046727 | 3300047471 | Bacteria | 3311 |
| 1131 | Ga0495684_0112208 | 3300047471 | Bacteria | 2056 |
| 1132 | Ga0495684_0164958 | 3300047471 | Bacteria | 1650 |
| 1133 | Ga0495593_0003105 | 3300047673 | Bacteria | 9995 |
| 1134 | Ga0495593_0004853 | 3300047673 | Bacteria | 7982 |
| 1135 | Ga0495593_0021597 | 3300047673 | Bacteria | 3593 |
| 1136 | Ga0495593_0039403 | 3300047673 | Bacteria | 2548 |
| 1137 | Ga0495602_0000023 | 3300048088 | Bacteria | 154845 |
| 1138 | Ga0495602_0000791 | 3300048088 | Bacteria | 30188 |
| 1139 | Ga0495602_0010363 | 3300048088 | Bacteria | 9675 |
| 1140 | Ga0495602_0011377 | 3300048088 | Bacteria | 9202 |
| 1141 | Ga0495602_0063552 | 3300048088 | Bacteria | 3198 |
| 1142 | Ga0495602_0097997 | 3300048088 | Bacteria | 2414 |
| 1143 | Ga0495602_0213136 | 3300048088 | Bacteria | 1464 |
| 1144 | Ga0495614_0026477 | 3300048089 | Bacteria | 2499 |
| 1145 | Ga0495614_0056694 | 3300048089 | Bacteria | 1682 |
| 1146 | Ga0495626_0104847 | 3300048091 | Bacteria | 1229 |
| 1147 | Ga0496100_0002357 | 3300048903 | Bacteria | 9558 |
| 1148 | Ga0496100_0002901 | 3300048903 | Bacteria | 8800 |
| 1149 | Ga0496100_0038159 | 3300048903 | Bacteria | 3042 |
| 1150 | Ga0496100_0065497 | 3300048903 | Bacteria | 2407 |
| 1151 | Ga0496100_0100815 | 3300048903 | Bacteria | 1990 |
| 1152 | Ga0496101_0004241 | 3300048904 | Bacteria | 8992 |
| 1153 | Ga0496101_0007358 | 3300048904 | Bacteria | 7129 |
| 1154 | Ga0496101_0011622 | 3300048904 | Bacteria | 5847 |
| 1155 | Ga0496101_0030972 | 3300048904 | Bacteria | 3756 |
| 1156 | Ga0496101_0031420 | 3300048904 | Bacteria | 3733 |
| 1157 | Ga0496101_0161055 | 3300048904 | Bacteria | 1721 |
| 1158 | Ga0496101_0374729 | 3300048904 | Bacteria | 1119 |
| 1159 | Ga0496102_0001843 | 3300048905 | Bacteria | 18300 |
| 1160 | Ga0496102_0013181 | 3300048905 | Bacteria | 7152 |
| 1161 | Ga0496102_0027651 | 3300048905 | Bacteria | 5065 |
| 1162 | Ga0496102_0077525 | 3300048905 | Bacteria | 3058 |
| 1163 | Ga0496102_0094781 | 3300048905 | Bacteria | 2766 |
| 1164 | Ga0496102_0117444 | 3300048905 | Bacteria | 2482 |
| 1165 | Ga0496102_0317585 | 3300048905 | Bacteria | 1467 |
| 1166 | Ga0496102_0335643 | 3300048905 | Bacteria | 1423 |
| 1167 | Ga0496103_0029906 | 3300048906 | Bacteria | 3312 |
| 1168 | Ga0496103_0040359 | 3300048906 | Bacteria | 2867 |
| 1169 | Ga0496103_0041708 | 3300048906 | Bacteria | 2822 |
| 1170 | Ga0496103_0045935 | 3300048906 | Bacteria | 2695 |
| 1171 | Ga0496103_0133260 | 3300048906 | Bacteria | 1587 |
| 1172 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 1173 | Ga0496104_0001905 | 3300048907 | Bacteria | 18076 |
| 1174 | Ga0496104_0002630 | 3300048907 | Bacteria | 15448 |
| 1175 | Ga0496104_0006160 | 3300048907 | Bacteria | 10529 |
| 1176 | Ga0496104_0012919 | 3300048907 | Bacteria | 7520 |
| 1177 | Ga0496104_0027928 | 3300048907 | Bacteria | 5225 |
| 1178 | Ga0496104_0069961 | 3300048907 | Bacteria | 3336 |
| 1179 | Ga0496104_0373441 | 3300048907 | Bacteria | 1338 |
| 1180 | Ga0496105_0000530 | 3300048908 | Bacteria | 25203 |
| 1181 | Ga0496105_0002467 | 3300048908 | Bacteria | 13391 |
| 1182 | Ga0496105_0002813 | 3300048908 | Bacteria | 12720 |
| 1183 | Ga0496105_0008513 | 3300048908 | Bacteria | 7969 |
| 1184 | Ga0496105_0022754 | 3300048908 | Bacteria | 5078 |
| 1185 | Ga0496105_0025339 | 3300048908 | Bacteria | 4828 |
| 1186 | Ga0496105_0043540 | 3300048908 | Bacteria | 3702 |
| 1187 | Ga0496105_0058791 | 3300048908 | Bacteria | 3173 |
| 1188 | Ga0496105_0490315 | 3300048908 | Bacteria | 966 |
| 1189 | Ga0496106_0001336 | 3300048909 | Bacteria | 18483 |
| 1190 | Ga0496106_0006847 | 3300048909 | Bacteria | 8437 |
| 1191 | Ga0496106_0009949 | 3300048909 | Bacteria | 7019 |
| 1192 | Ga0496106_0042090 | 3300048909 | Bacteria | 3424 |
| 1193 | Ga0496106_0045658 | 3300048909 | Bacteria | 3291 |
| 1194 | Ga0496106_0052632 | 3300048909 | Bacteria | 3072 |
| 1195 | Ga0496106_0054048 | 3300048909 | Bacteria | 3034 |
| 1196 | Ga0496106_0055401 | 3300048909 | Bacteria | 2997 |
| 1197 | Ga0496106_0060581 | 3300048909 | Bacteria | 2869 |
| 1198 | Ga0496106_0116699 | 3300048909 | Bacteria | 2082 |
| 1199 | Ga0496106_0228273 | 3300048909 | Bacteria | 1486 |
| 1200 | Ga0496106_0496535 | 3300048909 | Bacteria | 980 |
| 1201 | Ga0496107_0015297 | 3300048910 | Bacteria | 5377 |
| 1202 | Ga0496107_0043258 | 3300048910 | Bacteria | 3235 |
| 1203 | Ga0496107_0051543 | 3300048910 | Bacteria | 2968 |
| 1204 | Ga0496107_0086624 | 3300048910 | Bacteria | 2286 |
| 1205 | Ga0496107_0098319 | 3300048910 | Bacteria | 2143 |
| 1206 | Ga0496107_0125467 | 3300048910 | Bacteria | 1893 |
| 1207 | Ga0496107_0339822 | 3300048910 | Bacteria | 1117 |
| 1208 | Ga0496108_0001786 | 3300048911 | Bacteria | 17140 |
| 1209 | Ga0496108_0028823 | 3300048911 | Bacteria | 4594 |
| 1210 | Ga0496108_0059566 | 3300048911 | Bacteria | 3210 |
| 1211 | Ga0496108_0073397 | 3300048911 | Bacteria | 2888 |
| 1212 | Ga0496108_0115032 | 3300048911 | Bacteria | 2303 |
| 1213 | Ga0496108_0218541 | 3300048911 | Bacteria | 1655 |
| 1214 | Ga0496108_0599670 | 3300048911 | Bacteria | 960 |
| 1215 | Ga0496109_0001112 | 3300048912 | Bacteria | 22310 |
| 1216 | Ga0496109_0007518 | 3300048912 | Bacteria | 9230 |
| 1217 | Ga0496109_0024548 | 3300048912 | Bacteria | 5360 |
| 1218 | Ga0496109_0027034 | 3300048912 | Bacteria | 5120 |
| 1219 | Ga0496109_0035792 | 3300048912 | Bacteria | 4481 |
| 1220 | Ga0496109_0173154 | 3300048912 | Bacteria | 2025 |
| 1221 | Ga0496110_0001899 | 3300048913 | Bacteria | 15448 |
| 1222 | Ga0496110_0019661 | 3300048913 | Bacteria | 5688 |
| 1223 | Ga0496110_0027305 | 3300048913 | Bacteria | 4892 |
| 1224 | Ga0496110_0060404 | 3300048913 | Bacteria | 3343 |
| 1225 | Ga0496110_0087494 | 3300048913 | Bacteria | 2782 |
| 1226 | Ga0496110_0209339 | 3300048913 | Bacteria | 1773 |
| 1227 | Ga0496110_0234620 | 3300048913 | Bacteria | 1669 |
| 1228 | Ga0496111_0001319 | 3300048914 | Bacteria | 13938 |
| 1229 | Ga0496111_0007712 | 3300048914 | Bacteria | 7079 |
| 1230 | Ga0496111_0023200 | 3300048914 | Bacteria | 4354 |
| 1231 | Ga0496111_0032913 | 3300048914 | Bacteria | 3696 |
| 1232 | Ga0496112_0002554 | 3300048915 | Bacteria | 14703 |
| 1233 | Ga0496112_0035383 | 3300048915 | Bacteria | 4864 |
| 1234 | Ga0496112_0100582 | 3300048915 | Bacteria | 2860 |
| 1235 | Ga0496112_0125243 | 3300048915 | Bacteria | 2540 |
| 1236 | Ga0496112_0174239 | 3300048915 | Bacteria | 2116 |
| 1237 | Ga0496112_0257302 | 3300048915 | Bacteria | 1696 |
| 1238 | Ga0496113_0000266 | 3300048916 | Bacteria | 24721 |
| 1239 | Ga0496113_0047744 | 3300048916 | Bacteria | 3182 |
| 1240 | Ga0496113_0049923 | 3300048916 | Bacteria | 3117 |
| 1241 | Ga0496113_0148203 | 3300048916 | Bacteria | 1850 |
| 1242 | Ga0496113_0259366 | 3300048916 | Bacteria | 1388 |
| 1243 | Ga0496114_0006728 | 3300048917 | Bacteria | 9057 |
| 1244 | Ga0496114_0009408 | 3300048917 | Bacteria | 7759 |
| 1245 | Ga0496114_0018598 | 3300048917 | Bacteria | 5621 |
| 1246 | Ga0496114_0071933 | 3300048917 | Bacteria | 2907 |
| 1247 | Ga0496114_0105351 | 3300048917 | Bacteria | 2412 |
| 1248 | Ga0496114_0596528 | 3300048917 | Bacteria | 974 |
| 1249 | Ga0496115_0001664 | 3300048918 | Bacteria | 15989 |
| 1250 | Ga0496115_0010192 | 3300048918 | Bacteria | 7013 |
| 1251 | Ga0496115_0014231 | 3300048918 | Bacteria | 6021 |
| 1252 | Ga0496115_0022658 | 3300048918 | Bacteria | 4869 |
| 1253 | Ga0496115_0038237 | 3300048918 | Bacteria | 3807 |
| 1254 | Ga0496115_0057353 | 3300048918 | Bacteria | 3132 |
| 1255 | Ga0496115_0151144 | 3300048918 | Bacteria | 1917 |
| 1256 | Ga0496115_0257633 | 3300048918 | Bacteria | 1435 |
| 1257 | Ga0496117_0023535 | 3300048920 | Bacteria | 4903 |
| 1258 | Ga0496118_0005352 | 3300048921 | Bacteria | 14617 |
| 1259 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 1260 | Ga0496124_0000962 | 3300048927 | Bacteria | 45849 |
| 1261 | Ga0496125_0020074 | 3300048928 | Bacteria | 6283 |
| 1262 | Ga0496126_0007633 | 3300048929 | Bacteria | 11805 |
| 1263 | Ga0495678_007784 | 3300049459 | Bacteria | 5516 |
| 1264 | Ga0495682_0000184 | 3300049460 | Bacteria | 51305 |
| 1265 | Ga0501031_0036593 | 3300049568 | Bacteria | 3201 |
| 1266 | Ga0501031_0276199 | 3300049568 | Bacteria | 1090 |
| 1267 | Ga0501032_0038017 | 3300049569 | Bacteria | 3279 |
| 1268 | Ga0501033_0029459 | 3300049570 | Bacteria | 4125 |
| 1269 | Ga0501033_0240944 | 3300049570 | Bacteria | 1283 |
| 1270 | Ga0501034_0083115 | 3300049571 | Bacteria | 3203 |
| 1271 | Ga0501034_0097739 | 3300049571 | Bacteria | 2932 |
| 1272 | Ga0501034_0210195 | 3300049571 | Bacteria | 1901 |
| 1273 | Ga0501034_0604941 | 3300049571 | Bacteria | 1001 |
| 1274 | Ga0501036_0048929 | 3300049572 | Bacteria | 3579 |
| 1275 | Ga0501037_0114155 | 3300049573 | Bacteria | 1944 |
| 1276 | Ga0501037_0460972 | 3300049573 | Bacteria | 866 |
| 1277 | Ga0501038_0011243 | 3300049574 | Bacteria | 8172 |
| 1278 | Ga0501038_0138225 | 3300049574 | Bacteria | 1995 |
| 1279 | Ga0501039_0051384 | 3300049575 | Bacteria | 3190 |
| 1280 | Ga0501039_0179674 | 3300049575 | Bacteria | 1664 |
| 1281 | Ga0501039_0492418 | 3300049575 | Bacteria | 963 |
| 1282 | Ga0501040_0064199 | 3300049576 | Bacteria | 2528 |
| 1283 | Ga0501043_0324730 | 3300049579 | Bacteria | 1173 |
| 1284 | Ga0501047_0015958 | 3300049581 | Bacteria | 7162 |
| 1285 | Ga0501047_0061436 | 3300049581 | Bacteria | 3625 |
| 1286 | Ga0501047_0189861 | 3300049581 | Bacteria | 1918 |
| 1287 | Ga0501047_0252931 | 3300049581 | Bacteria | 1610 |
| 1288 | Ga0501047_0656100 | 3300049581 | Bacteria | 868 |
| 1289 | Ga0501048_0192887 | 3300049582 | Bacteria | 1444 |
| 1290 | Ga0501070_0136061 | 3300049586 | Bacteria | 2029 |
| 1291 | Ga0501070_0203298 | 3300049586 | Bacteria | 1626 |
| 1292 | Ga0501070_0255385 | 3300049586 | Bacteria | 1433 |
| 1293 | Ga0501070_0279103 | 3300049586 | Bacteria | 1363 |
| 1294 | Ga0501073_0145691 | 3300049589 | Bacteria | 1641 |
| 1295 | Ga0501073_0230532 | 3300049589 | Bacteria | 1279 |
| 1296 | Ga0501076_0156076 | 3300049592 | Bacteria | 1858 |
| 1297 | Ga0501076_0331141 | 3300049592 | Bacteria | 1249 |
| 1298 | Ga0501076_0541743 | 3300049592 | Bacteria | 960 |
| 1299 | Ga0501079_0027171 | 3300049741 | Bacteria | 4387 |
| 1300 | Ga0501079_0408836 | 3300049741 | Bacteria | 1065 |
| 1301 | Ga0501079_0432103 | 3300049741 | Bacteria | 1034 |
| 1302 | Ga0501080_0304823 | 3300049742 | Bacteria | 1444 |
| 1303 | Ga0501080_0363950 | 3300049742 | Bacteria | 1305 |
| 1304 | Ga0501080_0470144 | 3300049742 | Bacteria | 1126 |
| 1305 | Ga0501081_0207592 | 3300049743 | Bacteria | 1422 |
| 1306 | Ga0501083_0033131 | 3300049744 | Bacteria | 3539 |
| 1307 | Ga0501035_0035025 | 3300049822 | Bacteria | 4560 |
| 1308 | Ga0501035_0287387 | 3300049822 | Bacteria | 1388 |
| 1309 | Ga0501044_0079159 | 3300049823 | Bacteria | 3330 |
| 1310 | Ga0501044_0202501 | 3300049823 | Bacteria | 1943 |
| 1311 | nmdc:mga03n38_251421_c1 | 3300050490 | Bacteria | 934 |
| 1312 | nmdc:mga03n38_84057_c1 | 3300050490 | Unclassified | 1502 |
| 1313 | nmdc:mga0yw44_204314_c1 | 3300050492 | Bacteria | 1306 |
| 1314 | nmdc:mga0yw44_20898_c1 | 3300050492 | Bacteria | 3643 |
| 1315 | nmdc:mga0yw44_78314_c1 | 3300050492 | Bacteria | 2067 |
| 1316 | nmdc:mga06z11_51893_c1 | 3300050494 | Bacteria | 2101 |
| 1317 | nmdc:mga07m45_24160_c1 | 3300050496 | Bacteria | 3327 |
| 1318 | nmdc:mga05p37_115441_c1 | 3300050507 | Bacteria | 3301 |
| 1319 | nmdc:mga05p37_129_c1 | 3300050507 | Bacteria | 45745 |
| 1320 | nmdc:mga05p37_17690_c2 | 3300050507 | Bacteria | 2205 |
| 1321 | nmdc:mga05p37_7502_c1 | 3300050507 | Bacteria | 12858 |
| 1322 | nmdc:mga09592_4064_c1 | 3300050508 | Bacteria | 11820 |
| 1323 | nmdc:mga0qj67_182398_c1 | 3300050509 | Bacteria | 1705 |
| 1324 | nmdc:mga0qj67_236874_c1 | 3300050509 | Bacteria | 1481 |
| 1325 | nmdc:mga0qj67_624_c1 | 3300050509 | Bacteria | 24282 |
| 1326 | nmdc:mga0qj67_77805_c1 | 3300050509 | Bacteria | 2654 |
| 1327 | nmdc:mga06r32_171250_c1 | 3300050510 | Bacteria | 2155 |
| 1328 | nmdc:mga06r32_21650_c1 | 3300050510 | Bacteria | 3452 |
| 1329 | nmdc:mga06r32_274962_c1 | 3300050510 | Bacteria | 1672 |
| 1330 | nmdc:mga06r32_637973_c1 | 3300050510 | Bacteria | 1034 |
| 1331 | nmdc:mga06r32_75867_c1 | 3300050510 | Bacteria | 3264 |
| 1332 | nmdc:mga06r32_8962_c1 | 3300050510 | Bacteria | 9013 |
| 1333 | nmdc:mga08y16_1130_c1 | 3300050511 | Bacteria | 26261 |
| 1334 | nmdc:mga08y16_200225_c1 | 3300050511 | Bacteria | 2069 |
| 1335 | nmdc:mga08y16_220757_c1 | 3300050511 | Bacteria | 1962 |
| 1336 | nmdc:mga08y16_23508_c1 | 3300050511 | Bacteria | 6512 |
| 1337 | nmdc:mga08y16_500794_c1 | 3300050511 | Bacteria | 1234 |
| 1338 | nmdc:mga08y16_66580_c1 | 3300050511 | Bacteria | 3759 |
| 1339 | nmdc:mga08y16_691_c1 | 3300050511 | Bacteria | 32023 |
| 1340 | nmdc:mga0n895_108190_c1 | 3300050512 | Bacteria | 2794 |
| 1341 | nmdc:mga0n895_207_c1 | 3300050512 | Bacteria | 36776 |
| 1342 | nmdc:mga0n895_215801_c1 | 3300050512 | Bacteria | 1948 |
| 1343 | nmdc:mga0n895_248829_c1 | 3300050512 | Bacteria | 1804 |
| 1344 | nmdc:mga0n895_2552_c1 | 3300050512 | Bacteria | 14270 |
| 1345 | nmdc:mga0n895_36354_c1 | 3300050512 | Bacteria | 4755 |
| 1346 | nmdc:mga0n895_439473_c1 | 3300050512 | Bacteria | 1318 |
| 1347 | nmdc:mga0n895_551320_c1 | 3300050512 | Bacteria | 1159 |
| 1348 | nmdc:mga0n895_7901_c1 | 3300050512 | Bacteria | 9171 |
| 1349 | nmdc:mga0n895_96549_c1 | 3300050512 | Bacteria | 2961 |
| 1350 | nmdc:mga0rr50_1238_c1 | 3300050513 | Bacteria | 13930 |
| 1351 | nmdc:mga0rr50_263989_c1 | 3300050513 | Unclassified | 1433 |
| 1352 | nmdc:mga0rr50_90868_c1 | 3300050513 | Bacteria | 2377 |
| 1353 | nmdc:mga08x19_173208_c1 | 3300050514 | Bacteria | 1470 |
| 1354 | nmdc:mga08x19_74333_c1 | 3300050514 | Bacteria | 2220 |
| 1355 | nmdc:mga0a205_1327_c1 | 3300050515 | Bacteria | 20880 |
| 1356 | nmdc:mga0a205_160128_c1 | 3300050515 | Bacteria | 2148 |
| 1357 | nmdc:mga0a205_16175_c1 | 3300050515 | Bacteria | 6624 |
| 1358 | nmdc:mga0a205_169439_c1 | 3300050515 | Bacteria | 2079 |
| 1359 | nmdc:mga0a205_280102_c1 | 3300050515 | Bacteria | 1543 |
| 1360 | nmdc:mga0a205_74423_c1 | 3300050515 | Bacteria | 3282 |
| 1361 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 1362 | Ga0495601_0000152 | 3300053077 | Bacteria | 38651 |
| 1363 | Ga0495601_0002459 | 3300053077 | Bacteria | 10526 |
| 1364 | Ga0495601_0014626 | 3300053077 | Bacteria | 4730 |
| 1365 | Ga0495601_0035572 | 3300053077 | Bacteria | 3110 |
| 1366 | Ga0495601_0044469 | 3300053077 | Bacteria | 2791 |
| 1367 | Ga0495601_0360140 | 3300053077 | Bacteria | 945 |
| 1368 | Ga0495612_0000109 | 3300053078 | Bacteria | 34803 |
| 1369 | Ga0495612_0000244 | 3300053078 | Bacteria | 22545 |
| 1370 | Ga0495612_0000428 | 3300053078 | Bacteria | 16790 |
| 1371 | Ga0495612_0014095 | 3300053078 | Bacteria | 3218 |
| 1372 | Ga0495612_0150218 | 3300053078 | Bacteria | 1013 |
| 1373 | Ga0495655_0005486 | 3300053083 | Bacteria | 2243 |
| 1374 | Ga0495595_0000056 | 3300053084 | Bacteria | 58198 |
| 1375 | Ga0495595_0000474 | 3300053084 | Bacteria | 15271 |
| 1376 | Ga0495595_0000594 | 3300053084 | Bacteria | 13801 |
| 1377 | Ga0495595_0004440 | 3300053084 | Bacteria | 5646 |
| 1378 | Ga0495595_0006954 | 3300053084 | Bacteria | 4619 |
| 1379 | Ga0495595_0010934 | 3300053084 | Bacteria | 3787 |
| 1380 | Ga0495619_0000112 | 3300053085 | Bacteria | 61241 |
| 1381 | Ga0495619_0000115 | 3300053085 | Bacteria | 58866 |
| 1382 | Ga0495619_0000544 | 3300053085 | Bacteria | 24920 |
| 1383 | Ga0495619_0001076 | 3300053085 | Bacteria | 17916 |
| 1384 | Ga0495619_0001854 | 3300053085 | Bacteria | 14074 |
| 1385 | Ga0495619_0002853 | 3300053085 | Bacteria | 11252 |
| 1386 | Ga0495619_0002886 | 3300053085 | Bacteria | 11167 |
| 1387 | Ga0495619_0030456 | 3300053085 | Bacteria | 3494 |
| 1388 | Ga0495619_0093984 | 3300053085 | Bacteria | 2033 |
| 1389 | Ga0495619_0153328 | 3300053085 | Bacteria | 1589 |
| 1390 | Ga0500651_0007140 | 3300053093 | Bacteria | 6499 |
| 1391 | Ga0500651_0172389 | 3300053093 | Bacteria | 1289 |
| 1392 | Ga0500566_0056733 | 3300053094 | Bacteria | 2226 |
| 1393 | Ga0500641_0033235 | 3300053096 | Bacteria | 2046 |
| 1394 | Ga0500595_006831 | 3300053119 | Bacteria | 4803 |
| 1395 | Ga0500595_020963 | 3300053119 | Bacteria | 2341 |
| 1396 | Ga0500608_012444 | 3300053122 | Bacteria | 3732 |
| 1397 | Ga0500618_007629 | 3300053125 | Bacteria | 3070 |
| 1398 | Ga0500559_0118551 | 3300053136 | Bacteria | 1230 |
| 1399 | Ga0500604_0049470 | 3300053151 | Bacteria | 1293 |
| 1400 | Ga0500639_054919 | 3300053163 | Bacteria | 2067 |
| 1401 | Ga0500639_078936 | 3300053163 | Bacteria | 1662 |
| 1402 | Ga0500636_0008287 | 3300053177 | Bacteria | 6030 |
| 1403 | Ga0501084_0142406 | 3300054114 | Bacteria | 2019 |
| 1404 | Ga0501082_0159702 | 3300060353 | Bacteria | 1959 |
| 1405 | Ga0501082_0238356 | 3300060353 | Bacteria | 1583 |
| 1406 | Ga0501082_0414723 | 3300060353 | Bacteria | 1176 |
| 1407 | Ga0530510_0104738 | 3300061734 | Bacteria | 2070 |
| 1408 | Ga0530510_0345010 | 3300061734 | Bacteria | 1118 |
| 1409 | 2889919772 | 2889914905 | Bacteria | 5702301 |
| 1410 | 2922387780 | 2922386360 | Bacteria | 7017218 |
| 1411 | 3003935883 | 3003930520 | Bacteria | 5667563 |
| 1412 | Ga0466962_0131908 | |||
| 1413 | 2214544921 | |||
| 1414 | ARcpr5oldR_c000060 | |||
| 1415 | ARSoilYngRDRAFT_c00026 | |||
| 1416 | ARcpr5yngRDRAFT_c000062 | |||
| 1417 | ARSoilOldRDRAFT_c000014 | |||
| 1418 | ARCol0oldRDRAFT_c00135 | |||
| 1419 | ARCol0yngRDRAFT_1000075 | |||
| 1420 | JGI24739J22299_10001621 | |||
| 1421 | JGI24737J22298_10002215 | |||
| 1422 | JGI24737J22298_10003103 | |||
| 1423 | JGI24743J22301_10005752 | |||
| 1424 | JGI24750J21931_1000414 | |||
| 1425 | JGI24748J21848_1012436 | |||
| 1426 | JGI24744J21845_10005703 | |||
| 1427 | JGI24034J26672_10003479 | |||
| 1428 | JGI25405J52794_10002656 | |||
| 1429 | JGI25405J52794_10009957 | |||
| 1430 | Ga0065717_1001992 | |||
| 1431 | Ga0065716_1000064 | |||
| 1432 | Ga0065704_10089598 | |||
| 1433 | Ga0065712_10004414 | |||
| 1434 | Ga0065715_10003211 | |||
| 1435 | Ga0065715_10089057 | |||
| 1436 | Ga0065707_10168922 | |||
| 1437 | Ga0070658_10016413 | |||
| 1438 | Ga0070658_10080771 | |||
| 1439 | Ga0070658_10384811 | |||
| 1440 | Ga0070676_10004642 | |||
| 1441 | Ga0070676_10114479 | |||
| 1442 | Ga0070683_100013090 | |||
| 1443 | Ga0070683_100247020 | |||
| 1444 | Ga0070683_100420727 | |||
| 1445 | Ga0070683_100476657 | |||
| 1446 | Ga0070690_100006650 | |||
| 1447 | Ga0070690_100014960 | |||
| 1448 | Ga0070690_100042844 | |||
| 1449 | Ga0070670_100015971 | |||
| 1450 | Ga0070670_100044755 | |||
| 1451 | Ga0070670_100045922 | |||
| 1452 | Ga0070670_100381056 | |||
| 1453 | Ga0070677_10001512 | |||
| 1454 | Ga0068869_100012157 | |||
| 1455 | Ga0070666_10115017 | |||
| 1456 | Ga0070666_10141668 | |||
| 1457 | Ga0070666_10168732 | |||
| 1458 | Ga0070680_100117959 | |||
| 1459 | Ga0070680_100119686 | |||
| 1460 | Ga0070680_100211920 | |||
| 1461 | Ga0070680_100366804 | |||
| 1462 | Ga0070682_100010796 | |||
| 1463 | Ga0070682_100060305 | |||
| 1464 | Ga0070682_100253187 | |||
| 1465 | Ga0070682_100261130 | |||
| 1466 | Ga0068868_100008008 | |||
| 1467 | Ga0068868_100464130 | |||
| 1468 | Ga0070660_100018941 | |||
| 1469 | Ga0070660_100019654 | |||
| 1470 | Ga0070660_100082499 | |||
| 1471 | Ga0070660_100112362 | |||
| 1472 | Ga0070689_100008904 | |||
| 1473 | Ga0070691_10008977 | |||
| 1474 | Ga0070691_10054822 | |||
| 1475 | Ga0070687_100000508 | |||
| 1476 | Ga0070687_100003462 | |||
| 1477 | Ga0070661_100026333 | |||
| 1478 | Ga0070661_100083424 | |||
| 1479 | Ga0070661_100551902 | |||
| 1480 | Ga0070692_10009171 | |||
| 1481 | Ga0070692_10089731 | |||
| 1482 | Ga0070668_100048995 | |||
| 1483 | Ga0070668_100195731 | |||
| 1484 | Ga0070669_100004442 | |||
| 1485 | Ga0070675_100010960 | |||
| 1486 | Ga0070675_100063520 | |||
| 1487 | Ga0070671_100009960 | |||
| 1488 | Ga0070671_100015285 | |||
| 1489 | Ga0070671_100034762 | |||
| 1490 | Ga0070671_100042377 | |||
| 1491 | Ga0070671_100116676 | |||
| 1492 | Ga0070671_100127818 | |||
| 1493 | Ga0070674_100038698 | |||
| 1494 | Ga0070674_100067551 | |||
| 1495 | Ga0070674_100176136 | |||
| 1496 | Ga0070673_100010845 | |||
| 1497 | Ga0070673_100027965 | |||
| 1498 | Ga0070673_100048450 | |||
| 1499 | Ga0070673_100058113 | |||
| 1500 | Ga0070688_100021684 | |||
| 1501 | Ga0070688_100064577 | |||
| 1502 | Ga0070659_100009719 | |||
| 1503 | Ga0070659_100717367 | |||
| 1504 | Ga0070667_100053888 | |||
| 1505 | Ga0070667_100538288 | |||
| 1506 | Ga0070703_10004977 | |||
| 1507 | Ga0070703_10005901 | |||
| 1508 | Ga0070703_10011121 | |||
| 1509 | Ga0070709_10029207 | |||
| 1510 | Ga0070709_10030267 | |||
| 1511 | Ga0070709_10063573 | |||
| 1512 | Ga0070709_10114227 | |||
| 1513 | Ga0070709_10244267 | |||
| 1514 | Ga0070714_100025708 | |||
| 1515 | Ga0070714_100094055 | |||
| 1516 | Ga0070714_100569741 | |||
| 1517 | Ga0070713_100010962 | |||
| 1518 | Ga0070713_100095164 | |||
| 1519 | Ga0070713_100219392 | |||
| 1520 | Ga0070713_100288106 | |||
| 1521 | Ga0070713_100355787 | |||
| 1522 | Ga0070713_100618880 | |||
| 1523 | Ga0070713_100623566 | |||
| 1524 | Ga0070710_10016552 | |||
| 1525 | Ga0070710_10165267 | |||
| 1526 | Ga0070710_10334057 | |||
| 1527 | Ga0070701_10004735 | |||
| 1528 | Ga0070701_10041946 | |||
| 1529 | Ga0070701_10048811 | |||
| 1530 | Ga0070711_100015125 | |||
| 1531 | Ga0070711_100035735 | |||
| 1532 | Ga0070711_100075991 | |||
| 1533 | Ga0070711_100088873 | |||
| 1534 | Ga0070711_100159402 | |||
| 1535 | Ga0070711_100364562 | |||
| 1536 | Ga0070705_100017130 | |||
| 1537 | Ga0070705_100137652 | |||
| 1538 | Ga0070700_100010230 | |||
| 1539 | Ga0070700_100019075 | |||
| 1540 | Ga0070700_100038447 | |||
| 1541 | Ga0070694_100006188 | |||
| 1542 | Ga0070694_100246189 | |||
| 1543 | Ga0070708_100064041 | |||
| 1544 | Ga0070708_100792935 | |||
| 1545 | Ga0070663_100023888 | |||
| 1546 | Ga0070663_100082896 | |||
| 1547 | Ga0070663_100199867 | |||
| 1548 | Ga0070663_100280405 | |||
| 1549 | Ga0070678_100007085 | |||
| 1550 | Ga0070678_100375668 | |||
| 1551 | Ga0070678_100419311 | |||
| 1552 | Ga0070662_100053178 | |||
| 1553 | Ga0070662_100124026 | |||
| 1554 | Ga0070662_100190308 | |||
| 1555 | Ga0070681_10030704 | |||
| 1556 | Ga0070681_10042345 | |||
| 1557 | Ga0070681_10058918 | |||
| 1558 | Ga0070681_10257357 | |||
| 1559 | Ga0068867_100030148 | |||
| 1560 | Ga0068867_100464101 | |||
| 1561 | Ga0070685_10003206 | |||
| 1562 | Ga0070685_10022671 | |||
| 1563 | Ga0070685_10079920 | |||
| 1564 | Ga0070706_100783231 | |||
| 1565 | Ga0070707_100699583 | |||
| 1566 | Ga0074259_10498539 | |||
| 1567 | Ga0070679_100016311 | |||
| 1568 | Ga0070679_100034201 | |||
| 1569 | Ga0070679_100071215 | |||
| 1570 | Ga0070679_100199105 | |||
| 1571 | Ga0070679_100500161 | |||
| 1572 | Ga0070684_100019448 | |||
| 1573 | Ga0070684_100031373 | |||
| 1574 | Ga0070684_100100549 | |||
| 1575 | Ga0070684_100150484 | |||
| 1576 | Ga0070684_100672373 | |||
| 1577 | Ga0070697_100162182 | |||
| 1578 | Ga0070697_100199875 | |||
| 1579 | Ga0070697_100212243 | |||
| 1580 | Ga0068853_100007915 | |||
| 1581 | Ga0068853_100320027 | |||
| 1582 | Ga0070672_100002557 | |||
| 1583 | Ga0070686_100011589 | |||
| 1584 | Ga0070686_100014959 | |||
| 1585 | Ga0070686_100067461 | |||
| 1586 | Ga0070686_100305966 | |||
| 1587 | Ga0070686_100318544 | |||
| 1588 | Ga0070695_100004179 | |||
| 1589 | Ga0070695_100150537 | |||
| 1590 | Ga0070696_100017134 | |||
| 1591 | Ga0070696_100029007 | |||
| 1592 | Ga0070696_100034849 | |||
| 1593 | Ga0070696_100220956 | |||
| 1594 | Ga0070693_100000598 | |||
| 1595 | Ga0070693_100073417 | |||
| 1596 | Ga0070665_100131167 | |||
| 1597 | Ga0070665_100374236 | |||
| 1598 | Ga0070665_100402492 | |||
| 1599 | Ga0070704_100001411 | |||
| 1600 | Ga0070704_100001845 | |||
| 1601 | Ga0068855_100105869 | |||
| 1602 | Ga0068855_100142314 | |||
| 1603 | Ga0070664_100022064 | |||
| 1604 | Ga0070664_100114112 | |||
| 1605 | Ga0068857_100003946 | |||
| 1606 | Ga0068857_100114348 | |||
| 1607 | Ga0068857_100151095 | |||
| 1608 | Ga0068854_100040125 | |||
| 1609 | Ga0068856_100028987 | |||
| 1610 | Ga0068856_100089119 | |||
| 1611 | Ga0068856_100188149 | |||
| 1612 | Ga0070702_100004124 | |||
| 1613 | Ga0068852_100015213 | |||
| 1614 | Ga0068852_100032088 | |||
| 1615 | Ga0068852_100355922 | |||
| 1616 | Ga0068859_100015209 | |||
| 1617 | Ga0068859_100061305 | |||
| 1618 | Ga0068859_100445031 | |||
| 1619 | Ga0068864_100059186 | |||
| 1620 | Ga0068864_100094360 | |||
| 1621 | Ga0068864_100155145 | |||
| 1622 | Ga0068866_10006784 | |||
| 1623 | Ga0068866_10314560 | |||
| 1624 | Ga0068861_100009598 | |||
| 1625 | Ga0068861_100018479 | |||
| 1626 | Ga0068851_10064045 | |||
| 1627 | Ga0068870_10001856 | |||
| 1628 | Ga0068870_10016062 | |||
| 1629 | Ga0068863_100004842 | |||
| 1630 | Ga0068863_100014861 | |||
| 1631 | Ga0068863_100280571 | |||
| 1632 | Ga0068863_100512135 | |||
| 1633 | Ga0068858_100009730 | |||
| 1634 | Ga0068858_100031089 | |||
| 1635 | Ga0068858_100172483 | |||
| 1636 | Ga0068858_100233107 | |||
| 1637 | Ga0068858_100595353 | |||
| 1638 | Ga0068860_100031612 | |||
| 1639 | Ga0068860_100049035 | |||
| 1640 | Ga0068860_100058904 | |||
| 1641 | Ga0068860_100141624 | |||
| 1642 | Ga0068862_100001842 | |||
| 1643 | Ga0068862_100033969 | |||
| 1644 | Ga0081455_10000406 | |||
| 1645 | Ga0081455_10001669 | |||
| 1646 | Ga0081455_10009887 | |||
| 1647 | Ga0081455_10058719 | |||
| 1648 | Ga0081455_10152020 | |||
| 1649 | Ga0081455_10156129 | |||
| 1650 | Ga0081455_10350336 | |||
| 1651 | Ga0081455_10380543 | |||
| 1652 | Ga0081538_10011077 | |||
| 1653 | Ga0081540_1001987 | |||
| 1654 | Ga0081540_1020979 | |||
| 1655 | Ga0070717_10000378 | |||
| 1656 | Ga0070717_10029289 | |||
| 1657 | Ga0070717_10054790 | |||
| 1658 | Ga0070717_10422148 | |||
| 1659 | Ga0075365_10004370 | |||
| 1660 | Ga0075365_10016802 | |||
| 1661 | Ga0075365_10125659 | |||
| 1662 | Ga0075368_10065421 | |||
| 1663 | Ga0075432_10002074 | |||
| 1664 | Ga0075432_10029530 | |||
| 1665 | Ga0075432_10044944 | |||
| 1666 | Ga0070715_10006900 | |||
| 1667 | Ga0070715_10113238 | |||
| 1668 | Ga0070716_100051663 | |||
| 1669 | Ga0070712_100002271 | |||
| 1670 | Ga0070712_100011210 | |||
| 1671 | Ga0070712_100013459 | |||
| 1672 | Ga0070712_100035403 | |||
| 1673 | Ga0070712_100097488 | |||
| 1674 | Ga0070712_100418994 | |||
| 1675 | Ga0075367_10009844 | |||
| 1676 | Ga0075367_10016048 | |||
| 1677 | Ga0075367_10259558 | |||
| 1678 | Ga0075427_10003100 | |||
| 1679 | Ga0097621_100002928 | |||
| 1680 | Ga0097621_100078920 | |||
| 1681 | Ga0068871_100012296 | |||
| 1682 | Ga0068871_100019961 | |||
| 1683 | Ga0068871_100085640 | |||
| 1684 | Ga0075428_100001601 | |||
| 1685 | Ga0075430_100001162 | |||
| 1686 | Ga0075430_100314640 | |||
| 1687 | Ga0075431_100022376 | |||
| 1688 | Ga0075431_100207372 | |||
| 1689 | Ga0075431_100378249 | |||
| 1690 | Ga0075433_10000068 | |||
| 1691 | Ga0075433_10050889 | |||
| 1692 | Ga0075433_10074428 | |||
| 1693 | Ga0075433_10077350 | |||
| 1694 | Ga0075434_100002956 | |||
| 1695 | Ga0075434_100005563 | |||
| 1696 | Ga0075434_100031778 | |||
| 1697 | Ga0075434_100064642 | |||
| 1698 | Ga0075434_100072623 | |||
| 1699 | Ga0075434_100371993 | |||
| 1700 | Ga0075434_100457181 | |||
| 1701 | Ga0075434_100609247 | |||
| 1702 | Ga0075429_100002047 | |||
| 1703 | Ga0068865_100005119 | |||
| 1704 | Ga0068865_100064480 | |||
| 1705 | Ga0068865_100150586 | |||
| 1706 | Ga0075436_100024355 | |||
| 1707 | Ga0075436_100075157 | |||
| 1708 | Ga0097620_100015209 | |||
| 1709 | Ga0097620_100061307 | |||
| 1710 | Ga0097620_100445004 | |||
| 1711 | Ga0075435_100052519 | |||
| 1712 | Ga0075435_100115258 | |||
| 1713 | Ga0075435_100139329 | |||
| 1714 | Ga0075435_100288024 | |||
| 1715 | Ga0075435_100424800 | |||
| 1716 | Ga0075435_100481841 | |||
| 1717 | Ga0099794_10004391 | |||
| 1718 | Ga0099794_10129173 | |||
| 1719 | Ga0099795_10142778 | |||
| 1720 | Ga0105250_10101164 | |||
| 1721 | Ga0105240_10176065 | |||
| 1722 | Ga0111539_10001284 | |||
| 1723 | Ga0111539_10002543 | |||
| 1724 | Ga0111539_10032584 | |||
| 1725 | Ga0111539_10057660 | |||
| 1726 | Ga0111539_10136568 | |||
| 1727 | Ga0111539_10322462 | |||
| 1728 | Ga0105245_10031015 | |||
| 1729 | Ga0105245_10070005 | |||
| 1730 | Ga0105247_10021856 | |||
| 1731 | Ga0105247_10028136 | |||
| 1732 | Ga0105247_10142348 | |||
| 1733 | Ga0114129_10004127 | |||
| 1734 | Ga0114129_10015793 | |||
| 1735 | Ga0114129_10100651 | |||
| 1736 | Ga0105243_10008339 | |||
| 1737 | Ga0105243_10054689 | |||
| 1738 | Ga0105241_10004472 | |||
| 1739 | Ga0105241_10038688 | |||
| 1740 | Ga0105242_10017926 | |||
| 1741 | Ga0105242_10244928 | |||
| 1742 | Ga0105242_10273591 | |||
| 1743 | Ga0105242_10274991 | |||
| 1744 | Ga0105242_10524666 | |||
| 1745 | Ga0105248_10010313 | |||
| 1746 | Ga0105248_10059103 | |||
| 1747 | Ga0105248_10153891 | |||
| 1748 | Ga0105248_10615194 | |||
| 1749 | Ga0105237_10027346 | |||
| 1750 | Ga0105237_10042509 | |||
| 1751 | Ga0105237_10057323 | |||
| 1752 | Ga0105237_10091666 | |||
| 1753 | Ga0105237_10092507 | |||
| 1754 | Ga0105237_10096344 | |||
| 1755 | Ga0105238_10029419 | |||
| 1756 | Ga0105238_10051215 | |||
| 1757 | Ga0105238_10066723 | |||
| 1758 | Ga0105238_10182256 | |||
| 1759 | Ga0105249_10011749 | |||
| 1760 | Ga0105249_10032599 | |||
| 1761 | Ga0105249_10206037 | |||
| 1762 | Ga0105249_10867003 | |||
| 1763 | Ga0099796_10011403 | |||
| 1764 | Ga0099796_10030202 | |||
| 1765 | Ga0105239_10037971 | |||
| 1766 | Ga0105239_10305211 | |||
| 1767 | Ga0105239_10606125 | |||
| 1768 | Ga0105246_10012998 | |||
| 1769 | Ga0105246_10019263 | |||
| 1770 | Ga0105246_10330543 | |||
| 1771 | Ga0157344_1002048 | |||
| 1772 | Ga0157341_1003625 | |||
| 1773 | Ga0157373_10030696 | |||
| 1774 | Ga0157373_10076812 | |||
| 1775 | Ga0157371_10017224 | |||
| 1776 | Ga0157371_10232139 | |||
| 1777 | Ga0157369_10057951 | |||
| 1778 | Ga0157369_10201591 | |||
| 1779 | Ga0157369_10249485 | |||
| 1780 | Ga0157369_10343645 | |||
| 1781 | Ga0157374_10012525 | |||
| 1782 | Ga0157374_10103562 | |||
| 1783 | Ga0157374_10655161 | |||
| 1784 | Ga0157378_10122934 | |||
| 1785 | Ga0163162_10009600 | |||
| 1786 | Ga0163162_10039557 | |||
| 1787 | Ga0163162_10168070 | |||
| 1788 | Ga0163162_10351515 | |||
| 1789 | Ga0157372_10027001 | |||
| 1790 | Ga0157372_10098006 | |||
| 1791 | Ga0157372_10208706 | |||
| 1792 | Ga0157372_10406561 | |||
| 1793 | Ga0157372_10534766 | |||
| 1794 | Ga0157375_10134684 | |||
| 1795 | Ga0157375_10255882 | |||
| 1796 | Ga0163163_10002001 | |||
| 1797 | Ga0163163_10051014 | |||
| 1798 | Ga0163163_10265684 | |||
| 1799 | Ga0163163_10364894 | |||
| 1800 | Ga0163163_10388359 | |||
| 1801 | Ga0163163_10741757 | |||
| 1802 | Ga0157380_10095681 | |||
| 1803 | Ga0157377_10002093 | |||
| 1804 | Ga0157377_10213676 | |||
| 1805 | Ga0157379_10018091 | |||
| 1806 | Ga0157379_10137078 | |||
| 1807 | Ga0157379_10215837 | |||
| 1808 | Ga0157379_10245089 | |||
| 1809 | Ga0157379_10416148 | |||
| 1810 | Ga0157376_10040045 | |||
| 1811 | Ga0157376_10229335 | |||
| 1812 | Ga0157376_10249255 | |||
| 1813 | Ga0157376_10386395 | |||
| 1814 | Ga0182007_10002819 | |||
| 1815 | Ga0163161_10005218 | |||
| 1816 | Ga0163161_10236031 | |||
| 1817 | Ga0163161_10276350 | |||
| 1818 | Ga0206353_10140707 | |||
| 1819 | Ga0224572_1001529 | |||
| 1820 | Ga0228598_1024548 | |||
| 1821 | Ga0209233_1019820 | |||
| 1822 | Ga0207666_1000366 | |||
| 1823 | Ga0207666_1001084 | |||
| 1824 | Ga0207673_1000238 | |||
| 1825 | Ga0207697_10000659 | |||
| 1826 | Ga0207697_10131896 | |||
| 1827 | Ga0207696_1052480 | |||
| 1828 | Ga0207653_10001549 | |||
| 1829 | Ga0207653_10016283 | |||
| 1830 | Ga0207653_10086770 | |||
| 1831 | Ga0207682_10003189 | |||
| 1832 | Ga0207692_10006112 | |||
| 1833 | Ga0207692_10021377 | |||
| 1834 | Ga0207692_10060138 | |||
| 1835 | Ga0207692_10085824 | |||
| 1836 | Ga0207642_10049737 | |||
| 1837 | Ga0207642_10210196 | |||
| 1838 | Ga0207710_10012928 | |||
| 1839 | Ga0207710_10046390 | |||
| 1840 | Ga0207710_10061053 | |||
| 1841 | Ga0207688_10000981 | |||
| 1842 | Ga0207688_10003210 | |||
| 1843 | Ga0207688_10024956 | |||
| 1844 | Ga0207688_10047876 | |||
| 1845 | Ga0207680_10053858 | |||
| 1846 | Ga0207647_10005149 | |||
| 1847 | Ga0207647_10017110 | |||
| 1848 | Ga0207647_10026615 | |||
| 1849 | Ga0207647_10114025 | |||
| 1850 | Ga0207685_10000850 | |||
| 1851 | Ga0207685_10088572 | |||
| 1852 | Ga0207699_10006806 | |||
| 1853 | Ga0207699_10074999 | |||
| 1854 | Ga0207699_10079238 | |||
| 1855 | Ga0207645_10001680 | |||
| 1856 | Ga0207645_10014284 | |||
| 1857 | Ga0207645_10172531 | |||
| 1858 | Ga0207643_10000136 | |||
| 1859 | Ga0207643_10001619 | |||
| 1860 | Ga0207705_10045339 | |||
| 1861 | Ga0207705_10073636 | |||
| 1862 | Ga0207684_10293027 | |||
| 1863 | Ga0207654_10030573 | |||
| 1864 | Ga0207707_10136957 | |||
| 1865 | Ga0207671_10058000 | |||
| 1866 | Ga0207671_10101085 | |||
| 1867 | Ga0207671_10131048 | |||
| 1868 | Ga0207671_10173793 | |||
| 1869 | Ga0207693_10004015 | |||
| 1870 | Ga0207693_10004220 | |||
| 1871 | Ga0207693_10006069 | |||
| 1872 | Ga0207693_10006883 | |||
| 1873 | Ga0207693_10009217 | |||
| 1874 | Ga0207693_10021355 | |||
| 1875 | Ga0207693_10041913 | |||
| 1876 | Ga0207693_10046350 | |||
| 1877 | Ga0207693_10078370 | |||
| 1878 | Ga0207693_10111122 | |||
| 1879 | Ga0207663_10040902 | |||
| 1880 | Ga0207663_10147583 | |||
| 1881 | Ga0207663_10207243 | |||
| 1882 | Ga0207663_10248828 | |||
| 1883 | Ga0207660_10004668 | |||
| 1884 | Ga0207660_10039771 | |||
| 1885 | Ga0207660_10177115 | |||
| 1886 | Ga0207660_10226617 | |||
| 1887 | Ga0207662_10000154 | |||
| 1888 | Ga0207662_10000164 | |||
| 1889 | Ga0207662_10017874 | |||
| 1890 | Ga0207657_10011001 | |||
| 1891 | Ga0207657_10019204 | |||
| 1892 | Ga0207657_10026615 | |||
| 1893 | Ga0207657_10070086 | |||
| 1894 | Ga0207657_10101574 | |||
| 1895 | Ga0207649_10103318 | |||
| 1896 | Ga0207649_10421886 | |||
| 1897 | Ga0207652_10085136 | |||
| 1898 | Ga0207652_10119322 | |||
| 1899 | Ga0207652_10147825 | |||
| 1900 | Ga0207652_10254321 | |||
| 1901 | Ga0207646_10244096 | |||
| 1902 | Ga0207646_10350010 | |||
| 1903 | Ga0207681_10123602 | |||
| 1904 | Ga0207681_10137814 | |||
| 1905 | Ga0207694_10042102 | |||
| 1906 | Ga0207694_10224596 | |||
| 1907 | Ga0207650_10008674 | |||
| 1908 | Ga0207650_10039708 | |||
| 1909 | Ga0207650_10085293 | |||
| 1910 | Ga0207650_10092858 | |||
| 1911 | Ga0207650_10214521 | |||
| 1912 | Ga0207659_10002828 | |||
| 1913 | Ga0207687_10028673 | |||
| 1914 | Ga0207687_10034829 | |||
| 1915 | Ga0207687_10053586 | |||
| 1916 | Ga0207700_10000118 | |||
| 1917 | Ga0207700_10029464 | |||
| 1918 | Ga0207700_10225268 | |||
| 1919 | Ga0207700_10254586 | |||
| 1920 | Ga0207700_10573149 | |||
| 1921 | Ga0207700_10719611 | |||
| 1922 | Ga0207664_10025513 | |||
| 1923 | Ga0207664_10035107 | |||
| 1924 | Ga0207664_10092926 | |||
| 1925 | Ga0207664_10675070 | |||
| 1926 | Ga0207644_10001008 | |||
| 1927 | Ga0207644_10005274 | |||
| 1928 | Ga0207644_10055379 | |||
| 1929 | Ga0207644_10118046 | |||
| 1930 | Ga0207644_10185171 | |||
| 1931 | Ga0207690_10005061 | |||
| 1932 | Ga0207690_10034348 | |||
| 1933 | Ga0207706_10003055 | |||
| 1934 | Ga0207706_10008247 | |||
| 1935 | Ga0207706_10031726 | |||
| 1936 | Ga0207706_10038669 | |||
| 1937 | Ga0207706_10041161 | |||
| 1938 | Ga0207706_10054909 | |||
| 1939 | Ga0207686_10049555 | |||
| 1940 | Ga0207686_10087877 | |||
| 1941 | Ga0207686_10405827 | |||
| 1942 | Ga0207709_10016937 | |||
| 1943 | Ga0207709_10028591 | |||
| 1944 | Ga0207709_10084501 | |||
| 1945 | Ga0207670_10007415 | |||
| 1946 | Ga0207670_10009236 | |||
| 1947 | Ga0207670_10018498 | |||
| 1948 | Ga0207669_10002625 | |||
| 1949 | Ga0207669_10031057 | |||
| 1950 | Ga0207669_10031384 | |||
| 1951 | Ga0207669_10209153 | |||
| 1952 | Ga0207704_10003098 | |||
| 1953 | Ga0207704_10336434 | |||
| 1954 | Ga0207665_10025306 | |||
| 1955 | Ga0207665_10030390 | |||
| 1956 | Ga0207665_10067137 | |||
| 1957 | Ga0207665_10100954 | |||
| 1958 | Ga0207665_10182806 | |||
| 1959 | Ga0207691_10000812 | |||
| 1960 | Ga0207691_10002456 | |||
| 1961 | Ga0207691_10206046 | |||
| 1962 | Ga0207711_10044922 | |||
| 1963 | Ga0207711_10136770 | |||
| 1964 | Ga0207711_10188980 | |||
| 1965 | Ga0207711_10289120 | |||
| 1966 | Ga0207711_10441143 | |||
| 1967 | Ga0207689_10000427 | |||
| 1968 | Ga0207689_10009817 | |||
| 1969 | Ga0207689_10063205 | |||
| 1970 | Ga0207661_10031070 | |||
| 1971 | Ga0207661_10217548 | |||
| 1972 | Ga0207661_10467352 | |||
| 1973 | Ga0207679_10000853 | |||
| 1974 | Ga0207667_10058200 | |||
| 1975 | Ga0207667_10204823 | |||
| 1976 | Ga0207667_10298671 | |||
| 1977 | Ga0207651_10003200 | |||
| 1978 | Ga0207651_10004120 | |||
| 1979 | Ga0207651_10035784 | |||
| 1980 | Ga0207712_10008478 | |||
| 1981 | Ga0207712_10067643 | |||
| 1982 | Ga0207668_10013229 | |||
| 1983 | Ga0207668_10031378 | |||
| 1984 | Ga0207668_10106179 | |||
| 1985 | Ga0207668_10142169 | |||
| 1986 | Ga0207640_10005942 | |||
| 1987 | Ga0207640_10089427 | |||
| 1988 | Ga0207640_10377592 | |||
| 1989 | Ga0207658_10116096 | |||
| 1990 | Ga0207658_10340440 | |||
| 1991 | Ga0207658_10345981 | |||
| 1992 | Ga0207658_10693355 | |||
| 1993 | Ga0207677_10020473 | |||
| 1994 | Ga0207677_10047073 | |||
| 1995 | Ga0207677_10293589 | |||
| 1996 | Ga0207703_10024162 | |||
| 1997 | Ga0207703_10038967 | |||
| 1998 | Ga0207703_10056116 | |||
| 1999 | Ga0207703_10139047 | |||
| 2000 | Ga0207639_10032499 | |||
| 2001 | Ga0207678_10005504 | |||
| 2002 | Ga0207678_10008889 | |||
| 2003 | Ga0207678_10009330 | |||
| 2004 | Ga0207678_10024014 | |||
| 2005 | Ga0207708_10001137 | |||
| 2006 | Ga0207708_10001264 | |||
| 2007 | Ga0207708_10011789 | |||
| 2008 | Ga0207708_10081153 | |||
| 2009 | Ga0207702_10020210 | |||
| 2010 | Ga0207702_10128387 | |||
| 2011 | Ga0207702_10227326 | |||
| 2012 | Ga0207641_10017044 | |||
| 2013 | Ga0207641_10035250 | |||
| 2014 | Ga0207641_10556088 | |||
| 2015 | Ga0207648_10002630 | |||
| 2016 | Ga0207648_10035051 | |||
| 2017 | Ga0207648_10393955 | |||
| 2018 | Ga0207676_10066657 | |||
| 2019 | Ga0207676_10152751 | |||
| 2020 | Ga0207674_10004609 | |||
| 2021 | Ga0207674_10036803 | |||
| 2022 | Ga0207674_10092714 | |||
| 2023 | Ga0207674_10175216 | |||
| 2024 | Ga0207675_100003315 | |||
| 2025 | Ga0207675_100011227 | |||
| 2026 | Ga0207675_100022088 | |||
| 2027 | Ga0207675_100411237 | |||
| 2028 | Ga0207675_100619076 | |||
| 2029 | Ga0207683_10008982 | |||
| 2030 | Ga0207698_10036199 | |||
| 2031 | Ga0207698_10120755 | |||
| 2032 | Ga0209971_1018376 | |||
| 2033 | Ga0209966_1002117 | |||
| 2034 | Ga0209998_10000576 | |||
| 2035 | Ga0209998_10034804 | |||
| 2036 | Ga0209998_10035834 | |||
| 2037 | Ga0209974_10018091 | |||
| 2038 | Ga0207428_10000150 | |||
| 2039 | Ga0207428_10000594 | |||
| 2040 | Ga0207428_10001449 | |||
| 2041 | Ga0268266_10161989 | |||
| 2042 | Ga0268266_10302644 | |||
| 2043 | Ga0268266_10511300 | |||
| 2044 | Ga0268265_10010005 | |||
| 2045 | Ga0268265_10024707 | |||
| 2046 | Ga0268264_10029947 | |||
| 2047 | Ga0268264_10055972 | |||
| 2048 | Ga0268264_10059135 | |||
| 2049 | Ga0268264_10264596 | |||
| 2050 | Ga0268264_10365138 | |||
| 2051 | Ga0265337_1000084 | |||
| 2052 | Ga0265318_10055752 | |||
| 2053 | Ga0265336_10046681 | |||
| 2054 | Ga0265338_10006542 | |||
| 2055 | Ga0265338_10170721 | |||
| 2056 | Ga0265763_1000682 | |||
| 2057 | Ga0265760_10034437 | |||
| 2058 | Ga0265330_10039971 | |||
| 2059 | Ga0265332_10045527 | |||
| 2060 | Ga0265328_10035237 | |||
| 2061 | Ga0265320_10032836 | |||
| 2062 | Ga0265325_10000004 | |||
| 2063 | Ga0265325_10000630 | |||
| 2064 | Ga0265325_10013896 | |||
| 2065 | Ga0265325_10060087 | |||
| 2066 | Ga0265325_10060873 | |||
| 2067 | Ga0265325_10112940 | |||
| 2068 | Ga0265329_10045592 | |||
| 2069 | Ga0265340_10001253 | |||
| 2070 | Ga0265340_10007664 | |||
| 2071 | Ga0265340_10010658 | |||
| 2072 | Ga0265340_10015110 | |||
| 2073 | Ga0265339_10000133 | |||
| 2074 | Ga0265339_10004348 | |||
| 2075 | Ga0265339_10004657 | |||
| 2076 | Ga0265339_10112074 | |||
| 2077 | Ga0265339_10194858 | |||
| 2078 | Ga0265331_10024291 | |||
| 2079 | Ga0265331_10031897 | |||
| 2080 | Ga0265331_10051405 | |||
| 2081 | Ga0265316_10016679 | |||
| 2082 | Ga0265316_10026680 | |||
| 2083 | Ga0265316_10328348 | |||
| 2084 | Ga0265313_10000491 | |||
| 2085 | Ga0265313_10000868 | |||
| 2086 | Ga0265313_10015380 | |||
| 2087 | Ga0265313_10028881 | |||
| 2088 | Ga0307508_10000049 | |||
| 2089 | Ga0316575_10006591 | |||
| 2090 | Ga0316579_10031010 | |||
| 2091 | Ga0265314_10002573 | |||
| 2092 | Ga0265314_10004582 | |||
| 2093 | Ga0265314_10085258 | |||
| 2094 | Ga0265314_10111772 | |||
| 2095 | Ga0265342_10000093 | |||
| 2096 | Ga0265342_10001600 | |||
| 2097 | Ga0265342_10009354 | |||
| 2098 | Ga0265342_10045417 | |||
| 2099 | Ga0307516_10164851 | |||
| 2100 | Ga0307516_10179878 | |||
| 2101 | Ga0316583_10000400 | |||
| 2102 | Ga0316583_10032496 | |||
| 2103 | Ga0307507_10174228 | |||
| 2104 | Ga0373930_0000835 | |||
| 2105 | Ga0373930_0006760 | |||
| 2106 | Ga0373948_0000254 | |||
| 2107 | Ga0373948_0037241 | |||
| 2108 | Ga0373950_0000189 | |||
| 2109 | Ga0373950_0007445 | |||
| 2110 | Ga0373950_0021088 | |||
| 2111 | Ga0373958_0000784 | |||
| 2112 | Ga0373958_0014447 | |||
| 2113 | Ga0373958_0041796 | |||
| 2114 | Ga0373959_0000739 | |||
| 2115 | Ga0373959_0032426 | |||
| 2116 | Ga0373926_0000978 | |||
| 2117 | Ga0373926_0009827 | |||
| 2118 | Ga0373926_0052869 | |||
| 2119 | Ga0373928_0000170 | |||
| 2120 | Ga0373928_0002877 | |||
| 2121 | Ga0373929_0000249 | |||
| 2122 | Ga0373929_0018901 | |||
| 2123 | Ga0373929_0020499 | |||
| 2124 | Ga0373934_0035483 | |||
| 2125 | Ga0373934_0112996 | |||
| 2126 | Ga0373940_0000372 | |||
| 2127 | Ga0373940_0005705 | |||
| 2128 | Ga0373944_0019794 | |||
| 2129 | Ga0373949_0001262 | |||
| 2130 | Ga0373949_0002117 | |||
| 2131 | Ga0373949_0003612 | |||
| 2132 | Ga0373949_0004664 | |||
| 2133 | Ga0373951_0000237 | |||
| 2134 | Ga0373951_0002947 | |||
| 2135 | Ga0373951_0003252 | |||
| 2136 | Ga0373952_0001204 | |||
| 2137 | Ga0373923_0007009 | |||
| 2138 | Ga0373923_0012224 | |||
| 2139 | Ga0373923_0034032 | |||
| 2140 | Ga0373932_0000358 | |||
| 2141 | Ga0373932_0004563 | |||
| 2142 | Ga0373932_0011645 | |||
| 2143 | Ga0373936_0000247 | |||
| 2144 | Ga0373936_0008984 | |||
| 2145 | Ga0373936_0014000 | |||
| 2146 | Ga0373939_0001671 | |||
| 2147 | Ga0373939_0005026 | |||
| 2148 | Ga0373939_0005227 | |||
| 2149 | Ga0373939_0069815 | |||
| 2150 | Ga0373941_0132022 | |||
| 2151 | Ga0373945_0000745 | |||
| 2152 | Ga0373945_0002295 | |||
| 2153 | Ga0373945_0007669 | |||
| 2154 | Ga0373945_0011100 | |||
| 2155 | Ga0373945_0033341 | |||
| 2156 | Ga0373953_0004566 | |||
| 2157 | Ga0373953_0011967 | |||
| 2158 | Ga0373953_0022051 | |||
| 2159 | Ga0373954_0000594 | |||
| 2160 | Ga0373954_0017468 | |||
| 2161 | Ga0373954_0042143 | |||
| 2162 | Ga0373954_0210637 | |||
| 2163 | Ga0373956_0014225 | |||
| 2164 | Ga0373956_0020803 | |||
| 2165 | Ga0373956_0038030 | |||
| 2166 | Ga0373956_0058744 | |||
| 2167 | Ga0373957_0005882 | |||
| 2168 | Ga0373957_0015861 | |||
| 2169 | Ga0373957_0022379 | |||
| 2170 | Ga0373957_0026572 | |||
| 2171 | Ga0373957_0072208 | |||
| 2172 | Ga0373960_0000983 | |||
| 2173 | Ga0373960_0003870 | |||
| 2174 | Ga0373960_0004631 | |||
| 2175 | Ga0373960_0028890 | |||
| 2176 | Ga0373943_0000765 | |||
| 2177 | Ga0373943_0002206 | |||
| 2178 | Ga0373943_0027440 | |||
| 2179 | Ga0373943_0051014 | |||
| 2180 | Ga0373943_0081660 | |||
| 2181 | Ga0373943_0103620 | |||
| 2182 | Ga0373946_0005621 | |||
| 2183 | Ga0373946_0007520 | |||
| 2184 | Ga0373946_0008750 | |||
| 2185 | Ga0373946_0029382 | |||
| 2186 | Ga0373946_0047124 | |||
| 2187 | Ga0373946_0079515 | |||
| 2188 | Ga0373955_0000588 | |||
| 2189 | Ga0373955_0000790 | |||
| 2190 | Ga0373955_0006281 | |||
| 2191 | Ga0373955_0007878 | |||
| 2192 | Ga0373955_0052325 | |||
| 2193 | Ga0373955_0053290 | |||
| 2194 | Ga0373955_0160972 | |||
| 2195 | Ga0373955_0198559 | |||
| 2196 | Ga0373942_0009149 | |||
| 2197 | Ga0373961_0000267 | |||
| 2198 | Ga0373961_0011660 | |||
| 2199 | Ga0373961_0014287 | |||
| 2200 | Ga0373961_0040159 | |||
| 2201 | Ga0373962_0000465 | |||
| 2202 | Ga0373962_0022349 | |||
| 2203 | Ga0373924_0000311 | |||
| 2204 | Ga0373924_0011298 | |||
| 2205 | Ga0373924_0014516 | |||
| 2206 | Ga0373924_0024512 | |||
| 2207 | Ga0373924_0025071 | |||
| 2208 | Ga0373924_0033787 | |||
| 2209 | Ga0373924_0056803 | |||
| 2210 | Ga0373931_0000813 | |||
| 2211 | Ga0373931_0003284 | |||
| 2212 | Ga0373931_0044083 | |||
| 2213 | Ga0373935_0000142 | |||
| 2214 | Ga0373935_0007148 | |||
| 2215 | Ga0373935_0009871 | |||
| 2216 | Ga0373935_0025943 | |||
| 2217 | Ga0373935_0032442 | |||
| 2218 | Ga0373935_0114203 | |||
| 2219 | Ga0373935_0201129 | |||
| 2220 | Ga0373935_0210028 | |||
| 2221 | Ga0373935_0292511 | |||
| 2222 | Ga0373935_0297661 | |||
| 2223 | Ga0373935_0540772 | |||
| 2224 | Ga0373927_0002697 | |||
| 2225 | Ga0373927_0003928 | |||
| 2226 | Ga0373927_0011494 | |||
| 2227 | Ga0373927_0019711 | |||
| 2228 | Ga0373927_0035816 | |||
| 2229 | Ga0373927_0057174 | |||
| 2230 | Ga0373927_0218229 | |||
| 2231 | Ga0373933_0001807 | |||
| 2232 | Ga0373933_0001809 | |||
| 2233 | Ga0373933_0001937 | |||
| 2234 | Ga0373933_0002756 | |||
| 2235 | Ga0373933_0020681 | |||
| 2236 | Ga0373933_0021016 | |||
| 2237 | Ga0373947_0000334 | |||
| 2238 | Ga0373947_0006737 | |||
| 2239 | Ga0373947_0084587 | |||
| 2240 | Ga0373947_0115396 | |||
| 2241 | Ga0373937_0000802 | |||
| 2242 | Ga0373937_0001597 | |||
| 2243 | Ga0373937_0001602 | |||
| 2244 | Ga0373937_0001751 | |||
| 2245 | Ga0373937_0004661 | |||
| 2246 | Ga0373937_0005134 | |||
| 2247 | Ga0373937_0012412 | |||
| 2248 | Ga0373937_0054149 | |||
| 2249 | Ga0373937_0180034 | |||
| 2250 | Ga0373925_0000152 | |||
| 2251 | Ga0373925_0003524 | |||
| 2252 | Ga0373925_0028860 | |||
| 2253 | Ga0373925_0061971 | |||
| 2254 | Ga0373925_0122106 | |||
| 2255 | Ga0373925_0245655 | |||
| 2256 | Ga0373925_0248056 | |||
| 2257 | Ga0395899_0011380 | |||
| 2258 | Ga0395899_0100109 | |||
| 2259 | Ga0395900_0003511 | |||
| 2260 | Ga0395900_0030157 | |||
| 2261 | Ga0395900_0056684 | |||
| 2262 | Ga0395898_0089239 | |||
| 2263 | Ga0395898_0137489 | |||
| 2264 | Ga0395901_0010954 | |||
| 2265 | Ga0395901_0013418 | |||
| 2266 | Ga0242420_002050 | |||
| 2267 | Ga0400483_151746 | |||
| 2268 | Ga0400483_161457 | |||
| 2269 | Ga0436365_0274179 | |||
| 2270 | Ga0436365_0859425 | |||
| 2271 | Ga0436361_0161168 | |||
| 2272 | Ga0436363_0176166 | |||
| 2273 | Ga0436363_0963225 | |||
| 2274 | Ga0436363_1590609 | |||
| 2275 | Ga0439450_006195 | |||
| 2276 | Ga0439464_0008939 | |||
| 2277 | Ga0451577_0091412 | |||
| 2278 | Ga0453683_0083480 | |||
| 2279 | Ga0466963_0039766 | |||
| 2280 | Ga0466963_0041028 | |||
| 2281 | Ga0466963_0245160 | |||
| 2282 | Ga0453684_0226771 | |||
| 2283 | Ga0466957_0044609 | |||
| 2284 | Ga0451576_0166909 | |||
| 2285 | Ga0466967_0779464 | |||
| 2286 | Ga0495617_003311 | |||
| 2287 | Ga0495617_017730 | |||
| 2288 | Ga0495592_0000009 | |||
| 2289 | Ga0495592_0002207 | |||
| 2290 | Ga0495592_0002869 | |||
| 2291 | Ga0495592_0007893 | |||
| 2292 | Ga0495603_0001273 | |||
| 2293 | Ga0495603_0057352 | |||
| 2294 | Ga0495603_0093529 | |||
| 2295 | Ga0495629_0000026 | |||
| 2296 | Ga0495629_0003539 | |||
| 2297 | Ga0495629_0012950 | |||
| 2298 | Ga0495629_0022806 | |||
| 2299 | Ga0495629_0193599 | |||
| 2300 | Ga0495638_0000150 | |||
| 2301 | Ga0495638_0001385 | |||
| 2302 | Ga0495638_0031505 | |||
| 2303 | Ga0495641_0019956 | |||
| 2304 | Ga0495641_0110335 | |||
| 2305 | Ga0495651_0001594 | |||
| 2306 | Ga0495651_0002062 | |||
| 2307 | Ga0495651_0009198 | |||
| 2308 | Ga0495651_0014698 | |||
| 2309 | Ga0495651_0065667 | |||
| 2310 | Ga0495651_0401222 | |||
| 2311 | Ga0495653_0001255 | |||
| 2312 | Ga0495653_0019067 | |||
| 2313 | Ga0495653_0045135 | |||
| 2314 | Ga0495653_0069592 | |||
| 2315 | Ga0495653_0178884 | |||
| 2316 | Ga0495580_0014189 | |||
| 2317 | Ga0495580_0131424 | |||
| 2318 | Ga0495580_0225035 | |||
| 2319 | Ga0495582_0003737 | |||
| 2320 | Ga0495605_0000743 | |||
| 2321 | Ga0495639_0009238 | |||
| 2322 | Ga0495639_0093976 | |||
| 2323 | Ga0495662_0014404 | |||
| 2324 | Ga0495662_0022251 | |||
| 2325 | Ga0495662_0029602 | |||
| 2326 | Ga0495662_0067798 | |||
| 2327 | Ga0495664_0000002 | |||
| 2328 | Ga0495664_0000375 | |||
| 2329 | Ga0495664_0029112 | |||
| 2330 | Ga0495664_0076558 | |||
| 2331 | Ga0495664_0141693 | |||
| 2332 | Ga0495584_0031215 | |||
| 2333 | Ga0495584_0052960 | |||
| 2334 | Ga0495584_0064460 | |||
| 2335 | Ga0495585_0005673 | |||
| 2336 | Ga0495585_0050299 | |||
| 2337 | Ga0495585_0188433 | |||
| 2338 | Ga0495594_0008513 | |||
| 2339 | Ga0495594_0028509 | |||
| 2340 | Ga0495594_0045999 | |||
| 2341 | Ga0495594_0122516 | |||
| 2342 | Ga0495594_0165116 | |||
| 2343 | Ga0495607_0007593 | |||
| 2344 | Ga0495607_0008723 | |||
| 2345 | Ga0495607_0125793 | |||
| 2346 | Ga0495607_0150619 | |||
| 2347 | Ga0495583_0075433 | |||
| 2348 | Ga0495608_0000032 | |||
| 2349 | Ga0495608_0000180 | |||
| 2350 | Ga0495608_0003555 | |||
| 2351 | Ga0495608_0011097 | |||
| 2352 | Ga0495608_0026249 | |||
| 2353 | Ga0495610_0003832 | |||
| 2354 | Ga0495616_0001634 | |||
| 2355 | Ga0495616_0043539 | |||
| 2356 | Ga0495618_0000114 | |||
| 2357 | Ga0495618_0003664 | |||
| 2358 | Ga0495618_0029503 | |||
| 2359 | Ga0495618_0052091 | |||
| 2360 | Ga0495618_0065232 | |||
| 2361 | Ga0495620_0013168 | |||
| 2362 | Ga0495628_0000002 | |||
| 2363 | Ga0495628_0001064 | |||
| 2364 | Ga0495628_0074879 | |||
| 2365 | Ga0495628_0103074 | |||
| 2366 | Ga0495630_0000658 | |||
| 2367 | Ga0495630_0012700 | |||
| 2368 | Ga0495630_0037134 | |||
| 2369 | Ga0495630_0046355 | |||
| 2370 | Ga0495630_0066937 | |||
| 2371 | Ga0495630_0114588 | |||
| 2372 | Ga0495630_0427865 | |||
| 2373 | Ga0495630_0429262 | |||
| 2374 | Ga0495631_0110537 | |||
| 2375 | Ga0495632_0002399 | |||
| 2376 | Ga0495632_0011697 | |||
| 2377 | Ga0495637_0124883 | |||
| 2378 | Ga0495643_0003688 | |||
| 2379 | Ga0495644_0000690 | |||
| 2380 | Ga0495644_0009397 | |||
| 2381 | Ga0495644_0039008 | |||
| 2382 | Ga0495644_0121256 | |||
| 2383 | Ga0495644_0178707 | |||
| 2384 | Ga0495648_0000824 | |||
| 2385 | Ga0495663_0099245 | |||
| 2386 | Ga0495666_0039577 | |||
| 2387 | Ga0495666_0121951 | |||
| 2388 | Ga0495666_0135713 | |||
| 2389 | Ga0495652_0000004 | |||
| 2390 | Ga0495652_0001634 | |||
| 2391 | Ga0495652_0020229 | |||
| 2392 | Ga0495652_0030318 | |||
| 2393 | Ga0495652_0046041 | |||
| 2394 | Ga0495652_0118894 | |||
| 2395 | Ga0495652_0255980 | |||
| 2396 | Ga0495654_0003511 | |||
| 2397 | Ga0495665_0009815 | |||
| 2398 | Ga0495665_0018587 | |||
| 2399 | Ga0495665_0022210 | |||
| 2400 | Ga0495640_0000016 | |||
| 2401 | Ga0495640_0003068 | |||
| 2402 | Ga0495640_0003848 | |||
| 2403 | Ga0495640_0012588 | |||
| 2404 | Ga0495640_0042809 | |||
| 2405 | Ga0495640_0044226 | |||
| 2406 | Ga0495640_0064334 | |||
| 2407 | Ga0495586_0023543 | |||
| 2408 | Ga0495587_0000018 | |||
| 2409 | Ga0495587_0000894 | |||
| 2410 | Ga0495587_0001375 | |||
| 2411 | Ga0495587_0020330 | |||
| 2412 | Ga0495587_0076549 | |||
| 2413 | Ga0495598_0000140 | |||
| 2414 | Ga0495609_0067124 | |||
| 2415 | Ga0495621_0014113 | |||
| 2416 | Ga0495645_0000003 | |||
| 2417 | Ga0495645_0000368 | |||
| 2418 | Ga0495622_0000475 | |||
| 2419 | Ga0495622_0042530 | |||
| 2420 | Ga0495622_0177991 | |||
| 2421 | Ga0495633_0002619 | |||
| 2422 | Ga0495633_0057612 | |||
| 2423 | Ga0495667_0000348 | |||
| 2424 | Ga0495667_0000924 | |||
| 2425 | Ga0495667_0003684 | |||
| 2426 | Ga0495667_0012454 | |||
| 2427 | Ga0495667_0058752 | |||
| 2428 | Ga0495667_0087941 | |||
| 2429 | Ga0495656_0003815 | |||
| 2430 | Ga0495656_0034213 | |||
| 2431 | Ga0495656_0083205 | |||
| 2432 | Ga0495634_0002858 | |||
| 2433 | Ga0495634_0022289 | |||
| 2434 | Ga0495634_0070470 | |||
| 2435 | Ga0495634_0157692 | |||
| 2436 | Ga0495611_0017687 | |||
| 2437 | Ga0495635_0000025 | |||
| 2438 | Ga0495635_0006673 | |||
| 2439 | Ga0495635_0027534 | |||
| 2440 | Ga0495635_0041863 | |||
| 2441 | Ga0495635_0065217 | |||
| 2442 | Ga0495635_0079906 | |||
| 2443 | Ga0495635_0095517 | |||
| 2444 | Ga0495635_0099769 | |||
| 2445 | Ga0495659_0019320 | |||
| 2446 | Ga0495659_0034592 | |||
| 2447 | Ga0495661_0000231 | |||
| 2448 | Ga0495661_0018462 | |||
| 2449 | Ga0495661_0080871 | |||
| 2450 | Ga0495588_0036586 | |||
| 2451 | Ga0495657_0000702 | |||
| 2452 | Ga0495657_0004204 | |||
| 2453 | Ga0495657_0024030 | |||
| 2454 | Ga0495657_0032715 | |||
| 2455 | Ga0495657_0162450 | |||
| 2456 | Ga0495657_0167661 | |||
| 2457 | Ga0495599_0000067 | |||
| 2458 | Ga0495599_0003519 | |||
| 2459 | Ga0495599_0004649 | |||
| 2460 | Ga0495599_0007202 | |||
| 2461 | Ga0495623_0003596 | |||
| 2462 | Ga0495623_0004477 | |||
| 2463 | Ga0495623_0007246 | |||
| 2464 | Ga0495646_0000056 | |||
| 2465 | Ga0495646_0003759 | |||
| 2466 | Ga0495646_0005604 | |||
| 2467 | Ga0495646_0032527 | |||
| 2468 | Ga0495646_0098444 | |||
| 2469 | Ga0495647_0009175 | |||
| 2470 | Ga0495647_0014464 | |||
| 2471 | Ga0495647_0070924 | |||
| 2472 | Ga0495647_0081062 | |||
| 2473 | Ga0495658_0000926 | |||
| 2474 | Ga0495658_0019706 | |||
| 2475 | Ga0495658_0023629 | |||
| 2476 | Ga0495658_0060775 | |||
| 2477 | Ga0495669_0096300 | |||
| 2478 | Ga0495613_0008018 | |||
| 2479 | Ga0495613_0013064 | |||
| 2480 | Ga0495613_0059072 | |||
| 2481 | Ga0495613_0109731 | |||
| 2482 | Ga0495613_0133870 | |||
| 2483 | Ga0495624_0003694 | |||
| 2484 | Ga0495624_0046492 | |||
| 2485 | Ga0495624_0060680 | |||
| 2486 | Ga0495624_0142085 | |||
| 2487 | Ga0495624_0219090 | |||
| 2488 | Ga0495624_0249052 | |||
| 2489 | Ga0495670_0006044 | |||
| 2490 | Ga0495670_0024717 | |||
| 2491 | Ga0495670_0100383 | |||
| 2492 | Ga0495670_0263001 | |||
| 2493 | Ga0495671_0022458 | |||
| 2494 | Ga0495649_0002592 | |||
| 2495 | Ga0495649_0112213 | |||
| 2496 | Ga0495589_0008275 | |||
| 2497 | Ga0495600_0000009 | |||
| 2498 | Ga0495600_0024963 | |||
| 2499 | Ga0495600_0037632 | |||
| 2500 | Ga0495581_0014737 | |||
| 2501 | Ga0495581_0032334 | |||
| 2502 | Ga0495581_0052618 | |||
| 2503 | Ga0495581_0062029 | |||
| 2504 | Ga0495581_0092986 | |||
| 2505 | Ga0495581_0125439 | |||
| 2506 | Ga0495604_0000026 | |||
| 2507 | Ga0495604_0000241 | |||
| 2508 | Ga0495604_0002437 | |||
| 2509 | Ga0495604_0003490 | |||
| 2510 | Ga0495604_0009438 | |||
| 2511 | Ga0495604_0020497 | |||
| 2512 | Ga0495604_0274315 | |||
| 2513 | Ga0495674_0000954 | |||
| 2514 | Ga0495674_0005968 | |||
| 2515 | Ga0495674_0035711 | |||
| 2516 | Ga0495674_0092322 | |||
| 2517 | Ga0495674_0099261 | |||
| 2518 | Ga0495674_0100361 | |||
| 2519 | Ga0495672_0000750 | |||
| 2520 | Ga0495676_0015354 | |||
| 2521 | Ga0495676_0048928 | |||
| 2522 | Ga0495680_0001881 | |||
| 2523 | Ga0495680_0004941 | |||
| 2524 | Ga0495680_0005395 | |||
| 2525 | Ga0495680_0007514 | |||
| 2526 | Ga0495680_0011972 | |||
| 2527 | Ga0495680_0013738 | |||
| 2528 | Ga0495680_0019796 | |||
| 2529 | Ga0495680_0070395 | |||
| 2530 | Ga0495680_0092948 | |||
| 2531 | Ga0495680_0162010 | |||
| 2532 | Ga0495675_0000179 | |||
| 2533 | Ga0495675_0012831 | |||
| 2534 | Ga0495675_0054320 | |||
| 2535 | Ga0495675_0073000 | |||
| 2536 | Ga0495673_0000406 | |||
| 2537 | Ga0495681_0011965 | |||
| 2538 | Ga0495684_0000018 | |||
| 2539 | Ga0495684_0002950 | |||
| 2540 | Ga0495684_0029433 | |||
| 2541 | Ga0495684_0046727 | |||
| 2542 | Ga0495684_0112208 | |||
| 2543 | Ga0495684_0164958 | |||
| 2544 | Ga0495593_0003105 | |||
| 2545 | Ga0495593_0004853 | |||
| 2546 | Ga0495593_0021597 | |||
| 2547 | Ga0495593_0039403 | |||
| 2548 | Ga0495602_0000023 | |||
| 2549 | Ga0495602_0000791 | |||
| 2550 | Ga0495602_0010363 | |||
| 2551 | Ga0495602_0011377 | |||
| 2552 | Ga0495602_0063552 | |||
| 2553 | Ga0495602_0097997 | |||
| 2554 | Ga0495602_0213136 | |||
| 2555 | Ga0495614_0026477 | |||
| 2556 | Ga0495614_0056694 | |||
| 2557 | Ga0495626_0104847 | |||
| 2558 | Ga0496100_0002357 | |||
| 2559 | Ga0496100_0002901 | |||
| 2560 | Ga0496100_0038159 | |||
| 2561 | Ga0496100_0065497 | |||
| 2562 | Ga0496100_0100815 | |||
| 2563 | Ga0496101_0004241 | |||
| 2564 | Ga0496101_0007358 | |||
| 2565 | Ga0496101_0011622 | |||
| 2566 | Ga0496101_0030972 | |||
| 2567 | Ga0496101_0031420 | |||
| 2568 | Ga0496101_0161055 | |||
| 2569 | Ga0496101_0374729 | |||
| 2570 | Ga0496102_0001843 | |||
| 2571 | Ga0496102_0013181 | |||
| 2572 | Ga0496102_0027651 | |||
| 2573 | Ga0496102_0077525 | |||
| 2574 | Ga0496102_0094781 | |||
| 2575 | Ga0496102_0117444 | |||
| 2576 | Ga0496102_0317585 | |||
| 2577 | Ga0496102_0335643 | |||
| 2578 | Ga0496103_0029906 | |||
| 2579 | Ga0496103_0040359 | |||
| 2580 | Ga0496103_0041708 | |||
| 2581 | Ga0496103_0045935 | |||
| 2582 | Ga0496103_0133260 | |||
| 2583 | Ga0496104_0000065 | |||
| 2584 | Ga0496104_0001905 | |||
| 2585 | Ga0496104_0002630 | |||
| 2586 | Ga0496104_0006160 | |||
| 2587 | Ga0496104_0012919 | |||
| 2588 | Ga0496104_0027928 | |||
| 2589 | Ga0496104_0069961 | |||
| 2590 | Ga0496104_0373441 | |||
| 2591 | Ga0496105_0000530 | |||
| 2592 | Ga0496105_0002467 | |||
| 2593 | Ga0496105_0002813 | |||
| 2594 | Ga0496105_0008513 | |||
| 2595 | Ga0496105_0022754 | |||
| 2596 | Ga0496105_0025339 | |||
| 2597 | Ga0496105_0043540 | |||
| 2598 | Ga0496105_0058791 | |||
| 2599 | Ga0496105_0490315 | |||
| 2600 | Ga0496106_0001336 | |||
| 2601 | Ga0496106_0006847 | |||
| 2602 | Ga0496106_0009949 | |||
| 2603 | Ga0496106_0042090 | |||
| 2604 | Ga0496106_0045658 | |||
| 2605 | Ga0496106_0052632 | |||
| 2606 | Ga0496106_0054048 | |||
| 2607 | Ga0496106_0055401 | |||
| 2608 | Ga0496106_0060581 | |||
| 2609 | Ga0496106_0116699 | |||
| 2610 | Ga0496106_0228273 | |||
| 2611 | Ga0496106_0496535 | |||
| 2612 | Ga0496107_0015297 | |||
| 2613 | Ga0496107_0043258 | |||
| 2614 | Ga0496107_0051543 | |||
| 2615 | Ga0496107_0086624 | |||
| 2616 | Ga0496107_0098319 | |||
| 2617 | Ga0496107_0125467 | |||
| 2618 | Ga0496107_0339822 | |||
| 2619 | Ga0496108_0001786 | |||
| 2620 | Ga0496108_0028823 | |||
| 2621 | Ga0496108_0059566 | |||
| 2622 | Ga0496108_0073397 | |||
| 2623 | Ga0496108_0115032 | |||
| 2624 | Ga0496108_0218541 | |||
| 2625 | Ga0496108_0599670 | |||
| 2626 | Ga0496109_0001112 | |||
| 2627 | Ga0496109_0007518 | |||
| 2628 | Ga0496109_0024548 | |||
| 2629 | Ga0496109_0027034 | |||
| 2630 | Ga0496109_0035792 | |||
| 2631 | Ga0496109_0173154 | |||
| 2632 | Ga0496110_0001899 | |||
| 2633 | Ga0496110_0019661 | |||
| 2634 | Ga0496110_0027305 | |||
| 2635 | Ga0496110_0060404 | |||
| 2636 | Ga0496110_0087494 | |||
| 2637 | Ga0496110_0209339 | |||
| 2638 | Ga0496110_0234620 | |||
| 2639 | Ga0496111_0001319 | |||
| 2640 | Ga0496111_0007712 | |||
| 2641 | Ga0496111_0023200 | |||
| 2642 | Ga0496111_0032913 | |||
| 2643 | Ga0496112_0002554 | |||
| 2644 | Ga0496112_0035383 | |||
| 2645 | Ga0496112_0100582 | |||
| 2646 | Ga0496112_0125243 | |||
| 2647 | Ga0496112_0174239 | |||
| 2648 | Ga0496112_0257302 | |||
| 2649 | Ga0496113_0000266 | |||
| 2650 | Ga0496113_0047744 | |||
| 2651 | Ga0496113_0049923 | |||
| 2652 | Ga0496113_0148203 | |||
| 2653 | Ga0496113_0259366 | |||
| 2654 | Ga0496114_0006728 | |||
| 2655 | Ga0496114_0009408 | |||
| 2656 | Ga0496114_0018598 | |||
| 2657 | Ga0496114_0071933 | |||
| 2658 | Ga0496114_0105351 | |||
| 2659 | Ga0496114_0596528 | |||
| 2660 | Ga0496115_0001664 | |||
| 2661 | Ga0496115_0010192 | |||
| 2662 | Ga0496115_0014231 | |||
| 2663 | Ga0496115_0022658 | |||
| 2664 | Ga0496115_0038237 | |||
| 2665 | Ga0496115_0057353 | |||
| 2666 | Ga0496115_0151144 | |||
| 2667 | Ga0496115_0257633 | |||
| 2668 | Ga0496117_0023535 | |||
| 2669 | Ga0496118_0005352 | |||
| 2670 | Ga0496121_0000099 | |||
| 2671 | Ga0496124_0000962 | |||
| 2672 | Ga0496125_0020074 | |||
| 2673 | Ga0496126_0007633 | |||
| 2674 | Ga0495678_007784 | |||
| 2675 | Ga0495682_0000184 | |||
| 2676 | Ga0501031_0036593 | |||
| 2677 | Ga0501031_0276199 | |||
| 2678 | Ga0501032_0038017 | |||
| 2679 | Ga0501033_0029459 | |||
| 2680 | Ga0501033_0240944 | |||
| 2681 | Ga0501034_0083115 | |||
| 2682 | Ga0501034_0097739 | |||
| 2683 | Ga0501034_0210195 | |||
| 2684 | Ga0501034_0604941 | |||
| 2685 | Ga0501036_0048929 | |||
| 2686 | Ga0501037_0114155 | |||
| 2687 | Ga0501037_0460972 | |||
| 2688 | Ga0501038_0011243 | |||
| 2689 | Ga0501038_0138225 | |||
| 2690 | Ga0501039_0051384 | |||
| 2691 | Ga0501039_0179674 | |||
| 2692 | Ga0501039_0492418 | |||
| 2693 | Ga0501040_0064199 | |||
| 2694 | Ga0501043_0324730 | |||
| 2695 | Ga0501047_0015958 | |||
| 2696 | Ga0501047_0061436 | |||
| 2697 | Ga0501047_0189861 | |||
| 2698 | Ga0501047_0252931 | |||
| 2699 | Ga0501047_0656100 | |||
| 2700 | Ga0501048_0192887 | |||
| 2701 | Ga0501070_0136061 | |||
| 2702 | Ga0501070_0203298 | |||
| 2703 | Ga0501070_0255385 | |||
| 2704 | Ga0501070_0279103 | |||
| 2705 | Ga0501073_0145691 | |||
| 2706 | Ga0501073_0230532 | |||
| 2707 | Ga0501076_0156076 | |||
| 2708 | Ga0501076_0331141 | |||
| 2709 | Ga0501076_0541743 | |||
| 2710 | Ga0501079_0027171 | |||
| 2711 | Ga0501079_0408836 | |||
| 2712 | Ga0501079_0432103 | |||
| 2713 | Ga0501080_0304823 | |||
| 2714 | Ga0501080_0363950 | |||
| 2715 | Ga0501080_0470144 | |||
| 2716 | Ga0501081_0207592 | |||
| 2717 | Ga0501083_0033131 | |||
| 2718 | Ga0501035_0035025 | |||
| 2719 | Ga0501035_0287387 | |||
| 2720 | Ga0501044_0079159 | |||
| 2721 | Ga0501044_0202501 | |||
| 2722 | nmdc:mga03n38_251421_c1 | |||
| 2723 | nmdc:mga03n38_84057_c1 | |||
| 2724 | nmdc:mga0yw44_204314_c1 | |||
| 2725 | nmdc:mga0yw44_20898_c1 | |||
| 2726 | nmdc:mga0yw44_78314_c1 | |||
| 2727 | nmdc:mga06z11_51893_c1 | |||
| 2728 | nmdc:mga07m45_24160_c1 | |||
| 2729 | nmdc:mga05p37_115441_c1 | |||
| 2730 | nmdc:mga05p37_129_c1 | |||
| 2731 | nmdc:mga05p37_17690_c2 | |||
| 2732 | nmdc:mga05p37_7502_c1 | |||
| 2733 | nmdc:mga09592_4064_c1 | |||
| 2734 | nmdc:mga0qj67_182398_c1 | |||
| 2735 | nmdc:mga0qj67_236874_c1 | |||
| 2736 | nmdc:mga0qj67_624_c1 | |||
| 2737 | nmdc:mga0qj67_77805_c1 | |||
| 2738 | nmdc:mga06r32_171250_c1 | |||
| 2739 | nmdc:mga06r32_21650_c1 | |||
| 2740 | nmdc:mga06r32_274962_c1 | |||
| 2741 | nmdc:mga06r32_637973_c1 | |||
| 2742 | nmdc:mga06r32_75867_c1 | |||
| 2743 | nmdc:mga06r32_8962_c1 | |||
| 2744 | nmdc:mga08y16_1130_c1 | |||
| 2745 | nmdc:mga08y16_200225_c1 | |||
| 2746 | nmdc:mga08y16_220757_c1 | |||
| 2747 | nmdc:mga08y16_23508_c1 | |||
| 2748 | nmdc:mga08y16_500794_c1 | |||
| 2749 | nmdc:mga08y16_66580_c1 | |||
| 2750 | nmdc:mga08y16_691_c1 | |||
| 2751 | nmdc:mga0n895_108190_c1 | |||
| 2752 | nmdc:mga0n895_207_c1 | |||
| 2753 | nmdc:mga0n895_215801_c1 | |||
| 2754 | nmdc:mga0n895_248829_c1 | |||
| 2755 | nmdc:mga0n895_2552_c1 | |||
| 2756 | nmdc:mga0n895_36354_c1 | |||
| 2757 | nmdc:mga0n895_439473_c1 | |||
| 2758 | nmdc:mga0n895_551320_c1 | |||
| 2759 | nmdc:mga0n895_7901_c1 | |||
| 2760 | nmdc:mga0n895_96549_c1 | |||
| 2761 | nmdc:mga0rr50_1238_c1 | |||
| 2762 | nmdc:mga0rr50_263989_c1 | |||
| 2763 | nmdc:mga0rr50_90868_c1 | |||
| 2764 | nmdc:mga08x19_173208_c1 | |||
| 2765 | nmdc:mga08x19_74333_c1 | |||
| 2766 | nmdc:mga0a205_1327_c1 | |||
| 2767 | nmdc:mga0a205_160128_c1 | |||
| 2768 | nmdc:mga0a205_16175_c1 | |||
| 2769 | nmdc:mga0a205_169439_c1 | |||
| 2770 | nmdc:mga0a205_280102_c1 | |||
| 2771 | nmdc:mga0a205_74423_c1 | |||
| 2772 | Ga0495601_0000010 | |||
| 2773 | Ga0495601_0000152 | |||
| 2774 | Ga0495601_0002459 | |||
| 2775 | Ga0495601_0014626 | |||
| 2776 | Ga0495601_0035572 | |||
| 2777 | Ga0495601_0044469 | |||
| 2778 | Ga0495601_0360140 | |||
| 2779 | Ga0495612_0000109 | |||
| 2780 | Ga0495612_0000244 | |||
| 2781 | Ga0495612_0000428 | |||
| 2782 | Ga0495612_0014095 | |||
| 2783 | Ga0495612_0150218 | |||
| 2784 | Ga0495655_0005486 | |||
| 2785 | Ga0495595_0000056 | |||
| 2786 | Ga0495595_0000474 | |||
| 2787 | Ga0495595_0000594 | |||
| 2788 | Ga0495595_0004440 | |||
| 2789 | Ga0495595_0006954 | |||
| 2790 | Ga0495595_0010934 | |||
| 2791 | Ga0495619_0000112 | |||
| 2792 | Ga0495619_0000115 | |||
| 2793 | Ga0495619_0000544 | |||
| 2794 | Ga0495619_0001076 | |||
| 2795 | Ga0495619_0001854 | |||
| 2796 | Ga0495619_0002853 | |||
| 2797 | Ga0495619_0002886 | |||
| 2798 | Ga0495619_0030456 | |||
| 2799 | Ga0495619_0093984 | |||
| 2800 | Ga0495619_0153328 | |||
| 2801 | Ga0500651_0007140 | |||
| 2802 | Ga0500651_0172389 | |||
| 2803 | Ga0500566_0056733 | |||
| 2804 | Ga0500641_0033235 | |||
| 2805 | Ga0500595_006831 | |||
| 2806 | Ga0500595_020963 | |||
| 2807 | Ga0500608_012444 | |||
| 2808 | Ga0500618_007629 | |||
| 2809 | Ga0500559_0118551 | |||
| 2810 | Ga0500604_0049470 | |||
| 2811 | Ga0500639_054919 | |||
| 2812 | Ga0500639_078936 | |||
| 2813 | Ga0500636_0008287 | |||
| 2814 | Ga0501084_0142406 | |||
| 2815 | Ga0501082_0159702 | |||
| 2816 | Ga0501082_0238356 | |||
| 2817 | Ga0501082_0414723 | |||
| 2818 | Ga0530510_0104738 | |||
| 2819 | Ga0530510_0345010 | |||
| 2820 | 2889919772 | |||
| 2821 | 2922387780 | |||
| 2822 | 3003935883 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4za2-assembly1.cif.gz_C | crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ | 0.9423 | 9 | 270 |
| 8hs9-assembly2.cif.gz_E | brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t | 0.9356 | 10 | 266 |
| 4za2-assembly1.cif.gz_B | crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ | 0.9337 | 9 | 267 |
| 8jfi-assembly2.cif.gz_E | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori | 0.9336 | 17 | 266 |
| 3sj7-assembly1.cif.gz_B-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9325 | 17 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9398 | 17 | 49 | 3.50.50.60 |
| af_Q0JDN0_53_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9347 | 17 | 209 | 3.40.50.720 |
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9345 | 17 | 49 | 3.50.50.60 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9311 | 7 | 200 | 3.40.50.720 |
| 3cxrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9294 | 9 | 265 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A6EGH0-F1-model_v4 | Putative short-chain dehydrogenase | 0.9681 | 13 | 157 |
GO:0016616
GO:0030497 |
| AF-A0A2A8MD93-F1-model_v4 | deleted | 0.9626 | 10 | 154 |
|
| AF-A0A382LVV8-F1-model_v4 | Uncharacterized protein | 0.9624 | 13 | 189 |
GO:0016491
|
| AF-A0A399YVS1-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9595 | 10 | 192 |
GO:0016616
|
| AF-A0A836X0L3-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9592 | 13 | 157 |
GO:0016616
GO:0030497 |