F493757

General Info

Members Datasets Scaffolds Average Seq Length
1411 479 2822 264

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0131908|Ga0466962_0131908_49_963
Length 304
Sequence MPGLVPGIHALMPFNKEDVDGRDKPGHDEKRDRGRNTMSESFLKNPLALFDIRGKTAIVTGASGAFGALAAKTLAGAGANVVLAASKQADLDRISGECQGLGAKTATVAARPDSEENCQKIVDAAVKVFGGVDILVVAGGLNKVSKIVDQKYDDFLDVMDANVNQSWLMARAAGKQMLAQGRGGKVILTSSARGLLGHPAGYTAYCASKSAVDGITKALGCEWGETGITVNALGPTVFRSPLTAWMYEDTERAQTVRKGFLARVPKGRLGEPEDLAGPLLFLASKASDFYTGHILYADGGYTAG

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
18 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
140 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
158 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
246 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
261 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
262 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
263 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
264 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
265 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
266 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
286 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
287 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
288 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
289 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
290 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
291 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
306 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
311 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
346 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
347 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
364 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
375 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
376 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
377 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
378 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
379 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
380 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
381 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
382 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
424 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
439 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
462 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
463 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
464 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
465 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
466 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
467 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
468 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
469 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
470 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
471 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
472 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
473 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
477 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
478 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
479 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0.07
Rhizoplane 7.8
Rhizosphere 88.87
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0131908 3300061719 Bacteria 1208
2 2214544921 2209111006 Bacteria 20123
3 ARcpr5oldR_c000060 3300000041 Bacteria 20201
4 ARSoilYngRDRAFT_c00026 3300000042 Bacteria 22507
5 ARcpr5yngRDRAFT_c000062 3300000043 Bacteria 17597
6 ARSoilOldRDRAFT_c000014 3300000044 Bacteria 41686
7 ARCol0oldRDRAFT_c00135 3300000045 Bacteria 6631
8 ARCol0yngRDRAFT_1000075 3300000652 Bacteria 18624
9 JGI24739J22299_10001621 3300001989 Bacteria 8543
10 JGI24737J22298_10002215 3300001990 Bacteria 6928
11 JGI24737J22298_10003103 3300001990 Bacteria 5888
12 JGI24743J22301_10005752 3300001991 Bacteria 2083
13 JGI24750J21931_1000414 3300002070 Bacteria 7081
14 JGI24748J21848_1012436 3300002074 Bacteria 1004
15 JGI24744J21845_10005703 3300002077 Bacteria 2579
16 JGI24034J26672_10003479 3300002239 Bacteria 2198
17 JGI25405J52794_10002656 3300003911 Bacteria 3094
18 JGI25405J52794_10009957 3300003911 Bacteria 1803
19 Ga0065717_1001992 3300005276 Bacteria 4001
20 Ga0065716_1000064 3300005277 Bacteria 3112
21 Ga0065704_10089598 3300005289 Bacteria 2846
22 Ga0065712_10004414 3300005290 Bacteria 8856
23 Ga0065715_10003211 3300005293 Bacteria 6280
24 Ga0065715_10089057 3300005293 Bacteria 15452
25 Ga0065707_10168922 3300005295 Bacteria 1500
26 Ga0070658_10016413 3300005327 Bacteria 5925
27 Ga0070658_10080771 3300005327 Bacteria 2671
28 Ga0070658_10384811 3300005327 Bacteria 1204
29 Ga0070676_10004642 3300005328 Bacteria 7256
30 Ga0070676_10114479 3300005328 Bacteria 1684
31 Ga0070683_100013090 3300005329 Bacteria 7224
32 Ga0070683_100247020 3300005329 Bacteria 1697
33 Ga0070683_100420727 3300005329 Bacteria 1274
34 Ga0070683_100476657 3300005329 Bacteria 1191
35 Ga0070690_100006650 3300005330 Bacteria 6568
36 Ga0070690_100014960 3300005330 Bacteria 4615
37 Ga0070690_100042844 3300005330 Bacteria 2868
38 Ga0070670_100015971 3300005331 Bacteria 6442
39 Ga0070670_100044755 3300005331 Bacteria 3805
40 Ga0070670_100045922 3300005331 Bacteria 3755
41 Ga0070670_100381056 3300005331 Bacteria 1242
42 Ga0070677_10001512 3300005333 Bacteria 7364
43 Ga0068869_100012157 3300005334 Bacteria 5677
44 Ga0070666_10115017 3300005335 Bacteria 1863
45 Ga0070666_10141668 3300005335 Bacteria 1675
46 Ga0070666_10168732 3300005335 Bacteria 1532
47 Ga0070680_100117959 3300005336 Bacteria 2213
48 Ga0070680_100119686 3300005336 Bacteria 2197
49 Ga0070680_100211920 3300005336 Bacteria 1634
50 Ga0070680_100366804 3300005336 Bacteria 1225
51 Ga0070682_100010796 3300005337 Bacteria 5195
52 Ga0070682_100060305 3300005337 Bacteria 2399
53 Ga0070682_100253187 3300005337 Bacteria 1271
54 Ga0070682_100261130 3300005337 Bacteria 1253
55 Ga0068868_100008008 3300005338 Bacteria 7552
56 Ga0068868_100464130 3300005338 Bacteria 1103
57 Ga0070660_100018941 3300005339 Bacteria 5039
58 Ga0070660_100019654 3300005339 Bacteria 4953
59 Ga0070660_100082499 3300005339 Bacteria 2524
60 Ga0070660_100112362 3300005339 Bacteria 2168
61 Ga0070689_100008904 3300005340 Bacteria 7097
62 Ga0070691_10008977 3300005341 Bacteria 4573
63 Ga0070691_10054822 3300005341 Bacteria 1909
64 Ga0070687_100000508 3300005343 Bacteria 13021
65 Ga0070687_100003462 3300005343 Bacteria 6133
66 Ga0070661_100026333 3300005344 Bacteria 4182
67 Ga0070661_100083424 3300005344 Bacteria 2360
68 Ga0070661_100551902 3300005344 Bacteria 927
69 Ga0070692_10009171 3300005345 Bacteria 4449
70 Ga0070692_10089731 3300005345 Bacteria 1669
71 Ga0070668_100048995 3300005347 Bacteria 3250
72 Ga0070668_100195731 3300005347 Bacteria 1658
73 Ga0070669_100004442 3300005353 Bacteria 10112
74 Ga0070675_100010960 3300005354 Bacteria 7095
75 Ga0070675_100063520 3300005354 Bacteria 3052
76 Ga0070671_100009960 3300005355 Bacteria 7632
77 Ga0070671_100015285 3300005355 Bacteria 6198
78 Ga0070671_100034762 3300005355 Bacteria 4173
79 Ga0070671_100042377 3300005355 Bacteria 3783
80 Ga0070671_100116676 3300005355 Bacteria 2244
81 Ga0070671_100127818 3300005355 Bacteria 2140
82 Ga0070674_100038698 3300005356 Bacteria 3216
83 Ga0070674_100067551 3300005356 Bacteria 2515
84 Ga0070674_100176136 3300005356 Bacteria 1634
85 Ga0070673_100010845 3300005364 Bacteria 6192
86 Ga0070673_100027965 3300005364 Bacteria 4187
87 Ga0070673_100048450 3300005364 Bacteria 3313
88 Ga0070673_100058113 3300005364 Bacteria 3057
89 Ga0070688_100021684 3300005365 Bacteria 3755
90 Ga0070688_100064577 3300005365 Bacteria 2323
91 Ga0070659_100009719 3300005366 Bacteria 7065
92 Ga0070659_100717367 3300005366 Bacteria 866
93 Ga0070667_100053888 3300005367 Bacteria 3395
94 Ga0070667_100538288 3300005367 Bacteria 1073
95 Ga0070703_10004977 3300005406 Bacteria 3708
96 Ga0070703_10005901 3300005406 Bacteria 3430
97 Ga0070703_10011121 3300005406 Bacteria 2542
98 Ga0070709_10029207 3300005434 Bacteria 3296
99 Ga0070709_10030267 3300005434 Bacteria 3247
100 Ga0070709_10063573 3300005434 Bacteria 2358
101 Ga0070709_10114227 3300005434 Bacteria 1820
102 Ga0070709_10244267 3300005434 Unclassified 1290
103 Ga0070714_100025708 3300005435 Bacteria 4861
104 Ga0070714_100094055 3300005435 Bacteria 2630
105 Ga0070714_100569741 3300005435 Bacteria 1085
106 Ga0070713_100010962 3300005436 Bacteria 6574
107 Ga0070713_100095164 3300005436 Bacteria 2569
108 Ga0070713_100219392 3300005436 Bacteria 1725
109 Ga0070713_100288106 3300005436 Bacteria 1508
110 Ga0070713_100355787 3300005436 Bacteria 1359
111 Ga0070713_100618880 3300005436 Bacteria 1030
112 Ga0070713_100623566 3300005436 Bacteria 1026
113 Ga0070710_10016552 3300005437 Bacteria 3755
114 Ga0070710_10165267 3300005437 Bacteria 1375
115 Ga0070710_10334057 3300005437 Bacteria 998
116 Ga0070701_10004735 3300005438 Bacteria 5554
117 Ga0070701_10041946 3300005438 Bacteria 2333
118 Ga0070701_10048811 3300005438 Bacteria 2186
119 Ga0070711_100015125 3300005439 Bacteria 4878
120 Ga0070711_100035735 3300005439 Bacteria 3325
121 Ga0070711_100075991 3300005439 Bacteria 2380
122 Ga0070711_100088873 3300005439 Bacteria 2221
123 Ga0070711_100159402 3300005439 Bacteria 1709
124 Ga0070711_100364562 3300005439 Unclassified 1164
125 Ga0070705_100017130 3300005440 Bacteria 3778
126 Ga0070705_100137652 3300005440 Bacteria 1602
127 Ga0070700_100010230 3300005441 Bacteria 5175
128 Ga0070700_100019075 3300005441 Bacteria 3953
129 Ga0070700_100038447 3300005441 Bacteria 2916
130 Ga0070694_100006188 3300005444 Bacteria 7266
131 Ga0070694_100246189 3300005444 Bacteria 1350
132 Ga0070708_100064041 3300005445 Bacteria 3293
133 Ga0070708_100792935 3300005445 Bacteria 891
134 Ga0070663_100023888 3300005455 Bacteria 4104
135 Ga0070663_100082896 3300005455 Bacteria 2360
136 Ga0070663_100199867 3300005455 Bacteria 1559
137 Ga0070663_100280405 3300005455 Bacteria 1328
138 Ga0070678_100007085 3300005456 Bacteria 6630
139 Ga0070678_100375668 3300005456 Bacteria 1228
140 Ga0070678_100419311 3300005456 Bacteria 1166
141 Ga0070662_100053178 3300005457 Bacteria 2930
142 Ga0070662_100124026 3300005457 Bacteria 1983
143 Ga0070662_100190308 3300005457 Bacteria 1622
144 Ga0070681_10030704 3300005458 Bacteria 5392
145 Ga0070681_10042345 3300005458 Bacteria 4563
146 Ga0070681_10058918 3300005458 Bacteria 3820
147 Ga0070681_10257357 3300005458 Bacteria 1658
148 Ga0068867_100030148 3300005459 Bacteria 3912
149 Ga0068867_100464101 3300005459 Bacteria 1082
150 Ga0070685_10003206 3300005466 Bacteria 8326
151 Ga0070685_10022671 3300005466 Bacteria 3426
152 Ga0070685_10079920 3300005466 Bacteria 1958
153 Ga0070706_100783231 3300005467 Bacteria 883
154 Ga0070707_100699583 3300005468 Bacteria 976
155 Ga0074259_10498539 3300005507 Bacteria 1565
156 Ga0070679_100016311 3300005530 Bacteria 7160
157 Ga0070679_100034201 3300005530 Bacteria 5037
158 Ga0070679_100071215 3300005530 Bacteria 3467
159 Ga0070679_100199105 3300005530 Bacteria 1970
160 Ga0070679_100500161 3300005530 Bacteria 1159
161 Ga0070684_100019448 3300005535 Bacteria 5618
162 Ga0070684_100031373 3300005535 Bacteria 4523
163 Ga0070684_100100549 3300005535 Bacteria 2582
164 Ga0070684_100150484 3300005535 Bacteria 2108
165 Ga0070684_100672373 3300005535 Bacteria 964
166 Ga0070697_100162182 3300005536 Bacteria 1889
167 Ga0070697_100199875 3300005536 Bacteria 1699
168 Ga0070697_100212243 3300005536 Bacteria 1648
169 Ga0068853_100007915 3300005539 Bacteria 8523
170 Ga0068853_100320027 3300005539 Bacteria 1438
171 Ga0070672_100002557 3300005543 Bacteria 11597
172 Ga0070686_100011589 3300005544 Bacteria 5004
173 Ga0070686_100014959 3300005544 Bacteria 4482
174 Ga0070686_100067461 3300005544 Bacteria 2331
175 Ga0070686_100305966 3300005544 Bacteria 1180
176 Ga0070686_100318544 3300005544 Bacteria 1159
177 Ga0070695_100004179 3300005545 Bacteria 8443
178 Ga0070695_100150537 3300005545 Bacteria 1623
179 Ga0070696_100017134 3300005546 Bacteria 4889
180 Ga0070696_100029007 3300005546 Bacteria 3778
181 Ga0070696_100034849 3300005546 Bacteria 3464
182 Ga0070696_100220956 3300005546 Bacteria 1421
183 Ga0070693_100000598 3300005547 Bacteria 16004
184 Ga0070693_100073417 3300005547 Bacteria 2021
185 Ga0070665_100131167 3300005548 Bacteria 2508
186 Ga0070665_100374236 3300005548 Bacteria 1431
187 Ga0070665_100402492 3300005548 Bacteria 1377
188 Ga0070704_100001411 3300005549 Bacteria 12808
189 Ga0070704_100001845 3300005549 Bacteria 11678
190 Ga0068855_100105869 3300005563 Bacteria 3234
191 Ga0068855_100142314 3300005563 Bacteria 2732
192 Ga0070664_100022064 3300005564 Bacteria 5251
193 Ga0070664_100114112 3300005564 Bacteria 2360
194 Ga0068857_100003946 3300005577 Bacteria 12488
195 Ga0068857_100114348 3300005577 Bacteria 2427
196 Ga0068857_100151095 3300005577 Bacteria 2104
197 Ga0068854_100040125 3300005578 Bacteria 3301
198 Ga0068856_100028987 3300005614 Bacteria 5409
199 Ga0068856_100089119 3300005614 Bacteria 3068
200 Ga0068856_100188149 3300005614 Bacteria 2078
201 Ga0070702_100004124 3300005615 Bacteria 6599
202 Ga0068852_100015213 3300005616 Bacteria 5956
203 Ga0068852_100032088 3300005616 Bacteria 4344
204 Ga0068852_100355922 3300005616 Bacteria 1431
205 Ga0068859_100015209 3300005617 Bacteria 7724
206 Ga0068859_100061305 3300005617 Bacteria 3790
207 Ga0068859_100445031 3300005617 Bacteria 1392
208 Ga0068864_100059186 3300005618 Bacteria 3314
209 Ga0068864_100094360 3300005618 Bacteria 2644
210 Ga0068864_100155145 3300005618 Bacteria 2077
211 Ga0068866_10006784 3300005718 Bacteria 4778
212 Ga0068866_10314560 3300005718 Bacteria 983
213 Ga0068861_100009598 3300005719 Bacteria 6685
214 Ga0068861_100018479 3300005719 Bacteria 4967
215 Ga0068851_10064045 3300005834 Bacteria 1889
216 Ga0068870_10001856 3300005840 Bacteria 8692
217 Ga0068870_10016062 3300005840 Bacteria 3568
218 Ga0068863_100004842 3300005841 Bacteria 13256
219 Ga0068863_100014861 3300005841 Bacteria 7480
220 Ga0068863_100280571 3300005841 Bacteria 1614
221 Ga0068863_100512135 3300005841 Bacteria 1182
222 Ga0068858_100009730 3300005842 Bacteria 9155
223 Ga0068858_100031089 3300005842 Bacteria 4958
224 Ga0068858_100172483 3300005842 Bacteria 2040
225 Ga0068858_100233107 3300005842 Bacteria 1745
226 Ga0068858_100595353 3300005842 Bacteria 1072
227 Ga0068860_100031612 3300005843 Bacteria 5088
228 Ga0068860_100049035 3300005843 Bacteria 4024
229 Ga0068860_100058904 3300005843 Bacteria 3652
230 Ga0068860_100141624 3300005843 Bacteria 2312
231 Ga0068862_100001842 3300005844 Bacteria 19225
232 Ga0068862_100033969 3300005844 Bacteria 4314
233 Ga0081455_10000406 3300005937 Bacteria 56681
234 Ga0081455_10001669 3300005937 Bacteria 26910
235 Ga0081455_10009887 3300005937 Bacteria 9760
236 Ga0081455_10058719 3300005937 Bacteria 3253
237 Ga0081455_10152020 3300005937 Unclassified 1784
238 Ga0081455_10156129 3300005937 Bacteria 1754
239 Ga0081455_10350336 3300005937 Bacteria 1042
240 Ga0081455_10380543 3300005937 Bacteria 986
241 Ga0081538_10011077 3300005981 Bacteria 7333
242 Ga0081540_1001987 3300005983 Bacteria 17059
243 Ga0081540_1020979 3300005983 Bacteria 3909
244 Ga0070717_10000378 3300006028 Bacteria 28453
245 Ga0070717_10029289 3300006028 Bacteria 4415
246 Ga0070717_10054790 3300006028 Bacteria 3289
247 Ga0070717_10422148 3300006028 Bacteria 1200
248 Ga0075365_10004370 3300006038 Bacteria 7473
249 Ga0075365_10016802 3300006038 Bacteria 4462
250 Ga0075365_10125659 3300006038 Bacteria 1772
251 Ga0075368_10065421 3300006042 Bacteria 1461
252 Ga0075432_10002074 3300006058 Bacteria 6671
253 Ga0075432_10029530 3300006058 Bacteria 1893
254 Ga0075432_10044944 3300006058 Bacteria 1549
255 Ga0070715_10006900 3300006163 Bacteria 3882
256 Ga0070715_10113238 3300006163 Bacteria 1283
257 Ga0070716_100051663 3300006173 Bacteria 2337
258 Ga0070712_100002271 3300006175 Bacteria 11835
259 Ga0070712_100011210 3300006175 Bacteria 5676
260 Ga0070712_100013459 3300006175 Bacteria 5229
261 Ga0070712_100035403 3300006175 Bacteria 3389
262 Ga0070712_100097488 3300006175 Bacteria 2167
263 Ga0070712_100418994 3300006175 Bacteria 1109
264 Ga0075367_10009844 3300006178 Bacteria 5008
265 Ga0075367_10016048 3300006178 Bacteria 4083
266 Ga0075367_10259558 3300006178 Bacteria 1091
267 Ga0075427_10003100 3300006194 Bacteria 2272
268 Ga0097621_100002928 3300006237 Bacteria 11735
269 Ga0097621_100078920 3300006237 Bacteria 2735
270 Ga0068871_100012296 3300006358 Bacteria 6306
271 Ga0068871_100019961 3300006358 Bacteria 5125
272 Ga0068871_100085640 3300006358 Bacteria 2617
273 Ga0075428_100001601 3300006844 Bacteria 24210
274 Ga0075430_100001162 3300006846 Bacteria 21045
275 Ga0075430_100314640 3300006846 Bacteria 1294
276 Ga0075431_100022376 3300006847 Bacteria 6460
277 Ga0075431_100207372 3300006847 Bacteria 2003
278 Ga0075431_100378249 3300006847 Bacteria 1420
279 Ga0075433_10000068 3300006852 Bacteria 45762
280 Ga0075433_10050889 3300006852 Bacteria 3606
281 Ga0075433_10074428 3300006852 Bacteria 2989
282 Ga0075433_10077350 3300006852 Bacteria 2931
283 Ga0075434_100002956 3300006871 Bacteria 15111
284 Ga0075434_100005563 3300006871 Bacteria 11480
285 Ga0075434_100031778 3300006871 Bacteria 5205
286 Ga0075434_100064642 3300006871 Bacteria 3643
287 Ga0075434_100072623 3300006871 Bacteria 3433
288 Ga0075434_100371993 3300006871 Bacteria 1450
289 Ga0075434_100457181 3300006871 Bacteria 1298
290 Ga0075434_100609247 3300006871 Bacteria 1111
291 Ga0075429_100002047 3300006880 Bacteria 16779
292 Ga0068865_100005119 3300006881 Bacteria 7936
293 Ga0068865_100064480 3300006881 Unclassified 2578
294 Ga0068865_100150586 3300006881 Bacteria 1765
295 Ga0075436_100024355 3300006914 Bacteria 4160
296 Ga0075436_100075157 3300006914 Bacteria 2339
297 Ga0097620_100015209 3300006931 Bacteria 7724
298 Ga0097620_100061307 3300006931 Bacteria 3790
299 Ga0097620_100445004 3300006931 Bacteria 1392
300 Ga0075435_100052519 3300007076 Bacteria 3285
301 Ga0075435_100115258 3300007076 Bacteria 2237
302 Ga0075435_100139329 3300007076 Bacteria 2034
303 Ga0075435_100288024 3300007076 Unclassified 1403
304 Ga0075435_100424800 3300007076 Bacteria 1145
305 Ga0075435_100481841 3300007076 Bacteria 1072
306 Ga0099794_10004391 3300007265 Bacteria 5529
307 Ga0099794_10129173 3300007265 Bacteria 1275
308 Ga0099795_10142778 3300007788 Bacteria 975
309 Ga0105250_10101164 3300009092 Bacteria 1176
310 Ga0105240_10176065 3300009093 Bacteria 2529
311 Ga0111539_10001284 3300009094 Bacteria 33560
312 Ga0111539_10002543 3300009094 Bacteria 24151
313 Ga0111539_10032584 3300009094 Bacteria 6327
314 Ga0111539_10057660 3300009094 Bacteria 4611
315 Ga0111539_10136568 3300009094 Bacteria 2872
316 Ga0111539_10322462 3300009094 Bacteria 1798
317 Ga0105245_10031015 3300009098 Bacteria 4728
318 Ga0105245_10070005 3300009098 Bacteria 3182
319 Ga0105247_10021856 3300009101 Bacteria 3849
320 Ga0105247_10028136 3300009101 Bacteria 3400
321 Ga0105247_10142348 3300009101 Bacteria 1573
322 Ga0114129_10004127 3300009147 Bacteria 20519
323 Ga0114129_10015793 3300009147 Bacteria 10735
324 Ga0114129_10100651 3300009147 Bacteria 3999
325 Ga0105243_10008339 3300009148 Bacteria 7960
326 Ga0105243_10054689 3300009148 Bacteria 3170
327 Ga0105241_10004472 3300009174 Bacteria 10341
328 Ga0105241_10038688 3300009174 Bacteria 3596
329 Ga0105242_10017926 3300009176 Bacteria 5529
330 Ga0105242_10244928 3300009176 Bacteria 1613
331 Ga0105242_10273591 3300009176 Bacteria 1531
332 Ga0105242_10274991 3300009176 Bacteria 1527
333 Ga0105242_10524666 3300009176 Bacteria 1131
334 Ga0105248_10010313 3300009177 Bacteria 10284
335 Ga0105248_10059103 3300009177 Bacteria 4306
336 Ga0105248_10153891 3300009177 Bacteria 2594
337 Ga0105248_10615194 3300009177 Bacteria 1226
338 Ga0105237_10027346 3300009545 Bacteria 5823
339 Ga0105237_10042509 3300009545 Bacteria 4582
340 Ga0105237_10057323 3300009545 Bacteria 3899
341 Ga0105237_10091666 3300009545 Bacteria 3028
342 Ga0105237_10092507 3300009545 Bacteria 3013
343 Ga0105237_10096344 3300009545 Bacteria 2949
344 Ga0105238_10029419 3300009551 Bacteria 5596
345 Ga0105238_10051215 3300009551 Bacteria 4153
346 Ga0105238_10066723 3300009551 Bacteria 3599
347 Ga0105238_10182256 3300009551 Bacteria 2077
348 Ga0105249_10011749 3300009553 Bacteria 7698
349 Ga0105249_10032599 3300009553 Bacteria 4714
350 Ga0105249_10206037 3300009553 Bacteria 1927
351 Ga0105249_10867003 3300009553 Bacteria 969
352 Ga0099796_10011403 3300010159 Bacteria 2479
353 Ga0099796_10030202 3300010159 Bacteria 1756
354 Ga0105239_10037971 3300010375 Bacteria 5278
355 Ga0105239_10305211 3300010375 Bacteria 1793
356 Ga0105239_10606125 3300010375 Bacteria 1249
357 Ga0105246_10012998 3300011119 Bacteria 5210
358 Ga0105246_10019263 3300011119 Bacteria 4358
359 Ga0105246_10330543 3300011119 Bacteria 1242
360 Ga0157344_1002048 3300012476 Bacteria 1033
361 Ga0157341_1003625 3300012494 Bacteria 1086
362 Ga0157373_10030696 3300013100 Bacteria 3867
363 Ga0157373_10076812 3300013100 Bacteria 2357
364 Ga0157371_10017224 3300013102 Bacteria 5372
365 Ga0157371_10232139 3300013102 Bacteria 1326
366 Ga0157369_10057951 3300013105 Bacteria 4178
367 Ga0157369_10201591 3300013105 Bacteria 2088
368 Ga0157369_10249485 3300013105 Bacteria 1853
369 Ga0157369_10343645 3300013105 Bacteria 1550
370 Ga0157374_10012525 3300013296 Bacteria 7383
371 Ga0157374_10103562 3300013296 Bacteria 2731
372 Ga0157374_10655161 3300013296 Bacteria 1062
373 Ga0157378_10122934 3300013297 Bacteria 2394
374 Ga0163162_10009600 3300013306 Bacteria 9414
375 Ga0163162_10039557 3300013306 Bacteria 4713
376 Ga0163162_10168070 3300013306 Bacteria 2317
377 Ga0163162_10351515 3300013306 Bacteria 1607
378 Ga0157372_10027001 3300013307 Bacteria 6250
379 Ga0157372_10098006 3300013307 Bacteria 3344
380 Ga0157372_10208706 3300013307 Bacteria 2263
381 Ga0157372_10406561 3300013307 Bacteria 1586
382 Ga0157372_10534766 3300013307 Bacteria 1366
383 Ga0157375_10134684 3300013308 Bacteria 2593
384 Ga0157375_10255882 3300013308 Bacteria 1912
385 Ga0163163_10002001 3300014325 Bacteria 17220
386 Ga0163163_10051014 3300014325 Bacteria 4077
387 Ga0163163_10265684 3300014325 Bacteria 1767
388 Ga0163163_10364894 3300014325 Bacteria 1501
389 Ga0163163_10388359 3300014325 Bacteria 1453
390 Ga0163163_10741757 3300014325 Bacteria 1045
391 Ga0157380_10095681 3300014326 Bacteria 2461
392 Ga0157377_10002093 3300014745 Bacteria 8772
393 Ga0157377_10213676 3300014745 Bacteria 1231
394 Ga0157379_10018091 3300014968 Bacteria 6210
395 Ga0157379_10137078 3300014968 Bacteria 2205
396 Ga0157379_10215837 3300014968 Bacteria 1738
397 Ga0157379_10245089 3300014968 Bacteria 1626
398 Ga0157379_10416148 3300014968 Bacteria 1237
399 Ga0157376_10040045 3300014969 Bacteria 3827
400 Ga0157376_10229335 3300014969 Bacteria 1724
401 Ga0157376_10249255 3300014969 Bacteria 1658
402 Ga0157376_10386395 3300014969 Bacteria 1350
403 Ga0182007_10002819 3300015262 Bacteria 8466
404 Ga0163161_10005218 3300017792 Bacteria 9040
405 Ga0163161_10236031 3300017792 Bacteria 1420
406 Ga0163161_10276350 3300017792 Bacteria 1316
407 Ga0206353_10140707 3300020082 Bacteria 1050
408 Ga0224572_1001529 3300024225 Bacteria 3457
409 Ga0228598_1024548 3300024227 Bacteria 1186
410 Ga0209233_1019820 3300025261 Bacteria 1778
411 Ga0207666_1000366 3300025271 Bacteria 6107
412 Ga0207666_1001084 3300025271 Bacteria 3218
413 Ga0207673_1000238 3300025290 Bacteria 5615
414 Ga0207697_10000659 3300025315 Bacteria 19592
415 Ga0207697_10131896 3300025315 Bacteria 1080
416 Ga0207696_1052480 3300025711 Bacteria 1162
417 Ga0207653_10001549 3300025885 Bacteria 7443
418 Ga0207653_10016283 3300025885 Bacteria 2335
419 Ga0207653_10086770 3300025885 Bacteria 1091
420 Ga0207682_10003189 3300025893 Bacteria 7181
421 Ga0207692_10006112 3300025898 Bacteria 4872
422 Ga0207692_10021377 3300025898 Bacteria 2960
423 Ga0207692_10060138 3300025898 Bacteria 1964
424 Ga0207692_10085824 3300025898 Bacteria 1694
425 Ga0207642_10049737 3300025899 Bacteria 1886
426 Ga0207642_10210196 3300025899 Bacteria 1081
427 Ga0207710_10012928 3300025900 Bacteria 3516
428 Ga0207710_10046390 3300025900 Bacteria 1940
429 Ga0207710_10061053 3300025900 Bacteria 1710
430 Ga0207688_10000981 3300025901 Bacteria 14555
431 Ga0207688_10003210 3300025901 Bacteria 8924
432 Ga0207688_10024956 3300025901 Bacteria 3280
433 Ga0207688_10047876 3300025901 Bacteria 2388
434 Ga0207680_10053858 3300025903 Bacteria 2417
435 Ga0207647_10005149 3300025904 Bacteria 9621
436 Ga0207647_10017110 3300025904 Bacteria 4935
437 Ga0207647_10026615 3300025904 Bacteria 3782
438 Ga0207647_10114025 3300025904 Bacteria 1597
439 Ga0207685_10000850 3300025905 Bacteria 5728
440 Ga0207685_10088572 3300025905 Bacteria 1298
441 Ga0207699_10006806 3300025906 Bacteria 5560
442 Ga0207699_10074999 3300025906 Bacteria 2080
443 Ga0207699_10079238 3300025906 Bacteria 2032
444 Ga0207645_10001680 3300025907 Bacteria 18004
445 Ga0207645_10014284 3300025907 Bacteria 5319
446 Ga0207645_10172531 3300025907 Unclassified 1418
447 Ga0207643_10000136 3300025908 Bacteria 49812
448 Ga0207643_10001619 3300025908 Bacteria 12690
449 Ga0207705_10045339 3300025909 Bacteria 3160
450 Ga0207705_10073636 3300025909 Bacteria 2478
451 Ga0207684_10293027 3300025910 Bacteria 1403
452 Ga0207654_10030573 3300025911 Bacteria 2958
453 Ga0207707_10136957 3300025912 Bacteria 2141
454 Ga0207671_10058000 3300025914 Bacteria 2870
455 Ga0207671_10101085 3300025914 Bacteria 2184
456 Ga0207671_10131048 3300025914 Bacteria 1924
457 Ga0207671_10173793 3300025914 Bacteria 1674
458 Ga0207693_10004015 3300025915 Bacteria 12508
459 Ga0207693_10004220 3300025915 Bacteria 12189
460 Ga0207693_10006069 3300025915 Bacteria 10006
461 Ga0207693_10006883 3300025915 Bacteria 9392
462 Ga0207693_10009217 3300025915 Bacteria 8057
463 Ga0207693_10021355 3300025915 Bacteria 5145
464 Ga0207693_10041913 3300025915 Bacteria 3603
465 Ga0207693_10046350 3300025915 Bacteria 3415
466 Ga0207693_10078370 3300025915 Bacteria 2586
467 Ga0207693_10111122 3300025915 Bacteria 2149
468 Ga0207663_10040902 3300025916 Bacteria 2821
469 Ga0207663_10147583 3300025916 Bacteria 1646
470 Ga0207663_10207243 3300025916 Bacteria 1418
471 Ga0207663_10248828 3300025916 Bacteria 1307
472 Ga0207660_10004668 3300025917 Bacteria 8925
473 Ga0207660_10039771 3300025917 Bacteria 3289
474 Ga0207660_10177115 3300025917 Bacteria 1654
475 Ga0207660_10226617 3300025917 Bacteria 1468
476 Ga0207662_10000154 3300025918 Bacteria 32501
477 Ga0207662_10000164 3300025918 Bacteria 31404
478 Ga0207662_10017874 3300025918 Bacteria 4015
479 Ga0207657_10011001 3300025919 Bacteria 8995
480 Ga0207657_10019204 3300025919 Bacteria 6498
481 Ga0207657_10026615 3300025919 Bacteria 5309
482 Ga0207657_10070086 3300025919 Bacteria 2972
483 Ga0207657_10101574 3300025919 Bacteria 2387
484 Ga0207649_10103318 3300025920 Bacteria 1890
485 Ga0207649_10421886 3300025920 Bacteria 1002
486 Ga0207652_10085136 3300025921 Bacteria 2770
487 Ga0207652_10119322 3300025921 Bacteria 2346
488 Ga0207652_10147825 3300025921 Bacteria 2103
489 Ga0207652_10254321 3300025921 Bacteria 1584
490 Ga0207646_10244096 3300025922 Bacteria 1622
491 Ga0207646_10350010 3300025922 Bacteria 1335
492 Ga0207681_10123602 3300025923 Bacteria 1902
493 Ga0207681_10137814 3300025923 Unclassified 1813
494 Ga0207694_10042102 3300025924 Bacteria 3522
495 Ga0207694_10224596 3300025924 Unclassified 1532
496 Ga0207650_10008674 3300025925 Bacteria 6945
497 Ga0207650_10039708 3300025925 Bacteria 3440
498 Ga0207650_10085293 3300025925 Bacteria 2402
499 Ga0207650_10092858 3300025925 Bacteria 2309
500 Ga0207650_10214521 3300025925 Bacteria 1547
501 Ga0207659_10002828 3300025926 Bacteria 10358
502 Ga0207687_10028673 3300025927 Bacteria 3740
503 Ga0207687_10034829 3300025927 Bacteria 3422
504 Ga0207687_10053586 3300025927 Bacteria 2819
505 Ga0207700_10000118 3300025928 Bacteria 46756
506 Ga0207700_10029464 3300025928 Bacteria 3874
507 Ga0207700_10225268 3300025928 Bacteria 1591
508 Ga0207700_10254586 3300025928 Bacteria 1501
509 Ga0207700_10573149 3300025928 Bacteria 1003
510 Ga0207700_10719611 3300025928 Bacteria 892
511 Ga0207664_10025513 3300025929 Bacteria 4455
512 Ga0207664_10035107 3300025929 Bacteria 3867
513 Ga0207664_10092926 3300025929 Bacteria 2477
514 Ga0207664_10675070 3300025929 Bacteria 929
515 Ga0207644_10001008 3300025931 Bacteria 18010
516 Ga0207644_10005274 3300025931 Bacteria 8436
517 Ga0207644_10055379 3300025931 Bacteria 2858
518 Ga0207644_10118046 3300025931 Bacteria 2015
519 Ga0207644_10185171 3300025931 Bacteria 1634
520 Ga0207690_10005061 3300025932 Bacteria 7786
521 Ga0207690_10034348 3300025932 Bacteria 3267
522 Ga0207706_10003055 3300025933 Bacteria 16113
523 Ga0207706_10008247 3300025933 Bacteria 9613
524 Ga0207706_10031726 3300025933 Bacteria 4705
525 Ga0207706_10038669 3300025933 Bacteria 4232
526 Ga0207706_10041161 3300025933 Bacteria 4096
527 Ga0207706_10054909 3300025933 Bacteria 3515
528 Ga0207686_10049555 3300025934 Bacteria 2607
529 Ga0207686_10087877 3300025934 Unclassified 2045
530 Ga0207686_10405827 3300025934 Bacteria 1039
531 Ga0207709_10016937 3300025935 Bacteria 4061
532 Ga0207709_10028591 3300025935 Bacteria 3224
533 Ga0207709_10084501 3300025935 Bacteria 2055
534 Ga0207670_10007415 3300025936 Bacteria 6121
535 Ga0207670_10009236 3300025936 Bacteria 5613
536 Ga0207670_10018498 3300025936 Bacteria 4236
537 Ga0207669_10002625 3300025937 Bacteria 7693
538 Ga0207669_10031057 3300025937 Bacteria 2979
539 Ga0207669_10031384 3300025937 Bacteria 2968
540 Ga0207669_10209153 3300025937 Bacteria 1422
541 Ga0207704_10003098 3300025938 Bacteria 7514
542 Ga0207704_10336434 3300025938 Bacteria 1170
543 Ga0207665_10025306 3300025939 Bacteria 3916
544 Ga0207665_10030390 3300025939 Bacteria 3569
545 Ga0207665_10067137 3300025939 Bacteria 2442
546 Ga0207665_10100954 3300025939 Bacteria 2014
547 Ga0207665_10182806 3300025939 Bacteria 1519
548 Ga0207691_10000812 3300025940 Bacteria 31085
549 Ga0207691_10002456 3300025940 Bacteria 18130
550 Ga0207691_10206046 3300025940 Bacteria 1710
551 Ga0207711_10044922 3300025941 Bacteria 3773
552 Ga0207711_10136770 3300025941 Bacteria 2201
553 Ga0207711_10188980 3300025941 Bacteria 1876
554 Ga0207711_10289120 3300025941 Bacteria 1510
555 Ga0207711_10441143 3300025941 Bacteria 1211
556 Ga0207689_10000427 3300025942 Bacteria 39477
557 Ga0207689_10009817 3300025942 Bacteria 8250
558 Ga0207689_10063205 3300025942 Bacteria 3045
559 Ga0207661_10031070 3300025944 Bacteria 4120
560 Ga0207661_10217548 3300025944 Bacteria 1687
561 Ga0207661_10467352 3300025944 Bacteria 1150
562 Ga0207679_10000853 3300025945 Bacteria 19597
563 Ga0207667_10058200 3300025949 Bacteria 4055
564 Ga0207667_10204823 3300025949 Bacteria 2023
565 Ga0207667_10298671 3300025949 Bacteria 1645
566 Ga0207651_10003200 3300025960 Bacteria 8002
567 Ga0207651_10004120 3300025960 Bacteria 7260
568 Ga0207651_10035784 3300025960 Bacteria 3233
569 Ga0207712_10008478 3300025961 Bacteria 6499
570 Ga0207712_10067643 3300025961 Bacteria 2558
571 Ga0207668_10013229 3300025972 Bacteria 5073
572 Ga0207668_10031378 3300025972 Bacteria 3499
573 Ga0207668_10106179 3300025972 Bacteria 2097
574 Ga0207668_10142169 3300025972 Bacteria 1847
575 Ga0207640_10005942 3300025981 Bacteria 6662
576 Ga0207640_10089427 3300025981 Bacteria 2128
577 Ga0207640_10377592 3300025981 Bacteria 1147
578 Ga0207658_10116096 3300025986 Bacteria 2125
579 Ga0207658_10340440 3300025986 Bacteria 1303
580 Ga0207658_10345981 3300025986 Bacteria 1293
581 Ga0207658_10693355 3300025986 Bacteria 920
582 Ga0207677_10020473 3300026023 Bacteria 4018
583 Ga0207677_10047073 3300026023 Bacteria 2893
584 Ga0207677_10293589 3300026023 Bacteria 1340
585 Ga0207703_10024162 3300026035 Bacteria 4782
586 Ga0207703_10038967 3300026035 Bacteria 3796
587 Ga0207703_10056116 3300026035 Bacteria 3207
588 Ga0207703_10139047 3300026035 Bacteria 2106
589 Ga0207639_10032499 3300026041 Bacteria 3841
590 Ga0207678_10005504 3300026067 Bacteria 11320
591 Ga0207678_10008889 3300026067 Bacteria 8846
592 Ga0207678_10009330 3300026067 Bacteria 8637
593 Ga0207678_10024014 3300026067 Bacteria 5328
594 Ga0207708_10001137 3300026075 Bacteria 19993
595 Ga0207708_10001264 3300026075 Bacteria 19041
596 Ga0207708_10011789 3300026075 Bacteria 6511
597 Ga0207708_10081153 3300026075 Bacteria 2492
598 Ga0207702_10020210 3300026078 Bacteria 5516
599 Ga0207702_10128387 3300026078 Bacteria 2279
600 Ga0207702_10227326 3300026078 Bacteria 1742
601 Ga0207641_10017044 3300026088 Bacteria 5945
602 Ga0207641_10035250 3300026088 Bacteria 4167
603 Ga0207641_10556088 3300026088 Bacteria 1119
604 Ga0207648_10002630 3300026089 Bacteria 19221
605 Ga0207648_10035051 3300026089 Bacteria 4424
606 Ga0207648_10393955 3300026089 Bacteria 1254
607 Ga0207676_10066657 3300026095 Bacteria 2872
608 Ga0207676_10152751 3300026095 Bacteria 1990
609 Ga0207674_10004609 3300026116 Bacteria 16553
610 Ga0207674_10036803 3300026116 Bacteria 5095
611 Ga0207674_10092714 3300026116 Bacteria 3010
612 Ga0207674_10175216 3300026116 Bacteria 2097
613 Ga0207675_100003315 3300026118 Bacteria 15757
614 Ga0207675_100011227 3300026118 Bacteria 8389
615 Ga0207675_100022088 3300026118 Bacteria 5924
616 Ga0207675_100411237 3300026118 Bacteria 1335
617 Ga0207675_100619076 3300026118 Bacteria 1087
618 Ga0207683_10008982 3300026121 Bacteria 8515
619 Ga0207698_10036199 3300026142 Bacteria 3620
620 Ga0207698_10120755 3300026142 Bacteria 2217
621 Ga0209971_1018376 3300027682 Bacteria 1659
622 Ga0209966_1002117 3300027695 Bacteria 3310
623 Ga0209998_10000576 3300027717 Bacteria 9890
624 Ga0209998_10034804 3300027717 Bacteria 1127
625 Ga0209998_10035834 3300027717 Bacteria 1113
626 Ga0209974_10018091 3300027876 Bacteria 2336
627 Ga0207428_10000150 3300027907 Bacteria 94699
628 Ga0207428_10000594 3300027907 Bacteria 42742
629 Ga0207428_10001449 3300027907 Bacteria 24817
630 Ga0268266_10161989 3300028379 Bacteria 2025
631 Ga0268266_10302644 3300028379 Bacteria 1492
632 Ga0268266_10511300 3300028379 Bacteria 1147
633 Ga0268265_10010005 3300028380 Bacteria 6403
634 Ga0268265_10024707 3300028380 Bacteria 4255
635 Ga0268264_10029947 3300028381 Bacteria 4462
636 Ga0268264_10055972 3300028381 Bacteria 3296
637 Ga0268264_10059135 3300028381 Bacteria 3210
638 Ga0268264_10264596 3300028381 Bacteria 1604
639 Ga0268264_10365138 3300028381 Bacteria 1378
640 Ga0265337_1000084 3300028556 Bacteria 45523
641 Ga0265318_10055752 3300028577 Bacteria 1478
642 Ga0265336_10046681 3300028666 Bacteria 1316
643 Ga0265338_10006542 3300028800 Bacteria 14807
644 Ga0265338_10170721 3300028800 Bacteria 1668
645 Ga0265763_1000682 3300030763 Bacteria 2182
646 Ga0265760_10034437 3300031090 Bacteria 1498
647 Ga0265330_10039971 3300031235 Bacteria 2083
648 Ga0265332_10045527 3300031238 Bacteria 1891
649 Ga0265328_10035237 3300031239 Bacteria 1851
650 Ga0265320_10032836 3300031240 Bacteria 2654
651 Ga0265325_10000004 3300031241 Bacteria 347347
652 Ga0265325_10000630 3300031241 Bacteria 25635
653 Ga0265325_10013896 3300031241 Bacteria 4569
654 Ga0265325_10060087 3300031241 Bacteria 1932
655 Ga0265325_10060873 3300031241 Bacteria 1916
656 Ga0265325_10112940 3300031241 Bacteria 1318
657 Ga0265329_10045592 3300031242 Bacteria 1401
658 Ga0265340_10001253 3300031247 Bacteria 14589
659 Ga0265340_10007664 3300031247 Bacteria 5856
660 Ga0265340_10010658 3300031247 Bacteria 4913
661 Ga0265340_10015110 3300031247 Bacteria 4016
662 Ga0265339_10000133 3300031249 Bacteria 60726
663 Ga0265339_10004348 3300031249 Bacteria 9673
664 Ga0265339_10004657 3300031249 Bacteria 9320
665 Ga0265339_10112074 3300031249 Bacteria 1410
666 Ga0265339_10194858 3300031249 Bacteria 1002
667 Ga0265331_10024291 3300031250 Bacteria 3068
668 Ga0265331_10031897 3300031250 Bacteria 2616
669 Ga0265331_10051405 3300031250 Bacteria 1972
670 Ga0265316_10016679 3300031344 Bacteria 6366
671 Ga0265316_10026680 3300031344 Bacteria 4799
672 Ga0265316_10328348 3300031344 Bacteria 1110
673 Ga0265313_10000491 3300031595 Bacteria 41687
674 Ga0265313_10000868 3300031595 Bacteria 30518
675 Ga0265313_10015380 3300031595 Bacteria 4459
676 Ga0265313_10028881 3300031595 Bacteria 2876
677 Ga0307508_10000049 3300031616 Bacteria 137413
678 Ga0316575_10006591 3300031665 Bacteria 4182
679 Ga0316579_10031010 3300031691 Bacteria 2445
680 Ga0265314_10002573 3300031711 Bacteria 18388
681 Ga0265314_10004582 3300031711 Bacteria 12763
682 Ga0265314_10085258 3300031711 Bacteria 2072
683 Ga0265314_10111772 3300031711 Bacteria 1735
684 Ga0265342_10000093 3300031712 Bacteria 98424
685 Ga0265342_10001600 3300031712 Bacteria 20914
686 Ga0265342_10009354 3300031712 Bacteria 6916
687 Ga0265342_10045417 3300031712 Bacteria 2644
688 Ga0307516_10164851 3300031730 Bacteria 1962
689 Ga0307516_10179878 3300031730 Bacteria 1849
690 Ga0316583_10000400 3300032133 Bacteria 12645
691 Ga0316583_10032496 3300032133 Bacteria 1855
692 Ga0307507_10174228 3300033179 Bacteria 1554
693 Ga0373930_0000835 3300034816 Bacteria 4367
694 Ga0373930_0006760 3300034816 Bacteria 1952
695 Ga0373948_0000254 3300034817 Bacteria 6429
696 Ga0373948_0037241 3300034817 Bacteria 1005
697 Ga0373950_0000189 3300034818 Bacteria 8659
698 Ga0373950_0007445 3300034818 Bacteria 1700
699 Ga0373950_0021088 3300034818 Bacteria 1151
700 Ga0373958_0000784 3300034819 Bacteria 4072
701 Ga0373958_0014447 3300034819 Bacteria 1381
702 Ga0373958_0041796 3300034819 Bacteria 940
703 Ga0373959_0000739 3300034820 Bacteria 5585
704 Ga0373959_0032426 3300034820 Bacteria 1061
705 Ga0373926_0000978 3300035083 Bacteria 8306
706 Ga0373926_0009827 3300035083 Bacteria 3199
707 Ga0373926_0052869 3300035083 Bacteria 1469
708 Ga0373928_0000170 3300035084 Bacteria 12621
709 Ga0373928_0002877 3300035084 Bacteria 3320
710 Ga0373929_0000249 3300035085 Bacteria 9931
711 Ga0373929_0018901 3300035085 Bacteria 1374
712 Ga0373929_0020499 3300035085 Bacteria 1333
713 Ga0373934_0035483 3300035086 Bacteria 1962
714 Ga0373934_0112996 3300035086 Bacteria 1102
715 Ga0373940_0000372 3300035088 Bacteria 6761
716 Ga0373940_0005705 3300035088 Bacteria 2715
717 Ga0373944_0019794 3300035089 Bacteria 1934
718 Ga0373949_0001262 3300035090 Bacteria 7384
719 Ga0373949_0002117 3300035090 Bacteria 5219
720 Ga0373949_0003612 3300035090 Bacteria 3645
721 Ga0373949_0004664 3300035090 Bacteria 3117
722 Ga0373951_0000237 3300035091 Bacteria 18672
723 Ga0373951_0002947 3300035091 Bacteria 4221
724 Ga0373951_0003252 3300035091 Bacteria 3976
725 Ga0373952_0001204 3300035092 Bacteria 4714
726 Ga0373923_0007009 3300035111 Bacteria 3936
727 Ga0373923_0012224 3300035111 Bacteria 3167
728 Ga0373923_0034032 3300035111 Bacteria 2066
729 Ga0373932_0000358 3300035112 Bacteria 14048
730 Ga0373932_0004563 3300035112 Bacteria 3270
731 Ga0373932_0011645 3300035112 Bacteria 2153
732 Ga0373936_0000247 3300035113 Bacteria 17940
733 Ga0373936_0008984 3300035113 Bacteria 3768
734 Ga0373936_0014000 3300035113 Bacteria 3063
735 Ga0373939_0001671 3300035114 Bacteria 5362
736 Ga0373939_0005026 3300035114 Bacteria 3142
737 Ga0373939_0005227 3300035114 Bacteria 3086
738 Ga0373939_0069815 3300035114 Bacteria 1141
739 Ga0373941_0132022 3300035115 Bacteria 900
740 Ga0373945_0000745 3300035116 Bacteria 9494
741 Ga0373945_0002295 3300035116 Bacteria 5983
742 Ga0373945_0007669 3300035116 Bacteria 3499
743 Ga0373945_0011100 3300035116 Bacteria 2973
744 Ga0373945_0033341 3300035116 Bacteria 1829
745 Ga0373953_0004566 3300035117 Bacteria 4419
746 Ga0373953_0011967 3300035117 Bacteria 3060
747 Ga0373953_0022051 3300035117 Bacteria 2397
748 Ga0373954_0000594 3300035118 Bacteria 13743
749 Ga0373954_0017468 3300035118 Bacteria 3223
750 Ga0373954_0042143 3300035118 Bacteria 2128
751 Ga0373954_0210637 3300035118 Bacteria 955
752 Ga0373956_0014225 3300035119 Bacteria 3322
753 Ga0373956_0020803 3300035119 Bacteria 2796
754 Ga0373956_0038030 3300035119 Bacteria 2128
755 Ga0373956_0058744 3300035119 Bacteria 1739
756 Ga0373957_0005882 3300035120 Bacteria 3832
757 Ga0373957_0015861 3300035120 Bacteria 2600
758 Ga0373957_0022379 3300035120 Bacteria 2252
759 Ga0373957_0026572 3300035120 Bacteria 2095
760 Ga0373957_0072208 3300035120 Bacteria 1351
761 Ga0373960_0000983 3300035121 Bacteria 6136
762 Ga0373960_0003870 3300035121 Bacteria 3409
763 Ga0373960_0004631 3300035121 Bacteria 3158
764 Ga0373960_0028890 3300035121 Bacteria 1533
765 Ga0373943_0000765 3300035170 Bacteria 14011
766 Ga0373943_0002206 3300035170 Bacteria 8854
767 Ga0373943_0027440 3300035170 Bacteria 2675
768 Ga0373943_0051014 3300035170 Bacteria 2036
769 Ga0373943_0081660 3300035170 Bacteria 1658
770 Ga0373943_0103620 3300035170 Bacteria 1491
771 Ga0373946_0005621 3300035171 Bacteria 4528
772 Ga0373946_0007520 3300035171 Bacteria 3985
773 Ga0373946_0008750 3300035171 Bacteria 3716
774 Ga0373946_0029382 3300035171 Bacteria 2187
775 Ga0373946_0047124 3300035171 Bacteria 1790
776 Ga0373946_0079515 3300035171 Bacteria 1432
777 Ga0373955_0000588 3300035172 Bacteria 15451
778 Ga0373955_0000790 3300035172 Bacteria 13580
779 Ga0373955_0006281 3300035172 Bacteria 5411
780 Ga0373955_0007878 3300035172 Bacteria 4916
781 Ga0373955_0052325 3300035172 Bacteria 2227
782 Ga0373955_0053290 3300035172 Bacteria 2208
783 Ga0373955_0160972 3300035172 Bacteria 1325
784 Ga0373955_0198559 3300035172 Bacteria 1194
785 Ga0373942_0009149 3300035207 Bacteria 2314
786 Ga0373961_0000267 3300035241 Bacteria 23637
787 Ga0373961_0011660 3300035241 Bacteria 2184
788 Ga0373961_0014287 3300035241 Bacteria 2015
789 Ga0373961_0040159 3300035241 Bacteria 1347
790 Ga0373962_0000465 3300035242 Bacteria 8943
791 Ga0373962_0022349 3300035242 Bacteria 1676
792 Ga0373924_0000311 3300035410 Bacteria 14970
793 Ga0373924_0011298 3300035410 Bacteria 3314
794 Ga0373924_0014516 3300035410 Bacteria 2979
795 Ga0373924_0024512 3300035410 Bacteria 2378
796 Ga0373924_0025071 3300035410 Bacteria 2355
797 Ga0373924_0033787 3300035410 Bacteria 2067
798 Ga0373924_0056803 3300035410 Bacteria 1631
799 Ga0373931_0000813 3300035691 Bacteria 13072
800 Ga0373931_0003284 3300035691 Bacteria 7239
801 Ga0373931_0044083 3300035691 Bacteria 2351
802 Ga0373935_0000142 3300035692 Bacteria 32758
803 Ga0373935_0007148 3300035692 Bacteria 6664
804 Ga0373935_0009871 3300035692 Bacteria 5718
805 Ga0373935_0025943 3300035692 Bacteria 3612
806 Ga0373935_0032442 3300035692 Bacteria 3246
807 Ga0373935_0114203 3300035692 Bacteria 1796
808 Ga0373935_0201129 3300035692 Bacteria 1376
809 Ga0373935_0210028 3300035692 Bacteria 1348
810 Ga0373935_0292511 3300035692 Bacteria 1149
811 Ga0373935_0297661 3300035692 Bacteria 1140
812 Ga0373935_0540772 3300035692 Bacteria 848
813 Ga0373927_0002697 3300035695 Bacteria 12932
814 Ga0373927_0003928 3300035695 Bacteria 10541
815 Ga0373927_0011494 3300035695 Bacteria 5898
816 Ga0373927_0019711 3300035695 Bacteria 4422
817 Ga0373927_0035816 3300035695 Bacteria 3228
818 Ga0373927_0057174 3300035695 Bacteria 2522
819 Ga0373927_0218229 3300035695 Bacteria 1253
820 Ga0373933_0001807 3300035724 Bacteria 12403
821 Ga0373933_0001809 3300035724 Bacteria 12395
822 Ga0373933_0001937 3300035724 Bacteria 11941
823 Ga0373933_0002756 3300035724 Bacteria 9806
824 Ga0373933_0020681 3300035724 Bacteria 3731
825 Ga0373933_0021016 3300035724 Bacteria 3703
826 Ga0373947_0000334 3300035725 Bacteria 26518
827 Ga0373947_0006737 3300035725 Bacteria 6664
828 Ga0373947_0084587 3300035725 Bacteria 1969
829 Ga0373947_0115396 3300035725 Bacteria 1701
830 Ga0373937_0000802 3300036401 Bacteria 26864
831 Ga0373937_0001597 3300036401 Bacteria 19048
832 Ga0373937_0001602 3300036401 Bacteria 19014
833 Ga0373937_0001751 3300036401 Bacteria 18265
834 Ga0373937_0004661 3300036401 Bacteria 11646
835 Ga0373937_0005134 3300036401 Bacteria 11160
836 Ga0373937_0012412 3300036401 Bacteria 7492
837 Ga0373937_0054149 3300036401 Bacteria 3681
838 Ga0373937_0180034 3300036401 Bacteria 1985
839 Ga0373925_0000152 3300037068 Bacteria 74035
840 Ga0373925_0003524 3300037068 Bacteria 12079
841 Ga0373925_0028860 3300037068 Bacteria 4067
842 Ga0373925_0061971 3300037068 Bacteria 2811
843 Ga0373925_0122106 3300037068 Bacteria 2023
844 Ga0373925_0245655 3300037068 Bacteria 1434
845 Ga0373925_0248056 3300037068 Bacteria 1427
846 Ga0395899_0011380 3300037312 Bacteria 6814
847 Ga0395899_0100109 3300037312 Bacteria 2093
848 Ga0395900_0003511 3300037418 Bacteria 16927
849 Ga0395900_0030157 3300037418 Bacteria 5567
850 Ga0395900_0056684 3300037418 Bacteria 4033
851 Ga0395898_0089239 3300037466 Bacteria 2967
852 Ga0395898_0137489 3300037466 Bacteria 2339
853 Ga0395901_0010954 3300038443 Bacteria 9186
854 Ga0395901_0013418 3300038443 Bacteria 8328
855 Ga0242420_002050 3300038996 Bacteria 2817
856 Ga0400483_151746 3300039062 Bacteria 3517
857 Ga0400483_161457 3300039062 Bacteria 1137
858 Ga0436365_0274179 3300039437 Bacteria 967
859 Ga0436365_0859425 3300039437 Bacteria 689
860 Ga0436361_0161168 3300039447 Bacteria 1252
861 Ga0436363_0176166 3300039450 Bacteria 1299
862 Ga0436363_0963225 3300039450 Bacteria 1834
863 Ga0436363_1590609 3300039450 Bacteria 3055
864 Ga0439450_006195 3300042008 Bacteria 2143
865 Ga0439464_0008939 3300042439 Bacteria 2628
866 Ga0451577_0091412 3300042876 Bacteria 2717
867 Ga0453683_0083480 3300044673 Bacteria 2002
868 Ga0466963_0039766 3300044694 Bacteria 3081
869 Ga0466963_0041028 3300044694 Bacteria 3034
870 Ga0466963_0245160 3300044694 Bacteria 1257
871 Ga0453684_0226771 3300044712 Bacteria 2160
872 Ga0466957_0044609 3300044842 Bacteria 2687
873 Ga0451576_0166909 3300045051 Bacteria 2297
874 Ga0466967_0779464 3300045976 Bacteria 949
875 Ga0495617_003311 3300046452 Bacteria 6097
876 Ga0495617_017730 3300046452 Bacteria 2406
877 Ga0495592_0000009 3300046454 Bacteria 171624
878 Ga0495592_0002207 3300046454 Bacteria 13728
879 Ga0495592_0002869 3300046454 Bacteria 12255
880 Ga0495592_0007893 3300046454 Bacteria 7980
881 Ga0495603_0001273 3300046455 Bacteria 14676
882 Ga0495603_0057352 3300046455 Bacteria 2304
883 Ga0495603_0093529 3300046455 Bacteria 1757
884 Ga0495629_0000026 3300046459 Bacteria 134719
885 Ga0495629_0003539 3300046459 Bacteria 11804
886 Ga0495629_0012950 3300046459 Bacteria 6032
887 Ga0495629_0022806 3300046459 Bacteria 4460
888 Ga0495629_0193599 3300046459 Bacteria 1407
889 Ga0495638_0000150 3300046460 Bacteria 109804
890 Ga0495638_0001385 3300046460 Bacteria 22107
891 Ga0495638_0031505 3300046460 Bacteria 3407
892 Ga0495641_0019956 3300046461 Bacteria 3415
893 Ga0495641_0110335 3300046461 Bacteria 1227
894 Ga0495651_0001594 3300046462 Bacteria 17547
895 Ga0495651_0002062 3300046462 Bacteria 15531
896 Ga0495651_0009198 3300046462 Bacteria 7587
897 Ga0495651_0014698 3300046462 Bacteria 6053
898 Ga0495651_0065667 3300046462 Bacteria 2770
899 Ga0495651_0401222 3300046462 Bacteria 895
900 Ga0495653_0001255 3300046463 Bacteria 19638
901 Ga0495653_0019067 3300046463 Bacteria 5565
902 Ga0495653_0045135 3300046463 Bacteria 3418
903 Ga0495653_0069592 3300046463 Bacteria 2636
904 Ga0495653_0178884 3300046463 Bacteria 1457
905 Ga0495580_0014189 3300046472 Bacteria 6051
906 Ga0495580_0131424 3300046472 Bacteria 1736
907 Ga0495580_0225035 3300046472 Bacteria 1288
908 Ga0495582_0003737 3300046473 Bacteria 8576
909 Ga0495605_0000743 3300046474 Bacteria 23930
910 Ga0495639_0009238 3300046475 Bacteria 4225
911 Ga0495639_0093976 3300046475 Bacteria 1410
912 Ga0495662_0014404 3300046476 Bacteria 3846
913 Ga0495662_0022251 3300046476 Bacteria 3062
914 Ga0495662_0029602 3300046476 Bacteria 2643
915 Ga0495662_0067798 3300046476 Bacteria 1727
916 Ga0495664_0000002 3300046477 Bacteria 625183
917 Ga0495664_0000375 3300046477 Bacteria 21707
918 Ga0495664_0029112 3300046477 Bacteria 3228
919 Ga0495664_0076558 3300046477 Bacteria 2002
920 Ga0495664_0141693 3300046477 Bacteria 1457
921 Ga0495584_0031215 3300046491 Bacteria 2697
922 Ga0495584_0052960 3300046491 Bacteria 2042
923 Ga0495584_0064460 3300046491 Bacteria 1842
924 Ga0495585_0005673 3300046492 Bacteria 7836
925 Ga0495585_0050299 3300046492 Bacteria 2312
926 Ga0495585_0188433 3300046492 Bacteria 1057
927 Ga0495594_0008513 3300046499 Bacteria 5288
928 Ga0495594_0028509 3300046499 Bacteria 3013
929 Ga0495594_0045999 3300046499 Bacteria 2396
930 Ga0495594_0122516 3300046499 Bacteria 1470
931 Ga0495594_0165116 3300046499 Bacteria 1259
932 Ga0495607_0007593 3300046501 Bacteria 7479
933 Ga0495607_0008723 3300046501 Bacteria 6908
934 Ga0495607_0125793 3300046501 Bacteria 1340
935 Ga0495607_0150619 3300046501 Bacteria 1191
936 Ga0495583_0075433 3300046506 Bacteria 1475
937 Ga0495608_0000032 3300046511 Bacteria 144093
938 Ga0495608_0000180 3300046511 Bacteria 45181
939 Ga0495608_0003555 3300046511 Bacteria 11163
940 Ga0495608_0011097 3300046511 Bacteria 6276
941 Ga0495608_0026249 3300046511 Bacteria 3972
942 Ga0495610_0003832 3300046512 Bacteria 11456
943 Ga0495616_0001634 3300046513 Bacteria 15368
944 Ga0495616_0043539 3300046513 Bacteria 2280
945 Ga0495618_0000114 3300046514 Bacteria 59201
946 Ga0495618_0003664 3300046514 Bacteria 9525
947 Ga0495618_0029503 3300046514 Bacteria 3423
948 Ga0495618_0052091 3300046514 Bacteria 2586
949 Ga0495618_0065232 3300046514 Bacteria 2314
950 Ga0495620_0013168 3300046515 Bacteria 4244
951 Ga0495628_0000002 3300046516 Bacteria 589399
952 Ga0495628_0001064 3300046516 Bacteria 25180
953 Ga0495628_0074879 3300046516 Bacteria 2636
954 Ga0495628_0103074 3300046516 Bacteria 2200
955 Ga0495630_0000658 3300046517 Bacteria 24993
956 Ga0495630_0012700 3300046517 Bacteria 6119
957 Ga0495630_0037134 3300046517 Bacteria 3642
958 Ga0495630_0046355 3300046517 Bacteria 3249
959 Ga0495630_0066937 3300046517 Bacteria 2700
960 Ga0495630_0114588 3300046517 Bacteria 2043
961 Ga0495630_0427865 3300046517 Bacteria 1014
962 Ga0495630_0429262 3300046517 Bacteria 1012
963 Ga0495631_0110537 3300046518 Bacteria 1182
964 Ga0495632_0002399 3300046519 Bacteria 14292
965 Ga0495632_0011697 3300046519 Bacteria 5108
966 Ga0495637_0124883 3300046520 Bacteria 987
967 Ga0495643_0003688 3300046522 Bacteria 11102
968 Ga0495644_0000690 3300046523 Bacteria 13986
969 Ga0495644_0009397 3300046523 Bacteria 3771
970 Ga0495644_0039008 3300046523 Bacteria 1791
971 Ga0495644_0121256 3300046523 Bacteria 995
972 Ga0495644_0178707 3300046523 Bacteria 816
973 Ga0495648_0000824 3300046524 Bacteria 32707
974 Ga0495663_0099245 3300046525 Bacteria 957
975 Ga0495666_0039577 3300046526 Bacteria 2288
976 Ga0495666_0121951 3300046526 Bacteria 1220
977 Ga0495666_0135713 3300046526 Bacteria 1148
978 Ga0495652_0000004 3300046529 Bacteria 588877
979 Ga0495652_0001634 3300046529 Bacteria 24442
980 Ga0495652_0020229 3300046529 Bacteria 5916
981 Ga0495652_0030318 3300046529 Bacteria 4744
982 Ga0495652_0046041 3300046529 Bacteria 3746
983 Ga0495652_0118894 3300046529 Bacteria 2111
984 Ga0495652_0255980 3300046529 Bacteria 1295
985 Ga0495654_0003511 3300046530 Bacteria 9574
986 Ga0495665_0009815 3300046531 Bacteria 5182
987 Ga0495665_0018587 3300046531 Bacteria 3734
988 Ga0495665_0022210 3300046531 Bacteria 3412
989 Ga0495640_0000016 3300046533 Bacteria 144076
990 Ga0495640_0003068 3300046533 Bacteria 13447
991 Ga0495640_0003848 3300046533 Bacteria 12041
992 Ga0495640_0012588 3300046533 Bacteria 6458
993 Ga0495640_0042809 3300046533 Bacteria 3157
994 Ga0495640_0044226 3300046533 Bacteria 3097
995 Ga0495640_0064334 3300046533 Bacteria 2480
996 Ga0495586_0023543 3300046535 Bacteria 3290
997 Ga0495587_0000018 3300046536 Bacteria 166488
998 Ga0495587_0000894 3300046536 Bacteria 19740
999 Ga0495587_0001375 3300046536 Bacteria 16171
1000 Ga0495587_0020330 3300046536 Bacteria 4099
1001 Ga0495587_0076549 3300046536 Bacteria 1943
1002 Ga0495598_0000140 3300046537 Bacteria 12324
1003 Ga0495609_0067124 3300046538 Bacteria 1580
1004 Ga0495621_0014113 3300046539 Bacteria 2523
1005 Ga0495645_0000003 3300046543 Bacteria 570133
1006 Ga0495645_0000368 3300046543 Bacteria 31407
1007 Ga0495622_0000475 3300046557 Bacteria 25362
1008 Ga0495622_0042530 3300046557 Bacteria 2112
1009 Ga0495622_0177991 3300046557 Bacteria 954
1010 Ga0495633_0002619 3300046558 Bacteria 12591
1011 Ga0495633_0057612 3300046558 Bacteria 1825
1012 Ga0495667_0000348 3300046559 Bacteria 29268
1013 Ga0495667_0000924 3300046559 Bacteria 18995
1014 Ga0495667_0003684 3300046559 Bacteria 10313
1015 Ga0495667_0012454 3300046559 Bacteria 5767
1016 Ga0495667_0058752 3300046559 Bacteria 2525
1017 Ga0495667_0087941 3300046559 Bacteria 2014
1018 Ga0495656_0003815 3300046615 Bacteria 5124
1019 Ga0495656_0034213 3300046615 Bacteria 2079
1020 Ga0495656_0083205 3300046615 Bacteria 1449
1021 Ga0495634_0002858 3300046642 Bacteria 14172
1022 Ga0495634_0022289 3300046642 Bacteria 4463
1023 Ga0495634_0070470 3300046642 Bacteria 2304
1024 Ga0495634_0157692 3300046642 Bacteria 1432
1025 Ga0495611_0017687 3300046648 Bacteria 3052
1026 Ga0495635_0000025 3300046663 Bacteria 144645
1027 Ga0495635_0006673 3300046663 Bacteria 8060
1028 Ga0495635_0027534 3300046663 Bacteria 3953
1029 Ga0495635_0041863 3300046663 Bacteria 3164
1030 Ga0495635_0065217 3300046663 Bacteria 2499
1031 Ga0495635_0079906 3300046663 Bacteria 2238
1032 Ga0495635_0095517 3300046663 Bacteria 2032
1033 Ga0495635_0099769 3300046663 Bacteria 1984
1034 Ga0495659_0019320 3300046664 Bacteria 2280
1035 Ga0495659_0034592 3300046664 Bacteria 1777
1036 Ga0495661_0000231 3300046665 Bacteria 64275
1037 Ga0495661_0018462 3300046665 Bacteria 4586
1038 Ga0495661_0080871 3300046665 Bacteria 1874
1039 Ga0495588_0036586 3300046674 Bacteria 2491
1040 Ga0495657_0000702 3300046675 Bacteria 30077
1041 Ga0495657_0004204 3300046675 Bacteria 11525
1042 Ga0495657_0024030 3300046675 Bacteria 4345
1043 Ga0495657_0032715 3300046675 Bacteria 3627
1044 Ga0495657_0162450 3300046675 Bacteria 1381
1045 Ga0495657_0167661 3300046675 Bacteria 1354
1046 Ga0495599_0000067 3300046678 Bacteria 72171
1047 Ga0495599_0003519 3300046678 Bacteria 9173
1048 Ga0495599_0004649 3300046678 Bacteria 8140
1049 Ga0495599_0007202 3300046678 Bacteria 6738
1050 Ga0495623_0003596 3300046679 Bacteria 10253
1051 Ga0495623_0004477 3300046679 Bacteria 9179
1052 Ga0495623_0007246 3300046679 Bacteria 7198
1053 Ga0495646_0000056 3300046680 Bacteria 57248
1054 Ga0495646_0003759 3300046680 Bacteria 9488
1055 Ga0495646_0005604 3300046680 Bacteria 7944
1056 Ga0495646_0032527 3300046680 Bacteria 3246
1057 Ga0495646_0098444 3300046680 Bacteria 1680
1058 Ga0495647_0009175 3300046681 Bacteria 3342
1059 Ga0495647_0014464 3300046681 Bacteria 2750
1060 Ga0495647_0070924 3300046681 Bacteria 1394
1061 Ga0495647_0081062 3300046681 Bacteria 1316
1062 Ga0495658_0000926 3300046683 Bacteria 15656
1063 Ga0495658_0019706 3300046683 Bacteria 3525
1064 Ga0495658_0023629 3300046683 Bacteria 3265
1065 Ga0495658_0060775 3300046683 Bacteria 2168
1066 Ga0495669_0096300 3300046684 Bacteria 1371
1067 Ga0495613_0008018 3300046689 Bacteria 7856
1068 Ga0495613_0013064 3300046689 Bacteria 6171
1069 Ga0495613_0059072 3300046689 Bacteria 2812
1070 Ga0495613_0109731 3300046689 Bacteria 1989
1071 Ga0495613_0133870 3300046689 Bacteria 1774
1072 Ga0495624_0003694 3300046690 Bacteria 11307
1073 Ga0495624_0046492 3300046690 Bacteria 2759
1074 Ga0495624_0060680 3300046690 Bacteria 2370
1075 Ga0495624_0142085 3300046690 Bacteria 1470
1076 Ga0495624_0219090 3300046690 Bacteria 1154
1077 Ga0495624_0249052 3300046690 Bacteria 1074
1078 Ga0495670_0006044 3300046691 Bacteria 5932
1079 Ga0495670_0024717 3300046691 Bacteria 2970
1080 Ga0495670_0100383 3300046691 Bacteria 1490
1081 Ga0495670_0263001 3300046691 Bacteria 921
1082 Ga0495671_0022458 3300046692 Bacteria 3306
1083 Ga0495649_0002592 3300046694 Bacteria 12636
1084 Ga0495649_0112213 3300046694 Bacteria 1445
1085 Ga0495589_0008275 3300046794 Bacteria 5431
1086 Ga0495600_0000009 3300046809 Bacteria 143981
1087 Ga0495600_0024963 3300046809 Bacteria 3850
1088 Ga0495600_0037632 3300046809 Bacteria 3146
1089 Ga0495581_0014737 3300047315 Bacteria 4535
1090 Ga0495581_0032334 3300047315 Bacteria 3030
1091 Ga0495581_0052618 3300047315 Bacteria 2352
1092 Ga0495581_0062029 3300047315 Bacteria 2160
1093 Ga0495581_0092986 3300047315 Bacteria 1750
1094 Ga0495581_0125439 3300047315 Bacteria 1495
1095 Ga0495604_0000026 3300047317 Bacteria 143987
1096 Ga0495604_0000241 3300047317 Bacteria 48922
1097 Ga0495604_0002437 3300047317 Bacteria 14887
1098 Ga0495604_0003490 3300047317 Bacteria 12534
1099 Ga0495604_0009438 3300047317 Bacteria 7715
1100 Ga0495604_0020497 3300047317 Bacteria 5281
1101 Ga0495604_0274315 3300047317 Bacteria 1141
1102 Ga0495674_0000954 3300047319 Bacteria 27631
1103 Ga0495674_0005968 3300047319 Bacteria 11686
1104 Ga0495674_0035711 3300047319 Bacteria 4481
1105 Ga0495674_0092322 3300047319 Bacteria 2584
1106 Ga0495674_0099261 3300047319 Bacteria 2479
1107 Ga0495674_0100361 3300047319 Bacteria 2463
1108 Ga0495672_0000750 3300047320 Bacteria 35506
1109 Ga0495676_0015354 3300047321 Bacteria 6823
1110 Ga0495676_0048928 3300047321 Bacteria 3404
1111 Ga0495680_0001881 3300047322 Bacteria 22066
1112 Ga0495680_0004941 3300047322 Bacteria 12619
1113 Ga0495680_0005395 3300047322 Bacteria 12049
1114 Ga0495680_0007514 3300047322 Bacteria 9981
1115 Ga0495680_0011972 3300047322 Bacteria 7656
1116 Ga0495680_0013738 3300047322 Bacteria 7048
1117 Ga0495680_0019796 3300047322 Bacteria 5675
1118 Ga0495680_0070395 3300047322 Bacteria 2667
1119 Ga0495680_0092948 3300047322 Bacteria 2258
1120 Ga0495680_0162010 3300047322 Bacteria 1624
1121 Ga0495675_0000179 3300047444 Bacteria 46398
1122 Ga0495675_0012831 3300047444 Bacteria 5280
1123 Ga0495675_0054320 3300047444 Bacteria 2542
1124 Ga0495675_0073000 3300047444 Bacteria 2164
1125 Ga0495673_0000406 3300047469 Bacteria 50318
1126 Ga0495681_0011965 3300047470 Bacteria 5125
1127 Ga0495684_0000018 3300047471 Bacteria 156009
1128 Ga0495684_0002950 3300047471 Bacteria 13397
1129 Ga0495684_0029433 3300047471 Bacteria 4215
1130 Ga0495684_0046727 3300047471 Bacteria 3311
1131 Ga0495684_0112208 3300047471 Bacteria 2056
1132 Ga0495684_0164958 3300047471 Bacteria 1650
1133 Ga0495593_0003105 3300047673 Bacteria 9995
1134 Ga0495593_0004853 3300047673 Bacteria 7982
1135 Ga0495593_0021597 3300047673 Bacteria 3593
1136 Ga0495593_0039403 3300047673 Bacteria 2548
1137 Ga0495602_0000023 3300048088 Bacteria 154845
1138 Ga0495602_0000791 3300048088 Bacteria 30188
1139 Ga0495602_0010363 3300048088 Bacteria 9675
1140 Ga0495602_0011377 3300048088 Bacteria 9202
1141 Ga0495602_0063552 3300048088 Bacteria 3198
1142 Ga0495602_0097997 3300048088 Bacteria 2414
1143 Ga0495602_0213136 3300048088 Bacteria 1464
1144 Ga0495614_0026477 3300048089 Bacteria 2499
1145 Ga0495614_0056694 3300048089 Bacteria 1682
1146 Ga0495626_0104847 3300048091 Bacteria 1229
1147 Ga0496100_0002357 3300048903 Bacteria 9558
1148 Ga0496100_0002901 3300048903 Bacteria 8800
1149 Ga0496100_0038159 3300048903 Bacteria 3042
1150 Ga0496100_0065497 3300048903 Bacteria 2407
1151 Ga0496100_0100815 3300048903 Bacteria 1990
1152 Ga0496101_0004241 3300048904 Bacteria 8992
1153 Ga0496101_0007358 3300048904 Bacteria 7129
1154 Ga0496101_0011622 3300048904 Bacteria 5847
1155 Ga0496101_0030972 3300048904 Bacteria 3756
1156 Ga0496101_0031420 3300048904 Bacteria 3733
1157 Ga0496101_0161055 3300048904 Bacteria 1721
1158 Ga0496101_0374729 3300048904 Bacteria 1119
1159 Ga0496102_0001843 3300048905 Bacteria 18300
1160 Ga0496102_0013181 3300048905 Bacteria 7152
1161 Ga0496102_0027651 3300048905 Bacteria 5065
1162 Ga0496102_0077525 3300048905 Bacteria 3058
1163 Ga0496102_0094781 3300048905 Bacteria 2766
1164 Ga0496102_0117444 3300048905 Bacteria 2482
1165 Ga0496102_0317585 3300048905 Bacteria 1467
1166 Ga0496102_0335643 3300048905 Bacteria 1423
1167 Ga0496103_0029906 3300048906 Bacteria 3312
1168 Ga0496103_0040359 3300048906 Bacteria 2867
1169 Ga0496103_0041708 3300048906 Bacteria 2822
1170 Ga0496103_0045935 3300048906 Bacteria 2695
1171 Ga0496103_0133260 3300048906 Bacteria 1587
1172 Ga0496104_0000065 3300048907 Bacteria 108770
1173 Ga0496104_0001905 3300048907 Bacteria 18076
1174 Ga0496104_0002630 3300048907 Bacteria 15448
1175 Ga0496104_0006160 3300048907 Bacteria 10529
1176 Ga0496104_0012919 3300048907 Bacteria 7520
1177 Ga0496104_0027928 3300048907 Bacteria 5225
1178 Ga0496104_0069961 3300048907 Bacteria 3336
1179 Ga0496104_0373441 3300048907 Bacteria 1338
1180 Ga0496105_0000530 3300048908 Bacteria 25203
1181 Ga0496105_0002467 3300048908 Bacteria 13391
1182 Ga0496105_0002813 3300048908 Bacteria 12720
1183 Ga0496105_0008513 3300048908 Bacteria 7969
1184 Ga0496105_0022754 3300048908 Bacteria 5078
1185 Ga0496105_0025339 3300048908 Bacteria 4828
1186 Ga0496105_0043540 3300048908 Bacteria 3702
1187 Ga0496105_0058791 3300048908 Bacteria 3173
1188 Ga0496105_0490315 3300048908 Bacteria 966
1189 Ga0496106_0001336 3300048909 Bacteria 18483
1190 Ga0496106_0006847 3300048909 Bacteria 8437
1191 Ga0496106_0009949 3300048909 Bacteria 7019
1192 Ga0496106_0042090 3300048909 Bacteria 3424
1193 Ga0496106_0045658 3300048909 Bacteria 3291
1194 Ga0496106_0052632 3300048909 Bacteria 3072
1195 Ga0496106_0054048 3300048909 Bacteria 3034
1196 Ga0496106_0055401 3300048909 Bacteria 2997
1197 Ga0496106_0060581 3300048909 Bacteria 2869
1198 Ga0496106_0116699 3300048909 Bacteria 2082
1199 Ga0496106_0228273 3300048909 Bacteria 1486
1200 Ga0496106_0496535 3300048909 Bacteria 980
1201 Ga0496107_0015297 3300048910 Bacteria 5377
1202 Ga0496107_0043258 3300048910 Bacteria 3235
1203 Ga0496107_0051543 3300048910 Bacteria 2968
1204 Ga0496107_0086624 3300048910 Bacteria 2286
1205 Ga0496107_0098319 3300048910 Bacteria 2143
1206 Ga0496107_0125467 3300048910 Bacteria 1893
1207 Ga0496107_0339822 3300048910 Bacteria 1117
1208 Ga0496108_0001786 3300048911 Bacteria 17140
1209 Ga0496108_0028823 3300048911 Bacteria 4594
1210 Ga0496108_0059566 3300048911 Bacteria 3210
1211 Ga0496108_0073397 3300048911 Bacteria 2888
1212 Ga0496108_0115032 3300048911 Bacteria 2303
1213 Ga0496108_0218541 3300048911 Bacteria 1655
1214 Ga0496108_0599670 3300048911 Bacteria 960
1215 Ga0496109_0001112 3300048912 Bacteria 22310
1216 Ga0496109_0007518 3300048912 Bacteria 9230
1217 Ga0496109_0024548 3300048912 Bacteria 5360
1218 Ga0496109_0027034 3300048912 Bacteria 5120
1219 Ga0496109_0035792 3300048912 Bacteria 4481
1220 Ga0496109_0173154 3300048912 Bacteria 2025
1221 Ga0496110_0001899 3300048913 Bacteria 15448
1222 Ga0496110_0019661 3300048913 Bacteria 5688
1223 Ga0496110_0027305 3300048913 Bacteria 4892
1224 Ga0496110_0060404 3300048913 Bacteria 3343
1225 Ga0496110_0087494 3300048913 Bacteria 2782
1226 Ga0496110_0209339 3300048913 Bacteria 1773
1227 Ga0496110_0234620 3300048913 Bacteria 1669
1228 Ga0496111_0001319 3300048914 Bacteria 13938
1229 Ga0496111_0007712 3300048914 Bacteria 7079
1230 Ga0496111_0023200 3300048914 Bacteria 4354
1231 Ga0496111_0032913 3300048914 Bacteria 3696
1232 Ga0496112_0002554 3300048915 Bacteria 14703
1233 Ga0496112_0035383 3300048915 Bacteria 4864
1234 Ga0496112_0100582 3300048915 Bacteria 2860
1235 Ga0496112_0125243 3300048915 Bacteria 2540
1236 Ga0496112_0174239 3300048915 Bacteria 2116
1237 Ga0496112_0257302 3300048915 Bacteria 1696
1238 Ga0496113_0000266 3300048916 Bacteria 24721
1239 Ga0496113_0047744 3300048916 Bacteria 3182
1240 Ga0496113_0049923 3300048916 Bacteria 3117
1241 Ga0496113_0148203 3300048916 Bacteria 1850
1242 Ga0496113_0259366 3300048916 Bacteria 1388
1243 Ga0496114_0006728 3300048917 Bacteria 9057
1244 Ga0496114_0009408 3300048917 Bacteria 7759
1245 Ga0496114_0018598 3300048917 Bacteria 5621
1246 Ga0496114_0071933 3300048917 Bacteria 2907
1247 Ga0496114_0105351 3300048917 Bacteria 2412
1248 Ga0496114_0596528 3300048917 Bacteria 974
1249 Ga0496115_0001664 3300048918 Bacteria 15989
1250 Ga0496115_0010192 3300048918 Bacteria 7013
1251 Ga0496115_0014231 3300048918 Bacteria 6021
1252 Ga0496115_0022658 3300048918 Bacteria 4869
1253 Ga0496115_0038237 3300048918 Bacteria 3807
1254 Ga0496115_0057353 3300048918 Bacteria 3132
1255 Ga0496115_0151144 3300048918 Bacteria 1917
1256 Ga0496115_0257633 3300048918 Bacteria 1435
1257 Ga0496117_0023535 3300048920 Bacteria 4903
1258 Ga0496118_0005352 3300048921 Bacteria 14617
1259 Ga0496121_0000099 3300048924 Bacteria 200160
1260 Ga0496124_0000962 3300048927 Bacteria 45849
1261 Ga0496125_0020074 3300048928 Bacteria 6283
1262 Ga0496126_0007633 3300048929 Bacteria 11805
1263 Ga0495678_007784 3300049459 Bacteria 5516
1264 Ga0495682_0000184 3300049460 Bacteria 51305
1265 Ga0501031_0036593 3300049568 Bacteria 3201
1266 Ga0501031_0276199 3300049568 Bacteria 1090
1267 Ga0501032_0038017 3300049569 Bacteria 3279
1268 Ga0501033_0029459 3300049570 Bacteria 4125
1269 Ga0501033_0240944 3300049570 Bacteria 1283
1270 Ga0501034_0083115 3300049571 Bacteria 3203
1271 Ga0501034_0097739 3300049571 Bacteria 2932
1272 Ga0501034_0210195 3300049571 Bacteria 1901
1273 Ga0501034_0604941 3300049571 Bacteria 1001
1274 Ga0501036_0048929 3300049572 Bacteria 3579
1275 Ga0501037_0114155 3300049573 Bacteria 1944
1276 Ga0501037_0460972 3300049573 Bacteria 866
1277 Ga0501038_0011243 3300049574 Bacteria 8172
1278 Ga0501038_0138225 3300049574 Bacteria 1995
1279 Ga0501039_0051384 3300049575 Bacteria 3190
1280 Ga0501039_0179674 3300049575 Bacteria 1664
1281 Ga0501039_0492418 3300049575 Bacteria 963
1282 Ga0501040_0064199 3300049576 Bacteria 2528
1283 Ga0501043_0324730 3300049579 Bacteria 1173
1284 Ga0501047_0015958 3300049581 Bacteria 7162
1285 Ga0501047_0061436 3300049581 Bacteria 3625
1286 Ga0501047_0189861 3300049581 Bacteria 1918
1287 Ga0501047_0252931 3300049581 Bacteria 1610
1288 Ga0501047_0656100 3300049581 Bacteria 868
1289 Ga0501048_0192887 3300049582 Bacteria 1444
1290 Ga0501070_0136061 3300049586 Bacteria 2029
1291 Ga0501070_0203298 3300049586 Bacteria 1626
1292 Ga0501070_0255385 3300049586 Bacteria 1433
1293 Ga0501070_0279103 3300049586 Bacteria 1363
1294 Ga0501073_0145691 3300049589 Bacteria 1641
1295 Ga0501073_0230532 3300049589 Bacteria 1279
1296 Ga0501076_0156076 3300049592 Bacteria 1858
1297 Ga0501076_0331141 3300049592 Bacteria 1249
1298 Ga0501076_0541743 3300049592 Bacteria 960
1299 Ga0501079_0027171 3300049741 Bacteria 4387
1300 Ga0501079_0408836 3300049741 Bacteria 1065
1301 Ga0501079_0432103 3300049741 Bacteria 1034
1302 Ga0501080_0304823 3300049742 Bacteria 1444
1303 Ga0501080_0363950 3300049742 Bacteria 1305
1304 Ga0501080_0470144 3300049742 Bacteria 1126
1305 Ga0501081_0207592 3300049743 Bacteria 1422
1306 Ga0501083_0033131 3300049744 Bacteria 3539
1307 Ga0501035_0035025 3300049822 Bacteria 4560
1308 Ga0501035_0287387 3300049822 Bacteria 1388
1309 Ga0501044_0079159 3300049823 Bacteria 3330
1310 Ga0501044_0202501 3300049823 Bacteria 1943
1311 nmdc:mga03n38_251421_c1 3300050490 Bacteria 934
1312 nmdc:mga03n38_84057_c1 3300050490 Unclassified 1502
1313 nmdc:mga0yw44_204314_c1 3300050492 Bacteria 1306
1314 nmdc:mga0yw44_20898_c1 3300050492 Bacteria 3643
1315 nmdc:mga0yw44_78314_c1 3300050492 Bacteria 2067
1316 nmdc:mga06z11_51893_c1 3300050494 Bacteria 2101
1317 nmdc:mga07m45_24160_c1 3300050496 Bacteria 3327
1318 nmdc:mga05p37_115441_c1 3300050507 Bacteria 3301
1319 nmdc:mga05p37_129_c1 3300050507 Bacteria 45745
1320 nmdc:mga05p37_17690_c2 3300050507 Bacteria 2205
1321 nmdc:mga05p37_7502_c1 3300050507 Bacteria 12858
1322 nmdc:mga09592_4064_c1 3300050508 Bacteria 11820
1323 nmdc:mga0qj67_182398_c1 3300050509 Bacteria 1705
1324 nmdc:mga0qj67_236874_c1 3300050509 Bacteria 1481
1325 nmdc:mga0qj67_624_c1 3300050509 Bacteria 24282
1326 nmdc:mga0qj67_77805_c1 3300050509 Bacteria 2654
1327 nmdc:mga06r32_171250_c1 3300050510 Bacteria 2155
1328 nmdc:mga06r32_21650_c1 3300050510 Bacteria 3452
1329 nmdc:mga06r32_274962_c1 3300050510 Bacteria 1672
1330 nmdc:mga06r32_637973_c1 3300050510 Bacteria 1034
1331 nmdc:mga06r32_75867_c1 3300050510 Bacteria 3264
1332 nmdc:mga06r32_8962_c1 3300050510 Bacteria 9013
1333 nmdc:mga08y16_1130_c1 3300050511 Bacteria 26261
1334 nmdc:mga08y16_200225_c1 3300050511 Bacteria 2069
1335 nmdc:mga08y16_220757_c1 3300050511 Bacteria 1962
1336 nmdc:mga08y16_23508_c1 3300050511 Bacteria 6512
1337 nmdc:mga08y16_500794_c1 3300050511 Bacteria 1234
1338 nmdc:mga08y16_66580_c1 3300050511 Bacteria 3759
1339 nmdc:mga08y16_691_c1 3300050511 Bacteria 32023
1340 nmdc:mga0n895_108190_c1 3300050512 Bacteria 2794
1341 nmdc:mga0n895_207_c1 3300050512 Bacteria 36776
1342 nmdc:mga0n895_215801_c1 3300050512 Bacteria 1948
1343 nmdc:mga0n895_248829_c1 3300050512 Bacteria 1804
1344 nmdc:mga0n895_2552_c1 3300050512 Bacteria 14270
1345 nmdc:mga0n895_36354_c1 3300050512 Bacteria 4755
1346 nmdc:mga0n895_439473_c1 3300050512 Bacteria 1318
1347 nmdc:mga0n895_551320_c1 3300050512 Bacteria 1159
1348 nmdc:mga0n895_7901_c1 3300050512 Bacteria 9171
1349 nmdc:mga0n895_96549_c1 3300050512 Bacteria 2961
1350 nmdc:mga0rr50_1238_c1 3300050513 Bacteria 13930
1351 nmdc:mga0rr50_263989_c1 3300050513 Unclassified 1433
1352 nmdc:mga0rr50_90868_c1 3300050513 Bacteria 2377
1353 nmdc:mga08x19_173208_c1 3300050514 Bacteria 1470
1354 nmdc:mga08x19_74333_c1 3300050514 Bacteria 2220
1355 nmdc:mga0a205_1327_c1 3300050515 Bacteria 20880
1356 nmdc:mga0a205_160128_c1 3300050515 Bacteria 2148
1357 nmdc:mga0a205_16175_c1 3300050515 Bacteria 6624
1358 nmdc:mga0a205_169439_c1 3300050515 Bacteria 2079
1359 nmdc:mga0a205_280102_c1 3300050515 Bacteria 1543
1360 nmdc:mga0a205_74423_c1 3300050515 Bacteria 3282
1361 Ga0495601_0000010 3300053077 Bacteria 266222
1362 Ga0495601_0000152 3300053077 Bacteria 38651
1363 Ga0495601_0002459 3300053077 Bacteria 10526
1364 Ga0495601_0014626 3300053077 Bacteria 4730
1365 Ga0495601_0035572 3300053077 Bacteria 3110
1366 Ga0495601_0044469 3300053077 Bacteria 2791
1367 Ga0495601_0360140 3300053077 Bacteria 945
1368 Ga0495612_0000109 3300053078 Bacteria 34803
1369 Ga0495612_0000244 3300053078 Bacteria 22545
1370 Ga0495612_0000428 3300053078 Bacteria 16790
1371 Ga0495612_0014095 3300053078 Bacteria 3218
1372 Ga0495612_0150218 3300053078 Bacteria 1013
1373 Ga0495655_0005486 3300053083 Bacteria 2243
1374 Ga0495595_0000056 3300053084 Bacteria 58198
1375 Ga0495595_0000474 3300053084 Bacteria 15271
1376 Ga0495595_0000594 3300053084 Bacteria 13801
1377 Ga0495595_0004440 3300053084 Bacteria 5646
1378 Ga0495595_0006954 3300053084 Bacteria 4619
1379 Ga0495595_0010934 3300053084 Bacteria 3787
1380 Ga0495619_0000112 3300053085 Bacteria 61241
1381 Ga0495619_0000115 3300053085 Bacteria 58866
1382 Ga0495619_0000544 3300053085 Bacteria 24920
1383 Ga0495619_0001076 3300053085 Bacteria 17916
1384 Ga0495619_0001854 3300053085 Bacteria 14074
1385 Ga0495619_0002853 3300053085 Bacteria 11252
1386 Ga0495619_0002886 3300053085 Bacteria 11167
1387 Ga0495619_0030456 3300053085 Bacteria 3494
1388 Ga0495619_0093984 3300053085 Bacteria 2033
1389 Ga0495619_0153328 3300053085 Bacteria 1589
1390 Ga0500651_0007140 3300053093 Bacteria 6499
1391 Ga0500651_0172389 3300053093 Bacteria 1289
1392 Ga0500566_0056733 3300053094 Bacteria 2226
1393 Ga0500641_0033235 3300053096 Bacteria 2046
1394 Ga0500595_006831 3300053119 Bacteria 4803
1395 Ga0500595_020963 3300053119 Bacteria 2341
1396 Ga0500608_012444 3300053122 Bacteria 3732
1397 Ga0500618_007629 3300053125 Bacteria 3070
1398 Ga0500559_0118551 3300053136 Bacteria 1230
1399 Ga0500604_0049470 3300053151 Bacteria 1293
1400 Ga0500639_054919 3300053163 Bacteria 2067
1401 Ga0500639_078936 3300053163 Bacteria 1662
1402 Ga0500636_0008287 3300053177 Bacteria 6030
1403 Ga0501084_0142406 3300054114 Bacteria 2019
1404 Ga0501082_0159702 3300060353 Bacteria 1959
1405 Ga0501082_0238356 3300060353 Bacteria 1583
1406 Ga0501082_0414723 3300060353 Bacteria 1176
1407 Ga0530510_0104738 3300061734 Bacteria 2070
1408 Ga0530510_0345010 3300061734 Bacteria 1118
1409 2889919772 2889914905 Bacteria 5702301
1410 2922387780 2922386360 Bacteria 7017218
1411 3003935883 3003930520 Bacteria 5667563
1412 Ga0466962_0131908
1413 2214544921
1414 ARcpr5oldR_c000060
1415 ARSoilYngRDRAFT_c00026
1416 ARcpr5yngRDRAFT_c000062
1417 ARSoilOldRDRAFT_c000014
1418 ARCol0oldRDRAFT_c00135
1419 ARCol0yngRDRAFT_1000075
1420 JGI24739J22299_10001621
1421 JGI24737J22298_10002215
1422 JGI24737J22298_10003103
1423 JGI24743J22301_10005752
1424 JGI24750J21931_1000414
1425 JGI24748J21848_1012436
1426 JGI24744J21845_10005703
1427 JGI24034J26672_10003479
1428 JGI25405J52794_10002656
1429 JGI25405J52794_10009957
1430 Ga0065717_1001992
1431 Ga0065716_1000064
1432 Ga0065704_10089598
1433 Ga0065712_10004414
1434 Ga0065715_10003211
1435 Ga0065715_10089057
1436 Ga0065707_10168922
1437 Ga0070658_10016413
1438 Ga0070658_10080771
1439 Ga0070658_10384811
1440 Ga0070676_10004642
1441 Ga0070676_10114479
1442 Ga0070683_100013090
1443 Ga0070683_100247020
1444 Ga0070683_100420727
1445 Ga0070683_100476657
1446 Ga0070690_100006650
1447 Ga0070690_100014960
1448 Ga0070690_100042844
1449 Ga0070670_100015971
1450 Ga0070670_100044755
1451 Ga0070670_100045922
1452 Ga0070670_100381056
1453 Ga0070677_10001512
1454 Ga0068869_100012157
1455 Ga0070666_10115017
1456 Ga0070666_10141668
1457 Ga0070666_10168732
1458 Ga0070680_100117959
1459 Ga0070680_100119686
1460 Ga0070680_100211920
1461 Ga0070680_100366804
1462 Ga0070682_100010796
1463 Ga0070682_100060305
1464 Ga0070682_100253187
1465 Ga0070682_100261130
1466 Ga0068868_100008008
1467 Ga0068868_100464130
1468 Ga0070660_100018941
1469 Ga0070660_100019654
1470 Ga0070660_100082499
1471 Ga0070660_100112362
1472 Ga0070689_100008904
1473 Ga0070691_10008977
1474 Ga0070691_10054822
1475 Ga0070687_100000508
1476 Ga0070687_100003462
1477 Ga0070661_100026333
1478 Ga0070661_100083424
1479 Ga0070661_100551902
1480 Ga0070692_10009171
1481 Ga0070692_10089731
1482 Ga0070668_100048995
1483 Ga0070668_100195731
1484 Ga0070669_100004442
1485 Ga0070675_100010960
1486 Ga0070675_100063520
1487 Ga0070671_100009960
1488 Ga0070671_100015285
1489 Ga0070671_100034762
1490 Ga0070671_100042377
1491 Ga0070671_100116676
1492 Ga0070671_100127818
1493 Ga0070674_100038698
1494 Ga0070674_100067551
1495 Ga0070674_100176136
1496 Ga0070673_100010845
1497 Ga0070673_100027965
1498 Ga0070673_100048450
1499 Ga0070673_100058113
1500 Ga0070688_100021684
1501 Ga0070688_100064577
1502 Ga0070659_100009719
1503 Ga0070659_100717367
1504 Ga0070667_100053888
1505 Ga0070667_100538288
1506 Ga0070703_10004977
1507 Ga0070703_10005901
1508 Ga0070703_10011121
1509 Ga0070709_10029207
1510 Ga0070709_10030267
1511 Ga0070709_10063573
1512 Ga0070709_10114227
1513 Ga0070709_10244267
1514 Ga0070714_100025708
1515 Ga0070714_100094055
1516 Ga0070714_100569741
1517 Ga0070713_100010962
1518 Ga0070713_100095164
1519 Ga0070713_100219392
1520 Ga0070713_100288106
1521 Ga0070713_100355787
1522 Ga0070713_100618880
1523 Ga0070713_100623566
1524 Ga0070710_10016552
1525 Ga0070710_10165267
1526 Ga0070710_10334057
1527 Ga0070701_10004735
1528 Ga0070701_10041946
1529 Ga0070701_10048811
1530 Ga0070711_100015125
1531 Ga0070711_100035735
1532 Ga0070711_100075991
1533 Ga0070711_100088873
1534 Ga0070711_100159402
1535 Ga0070711_100364562
1536 Ga0070705_100017130
1537 Ga0070705_100137652
1538 Ga0070700_100010230
1539 Ga0070700_100019075
1540 Ga0070700_100038447
1541 Ga0070694_100006188
1542 Ga0070694_100246189
1543 Ga0070708_100064041
1544 Ga0070708_100792935
1545 Ga0070663_100023888
1546 Ga0070663_100082896
1547 Ga0070663_100199867
1548 Ga0070663_100280405
1549 Ga0070678_100007085
1550 Ga0070678_100375668
1551 Ga0070678_100419311
1552 Ga0070662_100053178
1553 Ga0070662_100124026
1554 Ga0070662_100190308
1555 Ga0070681_10030704
1556 Ga0070681_10042345
1557 Ga0070681_10058918
1558 Ga0070681_10257357
1559 Ga0068867_100030148
1560 Ga0068867_100464101
1561 Ga0070685_10003206
1562 Ga0070685_10022671
1563 Ga0070685_10079920
1564 Ga0070706_100783231
1565 Ga0070707_100699583
1566 Ga0074259_10498539
1567 Ga0070679_100016311
1568 Ga0070679_100034201
1569 Ga0070679_100071215
1570 Ga0070679_100199105
1571 Ga0070679_100500161
1572 Ga0070684_100019448
1573 Ga0070684_100031373
1574 Ga0070684_100100549
1575 Ga0070684_100150484
1576 Ga0070684_100672373
1577 Ga0070697_100162182
1578 Ga0070697_100199875
1579 Ga0070697_100212243
1580 Ga0068853_100007915
1581 Ga0068853_100320027
1582 Ga0070672_100002557
1583 Ga0070686_100011589
1584 Ga0070686_100014959
1585 Ga0070686_100067461
1586 Ga0070686_100305966
1587 Ga0070686_100318544
1588 Ga0070695_100004179
1589 Ga0070695_100150537
1590 Ga0070696_100017134
1591 Ga0070696_100029007
1592 Ga0070696_100034849
1593 Ga0070696_100220956
1594 Ga0070693_100000598
1595 Ga0070693_100073417
1596 Ga0070665_100131167
1597 Ga0070665_100374236
1598 Ga0070665_100402492
1599 Ga0070704_100001411
1600 Ga0070704_100001845
1601 Ga0068855_100105869
1602 Ga0068855_100142314
1603 Ga0070664_100022064
1604 Ga0070664_100114112
1605 Ga0068857_100003946
1606 Ga0068857_100114348
1607 Ga0068857_100151095
1608 Ga0068854_100040125
1609 Ga0068856_100028987
1610 Ga0068856_100089119
1611 Ga0068856_100188149
1612 Ga0070702_100004124
1613 Ga0068852_100015213
1614 Ga0068852_100032088
1615 Ga0068852_100355922
1616 Ga0068859_100015209
1617 Ga0068859_100061305
1618 Ga0068859_100445031
1619 Ga0068864_100059186
1620 Ga0068864_100094360
1621 Ga0068864_100155145
1622 Ga0068866_10006784
1623 Ga0068866_10314560
1624 Ga0068861_100009598
1625 Ga0068861_100018479
1626 Ga0068851_10064045
1627 Ga0068870_10001856
1628 Ga0068870_10016062
1629 Ga0068863_100004842
1630 Ga0068863_100014861
1631 Ga0068863_100280571
1632 Ga0068863_100512135
1633 Ga0068858_100009730
1634 Ga0068858_100031089
1635 Ga0068858_100172483
1636 Ga0068858_100233107
1637 Ga0068858_100595353
1638 Ga0068860_100031612
1639 Ga0068860_100049035
1640 Ga0068860_100058904
1641 Ga0068860_100141624
1642 Ga0068862_100001842
1643 Ga0068862_100033969
1644 Ga0081455_10000406
1645 Ga0081455_10001669
1646 Ga0081455_10009887
1647 Ga0081455_10058719
1648 Ga0081455_10152020
1649 Ga0081455_10156129
1650 Ga0081455_10350336
1651 Ga0081455_10380543
1652 Ga0081538_10011077
1653 Ga0081540_1001987
1654 Ga0081540_1020979
1655 Ga0070717_10000378
1656 Ga0070717_10029289
1657 Ga0070717_10054790
1658 Ga0070717_10422148
1659 Ga0075365_10004370
1660 Ga0075365_10016802
1661 Ga0075365_10125659
1662 Ga0075368_10065421
1663 Ga0075432_10002074
1664 Ga0075432_10029530
1665 Ga0075432_10044944
1666 Ga0070715_10006900
1667 Ga0070715_10113238
1668 Ga0070716_100051663
1669 Ga0070712_100002271
1670 Ga0070712_100011210
1671 Ga0070712_100013459
1672 Ga0070712_100035403
1673 Ga0070712_100097488
1674 Ga0070712_100418994
1675 Ga0075367_10009844
1676 Ga0075367_10016048
1677 Ga0075367_10259558
1678 Ga0075427_10003100
1679 Ga0097621_100002928
1680 Ga0097621_100078920
1681 Ga0068871_100012296
1682 Ga0068871_100019961
1683 Ga0068871_100085640
1684 Ga0075428_100001601
1685 Ga0075430_100001162
1686 Ga0075430_100314640
1687 Ga0075431_100022376
1688 Ga0075431_100207372
1689 Ga0075431_100378249
1690 Ga0075433_10000068
1691 Ga0075433_10050889
1692 Ga0075433_10074428
1693 Ga0075433_10077350
1694 Ga0075434_100002956
1695 Ga0075434_100005563
1696 Ga0075434_100031778
1697 Ga0075434_100064642
1698 Ga0075434_100072623
1699 Ga0075434_100371993
1700 Ga0075434_100457181
1701 Ga0075434_100609247
1702 Ga0075429_100002047
1703 Ga0068865_100005119
1704 Ga0068865_100064480
1705 Ga0068865_100150586
1706 Ga0075436_100024355
1707 Ga0075436_100075157
1708 Ga0097620_100015209
1709 Ga0097620_100061307
1710 Ga0097620_100445004
1711 Ga0075435_100052519
1712 Ga0075435_100115258
1713 Ga0075435_100139329
1714 Ga0075435_100288024
1715 Ga0075435_100424800
1716 Ga0075435_100481841
1717 Ga0099794_10004391
1718 Ga0099794_10129173
1719 Ga0099795_10142778
1720 Ga0105250_10101164
1721 Ga0105240_10176065
1722 Ga0111539_10001284
1723 Ga0111539_10002543
1724 Ga0111539_10032584
1725 Ga0111539_10057660
1726 Ga0111539_10136568
1727 Ga0111539_10322462
1728 Ga0105245_10031015
1729 Ga0105245_10070005
1730 Ga0105247_10021856
1731 Ga0105247_10028136
1732 Ga0105247_10142348
1733 Ga0114129_10004127
1734 Ga0114129_10015793
1735 Ga0114129_10100651
1736 Ga0105243_10008339
1737 Ga0105243_10054689
1738 Ga0105241_10004472
1739 Ga0105241_10038688
1740 Ga0105242_10017926
1741 Ga0105242_10244928
1742 Ga0105242_10273591
1743 Ga0105242_10274991
1744 Ga0105242_10524666
1745 Ga0105248_10010313
1746 Ga0105248_10059103
1747 Ga0105248_10153891
1748 Ga0105248_10615194
1749 Ga0105237_10027346
1750 Ga0105237_10042509
1751 Ga0105237_10057323
1752 Ga0105237_10091666
1753 Ga0105237_10092507
1754 Ga0105237_10096344
1755 Ga0105238_10029419
1756 Ga0105238_10051215
1757 Ga0105238_10066723
1758 Ga0105238_10182256
1759 Ga0105249_10011749
1760 Ga0105249_10032599
1761 Ga0105249_10206037
1762 Ga0105249_10867003
1763 Ga0099796_10011403
1764 Ga0099796_10030202
1765 Ga0105239_10037971
1766 Ga0105239_10305211
1767 Ga0105239_10606125
1768 Ga0105246_10012998
1769 Ga0105246_10019263
1770 Ga0105246_10330543
1771 Ga0157344_1002048
1772 Ga0157341_1003625
1773 Ga0157373_10030696
1774 Ga0157373_10076812
1775 Ga0157371_10017224
1776 Ga0157371_10232139
1777 Ga0157369_10057951
1778 Ga0157369_10201591
1779 Ga0157369_10249485
1780 Ga0157369_10343645
1781 Ga0157374_10012525
1782 Ga0157374_10103562
1783 Ga0157374_10655161
1784 Ga0157378_10122934
1785 Ga0163162_10009600
1786 Ga0163162_10039557
1787 Ga0163162_10168070
1788 Ga0163162_10351515
1789 Ga0157372_10027001
1790 Ga0157372_10098006
1791 Ga0157372_10208706
1792 Ga0157372_10406561
1793 Ga0157372_10534766
1794 Ga0157375_10134684
1795 Ga0157375_10255882
1796 Ga0163163_10002001
1797 Ga0163163_10051014
1798 Ga0163163_10265684
1799 Ga0163163_10364894
1800 Ga0163163_10388359
1801 Ga0163163_10741757
1802 Ga0157380_10095681
1803 Ga0157377_10002093
1804 Ga0157377_10213676
1805 Ga0157379_10018091
1806 Ga0157379_10137078
1807 Ga0157379_10215837
1808 Ga0157379_10245089
1809 Ga0157379_10416148
1810 Ga0157376_10040045
1811 Ga0157376_10229335
1812 Ga0157376_10249255
1813 Ga0157376_10386395
1814 Ga0182007_10002819
1815 Ga0163161_10005218
1816 Ga0163161_10236031
1817 Ga0163161_10276350
1818 Ga0206353_10140707
1819 Ga0224572_1001529
1820 Ga0228598_1024548
1821 Ga0209233_1019820
1822 Ga0207666_1000366
1823 Ga0207666_1001084
1824 Ga0207673_1000238
1825 Ga0207697_10000659
1826 Ga0207697_10131896
1827 Ga0207696_1052480
1828 Ga0207653_10001549
1829 Ga0207653_10016283
1830 Ga0207653_10086770
1831 Ga0207682_10003189
1832 Ga0207692_10006112
1833 Ga0207692_10021377
1834 Ga0207692_10060138
1835 Ga0207692_10085824
1836 Ga0207642_10049737
1837 Ga0207642_10210196
1838 Ga0207710_10012928
1839 Ga0207710_10046390
1840 Ga0207710_10061053
1841 Ga0207688_10000981
1842 Ga0207688_10003210
1843 Ga0207688_10024956
1844 Ga0207688_10047876
1845 Ga0207680_10053858
1846 Ga0207647_10005149
1847 Ga0207647_10017110
1848 Ga0207647_10026615
1849 Ga0207647_10114025
1850 Ga0207685_10000850
1851 Ga0207685_10088572
1852 Ga0207699_10006806
1853 Ga0207699_10074999
1854 Ga0207699_10079238
1855 Ga0207645_10001680
1856 Ga0207645_10014284
1857 Ga0207645_10172531
1858 Ga0207643_10000136
1859 Ga0207643_10001619
1860 Ga0207705_10045339
1861 Ga0207705_10073636
1862 Ga0207684_10293027
1863 Ga0207654_10030573
1864 Ga0207707_10136957
1865 Ga0207671_10058000
1866 Ga0207671_10101085
1867 Ga0207671_10131048
1868 Ga0207671_10173793
1869 Ga0207693_10004015
1870 Ga0207693_10004220
1871 Ga0207693_10006069
1872 Ga0207693_10006883
1873 Ga0207693_10009217
1874 Ga0207693_10021355
1875 Ga0207693_10041913
1876 Ga0207693_10046350
1877 Ga0207693_10078370
1878 Ga0207693_10111122
1879 Ga0207663_10040902
1880 Ga0207663_10147583
1881 Ga0207663_10207243
1882 Ga0207663_10248828
1883 Ga0207660_10004668
1884 Ga0207660_10039771
1885 Ga0207660_10177115
1886 Ga0207660_10226617
1887 Ga0207662_10000154
1888 Ga0207662_10000164
1889 Ga0207662_10017874
1890 Ga0207657_10011001
1891 Ga0207657_10019204
1892 Ga0207657_10026615
1893 Ga0207657_10070086
1894 Ga0207657_10101574
1895 Ga0207649_10103318
1896 Ga0207649_10421886
1897 Ga0207652_10085136
1898 Ga0207652_10119322
1899 Ga0207652_10147825
1900 Ga0207652_10254321
1901 Ga0207646_10244096
1902 Ga0207646_10350010
1903 Ga0207681_10123602
1904 Ga0207681_10137814
1905 Ga0207694_10042102
1906 Ga0207694_10224596
1907 Ga0207650_10008674
1908 Ga0207650_10039708
1909 Ga0207650_10085293
1910 Ga0207650_10092858
1911 Ga0207650_10214521
1912 Ga0207659_10002828
1913 Ga0207687_10028673
1914 Ga0207687_10034829
1915 Ga0207687_10053586
1916 Ga0207700_10000118
1917 Ga0207700_10029464
1918 Ga0207700_10225268
1919 Ga0207700_10254586
1920 Ga0207700_10573149
1921 Ga0207700_10719611
1922 Ga0207664_10025513
1923 Ga0207664_10035107
1924 Ga0207664_10092926
1925 Ga0207664_10675070
1926 Ga0207644_10001008
1927 Ga0207644_10005274
1928 Ga0207644_10055379
1929 Ga0207644_10118046
1930 Ga0207644_10185171
1931 Ga0207690_10005061
1932 Ga0207690_10034348
1933 Ga0207706_10003055
1934 Ga0207706_10008247
1935 Ga0207706_10031726
1936 Ga0207706_10038669
1937 Ga0207706_10041161
1938 Ga0207706_10054909
1939 Ga0207686_10049555
1940 Ga0207686_10087877
1941 Ga0207686_10405827
1942 Ga0207709_10016937
1943 Ga0207709_10028591
1944 Ga0207709_10084501
1945 Ga0207670_10007415
1946 Ga0207670_10009236
1947 Ga0207670_10018498
1948 Ga0207669_10002625
1949 Ga0207669_10031057
1950 Ga0207669_10031384
1951 Ga0207669_10209153
1952 Ga0207704_10003098
1953 Ga0207704_10336434
1954 Ga0207665_10025306
1955 Ga0207665_10030390
1956 Ga0207665_10067137
1957 Ga0207665_10100954
1958 Ga0207665_10182806
1959 Ga0207691_10000812
1960 Ga0207691_10002456
1961 Ga0207691_10206046
1962 Ga0207711_10044922
1963 Ga0207711_10136770
1964 Ga0207711_10188980
1965 Ga0207711_10289120
1966 Ga0207711_10441143
1967 Ga0207689_10000427
1968 Ga0207689_10009817
1969 Ga0207689_10063205
1970 Ga0207661_10031070
1971 Ga0207661_10217548
1972 Ga0207661_10467352
1973 Ga0207679_10000853
1974 Ga0207667_10058200
1975 Ga0207667_10204823
1976 Ga0207667_10298671
1977 Ga0207651_10003200
1978 Ga0207651_10004120
1979 Ga0207651_10035784
1980 Ga0207712_10008478
1981 Ga0207712_10067643
1982 Ga0207668_10013229
1983 Ga0207668_10031378
1984 Ga0207668_10106179
1985 Ga0207668_10142169
1986 Ga0207640_10005942
1987 Ga0207640_10089427
1988 Ga0207640_10377592
1989 Ga0207658_10116096
1990 Ga0207658_10340440
1991 Ga0207658_10345981
1992 Ga0207658_10693355
1993 Ga0207677_10020473
1994 Ga0207677_10047073
1995 Ga0207677_10293589
1996 Ga0207703_10024162
1997 Ga0207703_10038967
1998 Ga0207703_10056116
1999 Ga0207703_10139047
2000 Ga0207639_10032499
2001 Ga0207678_10005504
2002 Ga0207678_10008889
2003 Ga0207678_10009330
2004 Ga0207678_10024014
2005 Ga0207708_10001137
2006 Ga0207708_10001264
2007 Ga0207708_10011789
2008 Ga0207708_10081153
2009 Ga0207702_10020210
2010 Ga0207702_10128387
2011 Ga0207702_10227326
2012 Ga0207641_10017044
2013 Ga0207641_10035250
2014 Ga0207641_10556088
2015 Ga0207648_10002630
2016 Ga0207648_10035051
2017 Ga0207648_10393955
2018 Ga0207676_10066657
2019 Ga0207676_10152751
2020 Ga0207674_10004609
2021 Ga0207674_10036803
2022 Ga0207674_10092714
2023 Ga0207674_10175216
2024 Ga0207675_100003315
2025 Ga0207675_100011227
2026 Ga0207675_100022088
2027 Ga0207675_100411237
2028 Ga0207675_100619076
2029 Ga0207683_10008982
2030 Ga0207698_10036199
2031 Ga0207698_10120755
2032 Ga0209971_1018376
2033 Ga0209966_1002117
2034 Ga0209998_10000576
2035 Ga0209998_10034804
2036 Ga0209998_10035834
2037 Ga0209974_10018091
2038 Ga0207428_10000150
2039 Ga0207428_10000594
2040 Ga0207428_10001449
2041 Ga0268266_10161989
2042 Ga0268266_10302644
2043 Ga0268266_10511300
2044 Ga0268265_10010005
2045 Ga0268265_10024707
2046 Ga0268264_10029947
2047 Ga0268264_10055972
2048 Ga0268264_10059135
2049 Ga0268264_10264596
2050 Ga0268264_10365138
2051 Ga0265337_1000084
2052 Ga0265318_10055752
2053 Ga0265336_10046681
2054 Ga0265338_10006542
2055 Ga0265338_10170721
2056 Ga0265763_1000682
2057 Ga0265760_10034437
2058 Ga0265330_10039971
2059 Ga0265332_10045527
2060 Ga0265328_10035237
2061 Ga0265320_10032836
2062 Ga0265325_10000004
2063 Ga0265325_10000630
2064 Ga0265325_10013896
2065 Ga0265325_10060087
2066 Ga0265325_10060873
2067 Ga0265325_10112940
2068 Ga0265329_10045592
2069 Ga0265340_10001253
2070 Ga0265340_10007664
2071 Ga0265340_10010658
2072 Ga0265340_10015110
2073 Ga0265339_10000133
2074 Ga0265339_10004348
2075 Ga0265339_10004657
2076 Ga0265339_10112074
2077 Ga0265339_10194858
2078 Ga0265331_10024291
2079 Ga0265331_10031897
2080 Ga0265331_10051405
2081 Ga0265316_10016679
2082 Ga0265316_10026680
2083 Ga0265316_10328348
2084 Ga0265313_10000491
2085 Ga0265313_10000868
2086 Ga0265313_10015380
2087 Ga0265313_10028881
2088 Ga0307508_10000049
2089 Ga0316575_10006591
2090 Ga0316579_10031010
2091 Ga0265314_10002573
2092 Ga0265314_10004582
2093 Ga0265314_10085258
2094 Ga0265314_10111772
2095 Ga0265342_10000093
2096 Ga0265342_10001600
2097 Ga0265342_10009354
2098 Ga0265342_10045417
2099 Ga0307516_10164851
2100 Ga0307516_10179878
2101 Ga0316583_10000400
2102 Ga0316583_10032496
2103 Ga0307507_10174228
2104 Ga0373930_0000835
2105 Ga0373930_0006760
2106 Ga0373948_0000254
2107 Ga0373948_0037241
2108 Ga0373950_0000189
2109 Ga0373950_0007445
2110 Ga0373950_0021088
2111 Ga0373958_0000784
2112 Ga0373958_0014447
2113 Ga0373958_0041796
2114 Ga0373959_0000739
2115 Ga0373959_0032426
2116 Ga0373926_0000978
2117 Ga0373926_0009827
2118 Ga0373926_0052869
2119 Ga0373928_0000170
2120 Ga0373928_0002877
2121 Ga0373929_0000249
2122 Ga0373929_0018901
2123 Ga0373929_0020499
2124 Ga0373934_0035483
2125 Ga0373934_0112996
2126 Ga0373940_0000372
2127 Ga0373940_0005705
2128 Ga0373944_0019794
2129 Ga0373949_0001262
2130 Ga0373949_0002117
2131 Ga0373949_0003612
2132 Ga0373949_0004664
2133 Ga0373951_0000237
2134 Ga0373951_0002947
2135 Ga0373951_0003252
2136 Ga0373952_0001204
2137 Ga0373923_0007009
2138 Ga0373923_0012224
2139 Ga0373923_0034032
2140 Ga0373932_0000358
2141 Ga0373932_0004563
2142 Ga0373932_0011645
2143 Ga0373936_0000247
2144 Ga0373936_0008984
2145 Ga0373936_0014000
2146 Ga0373939_0001671
2147 Ga0373939_0005026
2148 Ga0373939_0005227
2149 Ga0373939_0069815
2150 Ga0373941_0132022
2151 Ga0373945_0000745
2152 Ga0373945_0002295
2153 Ga0373945_0007669
2154 Ga0373945_0011100
2155 Ga0373945_0033341
2156 Ga0373953_0004566
2157 Ga0373953_0011967
2158 Ga0373953_0022051
2159 Ga0373954_0000594
2160 Ga0373954_0017468
2161 Ga0373954_0042143
2162 Ga0373954_0210637
2163 Ga0373956_0014225
2164 Ga0373956_0020803
2165 Ga0373956_0038030
2166 Ga0373956_0058744
2167 Ga0373957_0005882
2168 Ga0373957_0015861
2169 Ga0373957_0022379
2170 Ga0373957_0026572
2171 Ga0373957_0072208
2172 Ga0373960_0000983
2173 Ga0373960_0003870
2174 Ga0373960_0004631
2175 Ga0373960_0028890
2176 Ga0373943_0000765
2177 Ga0373943_0002206
2178 Ga0373943_0027440
2179 Ga0373943_0051014
2180 Ga0373943_0081660
2181 Ga0373943_0103620
2182 Ga0373946_0005621
2183 Ga0373946_0007520
2184 Ga0373946_0008750
2185 Ga0373946_0029382
2186 Ga0373946_0047124
2187 Ga0373946_0079515
2188 Ga0373955_0000588
2189 Ga0373955_0000790
2190 Ga0373955_0006281
2191 Ga0373955_0007878
2192 Ga0373955_0052325
2193 Ga0373955_0053290
2194 Ga0373955_0160972
2195 Ga0373955_0198559
2196 Ga0373942_0009149
2197 Ga0373961_0000267
2198 Ga0373961_0011660
2199 Ga0373961_0014287
2200 Ga0373961_0040159
2201 Ga0373962_0000465
2202 Ga0373962_0022349
2203 Ga0373924_0000311
2204 Ga0373924_0011298
2205 Ga0373924_0014516
2206 Ga0373924_0024512
2207 Ga0373924_0025071
2208 Ga0373924_0033787
2209 Ga0373924_0056803
2210 Ga0373931_0000813
2211 Ga0373931_0003284
2212 Ga0373931_0044083
2213 Ga0373935_0000142
2214 Ga0373935_0007148
2215 Ga0373935_0009871
2216 Ga0373935_0025943
2217 Ga0373935_0032442
2218 Ga0373935_0114203
2219 Ga0373935_0201129
2220 Ga0373935_0210028
2221 Ga0373935_0292511
2222 Ga0373935_0297661
2223 Ga0373935_0540772
2224 Ga0373927_0002697
2225 Ga0373927_0003928
2226 Ga0373927_0011494
2227 Ga0373927_0019711
2228 Ga0373927_0035816
2229 Ga0373927_0057174
2230 Ga0373927_0218229
2231 Ga0373933_0001807
2232 Ga0373933_0001809
2233 Ga0373933_0001937
2234 Ga0373933_0002756
2235 Ga0373933_0020681
2236 Ga0373933_0021016
2237 Ga0373947_0000334
2238 Ga0373947_0006737
2239 Ga0373947_0084587
2240 Ga0373947_0115396
2241 Ga0373937_0000802
2242 Ga0373937_0001597
2243 Ga0373937_0001602
2244 Ga0373937_0001751
2245 Ga0373937_0004661
2246 Ga0373937_0005134
2247 Ga0373937_0012412
2248 Ga0373937_0054149
2249 Ga0373937_0180034
2250 Ga0373925_0000152
2251 Ga0373925_0003524
2252 Ga0373925_0028860
2253 Ga0373925_0061971
2254 Ga0373925_0122106
2255 Ga0373925_0245655
2256 Ga0373925_0248056
2257 Ga0395899_0011380
2258 Ga0395899_0100109
2259 Ga0395900_0003511
2260 Ga0395900_0030157
2261 Ga0395900_0056684
2262 Ga0395898_0089239
2263 Ga0395898_0137489
2264 Ga0395901_0010954
2265 Ga0395901_0013418
2266 Ga0242420_002050
2267 Ga0400483_151746
2268 Ga0400483_161457
2269 Ga0436365_0274179
2270 Ga0436365_0859425
2271 Ga0436361_0161168
2272 Ga0436363_0176166
2273 Ga0436363_0963225
2274 Ga0436363_1590609
2275 Ga0439450_006195
2276 Ga0439464_0008939
2277 Ga0451577_0091412
2278 Ga0453683_0083480
2279 Ga0466963_0039766
2280 Ga0466963_0041028
2281 Ga0466963_0245160
2282 Ga0453684_0226771
2283 Ga0466957_0044609
2284 Ga0451576_0166909
2285 Ga0466967_0779464
2286 Ga0495617_003311
2287 Ga0495617_017730
2288 Ga0495592_0000009
2289 Ga0495592_0002207
2290 Ga0495592_0002869
2291 Ga0495592_0007893
2292 Ga0495603_0001273
2293 Ga0495603_0057352
2294 Ga0495603_0093529
2295 Ga0495629_0000026
2296 Ga0495629_0003539
2297 Ga0495629_0012950
2298 Ga0495629_0022806
2299 Ga0495629_0193599
2300 Ga0495638_0000150
2301 Ga0495638_0001385
2302 Ga0495638_0031505
2303 Ga0495641_0019956
2304 Ga0495641_0110335
2305 Ga0495651_0001594
2306 Ga0495651_0002062
2307 Ga0495651_0009198
2308 Ga0495651_0014698
2309 Ga0495651_0065667
2310 Ga0495651_0401222
2311 Ga0495653_0001255
2312 Ga0495653_0019067
2313 Ga0495653_0045135
2314 Ga0495653_0069592
2315 Ga0495653_0178884
2316 Ga0495580_0014189
2317 Ga0495580_0131424
2318 Ga0495580_0225035
2319 Ga0495582_0003737
2320 Ga0495605_0000743
2321 Ga0495639_0009238
2322 Ga0495639_0093976
2323 Ga0495662_0014404
2324 Ga0495662_0022251
2325 Ga0495662_0029602
2326 Ga0495662_0067798
2327 Ga0495664_0000002
2328 Ga0495664_0000375
2329 Ga0495664_0029112
2330 Ga0495664_0076558
2331 Ga0495664_0141693
2332 Ga0495584_0031215
2333 Ga0495584_0052960
2334 Ga0495584_0064460
2335 Ga0495585_0005673
2336 Ga0495585_0050299
2337 Ga0495585_0188433
2338 Ga0495594_0008513
2339 Ga0495594_0028509
2340 Ga0495594_0045999
2341 Ga0495594_0122516
2342 Ga0495594_0165116
2343 Ga0495607_0007593
2344 Ga0495607_0008723
2345 Ga0495607_0125793
2346 Ga0495607_0150619
2347 Ga0495583_0075433
2348 Ga0495608_0000032
2349 Ga0495608_0000180
2350 Ga0495608_0003555
2351 Ga0495608_0011097
2352 Ga0495608_0026249
2353 Ga0495610_0003832
2354 Ga0495616_0001634
2355 Ga0495616_0043539
2356 Ga0495618_0000114
2357 Ga0495618_0003664
2358 Ga0495618_0029503
2359 Ga0495618_0052091
2360 Ga0495618_0065232
2361 Ga0495620_0013168
2362 Ga0495628_0000002
2363 Ga0495628_0001064
2364 Ga0495628_0074879
2365 Ga0495628_0103074
2366 Ga0495630_0000658
2367 Ga0495630_0012700
2368 Ga0495630_0037134
2369 Ga0495630_0046355
2370 Ga0495630_0066937
2371 Ga0495630_0114588
2372 Ga0495630_0427865
2373 Ga0495630_0429262
2374 Ga0495631_0110537
2375 Ga0495632_0002399
2376 Ga0495632_0011697
2377 Ga0495637_0124883
2378 Ga0495643_0003688
2379 Ga0495644_0000690
2380 Ga0495644_0009397
2381 Ga0495644_0039008
2382 Ga0495644_0121256
2383 Ga0495644_0178707
2384 Ga0495648_0000824
2385 Ga0495663_0099245
2386 Ga0495666_0039577
2387 Ga0495666_0121951
2388 Ga0495666_0135713
2389 Ga0495652_0000004
2390 Ga0495652_0001634
2391 Ga0495652_0020229
2392 Ga0495652_0030318
2393 Ga0495652_0046041
2394 Ga0495652_0118894
2395 Ga0495652_0255980
2396 Ga0495654_0003511
2397 Ga0495665_0009815
2398 Ga0495665_0018587
2399 Ga0495665_0022210
2400 Ga0495640_0000016
2401 Ga0495640_0003068
2402 Ga0495640_0003848
2403 Ga0495640_0012588
2404 Ga0495640_0042809
2405 Ga0495640_0044226
2406 Ga0495640_0064334
2407 Ga0495586_0023543
2408 Ga0495587_0000018
2409 Ga0495587_0000894
2410 Ga0495587_0001375
2411 Ga0495587_0020330
2412 Ga0495587_0076549
2413 Ga0495598_0000140
2414 Ga0495609_0067124
2415 Ga0495621_0014113
2416 Ga0495645_0000003
2417 Ga0495645_0000368
2418 Ga0495622_0000475
2419 Ga0495622_0042530
2420 Ga0495622_0177991
2421 Ga0495633_0002619
2422 Ga0495633_0057612
2423 Ga0495667_0000348
2424 Ga0495667_0000924
2425 Ga0495667_0003684
2426 Ga0495667_0012454
2427 Ga0495667_0058752
2428 Ga0495667_0087941
2429 Ga0495656_0003815
2430 Ga0495656_0034213
2431 Ga0495656_0083205
2432 Ga0495634_0002858
2433 Ga0495634_0022289
2434 Ga0495634_0070470
2435 Ga0495634_0157692
2436 Ga0495611_0017687
2437 Ga0495635_0000025
2438 Ga0495635_0006673
2439 Ga0495635_0027534
2440 Ga0495635_0041863
2441 Ga0495635_0065217
2442 Ga0495635_0079906
2443 Ga0495635_0095517
2444 Ga0495635_0099769
2445 Ga0495659_0019320
2446 Ga0495659_0034592
2447 Ga0495661_0000231
2448 Ga0495661_0018462
2449 Ga0495661_0080871
2450 Ga0495588_0036586
2451 Ga0495657_0000702
2452 Ga0495657_0004204
2453 Ga0495657_0024030
2454 Ga0495657_0032715
2455 Ga0495657_0162450
2456 Ga0495657_0167661
2457 Ga0495599_0000067
2458 Ga0495599_0003519
2459 Ga0495599_0004649
2460 Ga0495599_0007202
2461 Ga0495623_0003596
2462 Ga0495623_0004477
2463 Ga0495623_0007246
2464 Ga0495646_0000056
2465 Ga0495646_0003759
2466 Ga0495646_0005604
2467 Ga0495646_0032527
2468 Ga0495646_0098444
2469 Ga0495647_0009175
2470 Ga0495647_0014464
2471 Ga0495647_0070924
2472 Ga0495647_0081062
2473 Ga0495658_0000926
2474 Ga0495658_0019706
2475 Ga0495658_0023629
2476 Ga0495658_0060775
2477 Ga0495669_0096300
2478 Ga0495613_0008018
2479 Ga0495613_0013064
2480 Ga0495613_0059072
2481 Ga0495613_0109731
2482 Ga0495613_0133870
2483 Ga0495624_0003694
2484 Ga0495624_0046492
2485 Ga0495624_0060680
2486 Ga0495624_0142085
2487 Ga0495624_0219090
2488 Ga0495624_0249052
2489 Ga0495670_0006044
2490 Ga0495670_0024717
2491 Ga0495670_0100383
2492 Ga0495670_0263001
2493 Ga0495671_0022458
2494 Ga0495649_0002592
2495 Ga0495649_0112213
2496 Ga0495589_0008275
2497 Ga0495600_0000009
2498 Ga0495600_0024963
2499 Ga0495600_0037632
2500 Ga0495581_0014737
2501 Ga0495581_0032334
2502 Ga0495581_0052618
2503 Ga0495581_0062029
2504 Ga0495581_0092986
2505 Ga0495581_0125439
2506 Ga0495604_0000026
2507 Ga0495604_0000241
2508 Ga0495604_0002437
2509 Ga0495604_0003490
2510 Ga0495604_0009438
2511 Ga0495604_0020497
2512 Ga0495604_0274315
2513 Ga0495674_0000954
2514 Ga0495674_0005968
2515 Ga0495674_0035711
2516 Ga0495674_0092322
2517 Ga0495674_0099261
2518 Ga0495674_0100361
2519 Ga0495672_0000750
2520 Ga0495676_0015354
2521 Ga0495676_0048928
2522 Ga0495680_0001881
2523 Ga0495680_0004941
2524 Ga0495680_0005395
2525 Ga0495680_0007514
2526 Ga0495680_0011972
2527 Ga0495680_0013738
2528 Ga0495680_0019796
2529 Ga0495680_0070395
2530 Ga0495680_0092948
2531 Ga0495680_0162010
2532 Ga0495675_0000179
2533 Ga0495675_0012831
2534 Ga0495675_0054320
2535 Ga0495675_0073000
2536 Ga0495673_0000406
2537 Ga0495681_0011965
2538 Ga0495684_0000018
2539 Ga0495684_0002950
2540 Ga0495684_0029433
2541 Ga0495684_0046727
2542 Ga0495684_0112208
2543 Ga0495684_0164958
2544 Ga0495593_0003105
2545 Ga0495593_0004853
2546 Ga0495593_0021597
2547 Ga0495593_0039403
2548 Ga0495602_0000023
2549 Ga0495602_0000791
2550 Ga0495602_0010363
2551 Ga0495602_0011377
2552 Ga0495602_0063552
2553 Ga0495602_0097997
2554 Ga0495602_0213136
2555 Ga0495614_0026477
2556 Ga0495614_0056694
2557 Ga0495626_0104847
2558 Ga0496100_0002357
2559 Ga0496100_0002901
2560 Ga0496100_0038159
2561 Ga0496100_0065497
2562 Ga0496100_0100815
2563 Ga0496101_0004241
2564 Ga0496101_0007358
2565 Ga0496101_0011622
2566 Ga0496101_0030972
2567 Ga0496101_0031420
2568 Ga0496101_0161055
2569 Ga0496101_0374729
2570 Ga0496102_0001843
2571 Ga0496102_0013181
2572 Ga0496102_0027651
2573 Ga0496102_0077525
2574 Ga0496102_0094781
2575 Ga0496102_0117444
2576 Ga0496102_0317585
2577 Ga0496102_0335643
2578 Ga0496103_0029906
2579 Ga0496103_0040359
2580 Ga0496103_0041708
2581 Ga0496103_0045935
2582 Ga0496103_0133260
2583 Ga0496104_0000065
2584 Ga0496104_0001905
2585 Ga0496104_0002630
2586 Ga0496104_0006160
2587 Ga0496104_0012919
2588 Ga0496104_0027928
2589 Ga0496104_0069961
2590 Ga0496104_0373441
2591 Ga0496105_0000530
2592 Ga0496105_0002467
2593 Ga0496105_0002813
2594 Ga0496105_0008513
2595 Ga0496105_0022754
2596 Ga0496105_0025339
2597 Ga0496105_0043540
2598 Ga0496105_0058791
2599 Ga0496105_0490315
2600 Ga0496106_0001336
2601 Ga0496106_0006847
2602 Ga0496106_0009949
2603 Ga0496106_0042090
2604 Ga0496106_0045658
2605 Ga0496106_0052632
2606 Ga0496106_0054048
2607 Ga0496106_0055401
2608 Ga0496106_0060581
2609 Ga0496106_0116699
2610 Ga0496106_0228273
2611 Ga0496106_0496535
2612 Ga0496107_0015297
2613 Ga0496107_0043258
2614 Ga0496107_0051543
2615 Ga0496107_0086624
2616 Ga0496107_0098319
2617 Ga0496107_0125467
2618 Ga0496107_0339822
2619 Ga0496108_0001786
2620 Ga0496108_0028823
2621 Ga0496108_0059566
2622 Ga0496108_0073397
2623 Ga0496108_0115032
2624 Ga0496108_0218541
2625 Ga0496108_0599670
2626 Ga0496109_0001112
2627 Ga0496109_0007518
2628 Ga0496109_0024548
2629 Ga0496109_0027034
2630 Ga0496109_0035792
2631 Ga0496109_0173154
2632 Ga0496110_0001899
2633 Ga0496110_0019661
2634 Ga0496110_0027305
2635 Ga0496110_0060404
2636 Ga0496110_0087494
2637 Ga0496110_0209339
2638 Ga0496110_0234620
2639 Ga0496111_0001319
2640 Ga0496111_0007712
2641 Ga0496111_0023200
2642 Ga0496111_0032913
2643 Ga0496112_0002554
2644 Ga0496112_0035383
2645 Ga0496112_0100582
2646 Ga0496112_0125243
2647 Ga0496112_0174239
2648 Ga0496112_0257302
2649 Ga0496113_0000266
2650 Ga0496113_0047744
2651 Ga0496113_0049923
2652 Ga0496113_0148203
2653 Ga0496113_0259366
2654 Ga0496114_0006728
2655 Ga0496114_0009408
2656 Ga0496114_0018598
2657 Ga0496114_0071933
2658 Ga0496114_0105351
2659 Ga0496114_0596528
2660 Ga0496115_0001664
2661 Ga0496115_0010192
2662 Ga0496115_0014231
2663 Ga0496115_0022658
2664 Ga0496115_0038237
2665 Ga0496115_0057353
2666 Ga0496115_0151144
2667 Ga0496115_0257633
2668 Ga0496117_0023535
2669 Ga0496118_0005352
2670 Ga0496121_0000099
2671 Ga0496124_0000962
2672 Ga0496125_0020074
2673 Ga0496126_0007633
2674 Ga0495678_007784
2675 Ga0495682_0000184
2676 Ga0501031_0036593
2677 Ga0501031_0276199
2678 Ga0501032_0038017
2679 Ga0501033_0029459
2680 Ga0501033_0240944
2681 Ga0501034_0083115
2682 Ga0501034_0097739
2683 Ga0501034_0210195
2684 Ga0501034_0604941
2685 Ga0501036_0048929
2686 Ga0501037_0114155
2687 Ga0501037_0460972
2688 Ga0501038_0011243
2689 Ga0501038_0138225
2690 Ga0501039_0051384
2691 Ga0501039_0179674
2692 Ga0501039_0492418
2693 Ga0501040_0064199
2694 Ga0501043_0324730
2695 Ga0501047_0015958
2696 Ga0501047_0061436
2697 Ga0501047_0189861
2698 Ga0501047_0252931
2699 Ga0501047_0656100
2700 Ga0501048_0192887
2701 Ga0501070_0136061
2702 Ga0501070_0203298
2703 Ga0501070_0255385
2704 Ga0501070_0279103
2705 Ga0501073_0145691
2706 Ga0501073_0230532
2707 Ga0501076_0156076
2708 Ga0501076_0331141
2709 Ga0501076_0541743
2710 Ga0501079_0027171
2711 Ga0501079_0408836
2712 Ga0501079_0432103
2713 Ga0501080_0304823
2714 Ga0501080_0363950
2715 Ga0501080_0470144
2716 Ga0501081_0207592
2717 Ga0501083_0033131
2718 Ga0501035_0035025
2719 Ga0501035_0287387
2720 Ga0501044_0079159
2721 Ga0501044_0202501
2722 nmdc:mga03n38_251421_c1
2723 nmdc:mga03n38_84057_c1
2724 nmdc:mga0yw44_204314_c1
2725 nmdc:mga0yw44_20898_c1
2726 nmdc:mga0yw44_78314_c1
2727 nmdc:mga06z11_51893_c1
2728 nmdc:mga07m45_24160_c1
2729 nmdc:mga05p37_115441_c1
2730 nmdc:mga05p37_129_c1
2731 nmdc:mga05p37_17690_c2
2732 nmdc:mga05p37_7502_c1
2733 nmdc:mga09592_4064_c1
2734 nmdc:mga0qj67_182398_c1
2735 nmdc:mga0qj67_236874_c1
2736 nmdc:mga0qj67_624_c1
2737 nmdc:mga0qj67_77805_c1
2738 nmdc:mga06r32_171250_c1
2739 nmdc:mga06r32_21650_c1
2740 nmdc:mga06r32_274962_c1
2741 nmdc:mga06r32_637973_c1
2742 nmdc:mga06r32_75867_c1
2743 nmdc:mga06r32_8962_c1
2744 nmdc:mga08y16_1130_c1
2745 nmdc:mga08y16_200225_c1
2746 nmdc:mga08y16_220757_c1
2747 nmdc:mga08y16_23508_c1
2748 nmdc:mga08y16_500794_c1
2749 nmdc:mga08y16_66580_c1
2750 nmdc:mga08y16_691_c1
2751 nmdc:mga0n895_108190_c1
2752 nmdc:mga0n895_207_c1
2753 nmdc:mga0n895_215801_c1
2754 nmdc:mga0n895_248829_c1
2755 nmdc:mga0n895_2552_c1
2756 nmdc:mga0n895_36354_c1
2757 nmdc:mga0n895_439473_c1
2758 nmdc:mga0n895_551320_c1
2759 nmdc:mga0n895_7901_c1
2760 nmdc:mga0n895_96549_c1
2761 nmdc:mga0rr50_1238_c1
2762 nmdc:mga0rr50_263989_c1
2763 nmdc:mga0rr50_90868_c1
2764 nmdc:mga08x19_173208_c1
2765 nmdc:mga08x19_74333_c1
2766 nmdc:mga0a205_1327_c1
2767 nmdc:mga0a205_160128_c1
2768 nmdc:mga0a205_16175_c1
2769 nmdc:mga0a205_169439_c1
2770 nmdc:mga0a205_280102_c1
2771 nmdc:mga0a205_74423_c1
2772 Ga0495601_0000010
2773 Ga0495601_0000152
2774 Ga0495601_0002459
2775 Ga0495601_0014626
2776 Ga0495601_0035572
2777 Ga0495601_0044469
2778 Ga0495601_0360140
2779 Ga0495612_0000109
2780 Ga0495612_0000244
2781 Ga0495612_0000428
2782 Ga0495612_0014095
2783 Ga0495612_0150218
2784 Ga0495655_0005486
2785 Ga0495595_0000056
2786 Ga0495595_0000474
2787 Ga0495595_0000594
2788 Ga0495595_0004440
2789 Ga0495595_0006954
2790 Ga0495595_0010934
2791 Ga0495619_0000112
2792 Ga0495619_0000115
2793 Ga0495619_0000544
2794 Ga0495619_0001076
2795 Ga0495619_0001854
2796 Ga0495619_0002853
2797 Ga0495619_0002886
2798 Ga0495619_0030456
2799 Ga0495619_0093984
2800 Ga0495619_0153328
2801 Ga0500651_0007140
2802 Ga0500651_0172389
2803 Ga0500566_0056733
2804 Ga0500641_0033235
2805 Ga0500595_006831
2806 Ga0500595_020963
2807 Ga0500608_012444
2808 Ga0500618_007629
2809 Ga0500559_0118551
2810 Ga0500604_0049470
2811 Ga0500639_054919
2812 Ga0500639_078936
2813 Ga0500636_0008287
2814 Ga0501084_0142406
2815 Ga0501082_0159702
2816 Ga0501082_0238356
2817 Ga0501082_0414723
2818 Ga0530510_0104738
2819 Ga0530510_0345010
2820 2889919772
2821 2922387780
2822 3003935883

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

251

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

302

0.91

PF08659

KR

KR domain

55

233

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9423 9 270
8hs9-assembly2.cif.gz_E brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t 0.9356 10 266
4za2-assembly1.cif.gz_B crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9337 9 267
8jfi-assembly2.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori 0.9336 17 266
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9325 17 266
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9398 17 49 3.50.50.60
af_Q0JDN0_53_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9347 17 209 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9345 17 49 3.50.50.60
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 7 200 3.40.50.720
3cxrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9294 9 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A6EGH0-F1-model_v4 Putative short-chain dehydrogenase 0.9681 13 157 GO:0016616
GO:0030497
AF-A0A2A8MD93-F1-model_v4 deleted 0.9626 10 154
AF-A0A382LVV8-F1-model_v4 Uncharacterized protein 0.9624 13 189 GO:0016491
AF-A0A399YVS1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9595 10 192 GO:0016616
AF-A0A836X0L3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9592 13 157 GO:0016616
GO:0030497

Map