F493769
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1413 | 506 | 1413 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_11918672|Ga0105249_119186721 |
| Length | 119 |
| Sequence | MGLTIISPQLKDTRAMATATKSRPKIAFVPFEDRVVIMPSEEMETMRGGLYIPDTAKEKPTQGEVIAVGPGRFEKGTRVPMELKVGDQVIYGKYSGTPYTVEGDEYVIIKASDVLAKLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 134 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 135 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 153 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 243 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 270 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 271 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 272 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 292 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 298 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 301 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 302 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 303 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 304 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 305 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 306 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 307 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 308 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 312 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 313 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 315 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 316 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 317 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 318 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 319 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 320 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 321 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 322 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 323 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 324 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 325 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 326 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 327 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 328 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 329 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 330 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 331 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 332 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 333 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 334 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 335 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 336 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 337 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 338 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 339 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 340 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 341 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 342 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 343 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 344 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 348 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 389 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 390 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 427 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 428 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 429 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 430 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 431 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 432 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 433 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 434 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 435 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 436 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 437 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 438 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 443 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 444 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 445 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 450 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 461 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 462 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 463 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 464 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 468 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 469 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 470 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 471 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 472 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 473 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 475 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 477 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 485 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 486 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 487 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 488 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 489 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.28 |
| Metatranscriptomes | 6.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.26 |
| Nodule | 0 |
| Rhizoplane | 4.25 |
| Rhizosphere | 91.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1017945 | 3300001977 | Unclassified | 1003 |
| 2 | JGI24739J22299_10153085 | 3300001989 | Bacteria | 681 |
| 3 | JGI24739J22299_10173906 | 3300001989 | Bacteria | 634 |
| 4 | JGI24735J21928_10150096 | 3300002067 | Bacteria | 673 |
| 5 | JGI24738J21930_10113188 | 3300002075 | Bacteria | 585 |
| 6 | Ga0006759J45824_1142513 | 3300003163 | Bacteria | 511 |
| 7 | Ga0006770J48903_1017217 | 3300003305 | Bacteria | 1036 |
| 8 | Ga0006770J48903_1052527 | 3300003305 | Bacteria | 543 |
| 9 | rootH1_10160366 | 3300003323 | Bacteria | 1241 |
| 10 | Ga0007410J51695_1095721 | 3300003574 | Bacteria | 549 |
| 11 | Ga0007409J51694_1061563 | 3300003575 | Unclassified | 1029 |
| 12 | Ga0006562J51391_1014982 | 3300003578 | Bacteria | 2573 |
| 13 | Ga0007429J51699_1055138 | 3300003579 | Bacteria | 570 |
| 14 | Ga0007429J51699_1137424 | 3300003579 | Bacteria | 696 |
| 15 | Ga0032354_1070555 | 3300003693 | Unclassified | 896 |
| 16 | Ga0058858_1018058 | 3300004785 | Bacteria | 927 |
| 17 | Ga0058859_10150003 | 3300004798 | Bacteria | 573 |
| 18 | Ga0058859_11723421 | 3300004798 | Bacteria | 1127 |
| 19 | Ga0058863_11573035 | 3300004799 | Bacteria | 502 |
| 20 | Ga0058861_10068965 | 3300004800 | Bacteria | 843 |
| 21 | Ga0058861_11782770 | 3300004800 | Bacteria | 589 |
| 22 | Ga0058861_12050521 | 3300004800 | Bacteria | 1584 |
| 23 | Ga0058860_11567160 | 3300004801 | Unclassified | 506 |
| 24 | Ga0058860_12083350 | 3300004801 | Bacteria | 1042 |
| 25 | Ga0058860_12124474 | 3300004801 | Bacteria | 518 |
| 26 | Ga0058862_10000625 | 3300004803 | Bacteria | 1300 |
| 27 | Ga0058862_10109779 | 3300004803 | Bacteria | 580 |
| 28 | Ga0058862_12763569 | 3300004803 | Bacteria | 2124 |
| 29 | Ga0058862_12811975 | 3300004803 | Bacteria | 842 |
| 30 | Ga0065704_10501280 | 3300005289 | Bacteria | 667 |
| 31 | Ga0065712_10135028 | 3300005290 | Bacteria | 1506 |
| 32 | Ga0065715_10029592 | 3300005293 | Bacteria | 1814 |
| 33 | Ga0065715_10340438 | 3300005293 | Bacteria | 967 |
| 34 | Ga0065715_10879663 | 3300005293 | Bacteria | 581 |
| 35 | Ga0065715_11021616 | 3300005293 | Bacteria | 528 |
| 36 | Ga0065707_10031412 | 3300005295 | Bacteria | 1115 |
| 37 | Ga0065707_10362525 | 3300005295 | Bacteria | 902 |
| 38 | Ga0065707_11040338 | 3300005295 | Bacteria | 529 |
| 39 | Ga0070658_10124301 | 3300005327 | Bacteria | 2146 |
| 40 | Ga0070658_10404733 | 3300005327 | Bacteria | 1172 |
| 41 | Ga0070658_10951538 | 3300005327 | Bacteria | 747 |
| 42 | Ga0070658_10983028 | 3300005327 | Bacteria | 734 |
| 43 | Ga0070676_10005779 | 3300005328 | Bacteria | 6596 |
| 44 | Ga0070676_10017473 | 3300005328 | Bacteria | 3970 |
| 45 | Ga0070676_10022558 | 3300005328 | Bacteria | 3530 |
| 46 | Ga0070676_10064597 | 3300005328 | Bacteria | 2183 |
| 47 | Ga0070676_10141119 | 3300005328 | Bacteria | 1534 |
| 48 | Ga0070676_10674108 | 3300005328 | Bacteria | 753 |
| 49 | Ga0070676_11531196 | 3300005328 | Bacteria | 514 |
| 50 | Ga0070683_100001069 | 3300005329 | Bacteria | 20558 |
| 51 | Ga0070683_100624396 | 3300005329 | Bacteria | 1031 |
| 52 | Ga0070683_100757092 | 3300005329 | Bacteria | 931 |
| 53 | Ga0070683_102332946 | 3300005329 | Bacteria | 513 |
| 54 | Ga0070690_100004480 | 3300005330 | Bacteria | 7764 |
| 55 | Ga0070690_100054140 | 3300005330 | Unclassified | 2568 |
| 56 | Ga0070690_100410129 | 3300005330 | Bacteria | 997 |
| 57 | Ga0070690_100441175 | 3300005330 | Bacteria | 963 |
| 58 | Ga0070670_100438972 | 3300005331 | Bacteria | 1156 |
| 59 | Ga0070670_100497695 | 3300005331 | Bacteria | 1083 |
| 60 | Ga0070670_101223806 | 3300005331 | Bacteria | 686 |
| 61 | Ga0070670_101831978 | 3300005331 | Bacteria | 559 |
| 62 | Ga0070677_10213428 | 3300005333 | Bacteria | 938 |
| 63 | Ga0070677_10273013 | 3300005333 | Bacteria | 849 |
| 64 | Ga0070677_10371001 | 3300005333 | Bacteria | 747 |
| 65 | Ga0068869_100009804 | 3300005334 | Bacteria | 6220 |
| 66 | Ga0068869_100329731 | 3300005334 | Bacteria | 1240 |
| 67 | Ga0068869_100546191 | 3300005334 | Bacteria | 973 |
| 68 | Ga0070666_10039792 | 3300005335 | Bacteria | 3135 |
| 69 | Ga0070666_11459008 | 3300005335 | Bacteria | 511 |
| 70 | Ga0070680_100004792 | 3300005336 | Bacteria | 10179 |
| 71 | Ga0070680_100006737 | 3300005336 | Bacteria | 8749 |
| 72 | Ga0070680_100088267 | 3300005336 | Bacteria | 2565 |
| 73 | Ga0070680_100137496 | 3300005336 | Bacteria | 2047 |
| 74 | Ga0070680_100187460 | 3300005336 | Bacteria | 1743 |
| 75 | Ga0070680_100272285 | 3300005336 | Bacteria | 1434 |
| 76 | Ga0070680_100448545 | 3300005336 | Bacteria | 1102 |
| 77 | Ga0070680_100537067 | 3300005336 | Bacteria | 1002 |
| 78 | Ga0070680_100765095 | 3300005336 | Bacteria | 832 |
| 79 | Ga0070680_101248983 | 3300005336 | Bacteria | 643 |
| 80 | Ga0070680_101594546 | 3300005336 | Bacteria | 565 |
| 81 | Ga0070682_100007747 | 3300005337 | Bacteria | 6050 |
| 82 | Ga0070682_100214328 | 3300005337 | Bacteria | 1366 |
| 83 | Ga0070682_100469768 | 3300005337 | Bacteria | 968 |
| 84 | Ga0070682_100763886 | 3300005337 | Bacteria | 782 |
| 85 | Ga0070682_101228404 | 3300005337 | Bacteria | 634 |
| 86 | Ga0068868_100129570 | 3300005338 | Bacteria | 2063 |
| 87 | Ga0068868_100443867 | 3300005338 | Bacteria | 1127 |
| 88 | Ga0068868_100616415 | 3300005338 | Bacteria | 963 |
| 89 | Ga0068868_100863010 | 3300005338 | Bacteria | 820 |
| 90 | Ga0070660_100085863 | 3300005339 | Bacteria | 2475 |
| 91 | Ga0070660_100532077 | 3300005339 | Bacteria | 979 |
| 92 | Ga0070660_100605271 | 3300005339 | Bacteria | 916 |
| 93 | Ga0070660_100843691 | 3300005339 | Bacteria | 771 |
| 94 | Ga0070689_100425244 | 3300005340 | Bacteria | 1126 |
| 95 | Ga0070689_100439515 | 3300005340 | Unclassified | 1108 |
| 96 | Ga0070691_10056788 | 3300005341 | Bacteria | 1877 |
| 97 | Ga0070691_10061118 | 3300005341 | Bacteria | 1812 |
| 98 | Ga0070691_10504669 | 3300005341 | Bacteria | 700 |
| 99 | Ga0070691_10575289 | 3300005341 | Bacteria | 661 |
| 100 | Ga0070687_100045251 | 3300005343 | Bacteria | 2246 |
| 101 | Ga0070687_100065162 | 3300005343 | Bacteria | 1937 |
| 102 | Ga0070661_100064642 | 3300005344 | Bacteria | 2688 |
| 103 | Ga0070661_100081807 | 3300005344 | Bacteria | 2385 |
| 104 | Ga0070661_100150702 | 3300005344 | Bacteria | 1758 |
| 105 | Ga0070661_100276089 | 3300005344 | Bacteria | 1302 |
| 106 | Ga0070661_100521069 | 3300005344 | Bacteria | 953 |
| 107 | Ga0070692_10446872 | 3300005345 | Bacteria | 826 |
| 108 | Ga0070692_10857641 | 3300005345 | Bacteria | 624 |
| 109 | Ga0070692_11334128 | 3300005345 | Bacteria | 516 |
| 110 | Ga0070668_100047542 | 3300005347 | Bacteria | 3299 |
| 111 | Ga0070668_101828465 | 3300005347 | Bacteria | 559 |
| 112 | Ga0070669_100003047 | 3300005353 | Bacteria | 12052 |
| 113 | Ga0070669_100062064 | 3300005353 | Bacteria | 2747 |
| 114 | Ga0070669_100147225 | 3300005353 | Bacteria | 1820 |
| 115 | Ga0070669_100234851 | 3300005353 | Bacteria | 1455 |
| 116 | Ga0070669_101758867 | 3300005353 | Bacteria | 541 |
| 117 | Ga0070675_100010521 | 3300005354 | Bacteria | 7226 |
| 118 | Ga0070675_100119041 | 3300005354 | Unclassified | 2243 |
| 119 | Ga0070675_100143621 | 3300005354 | Bacteria | 2042 |
| 120 | Ga0070675_100333811 | 3300005354 | Bacteria | 1341 |
| 121 | Ga0070671_100005351 | 3300005355 | Bacteria | 10234 |
| 122 | Ga0070671_100111032 | 3300005355 | Bacteria | 2303 |
| 123 | Ga0070671_100630053 | 3300005355 | Bacteria | 928 |
| 124 | Ga0070671_100631672 | 3300005355 | Bacteria | 926 |
| 125 | Ga0070671_101469942 | 3300005355 | Bacteria | 603 |
| 126 | Ga0070674_100001645 | 3300005356 | Bacteria | 12049 |
| 127 | Ga0070674_100206660 | 3300005356 | Bacteria | 1519 |
| 128 | Ga0070674_101633682 | 3300005356 | Bacteria | 582 |
| 129 | Ga0070673_100065427 | 3300005364 | Bacteria | 2900 |
| 130 | Ga0070673_100198810 | 3300005364 | Bacteria | 1726 |
| 131 | Ga0070688_100116415 | 3300005365 | Bacteria | 1784 |
| 132 | Ga0070688_100352674 | 3300005365 | Bacteria | 1077 |
| 133 | Ga0070659_100024636 | 3300005366 | Bacteria | 4614 |
| 134 | Ga0070659_100101267 | 3300005366 | Bacteria | 2319 |
| 135 | Ga0070659_100287795 | 3300005366 | Bacteria | 1368 |
| 136 | Ga0070659_100617920 | 3300005366 | Bacteria | 932 |
| 137 | Ga0070659_101915838 | 3300005366 | Bacteria | 532 |
| 138 | Ga0070667_100033201 | 3300005367 | Bacteria | 4311 |
| 139 | Ga0070667_100468174 | 3300005367 | Bacteria | 1153 |
| 140 | Ga0070667_101486696 | 3300005367 | Bacteria | 636 |
| 141 | Ga0070709_10010524 | 3300005434 | Bacteria | 5126 |
| 142 | Ga0070709_10307781 | 3300005434 | Bacteria | 1159 |
| 143 | Ga0070709_11464173 | 3300005434 | Bacteria | 554 |
| 144 | Ga0070709_11637348 | 3300005434 | Bacteria | 525 |
| 145 | Ga0070714_100012646 | 3300005435 | Bacteria | 6740 |
| 146 | Ga0070714_100962981 | 3300005435 | Bacteria | 830 |
| 147 | Ga0070713_100069801 | 3300005436 | Bacteria | 2964 |
| 148 | Ga0070713_100351522 | 3300005436 | Bacteria | 1368 |
| 149 | Ga0070713_100498520 | 3300005436 | Bacteria | 1149 |
| 150 | Ga0070710_10039481 | 3300005437 | Bacteria | 2598 |
| 151 | Ga0070710_11084603 | 3300005437 | Bacteria | 587 |
| 152 | Ga0070701_10362308 | 3300005438 | Bacteria | 909 |
| 153 | Ga0070711_100372464 | 3300005439 | Bacteria | 1153 |
| 154 | Ga0070705_100004513 | 3300005440 | Bacteria | 6781 |
| 155 | Ga0070705_100046854 | 3300005440 | Bacteria | 2495 |
| 156 | Ga0070705_100217229 | 3300005440 | Bacteria | 1322 |
| 157 | Ga0070705_100663556 | 3300005440 | Bacteria | 815 |
| 158 | Ga0070705_101717346 | 3300005440 | Bacteria | 531 |
| 159 | Ga0070700_100484401 | 3300005441 | Bacteria | 948 |
| 160 | Ga0070694_100065463 | 3300005444 | Bacteria | 2490 |
| 161 | Ga0070694_100218981 | 3300005444 | Bacteria | 1427 |
| 162 | Ga0070694_100243246 | 3300005444 | Bacteria | 1358 |
| 163 | Ga0070694_100259424 | 3300005444 | Bacteria | 1318 |
| 164 | Ga0070694_101208692 | 3300005444 | Bacteria | 634 |
| 165 | Ga0070694_101942568 | 3300005444 | Bacteria | 503 |
| 166 | Ga0070708_100000480 | 3300005445 | Bacteria | 30280 |
| 167 | Ga0070708_100086499 | 3300005445 | Bacteria | 2847 |
| 168 | Ga0070708_100176264 | 3300005445 | Bacteria | 1998 |
| 169 | Ga0070708_100224161 | 3300005445 | Bacteria | 1763 |
| 170 | Ga0070708_100252627 | 3300005445 | Bacteria | 1656 |
| 171 | Ga0070708_100404918 | 3300005445 | Bacteria | 1286 |
| 172 | Ga0070708_100847685 | 3300005445 | Bacteria | 859 |
| 173 | Ga0070708_101283457 | 3300005445 | Bacteria | 684 |
| 174 | Ga0070663_100450178 | 3300005455 | Bacteria | 1061 |
| 175 | Ga0070663_100857926 | 3300005455 | Bacteria | 782 |
| 176 | Ga0070663_101202298 | 3300005455 | Bacteria | 666 |
| 177 | Ga0070663_101204184 | 3300005455 | Bacteria | 665 |
| 178 | Ga0070678_100002017 | 3300005456 | Bacteria | 10980 |
| 179 | Ga0070678_100132020 | 3300005456 | Bacteria | 1985 |
| 180 | Ga0070678_101269732 | 3300005456 | Bacteria | 684 |
| 181 | Ga0070662_100001156 | 3300005457 | Bacteria | 16193 |
| 182 | Ga0070662_100160783 | 3300005457 | Bacteria | 1757 |
| 183 | Ga0070662_101214325 | 3300005457 | Bacteria | 648 |
| 184 | Ga0070662_101316449 | 3300005457 | Bacteria | 622 |
| 185 | Ga0070681_10006976 | 3300005458 | Bacteria | 10993 |
| 186 | Ga0070681_10085276 | 3300005458 | Bacteria | 3111 |
| 187 | Ga0070681_10102285 | 3300005458 | Bacteria | 2810 |
| 188 | Ga0070681_10287672 | 3300005458 | Bacteria | 1554 |
| 189 | Ga0070681_10380842 | 3300005458 | Bacteria | 1321 |
| 190 | Ga0070681_10468889 | 3300005458 | Bacteria | 1172 |
| 191 | Ga0070681_10491091 | 3300005458 | Bacteria | 1141 |
| 192 | Ga0070681_10500030 | 3300005458 | Bacteria | 1129 |
| 193 | Ga0070681_11587399 | 3300005458 | Bacteria | 580 |
| 194 | Ga0068867_100000759 | 3300005459 | Bacteria | 21719 |
| 195 | Ga0068867_100056644 | 3300005459 | Bacteria | 2900 |
| 196 | Ga0068867_100411982 | 3300005459 | Bacteria | 1142 |
| 197 | Ga0070685_10033417 | 3300005466 | Bacteria | 2889 |
| 198 | Ga0070685_10516453 | 3300005466 | Bacteria | 847 |
| 199 | Ga0070706_100129191 | 3300005467 | Bacteria | 2357 |
| 200 | Ga0070706_100163214 | 3300005467 | Bacteria | 2080 |
| 201 | Ga0070706_100212481 | 3300005467 | Bacteria | 1806 |
| 202 | Ga0070706_100448273 | 3300005467 | Bacteria | 1201 |
| 203 | Ga0070706_100536274 | 3300005467 | Bacteria | 1089 |
| 204 | Ga0070706_100716034 | 3300005467 | Bacteria | 928 |
| 205 | Ga0070707_100000409 | 3300005468 | Bacteria | 42487 |
| 206 | Ga0070707_100023799 | 3300005468 | Bacteria | 5793 |
| 207 | Ga0070707_100033031 | 3300005468 | Bacteria | 4932 |
| 208 | Ga0070707_100162363 | 3300005468 | Bacteria | 2177 |
| 209 | Ga0070707_100172977 | 3300005468 | Bacteria | 2104 |
| 210 | Ga0070707_100256290 | 3300005468 | Bacteria | 1702 |
| 211 | Ga0070707_100292565 | 3300005468 | Bacteria | 1583 |
| 212 | Ga0070707_100314329 | 3300005468 | Bacteria | 1522 |
| 213 | Ga0070707_100558413 | 3300005468 | Bacteria | 1107 |
| 214 | Ga0070707_100768564 | 3300005468 | Bacteria | 927 |
| 215 | Ga0070707_101479720 | 3300005468 | Bacteria | 646 |
| 216 | Ga0070707_102288806 | 3300005468 | Bacteria | 508 |
| 217 | Ga0070698_100018255 | 3300005471 | Bacteria | 7387 |
| 218 | Ga0070698_100020032 | 3300005471 | Bacteria | 7012 |
| 219 | Ga0070698_100101549 | 3300005471 | Bacteria | 2847 |
| 220 | Ga0070698_100510801 | 3300005471 | Bacteria | 1140 |
| 221 | Ga0070698_100743688 | 3300005471 | Bacteria | 924 |
| 222 | Ga0070698_100793109 | 3300005471 | Bacteria | 891 |
| 223 | Ga0070698_101256764 | 3300005471 | Bacteria | 690 |
| 224 | Ga0070698_101440831 | 3300005471 | Bacteria | 640 |
| 225 | Ga0070699_100000092 | 3300005518 | Bacteria | 86686 |
| 226 | Ga0070699_100005907 | 3300005518 | Bacteria | 10696 |
| 227 | Ga0070699_100066677 | 3300005518 | Bacteria | 3125 |
| 228 | Ga0070699_100242105 | 3300005518 | Bacteria | 1610 |
| 229 | Ga0070699_100262589 | 3300005518 | Bacteria | 1544 |
| 230 | Ga0070699_100285581 | 3300005518 | Bacteria | 1478 |
| 231 | Ga0070699_100505206 | 3300005518 | Bacteria | 1098 |
| 232 | Ga0070699_100628596 | 3300005518 | Bacteria | 980 |
| 233 | Ga0070699_100898119 | 3300005518 | Bacteria | 811 |
| 234 | Ga0070699_101100650 | 3300005518 | Bacteria | 729 |
| 235 | Ga0070699_101104301 | 3300005518 | Bacteria | 727 |
| 236 | Ga0070699_101912559 | 3300005518 | Bacteria | 543 |
| 237 | Ga0070699_102180378 | 3300005518 | Bacteria | 506 |
| 238 | Ga0070679_100012235 | 3300005530 | Bacteria | 8197 |
| 239 | Ga0070679_100024190 | 3300005530 | Bacteria | 5951 |
| 240 | Ga0070679_100029083 | 3300005530 | Bacteria | 5451 |
| 241 | Ga0070679_100036806 | 3300005530 | Bacteria | 4857 |
| 242 | Ga0070679_100142459 | 3300005530 | Bacteria | 2376 |
| 243 | Ga0070679_100193864 | 3300005530 | Bacteria | 2000 |
| 244 | Ga0070679_100627738 | 3300005530 | Bacteria | 1017 |
| 245 | Ga0070679_101090511 | 3300005530 | Bacteria | 743 |
| 246 | Ga0070679_101197442 | 3300005530 | Bacteria | 705 |
| 247 | Ga0070679_101650682 | 3300005530 | Bacteria | 589 |
| 248 | Ga0070679_102128088 | 3300005530 | Bacteria | 511 |
| 249 | Ga0070684_100000326 | 3300005535 | Bacteria | 32933 |
| 250 | Ga0070684_100013532 | 3300005535 | Bacteria | 6582 |
| 251 | Ga0070684_100099104 | 3300005535 | Bacteria | 2600 |
| 252 | Ga0070684_100105047 | 3300005535 | Bacteria | 2527 |
| 253 | Ga0070684_100417840 | 3300005535 | Bacteria | 1238 |
| 254 | Ga0070684_101280834 | 3300005535 | Bacteria | 690 |
| 255 | Ga0070684_101299637 | 3300005535 | Bacteria | 685 |
| 256 | Ga0070684_101813731 | 3300005535 | Bacteria | 576 |
| 257 | Ga0070684_102227742 | 3300005535 | Bacteria | 517 |
| 258 | Ga0070697_100005779 | 3300005536 | Bacteria | 9539 |
| 259 | Ga0070697_100044318 | 3300005536 | Bacteria | 3602 |
| 260 | Ga0070697_100083526 | 3300005536 | Bacteria | 2634 |
| 261 | Ga0070697_100093526 | 3300005536 | Bacteria | 2489 |
| 262 | Ga0070697_100195298 | 3300005536 | Bacteria | 1718 |
| 263 | Ga0070697_100219566 | 3300005536 | Bacteria | 1620 |
| 264 | Ga0070697_100296028 | 3300005536 | Bacteria | 1391 |
| 265 | Ga0070697_100297776 | 3300005536 | Bacteria | 1386 |
| 266 | Ga0070697_100501203 | 3300005536 | Bacteria | 1062 |
| 267 | Ga0070697_100857270 | 3300005536 | Bacteria | 805 |
| 268 | Ga0068853_100008476 | 3300005539 | Bacteria | 8262 |
| 269 | Ga0068853_100238338 | 3300005539 | Bacteria | 1666 |
| 270 | Ga0068853_101092882 | 3300005539 | Bacteria | 769 |
| 271 | Ga0068853_101281858 | 3300005539 | Bacteria | 708 |
| 272 | Ga0068853_101917283 | 3300005539 | Bacteria | 574 |
| 273 | Ga0068853_102327201 | 3300005539 | Bacteria | 519 |
| 274 | Ga0068853_102474451 | 3300005539 | Bacteria | 503 |
| 275 | Ga0070672_100241186 | 3300005543 | Bacteria | 1520 |
| 276 | Ga0070672_101386323 | 3300005543 | Bacteria | 629 |
| 277 | Ga0070672_101462454 | 3300005543 | Bacteria | 612 |
| 278 | Ga0070672_101666467 | 3300005543 | Bacteria | 573 |
| 279 | Ga0070686_100160677 | 3300005544 | Bacteria | 1582 |
| 280 | Ga0070686_100300936 | 3300005544 | Bacteria | 1189 |
| 281 | Ga0070686_100730023 | 3300005544 | Bacteria | 793 |
| 282 | Ga0070695_100046229 | 3300005545 | Bacteria | 2777 |
| 283 | Ga0070695_100095824 | 3300005545 | Bacteria | 1989 |
| 284 | Ga0070695_100312876 | 3300005545 | Bacteria | 1165 |
| 285 | Ga0070695_101582349 | 3300005545 | Bacteria | 547 |
| 286 | Ga0070696_100003048 | 3300005546 | Bacteria | 11126 |
| 287 | Ga0070696_100013055 | 3300005546 | Bacteria | 5574 |
| 288 | Ga0070696_100064398 | 3300005546 | Bacteria | 2568 |
| 289 | Ga0070696_100153436 | 3300005546 | Bacteria | 1692 |
| 290 | Ga0070696_100370580 | 3300005546 | Bacteria | 1114 |
| 291 | Ga0070696_100453076 | 3300005546 | Bacteria | 1013 |
| 292 | Ga0070696_100990012 | 3300005546 | Bacteria | 702 |
| 293 | Ga0070693_100015975 | 3300005547 | Bacteria | 3877 |
| 294 | Ga0070693_100303135 | 3300005547 | Bacteria | 1078 |
| 295 | Ga0070693_100319342 | 3300005547 | Bacteria | 1053 |
| 296 | Ga0070693_100506005 | 3300005547 | Bacteria | 857 |
| 297 | Ga0070693_100885869 | 3300005547 | Bacteria | 668 |
| 298 | Ga0070693_101449685 | 3300005547 | Bacteria | 535 |
| 299 | Ga0070665_100011744 | 3300005548 | Bacteria | 8844 |
| 300 | Ga0070665_100965551 | 3300005548 | Bacteria | 865 |
| 301 | Ga0070665_101528570 | 3300005548 | Bacteria | 676 |
| 302 | Ga0070704_100056890 | 3300005549 | Bacteria | 2779 |
| 303 | Ga0070704_100116000 | 3300005549 | Bacteria | 2047 |
| 304 | Ga0070704_100431466 | 3300005549 | Bacteria | 1131 |
| 305 | Ga0070704_100486200 | 3300005549 | Bacteria | 1069 |
| 306 | Ga0070704_100752816 | 3300005549 | Bacteria | 867 |
| 307 | Ga0070704_100833708 | 3300005549 | Bacteria | 826 |
| 308 | Ga0068855_100081814 | 3300005563 | Bacteria | 3742 |
| 309 | Ga0068855_100404096 | 3300005563 | Bacteria | 1496 |
| 310 | Ga0068855_100577451 | 3300005563 | Bacteria | 1214 |
| 311 | Ga0068855_101774665 | 3300005563 | Bacteria | 627 |
| 312 | Ga0068855_102163024 | 3300005563 | Bacteria | 559 |
| 313 | Ga0070664_100004494 | 3300005564 | Bacteria | 11191 |
| 314 | Ga0070664_100132457 | 3300005564 | Bacteria | 2190 |
| 315 | Ga0070664_100136105 | 3300005564 | Bacteria | 2160 |
| 316 | Ga0070664_100245714 | 3300005564 | Bacteria | 1607 |
| 317 | Ga0070664_100245745 | 3300005564 | Bacteria | 1607 |
| 318 | Ga0070664_100460027 | 3300005564 | Bacteria | 1169 |
| 319 | Ga0070664_101254215 | 3300005564 | Bacteria | 700 |
| 320 | Ga0070664_101275582 | 3300005564 | Bacteria | 694 |
| 321 | Ga0070664_101426181 | 3300005564 | Bacteria | 655 |
| 322 | Ga0068857_100007935 | 3300005577 | Bacteria | 9161 |
| 323 | Ga0068857_100032526 | 3300005577 | Bacteria | 4613 |
| 324 | Ga0068857_100075686 | 3300005577 | Bacteria | 3001 |
| 325 | Ga0068857_100648026 | 3300005577 | Bacteria | 1001 |
| 326 | Ga0068857_101523931 | 3300005577 | Bacteria | 652 |
| 327 | Ga0068857_101757341 | 3300005577 | Bacteria | 607 |
| 328 | Ga0068854_100003432 | 3300005578 | Bacteria | 9880 |
| 329 | Ga0068854_100131928 | 3300005578 | Bacteria | 1909 |
| 330 | Ga0068854_100170652 | 3300005578 | Bacteria | 1692 |
| 331 | Ga0068854_101894065 | 3300005578 | Bacteria | 548 |
| 332 | Ga0068854_101962452 | 3300005578 | Bacteria | 539 |
| 333 | Ga0068856_100119705 | 3300005614 | Bacteria | 2634 |
| 334 | Ga0068856_100269836 | 3300005614 | Bacteria | 1717 |
| 335 | Ga0068856_100522275 | 3300005614 | Bacteria | 1208 |
| 336 | Ga0068856_100738213 | 3300005614 | Bacteria | 1005 |
| 337 | Ga0070702_100118342 | 3300005615 | Bacteria | 1654 |
| 338 | Ga0070702_100228920 | 3300005615 | Bacteria | 1248 |
| 339 | Ga0070702_100626702 | 3300005615 | Bacteria | 810 |
| 340 | Ga0068852_100005278 | 3300005616 | Bacteria | 9224 |
| 341 | Ga0068852_100065709 | 3300005616 | Bacteria | 3166 |
| 342 | Ga0068852_100127253 | 3300005616 | Bacteria | 2341 |
| 343 | Ga0068852_100376150 | 3300005616 | Bacteria | 1392 |
| 344 | Ga0068852_100927148 | 3300005616 | Bacteria | 888 |
| 345 | Ga0068852_101050239 | 3300005616 | Unclassified | 834 |
| 346 | Ga0068852_101605732 | 3300005616 | Bacteria | 673 |
| 347 | Ga0068859_100629297 | 3300005617 | Bacteria | 1165 |
| 348 | Ga0068859_100885997 | 3300005617 | Bacteria | 978 |
| 349 | Ga0068859_100937576 | 3300005617 | Bacteria | 949 |
| 350 | Ga0068859_101283992 | 3300005617 | Bacteria | 807 |
| 351 | Ga0068859_101764026 | 3300005617 | Bacteria | 684 |
| 352 | Ga0068864_100512406 | 3300005618 | Bacteria | 1155 |
| 353 | Ga0068864_100513615 | 3300005618 | Unclassified | 1154 |
| 354 | Ga0068864_101031802 | 3300005618 | Bacteria | 816 |
| 355 | Ga0068864_101054928 | 3300005618 | Bacteria | 807 |
| 356 | Ga0068864_101180369 | 3300005618 | Bacteria | 764 |
| 357 | Ga0068864_101877037 | 3300005618 | Bacteria | 605 |
| 358 | Ga0068864_102062129 | 3300005618 | Bacteria | 577 |
| 359 | Ga0068866_10000404 | 3300005718 | Bacteria | 20120 |
| 360 | Ga0068861_100176137 | 3300005719 | Bacteria | 1776 |
| 361 | Ga0068861_100198429 | 3300005719 | Bacteria | 1683 |
| 362 | Ga0068851_10021773 | 3300005834 | Bacteria | 3114 |
| 363 | Ga0068870_10030395 | 3300005840 | Bacteria | 2729 |
| 364 | Ga0068870_10866419 | 3300005840 | Bacteria | 636 |
| 365 | Ga0068863_100078093 | 3300005841 | Bacteria | 3134 |
| 366 | Ga0068863_100217663 | 3300005841 | Bacteria | 1839 |
| 367 | Ga0068863_100263845 | 3300005841 | Bacteria | 1666 |
| 368 | Ga0068863_101381658 | 3300005841 | Bacteria | 712 |
| 369 | Ga0068863_101610255 | 3300005841 | Bacteria | 658 |
| 370 | Ga0068863_102633411 | 3300005841 | Bacteria | 512 |
| 371 | Ga0068858_100077874 | 3300005842 | Bacteria | 3080 |
| 372 | Ga0068858_100901461 | 3300005842 | Unclassified | 865 |
| 373 | Ga0068858_101388984 | 3300005842 | Bacteria | 692 |
| 374 | Ga0068860_100208880 | 3300005843 | Bacteria | 1893 |
| 375 | Ga0068860_100254541 | 3300005843 | Bacteria | 1710 |
| 376 | Ga0068860_100576869 | 3300005843 | Bacteria | 1129 |
| 377 | Ga0068860_100904091 | 3300005843 | Bacteria | 899 |
| 378 | Ga0068860_101028444 | 3300005843 | Bacteria | 842 |
| 379 | Ga0068860_101029457 | 3300005843 | Bacteria | 842 |
| 380 | Ga0068860_101173858 | 3300005843 | Bacteria | 788 |
| 381 | Ga0068862_100590872 | 3300005844 | Bacteria | 1065 |
| 382 | Ga0068862_101039616 | 3300005844 | Bacteria | 812 |
| 383 | Ga0068862_101097672 | 3300005844 | Bacteria | 791 |
| 384 | Ga0068862_101459169 | 3300005844 | Bacteria | 689 |
| 385 | Ga0068862_101594291 | 3300005844 | Bacteria | 660 |
| 386 | Ga0068862_101961398 | 3300005844 | Bacteria | 596 |
| 387 | Ga0081455_10800432 | 3300005937 | Bacteria | 592 |
| 388 | Ga0070717_10213212 | 3300006028 | Bacteria | 1695 |
| 389 | Ga0075364_10102673 | 3300006051 | Bacteria | 1904 |
| 390 | Ga0075432_10311200 | 3300006058 | Bacteria | 657 |
| 391 | Ga0075432_10434716 | 3300006058 | Bacteria | 573 |
| 392 | Ga0070715_10065850 | 3300006163 | Bacteria | 1605 |
| 393 | Ga0070715_10457432 | 3300006163 | Bacteria | 722 |
| 394 | Ga0070716_100004886 | 3300006173 | Bacteria | 6447 |
| 395 | Ga0070716_100171570 | 3300006173 | Bacteria | 1416 |
| 396 | Ga0070716_101690437 | 3300006173 | Bacteria | 522 |
| 397 | Ga0070712_100436871 | 3300006175 | Bacteria | 1088 |
| 398 | Ga0070712_101902792 | 3300006175 | Bacteria | 521 |
| 399 | Ga0075362_10638651 | 3300006177 | Bacteria | 552 |
| 400 | Ga0075366_10104654 | 3300006195 | Bacteria | 1700 |
| 401 | Ga0097621_100963727 | 3300006237 | Bacteria | 797 |
| 402 | Ga0097621_101217495 | 3300006237 | Bacteria | 709 |
| 403 | Ga0097621_101281850 | 3300006237 | Bacteria | 692 |
| 404 | Ga0075370_10322826 | 3300006353 | Bacteria | 920 |
| 405 | Ga0068871_100375186 | 3300006358 | Bacteria | 1262 |
| 406 | Ga0068871_100391742 | 3300006358 | Bacteria | 1236 |
| 407 | Ga0068871_101463415 | 3300006358 | Bacteria | 645 |
| 408 | Ga0068871_101608985 | 3300006358 | Bacteria | 615 |
| 409 | Ga0075428_100446670 | 3300006844 | Bacteria | 1385 |
| 410 | Ga0075428_100835125 | 3300006844 | Bacteria | 979 |
| 411 | Ga0075428_101479644 | 3300006844 | Bacteria | 712 |
| 412 | Ga0075428_102526401 | 3300006844 | Bacteria | 526 |
| 413 | Ga0075430_100715140 | 3300006846 | Bacteria | 826 |
| 414 | Ga0075430_100929367 | 3300006846 | Bacteria | 717 |
| 415 | Ga0075431_100136198 | 3300006847 | Bacteria | 2532 |
| 416 | Ga0075431_100147269 | 3300006847 | Bacteria | 2426 |
| 417 | Ga0075431_100341443 | 3300006847 | Bacteria | 1507 |
| 418 | Ga0075431_100591123 | 3300006847 | Bacteria | 1095 |
| 419 | Ga0075433_10409775 | 3300006852 | Bacteria | 1196 |
| 420 | Ga0075433_10468029 | 3300006852 | Bacteria | 1110 |
| 421 | Ga0075434_100506556 | 3300006871 | Bacteria | 1228 |
| 422 | Ga0075434_100702695 | 3300006871 | Bacteria | 1029 |
| 423 | Ga0075434_101129355 | 3300006871 | Bacteria | 797 |
| 424 | Ga0075429_101074736 | 3300006880 | Bacteria | 703 |
| 425 | Ga0068865_100005654 | 3300006881 | Bacteria | 7590 |
| 426 | Ga0068865_100407770 | 3300006881 | Bacteria | 1114 |
| 427 | Ga0068865_100755444 | 3300006881 | Bacteria | 835 |
| 428 | Ga0075436_100008314 | 3300006914 | Bacteria | 7099 |
| 429 | Ga0075436_100389956 | 3300006914 | Bacteria | 1008 |
| 430 | Ga0075436_100910751 | 3300006914 | Bacteria | 658 |
| 431 | Ga0075436_100913257 | 3300006914 | Bacteria | 657 |
| 432 | Ga0075436_100990790 | 3300006914 | Bacteria | 630 |
| 433 | Ga0097620_100629275 | 3300006931 | Bacteria | 1165 |
| 434 | Ga0097620_100885962 | 3300006931 | Bacteria | 978 |
| 435 | Ga0097620_100937552 | 3300006931 | Bacteria | 949 |
| 436 | Ga0097620_101283884 | 3300006931 | Bacteria | 807 |
| 437 | Ga0097620_101764035 | 3300006931 | Bacteria | 684 |
| 438 | Ga0075435_100170485 | 3300007076 | Bacteria | 1836 |
| 439 | Ga0075435_101211370 | 3300007076 | Bacteria | 661 |
| 440 | Ga0075435_101427843 | 3300007076 | Bacteria | 607 |
| 441 | Ga0105240_10208118 | 3300009093 | Unclassified | 2288 |
| 442 | Ga0105240_10225714 | 3300009093 | Bacteria | 2179 |
| 443 | Ga0105240_10747923 | 3300009093 | Bacteria | 1063 |
| 444 | Ga0105240_11157464 | 3300009093 | Bacteria | 821 |
| 445 | Ga0111539_10433129 | 3300009094 | Bacteria | 1531 |
| 446 | Ga0111539_10567643 | 3300009094 | Bacteria | 1321 |
| 447 | Ga0111539_10691486 | 3300009094 | Bacteria | 1187 |
| 448 | Ga0111539_11315244 | 3300009094 | Bacteria | 839 |
| 449 | Ga0105245_10000082 | 3300009098 | Bacteria | 95636 |
| 450 | Ga0105245_10025517 | 3300009098 | Bacteria | 5198 |
| 451 | Ga0105245_10161584 | 3300009098 | Bacteria | 2126 |
| 452 | Ga0105247_10193790 | 3300009101 | Bacteria | 1362 |
| 453 | Ga0114129_10150508 | 3300009147 | Bacteria | 3185 |
| 454 | Ga0114129_10331483 | 3300009147 | Bacteria | 2020 |
| 455 | Ga0114129_10393376 | 3300009147 | Bacteria | 1828 |
| 456 | Ga0114129_10507958 | 3300009147 | Bacteria | 1573 |
| 457 | Ga0114129_10968006 | 3300009147 | Bacteria | 1074 |
| 458 | Ga0114129_11187811 | 3300009147 | Bacteria | 951 |
| 459 | Ga0114129_11409747 | 3300009147 | Bacteria | 859 |
| 460 | Ga0114129_11798651 | 3300009147 | Bacteria | 745 |
| 461 | Ga0114129_13403684 | 3300009147 | Bacteria | 511 |
| 462 | Ga0105243_10003111 | 3300009148 | Bacteria | 13635 |
| 463 | Ga0105243_10392916 | 3300009148 | Bacteria | 1286 |
| 464 | Ga0105241_10009451 | 3300009174 | Bacteria | 7161 |
| 465 | Ga0105241_10543631 | 3300009174 | Bacteria | 1042 |
| 466 | Ga0105241_10717181 | 3300009174 | Bacteria | 914 |
| 467 | Ga0105241_11800170 | 3300009174 | Bacteria | 598 |
| 468 | Ga0105242_10003345 | 3300009176 | Bacteria | 12474 |
| 469 | Ga0105242_10023463 | 3300009176 | Bacteria | 4861 |
| 470 | Ga0105242_10647666 | 3300009176 | Bacteria | 1027 |
| 471 | Ga0105242_10667366 | 3300009176 | Bacteria | 1013 |
| 472 | Ga0105242_11760108 | 3300009176 | Bacteria | 657 |
| 473 | Ga0105242_11814616 | 3300009176 | Unclassified | 648 |
| 474 | Ga0105248_10026828 | 3300009177 | Bacteria | 6408 |
| 475 | Ga0105248_10282138 | 3300009177 | Bacteria | 1870 |
| 476 | Ga0105248_10623999 | 3300009177 | Bacteria | 1216 |
| 477 | Ga0105248_13432348 | 3300009177 | Bacteria | 503 |
| 478 | Ga0105248_13461920 | 3300009177 | Bacteria | 501 |
| 479 | Ga0105237_10281100 | 3300009545 | Bacteria | 1667 |
| 480 | Ga0105237_11289889 | 3300009545 | Bacteria | 737 |
| 481 | Ga0105237_12221910 | 3300009545 | Bacteria | 558 |
| 482 | Ga0105238_10231835 | 3300009551 | Bacteria | 1823 |
| 483 | Ga0105238_10275029 | 3300009551 | Bacteria | 1665 |
| 484 | Ga0105238_10321897 | 3300009551 | Bacteria | 1532 |
| 485 | Ga0105238_10472384 | 3300009551 | Bacteria | 1253 |
| 486 | Ga0105238_10953504 | 3300009551 | Bacteria | 878 |
| 487 | Ga0105238_11734694 | 3300009551 | Bacteria | 656 |
| 488 | Ga0105249_10030534 | 3300009553 | Bacteria | 4872 |
| 489 | Ga0105249_11024306 | 3300009553 | Bacteria | 895 |
| 490 | Ga0105249_11625372 | 3300009553 | Bacteria | 719 |
| 491 | Ga0105249_11918672 | 3300009553 | Bacteria | 665 |
| 492 | Ga0105249_12648435 | 3300009553 | Bacteria | 574 |
| 493 | Ga0105239_10005836 | 3300010375 | Bacteria | 14347 |
| 494 | Ga0105239_10159505 | 3300010375 | Bacteria | 2519 |
| 495 | Ga0105239_10881783 | 3300010375 | Bacteria | 1027 |
| 496 | Ga0105246_10262910 | 3300011119 | Bacteria | 1375 |
| 497 | Ga0105246_10496521 | 3300011119 | Bacteria | 1035 |
| 498 | Ga0157329_1024032 | 3300012491 | Bacteria | 592 |
| 499 | Ga0157345_1033817 | 3300012498 | Bacteria | 586 |
| 500 | Ga0157327_1006565 | 3300012512 | Bacteria | 983 |
| 501 | Ga0157373_10206900 | 3300013100 | Bacteria | 1383 |
| 502 | Ga0157373_10223200 | 3300013100 | Bacteria | 1330 |
| 503 | Ga0157373_10248359 | 3300013100 | Bacteria | 1258 |
| 504 | Ga0157373_10522516 | 3300013100 | Bacteria | 859 |
| 505 | Ga0157373_11271784 | 3300013100 | Bacteria | 556 |
| 506 | Ga0157371_10224768 | 3300013102 | Bacteria | 1348 |
| 507 | Ga0157371_10272488 | 3300013102 | Bacteria | 1222 |
| 508 | Ga0157371_10422242 | 3300013102 | Bacteria | 978 |
| 509 | Ga0157370_10044459 | 3300013104 | Bacteria | 4269 |
| 510 | Ga0157370_10152532 | 3300013104 | Bacteria | 2150 |
| 511 | Ga0157370_10815091 | 3300013104 | Bacteria | 849 |
| 512 | Ga0157370_11458628 | 3300013104 | Bacteria | 615 |
| 513 | Ga0157369_10070857 | 3300013105 | Bacteria | 3744 |
| 514 | Ga0157369_10073266 | 3300013105 | Bacteria | 3675 |
| 515 | Ga0157369_12086848 | 3300013105 | Bacteria | 575 |
| 516 | Ga0157374_10684999 | 3300013296 | Bacteria | 1038 |
| 517 | Ga0157378_10000577 | 3300013297 | Bacteria | 34569 |
| 518 | Ga0157378_10162097 | 3300013297 | Bacteria | 2092 |
| 519 | Ga0157378_11034898 | 3300013297 | Bacteria | 856 |
| 520 | Ga0157378_11353924 | 3300013297 | Bacteria | 754 |
| 521 | Ga0163162_10429741 | 3300013306 | Bacteria | 1453 |
| 522 | Ga0163162_10872426 | 3300013306 | Bacteria | 1014 |
| 523 | Ga0163162_12717583 | 3300013306 | Bacteria | 570 |
| 524 | Ga0157372_10081879 | 3300013307 | Bacteria | 3654 |
| 525 | Ga0157372_10147504 | 3300013307 | Bacteria | 2713 |
| 526 | Ga0157372_10227076 | 3300013307 | Bacteria | 2164 |
| 527 | Ga0157372_10295081 | 3300013307 | Bacteria | 1885 |
| 528 | Ga0157372_10453519 | 3300013307 | Bacteria | 1494 |
| 529 | Ga0157372_10893734 | 3300013307 | Bacteria | 1031 |
| 530 | Ga0157372_12513007 | 3300013307 | Bacteria | 591 |
| 531 | Ga0157375_10047633 | 3300013308 | Bacteria | 4188 |
| 532 | Ga0157375_10733745 | 3300013308 | Bacteria | 1140 |
| 533 | Ga0157375_11140263 | 3300013308 | Bacteria | 913 |
| 534 | Ga0157375_11230699 | 3300013308 | Bacteria | 879 |
| 535 | Ga0157375_12909552 | 3300013308 | Bacteria | 572 |
| 536 | Ga0163163_10117853 | 3300014325 | Bacteria | 2687 |
| 537 | Ga0163163_11350123 | 3300014325 | Bacteria | 775 |
| 538 | Ga0157380_10365752 | 3300014326 | Bacteria | 1355 |
| 539 | Ga0157380_10881154 | 3300014326 | Bacteria | 919 |
| 540 | Ga0157380_12539380 | 3300014326 | Bacteria | 578 |
| 541 | Ga0182008_10348653 | 3300014497 | Bacteria | 785 |
| 542 | Ga0157377_10030601 | 3300014745 | Bacteria | 2917 |
| 543 | Ga0157377_11012458 | 3300014745 | Bacteria | 630 |
| 544 | Ga0157377_11085084 | 3300014745 | Bacteria | 612 |
| 545 | Ga0157379_10275152 | 3300014968 | Bacteria | 1531 |
| 546 | Ga0157379_11097937 | 3300014968 | Bacteria | 762 |
| 547 | Ga0157376_10025735 | 3300014969 | Bacteria | 4638 |
| 548 | Ga0157376_10396069 | 3300014969 | Bacteria | 1334 |
| 549 | Ga0157376_11231086 | 3300014969 | Bacteria | 777 |
| 550 | Ga0157376_11969980 | 3300014969 | Bacteria | 622 |
| 551 | Ga0157376_12187452 | 3300014969 | Bacteria | 592 |
| 552 | Ga0163161_10078147 | 3300017792 | Bacteria | 2432 |
| 553 | Ga0206355_1229164 | 3300020076 | Bacteria | 1392 |
| 554 | Ga0206355_1675750 | 3300020076 | Bacteria | 590 |
| 555 | Ga0206355_1700556 | 3300020076 | Bacteria | 528 |
| 556 | Ga0206351_10347809 | 3300020077 | Bacteria | 614 |
| 557 | Ga0206351_10550909 | 3300020077 | Bacteria | 683 |
| 558 | Ga0206351_10662335 | 3300020077 | Bacteria | 1078 |
| 559 | Ga0206351_10734128 | 3300020077 | Bacteria | 732 |
| 560 | Ga0206352_11006934 | 3300020078 | Bacteria | 650 |
| 561 | Ga0206350_10009095 | 3300020080 | Bacteria | 1019 |
| 562 | Ga0206350_11339704 | 3300020080 | Bacteria | 611 |
| 563 | Ga0206350_11600674 | 3300020080 | Bacteria | 2001 |
| 564 | Ga0206354_11041843 | 3300020081 | Bacteria | 792 |
| 565 | Ga0206353_10256562 | 3300020082 | Bacteria | 821 |
| 566 | Ga0206353_11560491 | 3300020082 | Bacteria | 936 |
| 567 | Ga0154015_1166432 | 3300020610 | Bacteria | 843 |
| 568 | Ga0154015_1563880 | 3300020610 | Bacteria | 725 |
| 569 | Ga0224712_10102578 | 3300022467 | Bacteria | 1215 |
| 570 | Ga0224712_10383109 | 3300022467 | Bacteria | 668 |
| 571 | Ga0256744_150842 | 3300023309 | Bacteria | 812 |
| 572 | Ga0207697_10018429 | 3300025315 | Bacteria | 2863 |
| 573 | Ga0207697_10145258 | 3300025315 | Bacteria | 1030 |
| 574 | Ga0207656_10104086 | 3300025321 | Bacteria | 1304 |
| 575 | Ga0207653_10427838 | 3300025885 | Bacteria | 519 |
| 576 | Ga0207682_10048598 | 3300025893 | Bacteria | 1749 |
| 577 | Ga0207682_10055623 | 3300025893 | Bacteria | 1646 |
| 578 | Ga0207682_10138248 | 3300025893 | Bacteria | 1092 |
| 579 | Ga0207692_10161191 | 3300025898 | Bacteria | 1293 |
| 580 | Ga0207642_10000405 | 3300025899 | Bacteria | 12984 |
| 581 | Ga0207688_10166726 | 3300025901 | Bacteria | 1308 |
| 582 | Ga0207680_10032117 | 3300025903 | Bacteria | 2981 |
| 583 | Ga0207647_10244479 | 3300025904 | Bacteria | 1030 |
| 584 | Ga0207685_10403253 | 3300025905 | Bacteria | 701 |
| 585 | Ga0207699_10034084 | 3300025906 | Bacteria | 2884 |
| 586 | Ga0207699_10319613 | 3300025906 | Bacteria | 1088 |
| 587 | Ga0207645_10005407 | 3300025907 | Bacteria | 9262 |
| 588 | Ga0207645_10017875 | 3300025907 | Bacteria | 4676 |
| 589 | Ga0207645_10135011 | 3300025907 | Bacteria | 1607 |
| 590 | Ga0207645_10217388 | 3300025907 | Bacteria | 1259 |
| 591 | Ga0207645_11055275 | 3300025907 | Bacteria | 549 |
| 592 | Ga0207643_10003848 | 3300025908 | Bacteria | 8076 |
| 593 | Ga0207643_10413708 | 3300025908 | Bacteria | 854 |
| 594 | Ga0207643_11002474 | 3300025908 | Bacteria | 540 |
| 595 | Ga0207705_10024161 | 3300025909 | Bacteria | 4337 |
| 596 | Ga0207705_10395806 | 3300025909 | Bacteria | 1068 |
| 597 | Ga0207705_10764772 | 3300025909 | Bacteria | 750 |
| 598 | Ga0207705_10972144 | 3300025909 | Bacteria | 656 |
| 599 | Ga0207684_10059226 | 3300025910 | Bacteria | 3251 |
| 600 | Ga0207684_10119427 | 3300025910 | Bacteria | 2260 |
| 601 | Ga0207684_11272122 | 3300025910 | Bacteria | 607 |
| 602 | Ga0207654_10429889 | 3300025911 | Bacteria | 923 |
| 603 | Ga0207654_10527224 | 3300025911 | Bacteria | 837 |
| 604 | Ga0207654_10715486 | 3300025911 | Bacteria | 720 |
| 605 | Ga0207707_10004691 | 3300025912 | Bacteria | 12001 |
| 606 | Ga0207707_10070111 | 3300025912 | Bacteria | 3055 |
| 607 | Ga0207707_10129960 | 3300025912 | Bacteria | 2203 |
| 608 | Ga0207707_10267494 | 3300025912 | Bacteria | 1482 |
| 609 | Ga0207707_10598707 | 3300025912 | Bacteria | 933 |
| 610 | Ga0207707_10775716 | 3300025912 | Bacteria | 800 |
| 611 | Ga0207707_10837354 | 3300025912 | Bacteria | 764 |
| 612 | Ga0207707_10893897 | 3300025912 | Bacteria | 735 |
| 613 | Ga0207707_11179558 | 3300025912 | Bacteria | 621 |
| 614 | Ga0207695_10192700 | 3300025913 | Bacteria | 1955 |
| 615 | Ga0207695_10301987 | 3300025913 | Bacteria | 1492 |
| 616 | Ga0207695_10377356 | 3300025913 | Bacteria | 1304 |
| 617 | Ga0207695_10856306 | 3300025913 | Bacteria | 789 |
| 618 | Ga0207671_10702703 | 3300025914 | Bacteria | 804 |
| 619 | Ga0207693_10319734 | 3300025915 | Bacteria | 1215 |
| 620 | Ga0207663_10066171 | 3300025916 | Bacteria | 2312 |
| 621 | Ga0207663_10320756 | 3300025916 | Bacteria | 1164 |
| 622 | Ga0207663_11244044 | 3300025916 | Bacteria | 600 |
| 623 | Ga0207660_10001699 | 3300025917 | Bacteria | 14765 |
| 624 | Ga0207660_10061959 | 3300025917 | Bacteria | 2694 |
| 625 | Ga0207660_10120341 | 3300025917 | Bacteria | 1988 |
| 626 | Ga0207660_10188180 | 3300025917 | Bacteria | 1606 |
| 627 | Ga0207660_10200051 | 3300025917 | Bacteria | 1560 |
| 628 | Ga0207660_10247526 | 3300025917 | Bacteria | 1406 |
| 629 | Ga0207660_10302396 | 3300025917 | Bacteria | 1274 |
| 630 | Ga0207660_10530818 | 3300025917 | Bacteria | 956 |
| 631 | Ga0207660_10840584 | 3300025917 | Bacteria | 749 |
| 632 | Ga0207660_10990615 | 3300025917 | Bacteria | 686 |
| 633 | Ga0207662_10002838 | 3300025918 | Bacteria | 8759 |
| 634 | Ga0207662_10145691 | 3300025918 | Bacteria | 1503 |
| 635 | Ga0207657_10035732 | 3300025919 | Bacteria | 4453 |
| 636 | Ga0207657_10141222 | 3300025919 | Bacteria | 1967 |
| 637 | Ga0207657_10251232 | 3300025919 | Bacteria | 1409 |
| 638 | Ga0207657_10619799 | 3300025919 | Bacteria | 843 |
| 639 | Ga0207649_10123547 | 3300025920 | Bacteria | 1748 |
| 640 | Ga0207649_10363850 | 3300025920 | Bacteria | 1074 |
| 641 | Ga0207649_10477255 | 3300025920 | Bacteria | 945 |
| 642 | Ga0207649_10748592 | 3300025920 | Bacteria | 760 |
| 643 | Ga0207649_11479492 | 3300025920 | Bacteria | 538 |
| 644 | Ga0207649_11485440 | 3300025920 | Bacteria | 536 |
| 645 | Ga0207652_10010917 | 3300025921 | Bacteria | 7321 |
| 646 | Ga0207652_10045176 | 3300025921 | Bacteria | 3754 |
| 647 | Ga0207652_10139310 | 3300025921 | Bacteria | 2168 |
| 648 | Ga0207652_10196417 | 3300025921 | Bacteria | 1815 |
| 649 | Ga0207652_10295615 | 3300025921 | Bacteria | 1461 |
| 650 | Ga0207652_10330421 | 3300025921 | Bacteria | 1376 |
| 651 | Ga0207652_10433045 | 3300025921 | Bacteria | 1186 |
| 652 | Ga0207652_10546292 | 3300025921 | Bacteria | 1041 |
| 653 | Ga0207652_10584527 | 3300025921 | Bacteria | 1002 |
| 654 | Ga0207652_10652349 | 3300025921 | Bacteria | 941 |
| 655 | Ga0207652_10673396 | 3300025921 | Bacteria | 924 |
| 656 | Ga0207646_10001673 | 3300025922 | Bacteria | 27062 |
| 657 | Ga0207646_10033666 | 3300025922 | Bacteria | 4632 |
| 658 | Ga0207646_10168228 | 3300025922 | Bacteria | 1979 |
| 659 | Ga0207646_10419294 | 3300025922 | Bacteria | 1208 |
| 660 | Ga0207646_10573772 | 3300025922 | Bacteria | 1013 |
| 661 | Ga0207646_10776853 | 3300025922 | Bacteria | 854 |
| 662 | Ga0207646_10863831 | 3300025922 | Bacteria | 804 |
| 663 | Ga0207681_10002648 | 3300025923 | Bacteria | 11344 |
| 664 | Ga0207681_10273253 | 3300025923 | Bacteria | 1327 |
| 665 | Ga0207694_10009441 | 3300025924 | Bacteria | 7355 |
| 666 | Ga0207694_10521156 | 3300025924 | Bacteria | 996 |
| 667 | Ga0207694_10552811 | 3300025924 | Bacteria | 966 |
| 668 | Ga0207694_10719173 | 3300025924 | Bacteria | 842 |
| 669 | Ga0207694_10910627 | 3300025924 | Bacteria | 744 |
| 670 | Ga0207650_10053915 | 3300025925 | Bacteria | 2981 |
| 671 | Ga0207659_10000902 | 3300025926 | Bacteria | 17672 |
| 672 | Ga0207659_10091679 | 3300025926 | Bacteria | 2270 |
| 673 | Ga0207659_10384418 | 3300025926 | Bacteria | 1171 |
| 674 | Ga0207659_11595348 | 3300025926 | Bacteria | 557 |
| 675 | Ga0207687_10000288 | 3300025927 | Bacteria | 34782 |
| 676 | Ga0207687_10109312 | 3300025927 | Bacteria | 2048 |
| 677 | Ga0207687_10175767 | 3300025927 | Bacteria | 1655 |
| 678 | Ga0207687_10196971 | 3300025927 | Bacteria | 1572 |
| 679 | Ga0207700_10356570 | 3300025928 | Bacteria | 1274 |
| 680 | Ga0207700_10424367 | 3300025928 | Bacteria | 1169 |
| 681 | Ga0207664_10051400 | 3300025929 | Bacteria | 3254 |
| 682 | Ga0207664_10094655 | 3300025929 | Bacteria | 2455 |
| 683 | Ga0207644_10007504 | 3300025931 | Bacteria | 7112 |
| 684 | Ga0207644_10088997 | 3300025931 | Bacteria | 2297 |
| 685 | Ga0207644_10276806 | 3300025931 | Bacteria | 1346 |
| 686 | Ga0207690_10136294 | 3300025932 | Bacteria | 1803 |
| 687 | Ga0207690_10189337 | 3300025932 | Bacteria | 1555 |
| 688 | Ga0207690_11409742 | 3300025932 | Bacteria | 582 |
| 689 | Ga0207706_10000105 | 3300025933 | Bacteria | 88610 |
| 690 | Ga0207706_10076892 | 3300025933 | Bacteria | 2936 |
| 691 | Ga0207706_10089932 | 3300025933 | Bacteria | 2699 |
| 692 | Ga0207706_10436537 | 3300025933 | Bacteria | 1134 |
| 693 | Ga0207706_10444829 | 3300025933 | Bacteria | 1121 |
| 694 | Ga0207706_10899012 | 3300025933 | Bacteria | 748 |
| 695 | Ga0207706_11100982 | 3300025933 | Bacteria | 664 |
| 696 | Ga0207686_10000323 | 3300025934 | Bacteria | 34416 |
| 697 | Ga0207686_10497711 | 3300025934 | Bacteria | 945 |
| 698 | Ga0207686_11109485 | 3300025934 | Bacteria | 645 |
| 699 | Ga0207709_10001805 | 3300025935 | Bacteria | 14313 |
| 700 | Ga0207709_10191320 | 3300025935 | Bacteria | 1454 |
| 701 | Ga0207670_10009329 | 3300025936 | Bacteria | 5596 |
| 702 | Ga0207670_10999456 | 3300025936 | Bacteria | 704 |
| 703 | Ga0207669_10012485 | 3300025937 | Bacteria | 4179 |
| 704 | Ga0207669_10297958 | 3300025937 | Bacteria | 1224 |
| 705 | Ga0207669_11399657 | 3300025937 | Bacteria | 595 |
| 706 | Ga0207665_10000486 | 3300025939 | Bacteria | 26908 |
| 707 | Ga0207665_10880324 | 3300025939 | Bacteria | 710 |
| 708 | Ga0207691_10887326 | 3300025940 | Bacteria | 747 |
| 709 | Ga0207691_11191058 | 3300025940 | Bacteria | 632 |
| 710 | Ga0207691_11247499 | 3300025940 | Bacteria | 615 |
| 711 | Ga0207711_10009631 | 3300025941 | Bacteria | 8049 |
| 712 | Ga0207711_10617721 | 3300025941 | Bacteria | 1011 |
| 713 | Ga0207711_10870341 | 3300025941 | Bacteria | 838 |
| 714 | Ga0207711_11530862 | 3300025941 | Bacteria | 610 |
| 715 | Ga0207689_10018455 | 3300025942 | Bacteria | 5887 |
| 716 | Ga0207689_10157603 | 3300025942 | Bacteria | 1871 |
| 717 | Ga0207689_10511255 | 3300025942 | Bacteria | 1007 |
| 718 | Ga0207689_11040244 | 3300025942 | Bacteria | 691 |
| 719 | Ga0207689_11431291 | 3300025942 | Bacteria | 579 |
| 720 | Ga0207661_10006266 | 3300025944 | Bacteria | 8414 |
| 721 | Ga0207661_10107789 | 3300025944 | Bacteria | 2350 |
| 722 | Ga0207661_10380586 | 3300025944 | Bacteria | 1277 |
| 723 | Ga0207661_10640929 | 3300025944 | Bacteria | 976 |
| 724 | Ga0207661_11205630 | 3300025944 | Bacteria | 696 |
| 725 | Ga0207661_11558771 | 3300025944 | Bacteria | 605 |
| 726 | Ga0207661_11962204 | 3300025944 | Bacteria | 531 |
| 727 | Ga0207679_10010117 | 3300025945 | Bacteria | 6064 |
| 728 | Ga0207679_10193448 | 3300025945 | Bacteria | 1693 |
| 729 | Ga0207679_10291104 | 3300025945 | Bacteria | 1404 |
| 730 | Ga0207679_10543840 | 3300025945 | Bacteria | 1041 |
| 731 | Ga0207679_11014810 | 3300025945 | Bacteria | 761 |
| 732 | Ga0207679_11481074 | 3300025945 | Bacteria | 623 |
| 733 | Ga0207679_11646702 | 3300025945 | Bacteria | 588 |
| 734 | Ga0207667_10029258 | 3300025949 | Bacteria | 5975 |
| 735 | Ga0207667_10031423 | 3300025949 | Bacteria | 5732 |
| 736 | Ga0207667_10239433 | 3300025949 | Bacteria | 1857 |
| 737 | Ga0207667_10927691 | 3300025949 | Bacteria | 861 |
| 738 | Ga0207667_11082659 | 3300025949 | Bacteria | 785 |
| 739 | Ga0207667_11904797 | 3300025949 | Bacteria | 557 |
| 740 | Ga0207651_10092780 | 3300025960 | Bacteria | 2215 |
| 741 | Ga0207651_10121830 | 3300025960 | Bacteria | 1979 |
| 742 | Ga0207651_10572322 | 3300025960 | Bacteria | 984 |
| 743 | Ga0207651_10627053 | 3300025960 | Bacteria | 942 |
| 744 | Ga0207651_11996530 | 3300025960 | Bacteria | 521 |
| 745 | Ga0207712_10024599 | 3300025961 | Bacteria | 3991 |
| 746 | Ga0207712_10700092 | 3300025961 | Bacteria | 884 |
| 747 | Ga0207712_11455101 | 3300025961 | Bacteria | 613 |
| 748 | Ga0207712_11567463 | 3300025961 | Unclassified | 590 |
| 749 | Ga0207668_10311790 | 3300025972 | Bacteria | 1302 |
| 750 | Ga0207668_10358350 | 3300025972 | Bacteria | 1221 |
| 751 | Ga0207640_10004935 | 3300025981 | Bacteria | 7248 |
| 752 | Ga0207640_10016300 | 3300025981 | Bacteria | 4319 |
| 753 | Ga0207640_10043092 | 3300025981 | Bacteria | 2882 |
| 754 | Ga0207640_10164632 | 3300025981 | Bacteria | 1645 |
| 755 | Ga0207640_10407637 | 3300025981 | Bacteria | 1109 |
| 756 | Ga0207640_10528203 | 3300025981 | Bacteria | 987 |
| 757 | Ga0207640_10679627 | 3300025981 | Bacteria | 880 |
| 758 | Ga0207640_11608610 | 3300025981 | Bacteria | 585 |
| 759 | Ga0207640_12199657 | 3300025981 | Bacteria | 501 |
| 760 | Ga0207658_10472545 | 3300025986 | Bacteria | 1113 |
| 761 | Ga0207658_10731189 | 3300025986 | Bacteria | 895 |
| 762 | Ga0207658_10998264 | 3300025986 | Bacteria | 764 |
| 763 | Ga0207677_10006894 | 3300026023 | Bacteria | 6245 |
| 764 | Ga0207677_10013904 | 3300026023 | Bacteria | 4678 |
| 765 | Ga0207677_10198868 | 3300026023 | Bacteria | 1591 |
| 766 | Ga0207703_10022018 | 3300026035 | Bacteria | 4992 |
| 767 | Ga0207703_10067157 | 3300026035 | Bacteria | 2951 |
| 768 | Ga0207703_11200295 | 3300026035 | Bacteria | 729 |
| 769 | Ga0207703_12250013 | 3300026035 | Bacteria | 521 |
| 770 | Ga0207639_10005399 | 3300026041 | Bacteria | 8643 |
| 771 | Ga0207639_10575069 | 3300026041 | Bacteria | 1037 |
| 772 | Ga0207639_12260585 | 3300026041 | Bacteria | 505 |
| 773 | Ga0207678_10011920 | 3300026067 | Bacteria | 7635 |
| 774 | Ga0207678_10059909 | 3300026067 | Bacteria | 3275 |
| 775 | Ga0207678_10272137 | 3300026067 | Bacteria | 1452 |
| 776 | Ga0207678_10443592 | 3300026067 | Bacteria | 1127 |
| 777 | Ga0207678_11164862 | 3300026067 | Bacteria | 683 |
| 778 | Ga0207708_10019638 | 3300026075 | Bacteria | 5096 |
| 779 | Ga0207708_10025473 | 3300026075 | Bacteria | 4474 |
| 780 | Ga0207708_10211327 | 3300026075 | Bacteria | 1551 |
| 781 | Ga0207708_11753825 | 3300026075 | Bacteria | 545 |
| 782 | Ga0207702_10024571 | 3300026078 | Bacteria | 5000 |
| 783 | Ga0207702_10146028 | 3300026078 | Bacteria | 2146 |
| 784 | Ga0207702_10217218 | 3300026078 | Bacteria | 1780 |
| 785 | Ga0207702_10835587 | 3300026078 | Bacteria | 911 |
| 786 | Ga0207702_10891786 | 3300026078 | Bacteria | 881 |
| 787 | Ga0207641_10063850 | 3300026088 | Bacteria | 3146 |
| 788 | Ga0207641_10128053 | 3300026088 | Bacteria | 2276 |
| 789 | Ga0207641_11908720 | 3300026088 | Bacteria | 595 |
| 790 | Ga0207641_12343158 | 3300026088 | Bacteria | 533 |
| 791 | Ga0207648_10000284 | 3300026089 | Bacteria | 55162 |
| 792 | Ga0207648_10045452 | 3300026089 | Bacteria | 3851 |
| 793 | Ga0207648_10374992 | 3300026089 | Bacteria | 1286 |
| 794 | Ga0207676_10283086 | 3300026095 | Bacteria | 1506 |
| 795 | Ga0207676_10301287 | 3300026095 | Bacteria | 1464 |
| 796 | Ga0207676_10468466 | 3300026095 | Bacteria | 1191 |
| 797 | Ga0207676_10998438 | 3300026095 | Bacteria | 825 |
| 798 | Ga0207676_11021709 | 3300026095 | Bacteria | 815 |
| 799 | Ga0207676_11488756 | 3300026095 | Bacteria | 674 |
| 800 | Ga0207676_11608624 | 3300026095 | Bacteria | 647 |
| 801 | Ga0207676_11792619 | 3300026095 | Bacteria | 612 |
| 802 | Ga0207674_10008143 | 3300026116 | Bacteria | 12151 |
| 803 | Ga0207674_10019801 | 3300026116 | Bacteria | 7282 |
| 804 | Ga0207674_10631637 | 3300026116 | Bacteria | 1034 |
| 805 | Ga0207674_10677041 | 3300026116 | Bacteria | 996 |
| 806 | Ga0207674_10734191 | 3300026116 | Bacteria | 953 |
| 807 | Ga0207674_10775844 | 3300026116 | Bacteria | 925 |
| 808 | Ga0207674_11036545 | 3300026116 | Bacteria | 790 |
| 809 | Ga0207675_100033436 | 3300026118 | Bacteria | 4791 |
| 810 | Ga0207675_100208012 | 3300026118 | Bacteria | 1881 |
| 811 | Ga0207675_100421917 | 3300026118 | Bacteria | 1317 |
| 812 | Ga0207683_10007614 | 3300026121 | Bacteria | 9274 |
| 813 | Ga0207683_10193544 | 3300026121 | Bacteria | 1847 |
| 814 | Ga0207698_10005024 | 3300026142 | Bacteria | 8116 |
| 815 | Ga0207698_10033457 | 3300026142 | Bacteria | 3736 |
| 816 | Ga0207698_10040229 | 3300026142 | Bacteria | 3471 |
| 817 | Ga0207698_10472832 | 3300026142 | Bacteria | 1214 |
| 818 | Ga0207698_10707898 | 3300026142 | Bacteria | 1003 |
| 819 | Ga0209967_1046460 | 3300027364 | Bacteria | 664 |
| 820 | Ga0210000_1037007 | 3300027462 | Bacteria | 770 |
| 821 | Ga0209995_1034417 | 3300027471 | Bacteria | 851 |
| 822 | Ga0209968_1090654 | 3300027526 | Bacteria | 554 |
| 823 | Ga0209999_1002779 | 3300027543 | Bacteria | 3097 |
| 824 | Ga0210002_1016324 | 3300027617 | Bacteria | 1174 |
| 825 | Ga0209971_1052119 | 3300027682 | Bacteria | 989 |
| 826 | Ga0209998_10022296 | 3300027717 | Bacteria | 1365 |
| 827 | Ga0209974_10052889 | 3300027876 | Bacteria | 1367 |
| 828 | Ga0207428_10453432 | 3300027907 | Bacteria | 935 |
| 829 | Ga0207428_10607995 | 3300027907 | Bacteria | 787 |
| 830 | Ga0268266_10004596 | 3300028379 | Bacteria | 13175 |
| 831 | Ga0268266_10868934 | 3300028379 | Bacteria | 872 |
| 832 | Ga0268266_11949311 | 3300028379 | Bacteria | 561 |
| 833 | Ga0268265_11603200 | 3300028380 | Bacteria | 656 |
| 834 | Ga0268265_11876387 | 3300028380 | Bacteria | 606 |
| 835 | Ga0268265_12198753 | 3300028380 | Bacteria | 559 |
| 836 | Ga0268264_10159852 | 3300028381 | Bacteria | 2028 |
| 837 | Ga0268264_10207215 | 3300028381 | Bacteria | 1798 |
| 838 | Ga0268264_10659599 | 3300028381 | Bacteria | 1036 |
| 839 | Ga0268264_10784427 | 3300028381 | Bacteria | 951 |
| 840 | Ga0307517_10152441 | 3300028786 | Bacteria | 1581 |
| 841 | Ga0265338_10253066 | 3300028800 | Bacteria | 1298 |
| 842 | Ga0310982_107480 | 3300029283 | Bacteria | 705 |
| 843 | Ga0265768_113673 | 3300030963 | Bacteria | 551 |
| 844 | Ga0265332_10010941 | 3300031238 | Bacteria | 4030 |
| 845 | Ga0307509_10000029 | 3300031507 | Bacteria | 215555 |
| 846 | Ga0307509_10047926 | 3300031507 | Bacteria | 4593 |
| 847 | Ga0307509_10077718 | 3300031507 | Bacteria | 3442 |
| 848 | Ga0307408_100038948 | 3300031548 | Bacteria | 3356 |
| 849 | Ga0307408_100042108 | 3300031548 | Bacteria | 3241 |
| 850 | Ga0307408_100080846 | 3300031548 | Bacteria | 2428 |
| 851 | Ga0307408_100127270 | 3300031548 | Bacteria | 1982 |
| 852 | Ga0307408_100127488 | 3300031548 | Bacteria | 1981 |
| 853 | Ga0307408_100281377 | 3300031548 | Bacteria | 1385 |
| 854 | Ga0307408_100283082 | 3300031548 | Bacteria | 1381 |
| 855 | Ga0307408_100341016 | 3300031548 | Bacteria | 1268 |
| 856 | Ga0307408_100496108 | 3300031548 | Bacteria | 1068 |
| 857 | Ga0307408_100818339 | 3300031548 | Bacteria | 847 |
| 858 | Ga0307408_101251135 | 3300031548 | Bacteria | 694 |
| 859 | Ga0307408_101623658 | 3300031548 | Bacteria | 614 |
| 860 | Ga0307408_101680848 | 3300031548 | Bacteria | 604 |
| 861 | Ga0307508_10172700 | 3300031616 | Bacteria | 1765 |
| 862 | Ga0307508_10341816 | 3300031616 | Bacteria | 1088 |
| 863 | Ga0316575_10057696 | 3300031665 | Bacteria | 1548 |
| 864 | Ga0316578_10400910 | 3300031728 | Bacteria | 813 |
| 865 | Ga0307516_10055293 | 3300031730 | Bacteria | 3875 |
| 866 | Ga0307405_10004381 | 3300031731 | Bacteria | 6664 |
| 867 | Ga0307405_10044041 | 3300031731 | Bacteria | 2727 |
| 868 | Ga0307405_10079146 | 3300031731 | Bacteria | 2141 |
| 869 | Ga0307405_10083608 | 3300031731 | Bacteria | 2093 |
| 870 | Ga0307405_10147946 | 3300031731 | Bacteria | 1648 |
| 871 | Ga0307405_10169124 | 3300031731 | Bacteria | 1557 |
| 872 | Ga0307405_10573142 | 3300031731 | Bacteria | 917 |
| 873 | Ga0307405_10747967 | 3300031731 | Bacteria | 814 |
| 874 | Ga0307405_10820350 | 3300031731 | Bacteria | 781 |
| 875 | Ga0307405_11125075 | 3300031731 | Bacteria | 676 |
| 876 | Ga0307405_11354087 | 3300031731 | Bacteria | 621 |
| 877 | Ga0316577_10048972 | 3300031733 | Bacteria | 2359 |
| 878 | Ga0307413_10014416 | 3300031824 | Bacteria | 4014 |
| 879 | Ga0307413_10035638 | 3300031824 | Bacteria | 2856 |
| 880 | Ga0307413_10058773 | 3300031824 | Bacteria | 2358 |
| 881 | Ga0307413_10059631 | 3300031824 | Bacteria | 2345 |
| 882 | Ga0307413_10060403 | 3300031824 | Bacteria | 2333 |
| 883 | Ga0307413_10087503 | 3300031824 | Bacteria | 2018 |
| 884 | Ga0307413_10150582 | 3300031824 | Bacteria | 1620 |
| 885 | Ga0307413_10218377 | 3300031824 | Bacteria | 1390 |
| 886 | Ga0307413_10342224 | 3300031824 | Bacteria | 1151 |
| 887 | Ga0307413_10392207 | 3300031824 | Bacteria | 1085 |
| 888 | Ga0307413_10468586 | 3300031824 | Bacteria | 1004 |
| 889 | Ga0307410_10034302 | 3300031852 | Bacteria | 3285 |
| 890 | Ga0307410_10065573 | 3300031852 | Bacteria | 2498 |
| 891 | Ga0307410_10140619 | 3300031852 | Bacteria | 1785 |
| 892 | Ga0307410_10207505 | 3300031852 | Bacteria | 1499 |
| 893 | Ga0307410_10260410 | 3300031852 | Bacteria | 1352 |
| 894 | Ga0307410_10382688 | 3300031852 | Bacteria | 1132 |
| 895 | Ga0307410_10581451 | 3300031852 | Bacteria | 932 |
| 896 | Ga0307410_10645984 | 3300031852 | Bacteria | 887 |
| 897 | Ga0307410_11440394 | 3300031852 | Bacteria | 605 |
| 898 | Ga0326468_10041234 | 3300031889 | Bacteria | 660 |
| 899 | Ga0307406_10026696 | 3300031901 | Bacteria | 3471 |
| 900 | Ga0307406_10131096 | 3300031901 | Bacteria | 1760 |
| 901 | Ga0307406_10243877 | 3300031901 | Bacteria | 1349 |
| 902 | Ga0307406_10370010 | 3300031901 | Bacteria | 1126 |
| 903 | Ga0307406_10470084 | 3300031901 | Bacteria | 1013 |
| 904 | Ga0307406_10633266 | 3300031901 | Bacteria | 886 |
| 905 | Ga0307406_11685902 | 3300031901 | Bacteria | 561 |
| 906 | Ga0307407_10011805 | 3300031903 | Bacteria | 4176 |
| 907 | Ga0307407_10022385 | 3300031903 | Bacteria | 3278 |
| 908 | Ga0307407_10082262 | 3300031903 | Bacteria | 1951 |
| 909 | Ga0307407_10349400 | 3300031903 | Bacteria | 1047 |
| 910 | Ga0307407_10369785 | 3300031903 | Bacteria | 1020 |
| 911 | Ga0307407_10426655 | 3300031903 | Bacteria | 957 |
| 912 | Ga0307407_10442645 | 3300031903 | Bacteria | 941 |
| 913 | Ga0307407_10534508 | 3300031903 | Bacteria | 864 |
| 914 | Ga0307407_10603483 | 3300031903 | Bacteria | 817 |
| 915 | Ga0307407_10785336 | 3300031903 | Bacteria | 723 |
| 916 | Ga0307407_10840624 | 3300031903 | Bacteria | 701 |
| 917 | Ga0307407_11244714 | 3300031903 | Bacteria | 582 |
| 918 | Ga0307407_11686280 | 3300031903 | Bacteria | 504 |
| 919 | Ga0307412_10009640 | 3300031911 | Bacteria | 5546 |
| 920 | Ga0307412_10016955 | 3300031911 | Bacteria | 4352 |
| 921 | Ga0307412_10055983 | 3300031911 | Bacteria | 2626 |
| 922 | Ga0307412_10157667 | 3300031911 | Bacteria | 1682 |
| 923 | Ga0307412_10163670 | 3300031911 | Bacteria | 1656 |
| 924 | Ga0307412_10165007 | 3300031911 | Bacteria | 1650 |
| 925 | Ga0307412_10451830 | 3300031911 | Bacteria | 1059 |
| 926 | Ga0307412_10729531 | 3300031911 | Bacteria | 853 |
| 927 | Ga0307412_11114318 | 3300031911 | Bacteria | 703 |
| 928 | Ga0307412_11501822 | 3300031911 | Bacteria | 612 |
| 929 | Ga0307409_100044098 | 3300031995 | Bacteria | 3356 |
| 930 | Ga0307409_100049673 | 3300031995 | Bacteria | 3199 |
| 931 | Ga0307409_100101758 | 3300031995 | Bacteria | 2385 |
| 932 | Ga0307409_100108550 | 3300031995 | Bacteria | 2321 |
| 933 | Ga0307409_100170107 | 3300031995 | Bacteria | 1917 |
| 934 | Ga0307409_100257418 | 3300031995 | Bacteria | 1599 |
| 935 | Ga0307409_100395582 | 3300031995 | Bacteria | 1318 |
| 936 | Ga0307409_100496453 | 3300031995 | Bacteria | 1187 |
| 937 | Ga0307409_100847684 | 3300031995 | Bacteria | 924 |
| 938 | Ga0307409_101259152 | 3300031995 | Bacteria | 764 |
| 939 | Ga0307409_101304133 | 3300031995 | Bacteria | 751 |
| 940 | Ga0307416_100158774 | 3300032002 | Bacteria | 2086 |
| 941 | Ga0307416_100164768 | 3300032002 | Bacteria | 2054 |
| 942 | Ga0307416_100167255 | 3300032002 | Bacteria | 2041 |
| 943 | Ga0307416_100197546 | 3300032002 | Bacteria | 1904 |
| 944 | Ga0307416_100203336 | 3300032002 | Bacteria | 1881 |
| 945 | Ga0307416_100229017 | 3300032002 | Bacteria | 1790 |
| 946 | Ga0307416_100318693 | 3300032002 | Bacteria | 1555 |
| 947 | Ga0307416_100400679 | 3300032002 | Bacteria | 1409 |
| 948 | Ga0307416_100588081 | 3300032002 | Bacteria | 1191 |
| 949 | Ga0307416_100703942 | 3300032002 | Bacteria | 1099 |
| 950 | Ga0307416_100747185 | 3300032002 | Bacteria | 1071 |
| 951 | Ga0307416_100879121 | 3300032002 | Bacteria | 995 |
| 952 | Ga0307416_100886965 | 3300032002 | Bacteria | 991 |
| 953 | Ga0307416_101185740 | 3300032002 | Bacteria | 869 |
| 954 | Ga0307416_101282796 | 3300032002 | Bacteria | 838 |
| 955 | Ga0307416_101299562 | 3300032002 | Bacteria | 833 |
| 956 | Ga0307416_102159419 | 3300032002 | Bacteria | 658 |
| 957 | Ga0307416_102821040 | 3300032002 | Bacteria | 581 |
| 958 | Ga0307416_103589622 | 3300032002 | Bacteria | 519 |
| 959 | Ga0307414_10003807 | 3300032004 | Bacteria | 8111 |
| 960 | Ga0307414_10067314 | 3300032004 | Bacteria | 2565 |
| 961 | Ga0307414_10177225 | 3300032004 | Bacteria | 1711 |
| 962 | Ga0307414_10347994 | 3300032004 | Bacteria | 1271 |
| 963 | Ga0307414_10546906 | 3300032004 | Bacteria | 1031 |
| 964 | Ga0307414_10810240 | 3300032004 | Bacteria | 854 |
| 965 | Ga0307414_10821820 | 3300032004 | Bacteria | 848 |
| 966 | Ga0307411_10010875 | 3300032005 | Bacteria | 4877 |
| 967 | Ga0307411_10018853 | 3300032005 | Bacteria | 3970 |
| 968 | Ga0307411_10034864 | 3300032005 | Bacteria | 3136 |
| 969 | Ga0307411_10144361 | 3300032005 | Bacteria | 1759 |
| 970 | Ga0307411_10396082 | 3300032005 | Bacteria | 1140 |
| 971 | Ga0307411_10523286 | 3300032005 | Bacteria | 1007 |
| 972 | Ga0307415_100003847 | 3300032126 | Bacteria | 7701 |
| 973 | Ga0307415_100335641 | 3300032126 | Bacteria | 1266 |
| 974 | Ga0307415_100745811 | 3300032126 | Bacteria | 888 |
| 975 | Ga0307415_101177721 | 3300032126 | Bacteria | 721 |
| 976 | Ga0307415_101297155 | 3300032126 | Bacteria | 689 |
| 977 | Ga0307415_101449927 | 3300032126 | Bacteria | 655 |
| 978 | Ga0307415_102081726 | 3300032126 | Bacteria | 554 |
| 979 | Ga0307415_102533515 | 3300032126 | Bacteria | 505 |
| 980 | Ga0316593_10406614 | 3300032168 | Bacteria | 527 |
| 981 | Ga0307507_10187294 | 3300033179 | Bacteria | 1464 |
| 982 | Ga0316596_1100435 | 3300033541 | Bacteria | 782 |
| 983 | Ga0373948_0104669 | 3300034817 | Bacteria | 670 |
| 984 | Ga0373950_0035776 | 3300034818 | Bacteria | 935 |
| 985 | Ga0373958_0040713 | 3300034819 | Bacteria | 949 |
| 986 | Ga0373959_0050477 | 3300034820 | Bacteria | 897 |
| 987 | Ga0373938_0063141 | 3300034957 | Bacteria | 871 |
| 988 | Ga0373926_0287478 | 3300035083 | Bacteria | 641 |
| 989 | Ga0373929_0086202 | 3300035085 | Bacteria | 773 |
| 990 | Ga0373949_0005273 | 3300035090 | Bacteria | 2891 |
| 991 | Ga0373949_0032384 | 3300035090 | Bacteria | 1251 |
| 992 | Ga0373949_0041542 | 3300035090 | Bacteria | 1132 |
| 993 | Ga0373949_0130164 | 3300035090 | Bacteria | 713 |
| 994 | Ga0373932_0194997 | 3300035112 | Bacteria | 717 |
| 995 | Ga0373936_0000001 | 3300035113 | Bacteria | 456155 |
| 996 | Ga0373939_0166704 | 3300035114 | Bacteria | 812 |
| 997 | Ga0373939_0200844 | 3300035114 | Bacteria | 754 |
| 998 | Ga0373941_0133309 | 3300035115 | Bacteria | 897 |
| 999 | Ga0373956_0332661 | 3300035119 | Bacteria | 724 |
| 1000 | Ga0373956_0421403 | 3300035119 | Bacteria | 637 |
| 1001 | Ga0373960_0387443 | 3300035121 | Bacteria | 537 |
| 1002 | Ga0373946_0344464 | 3300035171 | Bacteria | 744 |
| 1003 | Ga0373955_0587387 | 3300035172 | Bacteria | 682 |
| 1004 | Ga0373942_0104818 | 3300035207 | Bacteria | 868 |
| 1005 | Ga0373961_0000001 | 3300035241 | Bacteria | 199721 |
| 1006 | Ga0373961_0034817 | 3300035241 | Bacteria | 1426 |
| 1007 | Ga0373961_0166180 | 3300035241 | Bacteria | 761 |
| 1008 | Ga0373962_0251979 | 3300035242 | Bacteria | 613 |
| 1009 | Ga0316574_0063591 | 3300035398 | Bacteria | 2321 |
| 1010 | Ga0316574_0969945 | 3300035398 | Bacteria | 512 |
| 1011 | Ga0373931_0203221 | 3300035691 | Bacteria | 1185 |
| 1012 | Ga0373931_0462043 | 3300035691 | Bacteria | 813 |
| 1013 | Ga0373931_0540172 | 3300035691 | Bacteria | 756 |
| 1014 | Ga0373931_0865850 | 3300035691 | Bacteria | 606 |
| 1015 | Ga0373933_0885142 | 3300035724 | Bacteria | 588 |
| 1016 | Ga0373947_0563508 | 3300035725 | Bacteria | 776 |
| 1017 | Ga0373937_1480800 | 3300036401 | Bacteria | 626 |
| 1018 | Ga0316584_0074425 | 3300036712 | Bacteria | 2546 |
| 1019 | Ga0395899_0011864 | 3300037312 | Bacteria | 6671 |
| 1020 | Ga0395899_0124689 | 3300037312 | Bacteria | 1842 |
| 1021 | Ga0395900_1277603 | 3300037418 | Bacteria | 648 |
| 1022 | Ga0395900_1428789 | 3300037418 | Bacteria | 605 |
| 1023 | Ga0395900_1656624 | 3300037418 | Bacteria | 551 |
| 1024 | Ga0395898_0038342 | 3300037466 | Bacteria | 4750 |
| 1025 | Ga0395905_0119324 | 3300037471 | Bacteria | 2479 |
| 1026 | Ga0395905_0441651 | 3300037471 | Bacteria | 1198 |
| 1027 | Ga0395905_0777548 | 3300037471 | Bacteria | 860 |
| 1028 | Ga0395905_1417469 | 3300037471 | Bacteria | 599 |
| 1029 | Ga0395901_0182000 | 3300038443 | Bacteria | 2204 |
| 1030 | Ga0395901_1988056 | 3300038443 | Bacteria | 528 |
| 1031 | Ga0242419_005398 | 3300038698 | Bacteria | 909 |
| 1032 | Ga0242420_004350 | 3300038996 | Bacteria | 2138 |
| 1033 | Ga0242420_006711 | 3300038996 | Bacteria | 1825 |
| 1034 | Ga0436365_1236418 | 3300039437 | Bacteria | 885 |
| 1035 | Ga0436365_1827961 | 3300039437 | Bacteria | 1303 |
| 1036 | Ga0436363_0933504 | 3300039450 | Bacteria | 2032 |
| 1037 | Ga0439436_0020957 | 3300041404 | Bacteria | 1945 |
| 1038 | Ga0439436_0032287 | 3300041404 | Bacteria | 1518 |
| 1039 | Ga0439438_063807 | 3300041405 | Bacteria | 919 |
| 1040 | Ga0439439_0115416 | 3300041406 | Bacteria | 746 |
| 1041 | Ga0439447_057324 | 3300041407 | Bacteria | 921 |
| 1042 | Ga0439461_0044522 | 3300041410 | Bacteria | 968 |
| 1043 | Ga0439461_0166033 | 3300041410 | Bacteria | 578 |
| 1044 | Ga0439466_0047339 | 3300041411 | Bacteria | 1417 |
| 1045 | Ga0439466_0079827 | 3300041411 | Bacteria | 1033 |
| 1046 | Ga0439465_0323764 | 3300041413 | Bacteria | 579 |
| 1047 | Ga0451789_0947159 | 3300041443 | Bacteria | 758 |
| 1048 | Ga0451791_1316043 | 3300041451 | Bacteria | 549 |
| 1049 | Ga0451802_0276746 | 3300041460 | Bacteria | 661 |
| 1050 | Ga0451805_081734 | 3300041461 | Bacteria | 744 |
| 1051 | Ga0451808_06737 | 3300041464 | Bacteria | 622 |
| 1052 | Ga0451807_0294446 | 3300041486 | Bacteria | 968 |
| 1053 | Ga0451807_1937924 | 3300041486 | Bacteria | 536 |
| 1054 | Ga0451835_0596095 | 3300041492 | Bacteria | 944 |
| 1055 | Ga0451841_0658728 | 3300041498 | Bacteria | 756 |
| 1056 | Ga0451849_1401345 | 3300041505 | Bacteria | 2121 |
| 1057 | Ga0451851_0196687 | 3300041507 | Bacteria | 1087 |
| 1058 | Ga0451855_1580001 | 3300041511 | Bacteria | 1051 |
| 1059 | Ga0451853_1965433 | 3300041512 | Bacteria | 1506 |
| 1060 | Ga0439433_0003003 | 3300041999 | Bacteria | 3615 |
| 1061 | Ga0439433_0039156 | 3300041999 | Bacteria | 1100 |
| 1062 | Ga0439442_000012 | 3300042002 | Bacteria | 49187 |
| 1063 | Ga0439443_091325 | 3300042003 | Bacteria | 575 |
| 1064 | Ga0439445_0136378 | 3300042004 | Bacteria | 710 |
| 1065 | Ga0439432_097365 | 3300042006 | Bacteria | 882 |
| 1066 | Ga0439449_0029379 | 3300042007 | Bacteria | 2048 |
| 1067 | Ga0439449_0033278 | 3300042007 | Bacteria | 1920 |
| 1068 | Ga0439455_0065069 | 3300042012 | Bacteria | 972 |
| 1069 | Ga0439457_035060 | 3300042014 | Bacteria | 1115 |
| 1070 | Ga0439462_0023095 | 3300042015 | Bacteria | 1630 |
| 1071 | Ga0450911_012401 | 3300042115 | Bacteria | 1153 |
| 1072 | Ga0450920_004890 | 3300042122 | Bacteria | 2368 |
| 1073 | Ga0450920_006036 | 3300042122 | Bacteria | 2168 |
| 1074 | Ga0450898_045670 | 3300042134 | Bacteria | 837 |
| 1075 | Ga0450906_028800 | 3300042145 | Bacteria | 983 |
| 1076 | Ga0450907_000415 | 3300042146 | Bacteria | 12830 |
| 1077 | Ga0450907_021368 | 3300042146 | Bacteria | 1088 |
| 1078 | Ga0450910_060166 | 3300042147 | Bacteria | 640 |
| 1079 | Ga0450908_006541 | 3300042184 | Bacteria | 2209 |
| 1080 | Ga0439434_0000031 | 3300042435 | Bacteria | 33054 |
| 1081 | Ga0439434_0023852 | 3300042435 | Bacteria | 1843 |
| 1082 | Ga0439434_0057754 | 3300042435 | Bacteria | 1210 |
| 1083 | Ga0439434_0178087 | 3300042435 | Bacteria | 711 |
| 1084 | Ga0439444_0132977 | 3300042437 | Bacteria | 590 |
| 1085 | Ga0439444_0152842 | 3300042437 | Bacteria | 559 |
| 1086 | Ga0450918_000869 | 3300042531 | Bacteria | 6368 |
| 1087 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 1088 | Ga0451577_0018850 | 3300042876 | Bacteria | 6351 |
| 1089 | Ga0451577_0461331 | 3300042876 | Bacteria | 1154 |
| 1090 | Ga0453683_0163376 | 3300044673 | Bacteria | 1409 |
| 1091 | Ga0466965_0687816 | 3300044683 | Bacteria | 586 |
| 1092 | Ga0466966_0013970 | 3300044684 | Bacteria | 5316 |
| 1093 | Ga0453684_0019316 | 3300044712 | Bacteria | 10386 |
| 1094 | Ga0453684_0677429 | 3300044712 | Bacteria | 1123 |
| 1095 | Ga0466970_0822108 | 3300044765 | Bacteria | 545 |
| 1096 | Ga0466959_0072807 | 3300045049 | Bacteria | 2486 |
| 1097 | Ga0451576_1145132 | 3300045051 | Bacteria | 813 |
| 1098 | Ga0451576_1570374 | 3300045051 | Bacteria | 683 |
| 1099 | Ga0466967_1576409 | 3300045976 | Bacteria | 654 |
| 1100 | Ga0495590_0104703 | 3300046457 | Bacteria | 1007 |
| 1101 | Ga0495584_0401090 | 3300046491 | Bacteria | 697 |
| 1102 | Ga0495585_0310154 | 3300046492 | Bacteria | 774 |
| 1103 | Ga0495594_0380017 | 3300046499 | Bacteria | 804 |
| 1104 | Ga0495620_0357079 | 3300046515 | Bacteria | 554 |
| 1105 | Ga0495630_0263965 | 3300046517 | Bacteria | 1315 |
| 1106 | Ga0495663_0401218 | 3300046525 | Bacteria | 504 |
| 1107 | Ga0495586_0078526 | 3300046535 | Bacteria | 1811 |
| 1108 | Ga0495587_0309835 | 3300046536 | Bacteria | 882 |
| 1109 | Ga0495621_0032870 | 3300046539 | Bacteria | 1786 |
| 1110 | Ga0495621_0500183 | 3300046539 | Unclassified | 524 |
| 1111 | Ga0495622_0024248 | 3300046557 | Bacteria | 2833 |
| 1112 | Ga0495667_0150431 | 3300046559 | Bacteria | 1499 |
| 1113 | Ga0495635_0084621 | 3300046663 | Bacteria | 2170 |
| 1114 | Ga0495588_0007818 | 3300046674 | Bacteria | 4883 |
| 1115 | Ga0495623_0219777 | 3300046679 | Bacteria | 1083 |
| 1116 | Ga0495658_0463577 | 3300046683 | Bacteria | 810 |
| 1117 | Ga0495600_0424218 | 3300046809 | Bacteria | 825 |
| 1118 | Ga0495604_0369152 | 3300047317 | Bacteria | 950 |
| 1119 | Ga0495604_1009718 | 3300047317 | Bacteria | 514 |
| 1120 | Ga0495677_0151955 | 3300047445 | Bacteria | 892 |
| 1121 | Ga0495685_136166 | 3300047447 | Bacteria | 801 |
| 1122 | Ga0495681_0298583 | 3300047470 | Bacteria | 624 |
| 1123 | Ga0496100_0292564 | 3300048903 | Bacteria | 1217 |
| 1124 | Ga0496100_1332312 | 3300048903 | Bacteria | 567 |
| 1125 | Ga0496100_1676063 | 3300048903 | Bacteria | 503 |
| 1126 | Ga0496101_0113841 | 3300048904 | Bacteria | 2039 |
| 1127 | Ga0496101_0175258 | 3300048904 | Bacteria | 1649 |
| 1128 | Ga0496101_1211165 | 3300048904 | Bacteria | 591 |
| 1129 | Ga0496101_1403313 | 3300048904 | Bacteria | 545 |
| 1130 | Ga0496102_0084843 | 3300048905 | Bacteria | 2924 |
| 1131 | Ga0496102_0107907 | 3300048905 | Bacteria | 2593 |
| 1132 | Ga0496102_0597811 | 3300048905 | Bacteria | 1026 |
| 1133 | Ga0496102_0693815 | 3300048905 | Bacteria | 941 |
| 1134 | Ga0496103_0121752 | 3300048906 | Bacteria | 1662 |
| 1135 | Ga0496103_0638605 | 3300048906 | Bacteria | 677 |
| 1136 | Ga0496104_0006303 | 3300048907 | Bacteria | 10433 |
| 1137 | Ga0496104_0492225 | 3300048907 | Bacteria | 1137 |
| 1138 | Ga0496104_0515166 | 3300048907 | Bacteria | 1107 |
| 1139 | Ga0496105_0448317 | 3300048908 | Bacteria | 1019 |
| 1140 | Ga0496106_0146128 | 3300048909 | Bacteria | 1863 |
| 1141 | Ga0496106_0245621 | 3300048909 | Bacteria | 1430 |
| 1142 | Ga0496106_0292915 | 3300048909 | Bacteria | 1305 |
| 1143 | Ga0496106_0363572 | 3300048909 | Bacteria | 1162 |
| 1144 | Ga0496106_0407880 | 3300048909 | Bacteria | 1092 |
| 1145 | Ga0496106_0658431 | 3300048909 | Bacteria | 836 |
| 1146 | Ga0496106_1016349 | 3300048909 | Bacteria | 652 |
| 1147 | Ga0496106_1588372 | 3300048909 | Bacteria | 501 |
| 1148 | Ga0496107_0931869 | 3300048910 | Bacteria | 632 |
| 1149 | Ga0496108_0005557 | 3300048911 | Bacteria | 10202 |
| 1150 | Ga0496108_0009201 | 3300048911 | Bacteria | 7995 |
| 1151 | Ga0496108_0078456 | 3300048911 | Bacteria | 2795 |
| 1152 | Ga0496108_0701929 | 3300048911 | Bacteria | 877 |
| 1153 | Ga0496108_0965168 | 3300048911 | Bacteria | 729 |
| 1154 | Ga0496109_0022966 | 3300048912 | Bacteria | 5530 |
| 1155 | Ga0496109_0233095 | 3300048912 | Bacteria | 1732 |
| 1156 | Ga0496109_0582877 | 3300048912 | Bacteria | 1054 |
| 1157 | Ga0496109_0644441 | 3300048912 | Bacteria | 996 |
| 1158 | Ga0496109_2037380 | 3300048912 | Bacteria | 506 |
| 1159 | Ga0496110_0129583 | 3300048913 | Bacteria | 2277 |
| 1160 | Ga0496110_0240181 | 3300048913 | Bacteria | 1648 |
| 1161 | Ga0496111_0467027 | 3300048914 | Bacteria | 930 |
| 1162 | Ga0496112_0148753 | 3300048915 | Bacteria | 2309 |
| 1163 | Ga0496112_0432552 | 3300048915 | Bacteria | 1254 |
| 1164 | Ga0496112_0625396 | 3300048915 | Bacteria | 1007 |
| 1165 | Ga0496113_0046902 | 3300048916 | Bacteria | 3209 |
| 1166 | Ga0496113_0081115 | 3300048916 | Bacteria | 2486 |
| 1167 | Ga0496113_0700111 | 3300048916 | Bacteria | 808 |
| 1168 | Ga0496113_0766954 | 3300048916 | Bacteria | 767 |
| 1169 | Ga0496114_0008966 | 3300048917 | Bacteria | 7932 |
| 1170 | Ga0496114_0094823 | 3300048917 | Bacteria | 2539 |
| 1171 | Ga0496114_0150261 | 3300048917 | Bacteria | 2020 |
| 1172 | Ga0496115_0096451 | 3300048918 | Bacteria | 2421 |
| 1173 | Ga0496115_0664119 | 3300048918 | Bacteria | 823 |
| 1174 | Ga0496115_0672896 | 3300048918 | Bacteria | 816 |
| 1175 | Ga0496115_0968997 | 3300048918 | Bacteria | 652 |
| 1176 | Ga0501306_066075 | 3300049127 | Bacteria | 603 |
| 1177 | Ga0501308_002288 | 3300049128 | Bacteria | 1663 |
| 1178 | Ga0501308_036473 | 3300049128 | Bacteria | 679 |
| 1179 | Ga0501304_016458 | 3300049160 | Bacteria | 700 |
| 1180 | Ga0501304_036655 | 3300049160 | Bacteria | 537 |
| 1181 | Ga0501290_100117 | 3300049513 | Bacteria | 515 |
| 1182 | Ga0501296_027669 | 3300049519 | Bacteria | 751 |
| 1183 | Ga0501311_060777 | 3300049527 | Bacteria | 610 |
| 1184 | Ga0501311_075253 | 3300049527 | Bacteria | 566 |
| 1185 | Ga0501311_078438 | 3300049527 | Bacteria | 558 |
| 1186 | Ga0501315_084027 | 3300049531 | Bacteria | 544 |
| 1187 | Ga0501315_092029 | 3300049531 | Bacteria | 526 |
| 1188 | Ga0501316_023358 | 3300049532 | Bacteria | 793 |
| 1189 | Ga0501316_044099 | 3300049532 | Bacteria | 628 |
| 1190 | Ga0501316_053541 | 3300049532 | Bacteria | 585 |
| 1191 | Ga0501317_004354 | 3300049533 | Bacteria | 1468 |
| 1192 | Ga0501318_075407 | 3300049534 | Bacteria | 539 |
| 1193 | Ga0501320_019113 | 3300049536 | Bacteria | 779 |
| 1194 | Ga0501321_001077 | 3300049537 | Bacteria | 2063 |
| 1195 | Ga0501321_055844 | 3300049537 | Bacteria | 587 |
| 1196 | Ga0501322_010210 | 3300049538 | Bacteria | 721 |
| 1197 | Ga0501323_003862 | 3300049539 | Bacteria | 1554 |
| 1198 | Ga0501323_022872 | 3300049539 | Bacteria | 836 |
| 1199 | Ga0501323_032530 | 3300049539 | Bacteria | 738 |
| 1200 | Ga0501324_015038 | 3300049540 | Bacteria | 747 |
| 1201 | Ga0501324_018809 | 3300049540 | Bacteria | 694 |
| 1202 | Ga0501325_016317 | 3300049541 | Bacteria | 741 |
| 1203 | Ga0501325_022661 | 3300049541 | Bacteria | 673 |
| 1204 | Ga0501332_08295 | 3300049548 | Bacteria | 672 |
| 1205 | Ga0501333_000957 | 3300049549 | Bacteria | 1471 |
| 1206 | Ga0501032_0002375 | 3300049569 | Bacteria | 14697 |
| 1207 | Ga0501032_0205226 | 3300049569 | Bacteria | 1286 |
| 1208 | Ga0501033_0222059 | 3300049570 | Bacteria | 1345 |
| 1209 | Ga0501033_1017149 | 3300049570 | Bacteria | 553 |
| 1210 | Ga0501034_0478097 | 3300049571 | Bacteria | 1161 |
| 1211 | Ga0501034_1200893 | 3300049571 | Bacteria | 637 |
| 1212 | Ga0501036_0049128 | 3300049572 | Bacteria | 3572 |
| 1213 | Ga0501036_0301206 | 3300049572 | Bacteria | 1341 |
| 1214 | Ga0501036_0715550 | 3300049572 | Bacteria | 827 |
| 1215 | Ga0501036_1349747 | 3300049572 | Bacteria | 579 |
| 1216 | Ga0501036_1641935 | 3300049572 | Bacteria | 518 |
| 1217 | Ga0501036_1695644 | 3300049572 | Bacteria | 509 |
| 1218 | Ga0501037_0044275 | 3300049573 | Bacteria | 3268 |
| 1219 | Ga0501037_0442789 | 3300049573 | Bacteria | 887 |
| 1220 | Ga0501037_0463031 | 3300049573 | Bacteria | 864 |
| 1221 | Ga0501038_0699477 | 3300049574 | Bacteria | 759 |
| 1222 | Ga0501038_0904316 | 3300049574 | Bacteria | 651 |
| 1223 | Ga0501039_0031107 | 3300049575 | Bacteria | 4114 |
| 1224 | Ga0501039_0299904 | 3300049575 | Bacteria | 1263 |
| 1225 | Ga0501040_0049193 | 3300049576 | Bacteria | 2882 |
| 1226 | Ga0501040_0112219 | 3300049576 | Bacteria | 1907 |
| 1227 | Ga0501040_0157057 | 3300049576 | Bacteria | 1607 |
| 1228 | Ga0501040_0521425 | 3300049576 | Unclassified | 857 |
| 1229 | Ga0501041_0139617 | 3300049577 | Bacteria | 1511 |
| 1230 | Ga0501041_0164873 | 3300049577 | Bacteria | 1386 |
| 1231 | Ga0501042_0318212 | 3300049578 | Bacteria | 1124 |
| 1232 | Ga0501042_0564905 | 3300049578 | Bacteria | 827 |
| 1233 | Ga0501042_1147443 | 3300049578 | Bacteria | 566 |
| 1234 | Ga0501043_0080857 | 3300049579 | Bacteria | 2553 |
| 1235 | Ga0501046_0045733 | 3300049580 | Bacteria | 3476 |
| 1236 | Ga0501048_0797553 | 3300049582 | Bacteria | 678 |
| 1237 | Ga0501067_0098438 | 3300049583 | Bacteria | 1624 |
| 1238 | Ga0501067_0199831 | 3300049583 | Bacteria | 1113 |
| 1239 | Ga0501067_0258146 | 3300049583 | Bacteria | 970 |
| 1240 | Ga0501067_0390614 | 3300049583 | Bacteria | 776 |
| 1241 | Ga0501067_0740853 | 3300049583 | Bacteria | 553 |
| 1242 | Ga0501068_0061584 | 3300049584 | Bacteria | 2280 |
| 1243 | Ga0501068_0235984 | 3300049584 | Bacteria | 1163 |
| 1244 | Ga0501068_0498985 | 3300049584 | Bacteria | 789 |
| 1245 | Ga0501069_0024665 | 3300049585 | Bacteria | 3281 |
| 1246 | Ga0501069_0202088 | 3300049585 | Bacteria | 1152 |
| 1247 | Ga0501069_0219825 | 3300049585 | Bacteria | 1104 |
| 1248 | Ga0501069_0303562 | 3300049585 | Bacteria | 936 |
| 1249 | Ga0501069_0568409 | 3300049585 | Bacteria | 679 |
| 1250 | Ga0501070_0027238 | 3300049586 | Bacteria | 4794 |
| 1251 | Ga0501070_0085902 | 3300049586 | Bacteria | 2605 |
| 1252 | Ga0501070_0473066 | 3300049586 | Bacteria | 1008 |
| 1253 | Ga0501070_0598170 | 3300049586 | Bacteria | 879 |
| 1254 | Ga0501071_0022608 | 3300049587 | Bacteria | 4384 |
| 1255 | Ga0501071_0209315 | 3300049587 | Bacteria | 1466 |
| 1256 | Ga0501071_0774729 | 3300049587 | Bacteria | 739 |
| 1257 | Ga0501072_0039534 | 3300049588 | Bacteria | 3704 |
| 1258 | Ga0501072_0065137 | 3300049588 | Bacteria | 2873 |
| 1259 | Ga0501072_0309226 | 3300049588 | Bacteria | 1256 |
| 1260 | Ga0501072_0509073 | 3300049588 | Bacteria | 952 |
| 1261 | Ga0501072_0703780 | 3300049588 | Bacteria | 794 |
| 1262 | Ga0501074_0129833 | 3300049590 | Bacteria | 1803 |
| 1263 | Ga0501074_0503048 | 3300049590 | Bacteria | 858 |
| 1264 | Ga0501074_1282492 | 3300049590 | Unclassified | 513 |
| 1265 | Ga0501075_0187165 | 3300049591 | Bacteria | 1579 |
| 1266 | Ga0501075_0249461 | 3300049591 | Bacteria | 1353 |
| 1267 | Ga0501075_1296848 | 3300049591 | Unclassified | 552 |
| 1268 | Ga0501076_0019885 | 3300049592 | Bacteria | 5135 |
| 1269 | Ga0501076_0292687 | 3300049592 | Bacteria | 1334 |
| 1270 | Ga0501076_0480822 | 3300049592 | Bacteria | 1023 |
| 1271 | Ga0501076_1032015 | 3300049592 | Bacteria | 677 |
| 1272 | Ga0501077_0084305 | 3300049593 | Bacteria | 2014 |
| 1273 | Ga0501077_0110034 | 3300049593 | Bacteria | 1746 |
| 1274 | Ga0501077_0173903 | 3300049593 | Bacteria | 1368 |
| 1275 | Ga0501201_047924 | 3300049651 | Bacteria | 527 |
| 1276 | Ga0501206_035144 | 3300049653 | Bacteria | 757 |
| 1277 | Ga0501209_216804 | 3300049656 | Bacteria | 592 |
| 1278 | Ga0501217_262437 | 3300049661 | Bacteria | 560 |
| 1279 | Ga0501217_298442 | 3300049661 | Bacteria | 531 |
| 1280 | Ga0501224_065209 | 3300049664 | Bacteria | 572 |
| 1281 | Ga0501233_171317 | 3300049668 | Bacteria | 617 |
| 1282 | Ga0501247_067000 | 3300049677 | Bacteria | 561 |
| 1283 | Ga0501249_043288 | 3300049679 | Bacteria | 1024 |
| 1284 | Ga0501257_239723 | 3300049686 | Bacteria | 534 |
| 1285 | Ga0501258_041249 | 3300049687 | Bacteria | 617 |
| 1286 | Ga0501259_050586 | 3300049688 | Bacteria | 842 |
| 1287 | Ga0501225_0105716 | 3300049705 | Bacteria | 826 |
| 1288 | Ga0501225_0157881 | 3300049705 | Bacteria | 695 |
| 1289 | Ga0501079_0072197 | 3300049741 | Bacteria | 2667 |
| 1290 | Ga0501079_1026882 | 3300049741 | Bacteria | 649 |
| 1291 | Ga0501079_1163359 | 3300049741 | Bacteria | 608 |
| 1292 | Ga0501080_0246481 | 3300049742 | Bacteria | 1629 |
| 1293 | Ga0501080_0274379 | 3300049742 | Bacteria | 1534 |
| 1294 | Ga0501080_0518965 | 3300049742 | Bacteria | 1063 |
| 1295 | Ga0501080_0527496 | 3300049742 | Bacteria | 1053 |
| 1296 | Ga0501080_0844723 | 3300049742 | Bacteria | 801 |
| 1297 | Ga0501081_0097965 | 3300049743 | Bacteria | 2070 |
| 1298 | Ga0501081_0292707 | 3300049743 | Bacteria | 1194 |
| 1299 | Ga0501083_0270410 | 3300049744 | Bacteria | 1106 |
| 1300 | Ga0501083_0387893 | 3300049744 | Bacteria | 908 |
| 1301 | Ga0501083_0693752 | 3300049744 | Bacteria | 662 |
| 1302 | Ga0501083_1169878 | 3300049744 | Bacteria | 500 |
| 1303 | Ga0501264_033477 | 3300049761 | Bacteria | 601 |
| 1304 | Ga0501266_048627 | 3300049763 | Bacteria | 650 |
| 1305 | Ga0501273_080115 | 3300049770 | Bacteria | 542 |
| 1306 | Ga0501273_086341 | 3300049770 | Bacteria | 528 |
| 1307 | Ga0501283_137411 | 3300049779 | Bacteria | 500 |
| 1308 | Ga0501044_0369903 | 3300049823 | Bacteria | 1350 |
| 1309 | Ga0501044_0712922 | 3300049823 | Bacteria | 888 |
| 1310 | Ga0501044_0736726 | 3300049823 | Bacteria | 869 |
| 1311 | Ga0501044_1426621 | 3300049823 | Bacteria | 558 |
| 1312 | Ga0501045_0374149 | 3300049824 | Bacteria | 1060 |
| 1313 | Ga0501045_0607603 | 3300049824 | Bacteria | 810 |
| 1314 | Ga0501045_1307130 | 3300049824 | Bacteria | 528 |
| 1315 | nmdc:mga00v17_381822_c1 | 3300050491 | Bacteria | 916 |
| 1316 | nmdc:mga0k408_47265_c1 | 3300050493 | Bacteria | 2487 |
| 1317 | nmdc:mga07m45_628578_c1 | 3300050496 | Bacteria | 619 |
| 1318 | nmdc:mga05p37_1016723_c1 | 3300050507 | Bacteria | 878 |
| 1319 | nmdc:mga05p37_160415_c1 | 3300050507 | Bacteria | 2747 |
| 1320 | nmdc:mga05p37_1626423_c1 | 3300050507 | Bacteria | 635 |
| 1321 | nmdc:mga05p37_249930_c1 | 3300050507 | Bacteria | 2127 |
| 1322 | nmdc:mga05p37_483494_c1 | 3300050507 | Bacteria | 1425 |
| 1323 | nmdc:mga05p37_636196_c1 | 3300050507 | Unclassified | 1197 |
| 1324 | nmdc:mga05p37_67303_c1 | 3300050507 | Bacteria | 4406 |
| 1325 | nmdc:mga05p37_728397_c1 | 3300050507 | Bacteria | 1097 |
| 1326 | nmdc:mga05p37_922531_c1 | 3300050507 | Bacteria | 938 |
| 1327 | nmdc:mga09592_338617_c1 | 3300050508 | Bacteria | 1302 |
| 1328 | nmdc:mga09592_623402_c1 | 3300050508 | Bacteria | 923 |
| 1329 | nmdc:mga0qj67_819791_c1 | 3300050509 | Bacteria | 736 |
| 1330 | nmdc:mga06r32_186107_c1 | 3300050510 | Bacteria | 2063 |
| 1331 | nmdc:mga06r32_534480_c1 | 3300050510 | Bacteria | 1147 |
| 1332 | nmdc:mga06r32_602822_c1 | 3300050510 | Bacteria | 1069 |
| 1333 | nmdc:mga08y16_114735_c1 | 3300050511 | Bacteria | 2804 |
| 1334 | nmdc:mga08y16_142866_c1 | 3300050511 | Bacteria | 2488 |
| 1335 | nmdc:mga08y16_946504_c1 | 3300050511 | Bacteria | 845 |
| 1336 | nmdc:mga0n895_120980_c1 | 3300050512 | Bacteria | 2639 |
| 1337 | nmdc:mga0n895_1917392_c1 | 3300050512 | Bacteria | 551 |
| 1338 | nmdc:mga0n895_2199608_c1 | 3300050512 | Bacteria | 507 |
| 1339 | nmdc:mga0n895_441913_c1 | 3300050512 | Bacteria | 1314 |
| 1340 | nmdc:mga0n895_859021_c1 | 3300050512 | Bacteria | 895 |
| 1341 | nmdc:mga0rr50_145771_c1 | 3300050513 | Bacteria | 1909 |
| 1342 | nmdc:mga0rr50_375931_c1 | 3300050513 | Bacteria | 1197 |
| 1343 | nmdc:mga0rr50_600645_c1 | 3300050513 | Bacteria | 938 |
| 1344 | nmdc:mga0rr50_741140_c1 | 3300050513 | Bacteria | 838 |
| 1345 | nmdc:mga08x19_13948_c1 | 3300050514 | Bacteria | 4868 |
| 1346 | nmdc:mga08x19_271491_c1 | 3300050514 | Bacteria | 1174 |
| 1347 | nmdc:mga08x19_699764_c1 | 3300050514 | Bacteria | 719 |
| 1348 | nmdc:mga08x19_838218_c1 | 3300050514 | Bacteria | 653 |
| 1349 | nmdc:mga0a205_120580_c1 | 3300050515 | Bacteria | 2522 |
| 1350 | nmdc:mga0a205_21314_c1 | 3300050515 | Bacteria | 6130 |
| 1351 | Ga0500635_0155248 | 3300053080 | Bacteria | 875 |
| 1352 | Ga0500578_0240697 | 3300053086 | Bacteria | 1093 |
| 1353 | Ga0500646_0011933 | 3300053090 | Bacteria | 2239 |
| 1354 | Ga0500583_0071482 | 3300053092 | Bacteria | 1660 |
| 1355 | Ga0500566_0025437 | 3300053094 | Bacteria | 3471 |
| 1356 | Ga0500566_0127039 | 3300053094 | Bacteria | 1368 |
| 1357 | Ga0500640_006375 | 3300053095 | Bacteria | 4497 |
| 1358 | Ga0500572_150433 | 3300053111 | Bacteria | 760 |
| 1359 | Ga0500591_208188 | 3300053115 | Bacteria | 665 |
| 1360 | Ga0500594_0189517 | 3300053118 | Bacteria | 673 |
| 1361 | Ga0500595_000465 | 3300053119 | Bacteria | 25155 |
| 1362 | Ga0500597_056291 | 3300053120 | Bacteria | 1683 |
| 1363 | Ga0500614_000040 | 3300053123 | Bacteria | 27788 |
| 1364 | Ga0500642_0109796 | 3300053130 | Bacteria | 1287 |
| 1365 | Ga0500658_0308124 | 3300053134 | Bacteria | 728 |
| 1366 | Ga0500559_0145679 | 3300053136 | Bacteria | 1110 |
| 1367 | Ga0500564_327281 | 3300053138 | Bacteria | 578 |
| 1368 | Ga0500585_180530 | 3300053144 | Bacteria | 716 |
| 1369 | Ga0500588_0242700 | 3300053146 | Bacteria | 675 |
| 1370 | Ga0500603_007909 | 3300053150 | Bacteria | 2343 |
| 1371 | Ga0500619_145053 | 3300053154 | Bacteria | 808 |
| 1372 | Ga0500638_233021 | 3300053162 | Bacteria | 754 |
| 1373 | Ga0500639_259964 | 3300053163 | Bacteria | 687 |
| 1374 | Ga0500636_0061113 | 3300053177 | Bacteria | 2199 |
| 1375 | Ga0501084_0029023 | 3300054114 | Bacteria | 4625 |
| 1376 | Ga0501084_0046520 | 3300054114 | Bacteria | 3635 |
| 1377 | Ga0501084_0175659 | 3300054114 | Bacteria | 1808 |
| 1378 | Ga0501084_0705931 | 3300054114 | Bacteria | 850 |
| 1379 | Ga0500661_033843 | 3300055283 | Bacteria | 903 |
| 1380 | Ga0590071_005505 | 3300059421 | Bacteria | 3041 |
| 1381 | Ga0590071_024241 | 3300059421 | Bacteria | 1437 |
| 1382 | Ga0590074_008331 | 3300059423 | Bacteria | 1726 |
| 1383 | Ga0590074_010196 | 3300059423 | Bacteria | 1570 |
| 1384 | Ga0590075_065515 | 3300059424 | Bacteria | 937 |
| 1385 | Ga0590077_009251 | 3300059426 | Bacteria | 2018 |
| 1386 | Ga0590077_013609 | 3300059426 | Bacteria | 1692 |
| 1387 | Ga0587084_079802 | 3300059477 | Bacteria | 632 |
| 1388 | Ga0587066_047237 | 3300059490 | Bacteria | 834 |
| 1389 | Ga0587070_015773 | 3300059491 | Bacteria | 1201 |
| 1390 | Ga0587077_070905 | 3300059493 | Bacteria | 778 |
| 1391 | Ga0587082_061609 | 3300059504 | Bacteria | 741 |
| 1392 | Ga0587083_0262872 | 3300059505 | Unclassified | 519 |
| 1393 | Ga0587090_004357 | 3300059510 | Bacteria | 1714 |
| 1394 | Ga0587090_089570 | 3300059510 | Bacteria | 628 |
| 1395 | Ga0587098_021026 | 3300059604 | Bacteria | 829 |
| 1396 | Ga0587109_057260 | 3300059624 | Bacteria | 813 |
| 1397 | Ga0587128_033952 | 3300059630 | Bacteria | 861 |
| 1398 | Ga0587128_047718 | 3300059630 | Bacteria | 772 |
| 1399 | Ga0587072_003555 | 3300059643 | Bacteria | 2200 |
| 1400 | Ga0587072_200191 | 3300059643 | Bacteria | 507 |
| 1401 | Ga0587075_061053 | 3300059644 | Bacteria | 680 |
| 1402 | Ga0587078_016647 | 3300059646 | Bacteria | 897 |
| 1403 | Ga0587079_123748 | 3300059647 | Bacteria | 642 |
| 1404 | Ga0587107_020131 | 3300059652 | Bacteria | 922 |
| 1405 | Ga0587114_044750 | 3300059655 | Bacteria | 730 |
| 1406 | Ga0501082_0073796 | 3300060353 | Bacteria | 2938 |
| 1407 | Ga0501082_0144012 | 3300060353 | Bacteria | 2068 |
| 1408 | Ga0501082_0259257 | 3300060353 | Bacteria | 1512 |
| 1409 | Ga0501082_0851237 | 3300060353 | Bacteria | 798 |
| 1410 | Ga0530510_0331631 | 3300061734 | Bacteria | 1141 |
| 1411 | Ga0530510_0743561 | 3300061734 | Bacteria | 748 |
| 1412 | Ga0530510_0765706 | 3300061734 | Bacteria | 736 |
| 1413 | Ga0530510_0926384 | 3300061734 | Bacteria | 666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10775844 | Ga0207674_107758442 | 85 |
| 2 | 3300044683 | Ga0466965_0687816 | Ga0466965_0687816_26_289 | 85 |
| 3 | 3300003163 | Ga0006759J45824_1142513 | Ga0006759J45824_11425131 | 94 |
| 4 | 3300003305 | Ga0006770J48903_1017217 | Ga0006770J48903_10172171 | 94 |
| 5 | 3300003305 | Ga0006770J48903_1052527 | Ga0006770J48903_10525271 | 94 |
| 6 | 3300003579 | Ga0007429J51699_1137424 | Ga0007429J51699_11374241 | 94 |
| 7 | 3300004785 | Ga0058858_1018058 | Ga0058858_10180581 | 94 |
| 8 | 3300004798 | Ga0058859_10150003 | Ga0058859_101500032 | 94 |
| 9 | 3300004800 | Ga0058861_10068965 | Ga0058861_100689652 | 94 |
| 10 | 3300004803 | Ga0058862_10109779 | Ga0058862_101097792 | 94 |
| 11 | 3300005328 | Ga0070676_11531196 | Ga0070676_115311961 | 94 |
| 12 | 3300005329 | Ga0070683_100624396 | Ga0070683_1006243961 | 94 |
| 13 | 3300005330 | Ga0070690_100004480 | Ga0070690_1000044809 | 94 |
| 14 | 3300005330 | Ga0070690_100441175 | Ga0070690_1004411752 | 94 |
| 15 | 3300005338 | Ga0068868_100443867 | Ga0068868_1004438672 | 94 |
| 16 | 3300005345 | Ga0070692_11334128 | Ga0070692_113341282 | 94 |
| 17 | 3300005365 | Ga0070688_100352674 | Ga0070688_1003526742 | 94 |
| 18 | 3300005434 | Ga0070709_11637348 | Ga0070709_116373482 | 94 |
| 19 | 3300005456 | Ga0070678_101269732 | Ga0070678_1012697322 | 94 |
| 20 | 3300005466 | Ga0070685_10516453 | Ga0070685_105164532 | 94 |
| 21 | 3300005468 | Ga0070707_102288806 | Ga0070707_1022888061 | 94 |
| 22 | 3300005530 | Ga0070679_100029083 | Ga0070679_1000290832 | 94 |
| 23 | 3300005535 | Ga0070684_101299637 | Ga0070684_1012996371 | 94 |
| 24 | 3300005545 | Ga0070695_101582349 | Ga0070695_1015823491 | 94 |
| 25 | 3300005548 | Ga0070665_100011744 | Ga0070665_1000117445 | 94 |
| 26 | 3300005548 | Ga0070665_100965551 | Ga0070665_1009655512 | 94 |
| 27 | 3300005549 | Ga0070704_100752816 | Ga0070704_1007528162 | 94 |
| 28 | 3300005577 | Ga0068857_100075686 | Ga0068857_1000756862 | 94 |
| 29 | 3300005578 | Ga0068854_101894065 | Ga0068854_1018940651 | 94 |
| 30 | 3300005614 | Ga0068856_100269836 | Ga0068856_1002698362 | 94 |
| 31 | 3300005617 | Ga0068859_100885997 | Ga0068859_1008859972 | 94 |
| 32 | 3300005618 | Ga0068864_101180369 | Ga0068864_1011803691 | 94 |
| 33 | 3300005618 | Ga0068864_102062129 | Ga0068864_1020621291 | 94 |
| 34 | 3300005841 | Ga0068863_101610255 | Ga0068863_1016102551 | 94 |
| 35 | 3300005843 | Ga0068860_100576869 | Ga0068860_1005768692 | 94 |
| 36 | 3300005937 | Ga0081455_10800432 | Ga0081455_108004322 | 94 |
| 37 | 3300006028 | Ga0070717_10213212 | Ga0070717_102132122 | 94 |
| 38 | 3300006051 | Ga0075364_10102673 | Ga0075364_101026732 | 94 |
| 39 | 3300006177 | Ga0075362_10638651 | Ga0075362_106386512 | 94 |
| 40 | 3300006195 | Ga0075366_10104654 | Ga0075366_101046542 | 94 |
| 41 | 3300006237 | Ga0097621_100963727 | Ga0097621_1009637272 | 94 |
| 42 | 3300006237 | Ga0097621_101217495 | Ga0097621_1012174952 | 94 |
| 43 | 3300006847 | Ga0075431_100341443 | Ga0075431_1003414432 | 94 |
| 44 | 3300006881 | Ga0068865_100755444 | Ga0068865_1007554442 | 94 |
| 45 | 3300006931 | Ga0097620_100885962 | Ga0097620_1008859622 | 94 |
| 46 | 3300009098 | Ga0105245_10000082 | Ga0105245_1000008219 | 94 |
| 47 | 3300009177 | Ga0105248_10623999 | Ga0105248_106239992 | 94 |
| 48 | 3300009177 | Ga0105248_13461920 | Ga0105248_134619201 | 94 |
| 49 | 3300009545 | Ga0105237_12221910 | Ga0105237_122219101 | 94 |
| 50 | 3300009553 | Ga0105249_10030534 | Ga0105249_100305346 | 94 |
| 51 | 3300013297 | Ga0157378_11034898 | Ga0157378_110348982 | 94 |
| 52 | 3300014325 | Ga0163163_11350123 | Ga0163163_113501232 | 94 |
| 53 | 3300014969 | Ga0157376_11231086 | Ga0157376_112310862 | 94 |
| 54 | 3300014969 | Ga0157376_11969980 | Ga0157376_119699801 | 94 |
| 55 | 3300020080 | Ga0206350_11600674 | Ga0206350_116006741 | 94 |
| 56 | 3300023309 | Ga0256744_150842 | Ga0256744_1508421 | 94 |
| 57 | 3300025912 | Ga0207707_11179558 | Ga0207707_111795582 | 94 |
| 58 | 3300025914 | Ga0207671_10702703 | Ga0207671_107027031 | 94 |
| 59 | 3300025917 | Ga0207660_10247526 | Ga0207660_102475262 | 94 |
| 60 | 3300025921 | Ga0207652_10330421 | Ga0207652_103304212 | 94 |
| 61 | 3300025924 | Ga0207694_10521156 | Ga0207694_105211562 | 94 |
| 62 | 3300025927 | Ga0207687_10000288 | Ga0207687_1000028820 | 94 |
| 63 | 3300025941 | Ga0207711_11530862 | Ga0207711_115308621 | 94 |
| 64 | 3300025942 | Ga0207689_10157603 | Ga0207689_101576032 | 94 |
| 65 | 3300025944 | Ga0207661_11205630 | Ga0207661_112056302 | 94 |
| 66 | 3300025944 | Ga0207661_11558771 | Ga0207661_115587712 | 94 |
| 67 | 3300025961 | Ga0207712_10024599 | Ga0207712_100245992 | 94 |
| 68 | 3300025981 | Ga0207640_10528203 | Ga0207640_105282032 | 94 |
| 69 | 3300026078 | Ga0207702_10146028 | Ga0207702_101460282 | 94 |
| 70 | 3300026088 | Ga0207641_11908720 | Ga0207641_119087202 | 94 |
| 71 | 3300026095 | Ga0207676_10468466 | Ga0207676_104684662 | 94 |
| 72 | 3300026095 | Ga0207676_11021709 | Ga0207676_110217092 | 94 |
| 73 | 3300026095 | Ga0207676_11488756 | Ga0207676_114887562 | 94 |
| 74 | 3300026116 | Ga0207674_11036545 | Ga0207674_110365451 | 94 |
| 75 | 3300026142 | Ga0207698_10707898 | Ga0207698_107078982 | 94 |
| 76 | 3300028379 | Ga0268266_10004596 | Ga0268266_100045966 | 94 |
| 77 | 3300028379 | Ga0268266_10868934 | Ga0268266_108689342 | 94 |
| 78 | 3300028786 | Ga0307517_10152441 | Ga0307517_101524412 | 94 |
| 79 | 3300028800 | Ga0265338_10253066 | Ga0265338_102530662 | 94 |
| 80 | 3300029283 | Ga0310982_107480 | Ga0310982_1074802 | 94 |
| 81 | 3300031238 | Ga0265332_10010941 | Ga0265332_100109412 | 94 |
| 82 | 3300031507 | Ga0307509_10000029 | Ga0307509_10000029108 | 94 |
| 83 | 3300031507 | Ga0307509_10047926 | Ga0307509_100479265 | 94 |
| 84 | 3300031507 | Ga0307509_10077718 | Ga0307509_100777182 | 94 |
| 85 | 3300031616 | Ga0307508_10172700 | Ga0307508_101727003 | 94 |
| 86 | 3300031616 | Ga0307508_10341816 | Ga0307508_103418162 | 94 |
| 87 | 3300031665 | Ga0316575_10057696 | Ga0316575_100576961 | 94 |
| 88 | 3300031728 | Ga0316578_10400910 | Ga0316578_104009101 | 94 |
| 89 | 3300031730 | Ga0307516_10055293 | Ga0307516_100552935 | 94 |
| 90 | 3300031733 | Ga0316577_10048972 | Ga0316577_100489722 | 94 |
| 91 | 3300032168 | Ga0316593_10406614 | Ga0316593_104066141 | 94 |
| 92 | 3300033179 | Ga0307507_10187294 | Ga0307507_101872942 | 94 |
| 93 | 3300033541 | Ga0316596_1100435 | Ga0316596_11004351 | 94 |
| 94 | 3300034819 | Ga0373958_0040713 | Ga0373958_0040713_90_377 | 94 |
| 95 | 3300035083 | Ga0373926_0287478 | Ga0373926_0287478_156_446 | 94 |
| 96 | 3300035090 | Ga0373949_0005273 | Ga0373949_0005273_2066_2353 | 94 |
| 97 | 3300035113 | Ga0373936_0000001 | Ga0373936_0000001_232599_232886 | 94 |
| 98 | 3300035115 | Ga0373941_0133309 | Ga0373941_0133309_251_538 | 94 |
| 99 | 3300035119 | Ga0373956_0332661 | Ga0373956_0332661_189_479 | 94 |
| 100 | 3300035119 | Ga0373956_0421403 | Ga0373956_0421403_206_493 | 94 |
| 101 | 3300035121 | Ga0373960_0387443 | Ga0373960_0387443_127_414 | 94 |
| 102 | 3300035241 | Ga0373961_0000001 | Ga0373961_0000001_29834_30121 | 94 |
| 103 | 3300035398 | Ga0316574_0063591 | Ga0316574_0063591_1887_2177 | 94 |
| 104 | 3300035398 | Ga0316574_0969945 | Ga0316574_0969945_40_330 | 94 |
| 105 | 3300035691 | Ga0373931_0203221 | Ga0373931_0203221_216_503 | 94 |
| 106 | 3300035725 | Ga0373947_0563508 | Ga0373947_0563508_171_461 | 94 |
| 107 | 3300036712 | Ga0316584_0074425 | Ga0316584_0074425_1957_2247 | 94 |
| 108 | 3300039437 | Ga0436365_1236418 | Ga0436365_1236418_518_808 | 94 |
| 109 | 3300039450 | Ga0436363_0933504 | Ga0436363_0933504_1190_1477 | 94 |
| 110 | 3300041461 | Ga0451805_081734 | Ga0451805_081734_325_615 | 94 |
| 111 | 3300041486 | Ga0451807_1937924 | Ga0451807_1937924_221_508 | 94 |
| 112 | 3300041492 | Ga0451835_0596095 | Ga0451835_0596095_420_710 | 94 |
| 113 | 3300041498 | Ga0451841_0658728 | Ga0451841_0658728_250_540 | 94 |
| 114 | 3300041505 | Ga0451849_1401345 | Ga0451849_1401345_1696_1986 | 94 |
| 115 | 3300041507 | Ga0451851_0196687 | Ga0451851_0196687_386_676 | 94 |
| 116 | 3300041511 | Ga0451855_1580001 | Ga0451855_1580001_393_683 | 94 |
| 117 | 3300041512 | Ga0451853_1965433 | Ga0451853_1965433_240_530 | 94 |
| 118 | 3300045051 | Ga0451576_1570374 | Ga0451576_1570374_241_531 | 94 |
| 119 | 3300046457 | Ga0495590_0104703 | Ga0495590_0104703_521_808 | 94 |
| 120 | 3300046517 | Ga0495630_0263965 | Ga0495630_0263965_959_1246 | 94 |
| 121 | 3300046557 | Ga0495622_0024248 | Ga0495622_0024248_2148_2435 | 94 |
| 122 | 3300046683 | Ga0495658_0463577 | Ga0495658_0463577_55_342 | 94 |
| 123 | 3300048908 | Ga0496105_0448317 | Ga0496105_0448317_584_874 | 94 |
| 124 | 3300048917 | Ga0496114_0094823 | Ga0496114_0094823_1563_1853 | 94 |
| 125 | 3300048918 | Ga0496115_0672896 | Ga0496115_0672896_473_760 | 94 |
| 126 | 3300048918 | Ga0496115_0968997 | Ga0496115_0968997_28_318 | 94 |
| 127 | 3300049536 | Ga0501320_019113 | Ga0501320_019113_53_340 | 94 |
| 128 | 3300049539 | Ga0501323_032530 | Ga0501323_032530_58_345 | 94 |
| 129 | 3300049570 | Ga0501033_1017149 | Ga0501033_1017149_82_369 | 94 |
| 130 | 3300049571 | Ga0501034_0478097 | Ga0501034_0478097_762_1049 | 94 |
| 131 | 3300049583 | Ga0501067_0199831 | Ga0501067_0199831_369_659 | 94 |
| 132 | 3300049584 | Ga0501068_0061584 | Ga0501068_0061584_1895_2182 | 94 |
| 133 | 3300049584 | Ga0501068_0235984 | Ga0501068_0235984_714_1004 | 94 |
| 134 | 3300049585 | Ga0501069_0202088 | Ga0501069_0202088_334_621 | 94 |
| 135 | 3300049586 | Ga0501070_0027238 | Ga0501070_0027238_2942_3229 | 94 |
| 136 | 3300049586 | Ga0501070_0473066 | Ga0501070_0473066_76_363 | 94 |
| 137 | 3300049587 | Ga0501071_0209315 | Ga0501071_0209315_898_1185 | 94 |
| 138 | 3300049588 | Ga0501072_0309226 | Ga0501072_0309226_750_1037 | 94 |
| 139 | 3300049742 | Ga0501080_0246481 | Ga0501080_0246481_1230_1517 | 94 |
| 140 | 3300049743 | Ga0501081_0292707 | Ga0501081_0292707_338_625 | 94 |
| 141 | 3300049744 | Ga0501083_0387893 | Ga0501083_0387893_415_702 | 94 |
| 142 | 3300049744 | Ga0501083_1169878 | Ga0501083_1169878_64_351 | 94 |
| 143 | 3300050491 | nmdc:mga00v17_381822_c1 | nmdc:mga00v17_381822_c1_406_696 | 94 |
| 144 | 3300050493 | nmdc:mga0k408_47265_c1 | nmdc:mga0k408_47265_c1_1150_1440 | 94 |
| 145 | 3300050510 | nmdc:mga06r32_602822_c1 | nmdc:mga06r32_602822_c1_560_850 | 94 |
| 146 | 3300053080 | Ga0500635_0155248 | Ga0500635_0155248_395_682 | 94 |
| 147 | 3300053086 | Ga0500578_0240697 | Ga0500578_0240697_168_455 | 94 |
| 148 | 3300053090 | Ga0500646_0011933 | Ga0500646_0011933_240_527 | 94 |
| 149 | 3300053092 | Ga0500583_0071482 | Ga0500583_0071482_191_478 | 94 |
| 150 | 3300053094 | Ga0500566_0025437 | Ga0500566_0025437_600_887 | 94 |
| 151 | 3300053094 | Ga0500566_0127039 | Ga0500566_0127039_572_859 | 94 |
| 152 | 3300053095 | Ga0500640_006375 | Ga0500640_006375_393_680 | 94 |
| 153 | 3300053111 | Ga0500572_150433 | Ga0500572_150433_182_469 | 94 |
| 154 | 3300053115 | Ga0500591_208188 | Ga0500591_208188_281_568 | 94 |
| 155 | 3300053118 | Ga0500594_0189517 | Ga0500594_0189517_285_572 | 94 |
| 156 | 3300053119 | Ga0500595_000465 | Ga0500595_000465_23232_23519 | 94 |
| 157 | 3300053120 | Ga0500597_056291 | Ga0500597_056291_358_645 | 94 |
| 158 | 3300053123 | Ga0500614_000040 | Ga0500614_000040_9063_9350 | 94 |
| 159 | 3300053130 | Ga0500642_0109796 | Ga0500642_0109796_890_1177 | 94 |
| 160 | 3300053134 | Ga0500658_0308124 | Ga0500658_0308124_208_495 | 94 |
| 161 | 3300053136 | Ga0500559_0145679 | Ga0500559_0145679_411_698 | 94 |
| 162 | 3300053138 | Ga0500564_327281 | Ga0500564_327281_132_419 | 94 |
| 163 | 3300053144 | Ga0500585_180530 | Ga0500585_180530_234_521 | 94 |
| 164 | 3300053146 | Ga0500588_0242700 | Ga0500588_0242700_246_533 | 94 |
| 165 | 3300053150 | Ga0500603_007909 | Ga0500603_007909_1899_2186 | 94 |
| 166 | 3300053154 | Ga0500619_145053 | Ga0500619_145053_476_763 | 94 |
| 167 | 3300053162 | Ga0500638_233021 | Ga0500638_233021_185_472 | 94 |
| 168 | 3300053163 | Ga0500639_259964 | Ga0500639_259964_126_413 | 94 |
| 169 | 3300053177 | Ga0500636_0061113 | Ga0500636_0061113_663_950 | 94 |
| 170 | 3300055283 | Ga0500661_033843 | Ga0500661_033843_29_316 | 94 |
| 171 | 3300059491 | Ga0587070_015773 | Ga0587070_015773_790_1080 | 94 |
| 172 | 3300059604 | Ga0587098_021026 | Ga0587098_021026_486_776 | 94 |
| 173 | 3300059624 | Ga0587109_057260 | Ga0587109_057260_58_345 | 94 |
| 174 | 3300060353 | Ga0501082_0144012 | Ga0501082_0144012_513_800 | 94 |
| 175 | 3300003578 | Ga0006562J51391_1014982 | Ga0006562J51391_10149822 | 95 |
| 176 | 3300005327 | Ga0070658_10983028 | Ga0070658_109830281 | 95 |
| 177 | 3300005331 | Ga0070670_101223806 | Ga0070670_1012238062 | 95 |
| 178 | 3300005468 | Ga0070707_100162363 | Ga0070707_1001623632 | 95 |
| 179 | 3300006058 | Ga0075432_10311200 | Ga0075432_103112001 | 95 |
| 180 | 3300006353 | Ga0075370_10322826 | Ga0075370_103228262 | 95 |
| 181 | 3300006844 | Ga0075428_102526401 | Ga0075428_1025264011 | 95 |
| 182 | 3300009147 | Ga0114129_10150508 | Ga0114129_101505083 | 95 |
| 183 | 3300013102 | Ga0157371_10422242 | Ga0157371_104222421 | 95 |
| 184 | 3300013105 | Ga0157369_12086848 | Ga0157369_120868481 | 95 |
| 185 | 3300013307 | Ga0157372_10893734 | Ga0157372_108937342 | 95 |
| 186 | 3300014497 | Ga0182008_10348653 | Ga0182008_103486531 | 95 |
| 187 | 3300020076 | Ga0206355_1229164 | Ga0206355_12291641 | 95 |
| 188 | 3300020076 | Ga0206355_1700556 | Ga0206355_17005562 | 95 |
| 189 | 3300020082 | Ga0206353_11560491 | Ga0206353_115604912 | 95 |
| 190 | 3300022467 | Ga0224712_10383109 | Ga0224712_103831091 | 95 |
| 191 | 3300025909 | Ga0207705_10395806 | Ga0207705_103958061 | 95 |
| 192 | 3300026116 | Ga0207674_10677041 | Ga0207674_106770412 | 95 |
| 193 | 3300030963 | Ga0265768_113673 | Ga0265768_1136731 | 95 |
| 194 | 3300031548 | Ga0307408_100042108 | Ga0307408_1000421083 | 95 |
| 195 | 3300031548 | Ga0307408_100080846 | Ga0307408_1000808462 | 95 |
| 196 | 3300031548 | Ga0307408_100127270 | Ga0307408_1001272702 | 95 |
| 197 | 3300031548 | Ga0307408_100127488 | Ga0307408_1001274882 | 95 |
| 198 | 3300031548 | Ga0307408_100281377 | Ga0307408_1002813771 | 95 |
| 199 | 3300031548 | Ga0307408_100283082 | Ga0307408_1002830821 | 95 |
| 200 | 3300031548 | Ga0307408_101251135 | Ga0307408_1012511352 | 95 |
| 201 | 3300031731 | Ga0307405_10044041 | Ga0307405_100440413 | 95 |
| 202 | 3300031731 | Ga0307405_10083608 | Ga0307405_100836081 | 95 |
| 203 | 3300031731 | Ga0307405_10147946 | Ga0307405_101479462 | 95 |
| 204 | 3300031731 | Ga0307405_10169124 | Ga0307405_101691242 | 95 |
| 205 | 3300031824 | Ga0307413_10035638 | Ga0307413_100356382 | 95 |
| 206 | 3300031824 | Ga0307413_10060403 | Ga0307413_100604032 | 95 |
| 207 | 3300031824 | Ga0307413_10392207 | Ga0307413_103922071 | 95 |
| 208 | 3300031852 | Ga0307410_10034302 | Ga0307410_100343022 | 95 |
| 209 | 3300031852 | Ga0307410_10140619 | Ga0307410_101406192 | 95 |
| 210 | 3300031852 | Ga0307410_10260410 | Ga0307410_102604101 | 95 |
| 211 | 3300031903 | Ga0307407_10011805 | Ga0307407_100118053 | 95 |
| 212 | 3300031903 | Ga0307407_10082262 | Ga0307407_100822622 | 95 |
| 213 | 3300031903 | Ga0307407_10369785 | Ga0307407_103697852 | 95 |
| 214 | 3300031903 | Ga0307407_10534508 | Ga0307407_105345082 | 95 |
| 215 | 3300031903 | Ga0307407_11686280 | Ga0307407_116862801 | 95 |
| 216 | 3300031911 | Ga0307412_10009640 | Ga0307412_100096404 | 95 |
| 217 | 3300031911 | Ga0307412_10055983 | Ga0307412_100559832 | 95 |
| 218 | 3300031911 | Ga0307412_10157667 | Ga0307412_101576673 | 95 |
| 219 | 3300031911 | Ga0307412_10163670 | Ga0307412_101636702 | 95 |
| 220 | 3300031911 | Ga0307412_10165007 | Ga0307412_101650072 | 95 |
| 221 | 3300031911 | Ga0307412_10451830 | Ga0307412_104518302 | 95 |
| 222 | 3300031911 | Ga0307412_11501822 | Ga0307412_115018221 | 95 |
| 223 | 3300031995 | Ga0307409_100257418 | Ga0307409_1002574182 | 95 |
| 224 | 3300031995 | Ga0307409_100395582 | Ga0307409_1003955821 | 95 |
| 225 | 3300031995 | Ga0307409_100496453 | Ga0307409_1004964532 | 95 |
| 226 | 3300031995 | Ga0307409_100847684 | Ga0307409_1008476842 | 95 |
| 227 | 3300032002 | Ga0307416_100167255 | Ga0307416_1001672552 | 95 |
| 228 | 3300032002 | Ga0307416_100203336 | Ga0307416_1002033362 | 95 |
| 229 | 3300032002 | Ga0307416_100400679 | Ga0307416_1004006792 | 95 |
| 230 | 3300032002 | Ga0307416_100588081 | Ga0307416_1005880812 | 95 |
| 231 | 3300032002 | Ga0307416_100879121 | Ga0307416_1008791212 | 95 |
| 232 | 3300032004 | Ga0307414_10810240 | Ga0307414_108102401 | 95 |
| 233 | 3300032004 | Ga0307414_10821820 | Ga0307414_108218202 | 95 |
| 234 | 3300032005 | Ga0307411_10396082 | Ga0307411_103960822 | 95 |
| 235 | 3300032126 | Ga0307415_100335641 | Ga0307415_1003356413 | 95 |
| 236 | 3300032126 | Ga0307415_100745811 | Ga0307415_1007458111 | 95 |
| 237 | 3300037312 | Ga0395899_0011864 | Ga0395899_0011864_1314_1607 | 95 |
| 238 | 3300037312 | Ga0395899_0124689 | Ga0395899_0124689_400_693 | 95 |
| 239 | 3300037466 | Ga0395898_0038342 | Ga0395898_0038342_4302_4595 | 95 |
| 240 | 3300037471 | Ga0395905_0441651 | Ga0395905_0441651_266_559 | 95 |
| 241 | 3300038443 | Ga0395901_0182000 | Ga0395901_0182000_1015_1308 | 95 |
| 242 | 3300041404 | Ga0439436_0020957 | Ga0439436_0020957_1181_1474 | 95 |
| 243 | 3300041404 | Ga0439436_0032287 | Ga0439436_0032287_246_539 | 95 |
| 244 | 3300041405 | Ga0439438_063807 | Ga0439438_063807_339_632 | 95 |
| 245 | 3300041407 | Ga0439447_057324 | Ga0439447_057324_16_309 | 95 |
| 246 | 3300041410 | Ga0439461_0044522 | Ga0439461_0044522_363_656 | 95 |
| 247 | 3300041411 | Ga0439466_0047339 | Ga0439466_0047339_1089_1382 | 95 |
| 248 | 3300041413 | Ga0439465_0323764 | Ga0439465_0323764_262_555 | 95 |
| 249 | 3300041999 | Ga0439433_0003003 | Ga0439433_0003003_2616_2909 | 95 |
| 250 | 3300041999 | Ga0439433_0039156 | Ga0439433_0039156_511_804 | 95 |
| 251 | 3300042002 | Ga0439442_000012 | Ga0439442_000012_38536_38829 | 95 |
| 252 | 3300042006 | Ga0439432_097365 | Ga0439432_097365_31_324 | 95 |
| 253 | 3300042007 | Ga0439449_0029379 | Ga0439449_0029379_860_1153 | 95 |
| 254 | 3300042007 | Ga0439449_0033278 | Ga0439449_0033278_337_630 | 95 |
| 255 | 3300042014 | Ga0439457_035060 | Ga0439457_035060_34_327 | 95 |
| 256 | 3300042015 | Ga0439462_0023095 | Ga0439462_0023095_165_458 | 95 |
| 257 | 3300042115 | Ga0450911_012401 | Ga0450911_012401_402_695 | 95 |
| 258 | 3300042122 | Ga0450920_004890 | Ga0450920_004890_820_1113 | 95 |
| 259 | 3300042122 | Ga0450920_006036 | Ga0450920_006036_1770_2063 | 95 |
| 260 | 3300042134 | Ga0450898_045670 | Ga0450898_045670_302_595 | 95 |
| 261 | 3300042145 | Ga0450906_028800 | Ga0450906_028800_644_937 | 95 |
| 262 | 3300042146 | Ga0450907_000415 | Ga0450907_000415_1890_2183 | 95 |
| 263 | 3300042146 | Ga0450907_021368 | Ga0450907_021368_663_956 | 95 |
| 264 | 3300042147 | Ga0450910_060166 | Ga0450910_060166_28_321 | 95 |
| 265 | 3300042184 | Ga0450908_006541 | Ga0450908_006541_1027_1320 | 95 |
| 266 | 3300042435 | Ga0439434_0000031 | Ga0439434_0000031_10822_11115 | 95 |
| 267 | 3300042435 | Ga0439434_0023852 | Ga0439434_0023852_662_955 | 95 |
| 268 | 3300042531 | Ga0450918_000869 | Ga0450918_000869_1014_1307 | 95 |
| 269 | 3300044765 | Ga0466970_0822108 | Ga0466970_0822108_28_321 | 95 |
| 270 | 3300046535 | Ga0495586_0078526 | Ga0495586_0078526_1289_1582 | 95 |
| 271 | 3300048904 | Ga0496101_1211165 | Ga0496101_1211165_101_394 | 95 |
| 272 | 3300048906 | Ga0496103_0121752 | Ga0496103_0121752_644_937 | 95 |
| 273 | 3300048909 | Ga0496106_1588372 | Ga0496106_1588372_47_340 | 95 |
| 274 | 3300048916 | Ga0496113_0081115 | Ga0496113_0081115_515_808 | 95 |
| 275 | 3300049128 | Ga0501308_002288 | Ga0501308_002288_1274_1567 | 95 |
| 276 | 3300049128 | Ga0501308_036473 | Ga0501308_036473_102_395 | 95 |
| 277 | 3300049160 | Ga0501304_016458 | Ga0501304_016458_312_605 | 95 |
| 278 | 3300049527 | Ga0501311_075253 | Ga0501311_075253_233_526 | 95 |
| 279 | 3300049527 | Ga0501311_078438 | Ga0501311_078438_225_518 | 95 |
| 280 | 3300049531 | Ga0501315_084027 | Ga0501315_084027_233_526 | 95 |
| 281 | 3300049532 | Ga0501316_023358 | Ga0501316_023358_14_307 | 95 |
| 282 | 3300049532 | Ga0501316_053541 | Ga0501316_053541_26_319 | 95 |
| 283 | 3300049533 | Ga0501317_004354 | Ga0501317_004354_1073_1366 | 95 |
| 284 | 3300049534 | Ga0501318_075407 | Ga0501318_075407_35_328 | 95 |
| 285 | 3300049537 | Ga0501321_001077 | Ga0501321_001077_1263_1556 | 95 |
| 286 | 3300049537 | Ga0501321_055844 | Ga0501321_055844_244_537 | 95 |
| 287 | 3300049538 | Ga0501322_010210 | Ga0501322_010210_113_406 | 95 |
| 288 | 3300049539 | Ga0501323_003862 | Ga0501323_003862_970_1263 | 95 |
| 289 | 3300049540 | Ga0501324_015038 | Ga0501324_015038_119_412 | 95 |
| 290 | 3300049540 | Ga0501324_018809 | Ga0501324_018809_26_319 | 95 |
| 291 | 3300049541 | Ga0501325_016317 | Ga0501325_016317_108_401 | 95 |
| 292 | 3300049541 | Ga0501325_022661 | Ga0501325_022661_309_602 | 95 |
| 293 | 3300049548 | Ga0501332_08295 | Ga0501332_08295_40_333 | 95 |
| 294 | 3300049549 | Ga0501333_000957 | Ga0501333_000957_1134_1427 | 95 |
| 295 | 3300049569 | Ga0501032_0002375 | Ga0501032_0002375_7842_8135 | 95 |
| 296 | 3300049569 | Ga0501032_0205226 | Ga0501032_0205226_607_900 | 95 |
| 297 | 3300049570 | Ga0501033_0222059 | Ga0501033_0222059_613_906 | 95 |
| 298 | 3300049572 | Ga0501036_0049128 | Ga0501036_0049128_3210_3503 | 95 |
| 299 | 3300049573 | Ga0501037_0044275 | Ga0501037_0044275_1386_1679 | 95 |
| 300 | 3300049574 | Ga0501038_0904316 | Ga0501038_0904316_166_459 | 95 |
| 301 | 3300049575 | Ga0501039_0031107 | Ga0501039_0031107_2715_3008 | 95 |
| 302 | 3300049579 | Ga0501043_0080857 | Ga0501043_0080857_563_856 | 95 |
| 303 | 3300049586 | Ga0501070_0085902 | Ga0501070_0085902_1206_1499 | 95 |
| 304 | 3300049656 | Ga0501209_216804 | Ga0501209_216804_170_463 | 95 |
| 305 | 3300049823 | Ga0501044_0369903 | Ga0501044_0369903_1033_1326 | 95 |
| 306 | 3300049824 | Ga0501045_1307130 | Ga0501045_1307130_206_499 | 95 |
| 307 | 3300050496 | nmdc:mga07m45_628578_c1 | nmdc:mga07m45_628578_c1_200_493 | 95 |
| 308 | 3300059510 | Ga0587090_004357 | Ga0587090_004357_168_461 | 95 |
| 309 | 3300059630 | Ga0587128_047718 | Ga0587128_047718_263_556 | 95 |
| 310 | 3300059643 | Ga0587072_003555 | Ga0587072_003555_1715_2008 | 95 |
| 311 | 3300009093 | Ga0105240_11157464 | Ga0105240_111574642 | 96 |
| 312 | 3300009176 | Ga0105242_11760108 | Ga0105242_117601081 | 96 |
| 313 | 3300009545 | Ga0105237_10281100 | Ga0105237_102811003 | 96 |
| 314 | 3300009551 | Ga0105238_10231835 | Ga0105238_102318353 | 96 |
| 315 | 3300010375 | Ga0105239_10159505 | Ga0105239_101595052 | 96 |
| 316 | 3300014969 | Ga0157376_10025735 | Ga0157376_100257352 | 96 |
| 317 | 3300025913 | Ga0207695_10856306 | Ga0207695_108563062 | 96 |
| 318 | 3300027617 | Ga0210002_1016324 | Ga0210002_10163242 | 96 |
| 319 | 3300041451 | Ga0451791_1316043 | Ga0451791_1316043_84_380 | 96 |
| 320 | 3300041460 | Ga0451802_0276746 | Ga0451802_0276746_175_471 | 96 |
| 321 | 3300041464 | Ga0451808_06737 | Ga0451808_06737_83_379 | 96 |
| 322 | 3300041486 | Ga0451807_0294446 | Ga0451807_0294446_317_613 | 96 |
| 323 | 3300044684 | Ga0466966_0013970 | Ga0466966_0013970_2218_2508 | 96 |
| 324 | 3300045049 | Ga0466959_0072807 | Ga0466959_0072807_298_588 | 96 |
| 325 | 3300049160 | Ga0501304_036655 | Ga0501304_036655_73_369 | 96 |
| 326 | 3300005467 | Ga0070706_100716034 | Ga0070706_1007160342 | 97 |
| 327 | 3300005468 | Ga0070707_100558413 | Ga0070707_1005584132 | 97 |
| 328 | 3300005468 | Ga0070707_100768564 | Ga0070707_1007685642 | 97 |
| 329 | 3300005471 | Ga0070698_100793109 | Ga0070698_1007931092 | 97 |
| 330 | 3300005536 | Ga0070697_100857270 | Ga0070697_1008572702 | 97 |
| 331 | 3300006175 | Ga0070712_101902792 | Ga0070712_1019027921 | 97 |
| 332 | 3300025915 | Ga0207693_10319734 | Ga0207693_103197341 | 97 |
| 333 | 3300025928 | Ga0207700_10424367 | Ga0207700_104243672 | 97 |
| 334 | 3300005327 | Ga0070658_10404733 | Ga0070658_104047332 | 98 |
| 335 | 3300005329 | Ga0070683_100757092 | Ga0070683_1007570922 | 98 |
| 336 | 3300005344 | Ga0070661_100150702 | Ga0070661_1001507022 | 98 |
| 337 | 3300005535 | Ga0070684_101813731 | Ga0070684_1018137312 | 98 |
| 338 | 3300005547 | Ga0070693_100885869 | Ga0070693_1008858692 | 98 |
| 339 | 3300046539 | Ga0495621_0500183 | Ga0495621_0500183_108_404 | 98 |
| 340 | 3300005616 | Ga0068852_101605732 | Ga0068852_1016057322 | 99 |
| 341 | 3300031824 | Ga0307413_10342224 | Ga0307413_103422242 | 99 |
| 342 | 3300005328 | Ga0070676_10674108 | Ga0070676_106741081 | 100 |
| 343 | 3300005329 | Ga0070683_102332946 | Ga0070683_1023329461 | 100 |
| 344 | 3300005336 | Ga0070680_100187460 | Ga0070680_1001874602 | 100 |
| 345 | 3300005339 | Ga0070660_100085863 | Ga0070660_1000858633 | 100 |
| 346 | 3300005339 | Ga0070660_100532077 | Ga0070660_1005320771 | 100 |
| 347 | 3300005341 | Ga0070691_10061118 | Ga0070691_100611181 | 100 |
| 348 | 3300005344 | Ga0070661_100081807 | Ga0070661_1000818072 | 100 |
| 349 | 3300005366 | Ga0070659_101915838 | Ga0070659_1019158382 | 100 |
| 350 | 3300005444 | Ga0070694_100243246 | Ga0070694_1002432462 | 100 |
| 351 | 3300005458 | Ga0070681_10287672 | Ga0070681_102876721 | 100 |
| 352 | 3300005458 | Ga0070681_10468889 | Ga0070681_104688892 | 100 |
| 353 | 3300005458 | Ga0070681_11587399 | Ga0070681_115873991 | 100 |
| 354 | 3300005468 | Ga0070707_101479720 | Ga0070707_1014797201 | 100 |
| 355 | 3300005471 | Ga0070698_100018255 | Ga0070698_1000182557 | 100 |
| 356 | 3300005530 | Ga0070679_101650682 | Ga0070679_1016506821 | 100 |
| 357 | 3300005530 | Ga0070679_102128088 | Ga0070679_1021280881 | 100 |
| 358 | 3300005535 | Ga0070684_100099104 | Ga0070684_1000991041 | 100 |
| 359 | 3300005535 | Ga0070684_102227742 | Ga0070684_1022277421 | 100 |
| 360 | 3300005539 | Ga0068853_101281858 | Ga0068853_1012818582 | 100 |
| 361 | 3300005546 | Ga0070696_100153436 | Ga0070696_1001534362 | 100 |
| 362 | 3300005563 | Ga0068855_100404096 | Ga0068855_1004040962 | 100 |
| 363 | 3300005563 | Ga0068855_100577451 | Ga0068855_1005774512 | 100 |
| 364 | 3300005563 | Ga0068855_101774665 | Ga0068855_1017746652 | 100 |
| 365 | 3300005564 | Ga0070664_100460027 | Ga0070664_1004600272 | 100 |
| 366 | 3300005614 | Ga0068856_100119705 | Ga0068856_1001197052 | 100 |
| 367 | 3300005614 | Ga0068856_100522275 | Ga0068856_1005222752 | 100 |
| 368 | 3300005616 | Ga0068852_100065709 | Ga0068852_1000657094 | 100 |
| 369 | 3300005616 | Ga0068852_100127253 | Ga0068852_1001272532 | 100 |
| 370 | 3300006914 | Ga0075436_100389956 | Ga0075436_1003899562 | 100 |
| 371 | 3300009093 | Ga0105240_10225714 | Ga0105240_102257142 | 100 |
| 372 | 3300009551 | Ga0105238_10953504 | Ga0105238_109535042 | 100 |
| 373 | 3300013100 | Ga0157373_10248359 | Ga0157373_102483592 | 100 |
| 374 | 3300013102 | Ga0157371_10224768 | Ga0157371_102247682 | 100 |
| 375 | 3300013102 | Ga0157371_10272488 | Ga0157371_102724882 | 100 |
| 376 | 3300013104 | Ga0157370_10152532 | Ga0157370_101525322 | 100 |
| 377 | 3300013104 | Ga0157370_11458628 | Ga0157370_114586282 | 100 |
| 378 | 3300013105 | Ga0157369_10070857 | Ga0157369_100708572 | 100 |
| 379 | 3300013105 | Ga0157369_10073266 | Ga0157369_100732664 | 100 |
| 380 | 3300013307 | Ga0157372_10081879 | Ga0157372_100818792 | 100 |
| 381 | 3300013307 | Ga0157372_10295081 | Ga0157372_102950812 | 100 |
| 382 | 3300020076 | Ga0206355_1675750 | Ga0206355_16757502 | 100 |
| 383 | 3300020077 | Ga0206351_10734128 | Ga0206351_107341282 | 100 |
| 384 | 3300025907 | Ga0207645_10217388 | Ga0207645_102173882 | 100 |
| 385 | 3300025909 | Ga0207705_10024161 | Ga0207705_100241613 | 100 |
| 386 | 3300025909 | Ga0207705_10764772 | Ga0207705_107647722 | 100 |
| 387 | 3300025912 | Ga0207707_10837354 | Ga0207707_108373542 | 100 |
| 388 | 3300025912 | Ga0207707_10893897 | Ga0207707_108938971 | 100 |
| 389 | 3300025913 | Ga0207695_10377356 | Ga0207695_103773562 | 100 |
| 390 | 3300025917 | Ga0207660_10061959 | Ga0207660_100619592 | 100 |
| 391 | 3300025919 | Ga0207657_10035732 | Ga0207657_100357323 | 100 |
| 392 | 3300025919 | Ga0207657_10141222 | Ga0207657_101412222 | 100 |
| 393 | 3300025920 | Ga0207649_11485440 | Ga0207649_114854401 | 100 |
| 394 | 3300025921 | Ga0207652_10546292 | Ga0207652_105462922 | 100 |
| 395 | 3300025921 | Ga0207652_10584527 | Ga0207652_105845271 | 100 |
| 396 | 3300025922 | Ga0207646_10776853 | Ga0207646_107768532 | 100 |
| 397 | 3300025924 | Ga0207694_10910627 | Ga0207694_109106272 | 100 |
| 398 | 3300025933 | Ga0207706_10436537 | Ga0207706_104365372 | 100 |
| 399 | 3300025933 | Ga0207706_10444829 | Ga0207706_104448292 | 100 |
| 400 | 3300025944 | Ga0207661_10640929 | Ga0207661_106409292 | 100 |
| 401 | 3300025944 | Ga0207661_11962204 | Ga0207661_119622041 | 100 |
| 402 | 3300025945 | Ga0207679_10291104 | Ga0207679_102911043 | 100 |
| 403 | 3300025949 | Ga0207667_10031423 | Ga0207667_100314234 | 100 |
| 404 | 3300025949 | Ga0207667_10239433 | Ga0207667_102394332 | 100 |
| 405 | 3300025949 | Ga0207667_10927691 | Ga0207667_109276911 | 100 |
| 406 | 3300025981 | Ga0207640_10016300 | Ga0207640_100163004 | 100 |
| 407 | 3300025981 | Ga0207640_10407637 | Ga0207640_104076372 | 100 |
| 408 | 3300026041 | Ga0207639_12260585 | Ga0207639_122605851 | 100 |
| 409 | 3300026067 | Ga0207678_10011920 | Ga0207678_100119204 | 100 |
| 410 | 3300026078 | Ga0207702_10217218 | Ga0207702_102172182 | 100 |
| 411 | 3300026078 | Ga0207702_10891786 | Ga0207702_108917861 | 100 |
| 412 | 3300026142 | Ga0207698_10040229 | Ga0207698_100402295 | 100 |
| 413 | 3300026142 | Ga0207698_10472832 | Ga0207698_104728321 | 100 |
| 414 | 3300031731 | Ga0307405_11125075 | Ga0307405_111250752 | 100 |
| 415 | 3300031824 | Ga0307413_10059631 | Ga0307413_100596312 | 100 |
| 416 | 3300031852 | Ga0307410_10207505 | Ga0307410_102075052 | 100 |
| 417 | 3300031903 | Ga0307407_10785336 | Ga0307407_107853362 | 100 |
| 418 | 3300031995 | Ga0307409_100101758 | Ga0307409_1001017582 | 100 |
| 419 | 3300031995 | Ga0307409_101259152 | Ga0307409_1012591522 | 100 |
| 420 | 3300032002 | Ga0307416_101299562 | Ga0307416_1012995622 | 100 |
| 421 | 3300032004 | Ga0307414_10177225 | Ga0307414_101772252 | 100 |
| 422 | 3300032005 | Ga0307411_10010875 | Ga0307411_100108755 | 100 |
| 423 | 3300035090 | Ga0373949_0130164 | Ga0373949_0130164_54_356 | 100 |
| 424 | 3300035241 | Ga0373961_0166180 | Ga0373961_0166180_84_386 | 100 |
| 425 | 3300035242 | Ga0373962_0251979 | Ga0373962_0251979_269_571 | 100 |
| 426 | 3300035724 | Ga0373933_0885142 | Ga0373933_0885142_136_438 | 100 |
| 427 | 3300042435 | Ga0439434_0178087 | Ga0439434_0178087_45_356 | 100 |
| 428 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_41636_41938 | 100 |
| 429 | 3300042876 | Ga0451577_0461331 | Ga0451577_0461331_471_773 | 100 |
| 430 | 3300047317 | Ga0495604_0369152 | Ga0495604_0369152_344_652 | 100 |
| 431 | 3300049572 | Ga0501036_1349747 | Ga0501036_1349747_225_533 | 100 |
| 432 | 3300049576 | Ga0501040_0157057 | Ga0501040_0157057_994_1302 | 100 |
| 433 | 3300049583 | Ga0501067_0098438 | Ga0501067_0098438_183_485 | 100 |
| 434 | 3300049585 | Ga0501069_0568409 | Ga0501069_0568409_71_373 | 100 |
| 435 | 3300049587 | Ga0501071_0774729 | Ga0501071_0774729_283_591 | 100 |
| 436 | 3300049590 | Ga0501074_0503048 | Ga0501074_0503048_223_531 | 100 |
| 437 | 3300049592 | Ga0501076_0480822 | Ga0501076_0480822_140_448 | 100 |
| 438 | 3300049742 | Ga0501080_0274379 | Ga0501080_0274379_107_415 | 100 |
| 439 | 3300049743 | Ga0501081_0097965 | Ga0501081_0097965_1546_1854 | 100 |
| 440 | 3300054114 | Ga0501084_0046520 | Ga0501084_0046520_2599_2907 | 100 |
| 441 | 3300060353 | Ga0501082_0259257 | Ga0501082_0259257_418_726 | 100 |
| 442 | 3300060353 | Ga0501082_0851237 | Ga0501082_0851237_223_525 | 100 |
| 443 | 3300061734 | Ga0530510_0331631 | Ga0530510_0331631_170_478 | 100 |
| 444 | 3300061734 | Ga0530510_0926384 | Ga0530510_0926384_282_590 | 100 |
| 445 | 3300004799 | Ga0058863_11573035 | Ga0058863_115730351 | 101 |
| 446 | 3300004801 | Ga0058860_11567160 | Ga0058860_115671601 | 101 |
| 447 | 3300004803 | Ga0058862_10000625 | Ga0058862_100006251 | 101 |
| 448 | 3300004803 | Ga0058862_12811975 | Ga0058862_128119751 | 101 |
| 449 | 3300005295 | Ga0065707_10031412 | Ga0065707_100314122 | 101 |
| 450 | 3300005327 | Ga0070658_10951538 | Ga0070658_109515382 | 101 |
| 451 | 3300005336 | Ga0070680_100004792 | Ga0070680_1000047924 | 101 |
| 452 | 3300005337 | Ga0070682_100469768 | Ga0070682_1004697682 | 101 |
| 453 | 3300005339 | Ga0070660_100605271 | Ga0070660_1006052712 | 101 |
| 454 | 3300005344 | Ga0070661_100064642 | Ga0070661_1000646422 | 101 |
| 455 | 3300005366 | Ga0070659_100287795 | Ga0070659_1002877951 | 101 |
| 456 | 3300005434 | Ga0070709_10307781 | Ga0070709_103077812 | 101 |
| 457 | 3300005434 | Ga0070709_11464173 | Ga0070709_114641732 | 101 |
| 458 | 3300005435 | Ga0070714_100012646 | Ga0070714_1000126462 | 101 |
| 459 | 3300005435 | Ga0070714_100962981 | Ga0070714_1009629812 | 101 |
| 460 | 3300005436 | Ga0070713_100351522 | Ga0070713_1003515222 | 101 |
| 461 | 3300005455 | Ga0070663_100450178 | Ga0070663_1004501782 | 101 |
| 462 | 3300005458 | Ga0070681_10102285 | Ga0070681_101022852 | 101 |
| 463 | 3300005467 | Ga0070706_100536274 | Ga0070706_1005362742 | 101 |
| 464 | 3300005530 | Ga0070679_100036806 | Ga0070679_1000368064 | 101 |
| 465 | 3300005536 | Ga0070697_100296028 | Ga0070697_1002960282 | 101 |
| 466 | 3300005539 | Ga0068853_100008476 | Ga0068853_1000084765 | 101 |
| 467 | 3300005539 | Ga0068853_101917283 | Ga0068853_1019172832 | 101 |
| 468 | 3300005547 | Ga0070693_101449685 | Ga0070693_1014496851 | 101 |
| 469 | 3300005563 | Ga0068855_100081814 | Ga0068855_1000818143 | 101 |
| 470 | 3300005578 | Ga0068854_100131928 | Ga0068854_1001319281 | 101 |
| 471 | 3300005616 | Ga0068852_100005278 | Ga0068852_1000052785 | 101 |
| 472 | 3300006844 | Ga0075428_100835125 | Ga0075428_1008351252 | 101 |
| 473 | 3300006846 | Ga0075430_100929367 | Ga0075430_1009293671 | 101 |
| 474 | 3300006847 | Ga0075431_100591123 | Ga0075431_1005911232 | 101 |
| 475 | 3300006852 | Ga0075433_10409775 | Ga0075433_104097753 | 101 |
| 476 | 3300006871 | Ga0075434_101129355 | Ga0075434_1011293552 | 101 |
| 477 | 3300006914 | Ga0075436_100990790 | Ga0075436_1009907902 | 101 |
| 478 | 3300007076 | Ga0075435_101211370 | Ga0075435_1012113701 | 101 |
| 479 | 3300009093 | Ga0105240_10747923 | Ga0105240_107479231 | 101 |
| 480 | 3300009094 | Ga0111539_10433129 | Ga0111539_104331292 | 101 |
| 481 | 3300009147 | Ga0114129_10393376 | Ga0114129_103933761 | 101 |
| 482 | 3300009147 | Ga0114129_10507958 | Ga0114129_105079582 | 101 |
| 483 | 3300009147 | Ga0114129_10968006 | Ga0114129_109680062 | 101 |
| 484 | 3300009174 | Ga0105241_10717181 | Ga0105241_107171811 | 101 |
| 485 | 3300009551 | Ga0105238_10321897 | Ga0105238_103218972 | 101 |
| 486 | 3300009551 | Ga0105238_11734694 | Ga0105238_117346942 | 101 |
| 487 | 3300013100 | Ga0157373_10223200 | Ga0157373_102232002 | 101 |
| 488 | 3300013104 | Ga0157370_10044459 | Ga0157370_100444594 | 101 |
| 489 | 3300013307 | Ga0157372_10227076 | Ga0157372_102270762 | 101 |
| 490 | 3300013307 | Ga0157372_10453519 | Ga0157372_104535192 | 101 |
| 491 | 3300014326 | Ga0157380_10881154 | Ga0157380_108811542 | 101 |
| 492 | 3300020077 | Ga0206351_10347809 | Ga0206351_103478091 | 101 |
| 493 | 3300020610 | Ga0154015_1166432 | Ga0154015_11664321 | 101 |
| 494 | 3300025885 | Ga0207653_10427838 | Ga0207653_104278381 | 101 |
| 495 | 3300025909 | Ga0207705_10972144 | Ga0207705_109721441 | 101 |
| 496 | 3300025911 | Ga0207654_10715486 | Ga0207654_107154861 | 101 |
| 497 | 3300025912 | Ga0207707_10070111 | Ga0207707_100701113 | 101 |
| 498 | 3300025913 | Ga0207695_10301987 | Ga0207695_103019872 | 101 |
| 499 | 3300025917 | Ga0207660_10530818 | Ga0207660_105308182 | 101 |
| 500 | 3300025919 | Ga0207657_10619799 | Ga0207657_106197992 | 101 |
| 501 | 3300025920 | Ga0207649_10477255 | Ga0207649_104772551 | 101 |
| 502 | 3300025921 | Ga0207652_10045176 | Ga0207652_100451762 | 101 |
| 503 | 3300025924 | Ga0207694_10009441 | Ga0207694_100094414 | 101 |
| 504 | 3300025929 | Ga0207664_10094655 | Ga0207664_100946553 | 101 |
| 505 | 3300025933 | Ga0207706_11100982 | Ga0207706_111009822 | 101 |
| 506 | 3300025939 | Ga0207665_10880324 | Ga0207665_108803241 | 101 |
| 507 | 3300025949 | Ga0207667_10029258 | Ga0207667_100292587 | 101 |
| 508 | 3300025981 | Ga0207640_10043092 | Ga0207640_100430921 | 101 |
| 509 | 3300026041 | Ga0207639_10005399 | Ga0207639_100053998 | 101 |
| 510 | 3300026067 | Ga0207678_10272137 | Ga0207678_102721372 | 101 |
| 511 | 3300026078 | Ga0207702_10024571 | Ga0207702_100245717 | 101 |
| 512 | 3300026142 | Ga0207698_10005024 | Ga0207698_100050246 | 101 |
| 513 | 3300027907 | Ga0207428_10453432 | Ga0207428_104534321 | 101 |
| 514 | 3300031824 | Ga0307413_10218377 | Ga0307413_102183772 | 101 |
| 515 | 3300031852 | Ga0307410_10065573 | Ga0307410_100655732 | 101 |
| 516 | 3300031903 | Ga0307407_10442645 | Ga0307407_104426451 | 101 |
| 517 | 3300031995 | Ga0307409_100044098 | Ga0307409_1000440984 | 101 |
| 518 | 3300032002 | Ga0307416_100886965 | Ga0307416_1008869652 | 101 |
| 519 | 3300032002 | Ga0307416_103589622 | Ga0307416_1035896222 | 101 |
| 520 | 3300032005 | Ga0307411_10034864 | Ga0307411_100348644 | 101 |
| 521 | 3300041411 | Ga0439466_0079827 | Ga0439466_0079827_665_976 | 101 |
| 522 | 3300042003 | Ga0439443_091325 | Ga0439443_091325_232_549 | 101 |
| 523 | 3300042435 | Ga0439434_0057754 | Ga0439434_0057754_549_860 | 101 |
| 524 | 3300046491 | Ga0495584_0401090 | Ga0495584_0401090_373_684 | 101 |
| 525 | 3300049571 | Ga0501034_1200893 | Ga0501034_1200893_305_616 | 101 |
| 526 | 3300049572 | Ga0501036_0301206 | Ga0501036_0301206_358_669 | 101 |
| 527 | 3300049572 | Ga0501036_0715550 | Ga0501036_0715550_194_505 | 101 |
| 528 | 3300049572 | Ga0501036_1695644 | Ga0501036_1695644_69_380 | 101 |
| 529 | 3300049573 | Ga0501037_0442789 | Ga0501037_0442789_116_445 | 101 |
| 530 | 3300049574 | Ga0501038_0699477 | Ga0501038_0699477_239_568 | 101 |
| 531 | 3300049575 | Ga0501039_0299904 | Ga0501039_0299904_209_538 | 101 |
| 532 | 3300049576 | Ga0501040_0049193 | Ga0501040_0049193_879_1208 | 101 |
| 533 | 3300049577 | Ga0501041_0139617 | Ga0501041_0139617_695_1024 | 101 |
| 534 | 3300049578 | Ga0501042_1147443 | Ga0501042_1147443_167_478 | 101 |
| 535 | 3300049580 | Ga0501046_0045733 | Ga0501046_0045733_2603_2932 | 101 |
| 536 | 3300049582 | Ga0501048_0797553 | Ga0501048_0797553_324_635 | 101 |
| 537 | 3300049584 | Ga0501068_0498985 | Ga0501068_0498985_449_778 | 101 |
| 538 | 3300049587 | Ga0501071_0022608 | Ga0501071_0022608_225_554 | 101 |
| 539 | 3300049588 | Ga0501072_0065137 | Ga0501072_0065137_1059_1370 | 101 |
| 540 | 3300049588 | Ga0501072_0509073 | Ga0501072_0509073_109_420 | 101 |
| 541 | 3300049590 | Ga0501074_0129833 | Ga0501074_0129833_621_950 | 101 |
| 542 | 3300049591 | Ga0501075_0187165 | Ga0501075_0187165_156_485 | 101 |
| 543 | 3300049591 | Ga0501075_1296848 | Ga0501075_1296848_48_359 | 101 |
| 544 | 3300049592 | Ga0501076_0019885 | Ga0501076_0019885_3418_3729 | 101 |
| 545 | 3300049593 | Ga0501077_0110034 | Ga0501077_0110034_182_499 | 101 |
| 546 | 3300049668 | Ga0501233_171317 | Ga0501233_171317_35_352 | 101 |
| 547 | 3300049741 | Ga0501079_1026882 | Ga0501079_1026882_296_625 | 101 |
| 548 | 3300049742 | Ga0501080_0844723 | Ga0501080_0844723_213_542 | 101 |
| 549 | 3300049744 | Ga0501083_0270410 | Ga0501083_0270410_39_368 | 101 |
| 550 | 3300049823 | Ga0501044_0712922 | Ga0501044_0712922_501_830 | 101 |
| 551 | 3300049824 | Ga0501045_0607603 | Ga0501045_0607603_134_463 | 101 |
| 552 | 3300050507 | nmdc:mga05p37_160415_c1 | nmdc:mga05p37_160415_c1_146_460 | 101 |
| 553 | 3300050507 | nmdc:mga05p37_1626423_c1 | nmdc:mga05p37_1626423_c1_266_583 | 101 |
| 554 | 3300050507 | nmdc:mga05p37_728397_c1 | nmdc:mga05p37_728397_c1_637_948 | 101 |
| 555 | 3300050510 | nmdc:mga06r32_186107_c1 | nmdc:mga06r32_186107_c1_1285_1596 | 101 |
| 556 | 3300050511 | nmdc:mga08y16_114735_c1 | nmdc:mga08y16_114735_c1_1371_1682 | 101 |
| 557 | 3300050512 | nmdc:mga0n895_1917392_c1 | nmdc:mga0n895_1917392_c1_149_463 | 101 |
| 558 | 3300050513 | nmdc:mga0rr50_600645_c1 | nmdc:mga0rr50_600645_c1_449_763 | 101 |
| 559 | 3300050513 | nmdc:mga0rr50_741140_c1 | nmdc:mga0rr50_741140_c1_81_395 | 101 |
| 560 | 3300054114 | Ga0501084_0705931 | Ga0501084_0705931_331_660 | 101 |
| 561 | 3300059421 | Ga0590071_024241 | Ga0590071_024241_1068_1379 | 101 |
| 562 | 3300059423 | Ga0590074_010196 | Ga0590074_010196_207_518 | 101 |
| 563 | 3300059424 | Ga0590075_065515 | Ga0590075_065515_96_407 | 101 |
| 564 | 3300059426 | Ga0590077_013609 | Ga0590077_013609_1185_1496 | 101 |
| 565 | 3300060353 | Ga0501082_0073796 | Ga0501082_0073796_1699_2010 | 101 |
| 566 | 3300061734 | Ga0530510_0765706 | Ga0530510_0765706_133_462 | 101 |
| 567 | 3300001977 | JGI24746J21847_1017945 | JGI24746J21847_10179451 | 102 |
| 568 | 3300001989 | JGI24739J22299_10153085 | JGI24739J22299_101530852 | 102 |
| 569 | 3300001989 | JGI24739J22299_10173906 | JGI24739J22299_101739061 | 102 |
| 570 | 3300002067 | JGI24735J21928_10150096 | JGI24735J21928_101500962 | 102 |
| 571 | 3300002075 | JGI24738J21930_10113188 | JGI24738J21930_101131882 | 102 |
| 572 | 3300003323 | rootH1_10160366 | rootH1_101603662 | 102 |
| 573 | 3300003574 | Ga0007410J51695_1095721 | Ga0007410J51695_10957211 | 102 |
| 574 | 3300003575 | Ga0007409J51694_1061563 | Ga0007409J51694_10615631 | 102 |
| 575 | 3300003579 | Ga0007429J51699_1055138 | Ga0007429J51699_10551381 | 102 |
| 576 | 3300003693 | Ga0032354_1070555 | Ga0032354_10705551 | 102 |
| 577 | 3300004798 | Ga0058859_11723421 | Ga0058859_117234212 | 102 |
| 578 | 3300004800 | Ga0058861_11782770 | Ga0058861_117827701 | 102 |
| 579 | 3300004800 | Ga0058861_12050521 | Ga0058861_120505211 | 102 |
| 580 | 3300004801 | Ga0058860_12083350 | Ga0058860_120833501 | 102 |
| 581 | 3300004801 | Ga0058860_12124474 | Ga0058860_121244741 | 102 |
| 582 | 3300004803 | Ga0058862_12763569 | Ga0058862_127635692 | 102 |
| 583 | 3300005289 | Ga0065704_10501280 | Ga0065704_105012801 | 102 |
| 584 | 3300005290 | Ga0065712_10135028 | Ga0065712_101350281 | 102 |
| 585 | 3300005293 | Ga0065715_10029592 | Ga0065715_100295922 | 102 |
| 586 | 3300005293 | Ga0065715_10340438 | Ga0065715_103404382 | 102 |
| 587 | 3300005293 | Ga0065715_10879663 | Ga0065715_108796632 | 102 |
| 588 | 3300005293 | Ga0065715_11021616 | Ga0065715_110216161 | 102 |
| 589 | 3300005295 | Ga0065707_10362525 | Ga0065707_103625251 | 102 |
| 590 | 3300005295 | Ga0065707_11040338 | Ga0065707_110403381 | 102 |
| 591 | 3300005327 | Ga0070658_10124301 | Ga0070658_101243012 | 102 |
| 592 | 3300005328 | Ga0070676_10005779 | Ga0070676_100057794 | 102 |
| 593 | 3300005328 | Ga0070676_10017473 | Ga0070676_100174732 | 102 |
| 594 | 3300005328 | Ga0070676_10022558 | Ga0070676_100225582 | 102 |
| 595 | 3300005328 | Ga0070676_10064597 | Ga0070676_100645972 | 102 |
| 596 | 3300005328 | Ga0070676_10141119 | Ga0070676_101411192 | 102 |
| 597 | 3300005329 | Ga0070683_100001069 | Ga0070683_10000106923 | 102 |
| 598 | 3300005330 | Ga0070690_100054140 | Ga0070690_1000541403 | 102 |
| 599 | 3300005330 | Ga0070690_100410129 | Ga0070690_1004101292 | 102 |
| 600 | 3300005331 | Ga0070670_100438972 | Ga0070670_1004389722 | 102 |
| 601 | 3300005331 | Ga0070670_100497695 | Ga0070670_1004976951 | 102 |
| 602 | 3300005331 | Ga0070670_101831978 | Ga0070670_1018319782 | 102 |
| 603 | 3300005333 | Ga0070677_10213428 | Ga0070677_102134282 | 102 |
| 604 | 3300005333 | Ga0070677_10273013 | Ga0070677_102730132 | 102 |
| 605 | 3300005333 | Ga0070677_10371001 | Ga0070677_103710012 | 102 |
| 606 | 3300005334 | Ga0068869_100009804 | Ga0068869_1000098046 | 102 |
| 607 | 3300005334 | Ga0068869_100329731 | Ga0068869_1003297312 | 102 |
| 608 | 3300005334 | Ga0068869_100546191 | Ga0068869_1005461912 | 102 |
| 609 | 3300005335 | Ga0070666_10039792 | Ga0070666_100397922 | 102 |
| 610 | 3300005335 | Ga0070666_11459008 | Ga0070666_114590081 | 102 |
| 611 | 3300005336 | Ga0070680_100006737 | Ga0070680_1000067372 | 102 |
| 612 | 3300005336 | Ga0070680_100088267 | Ga0070680_1000882672 | 102 |
| 613 | 3300005336 | Ga0070680_100137496 | Ga0070680_1001374962 | 102 |
| 614 | 3300005336 | Ga0070680_100272285 | Ga0070680_1002722852 | 102 |
| 615 | 3300005336 | Ga0070680_100448545 | Ga0070680_1004485452 | 102 |
| 616 | 3300005336 | Ga0070680_100537067 | Ga0070680_1005370672 | 102 |
| 617 | 3300005336 | Ga0070680_100765095 | Ga0070680_1007650952 | 102 |
| 618 | 3300005336 | Ga0070680_101248983 | Ga0070680_1012489831 | 102 |
| 619 | 3300005336 | Ga0070680_101594546 | Ga0070680_1015945461 | 102 |
| 620 | 3300005337 | Ga0070682_100007747 | Ga0070682_1000077472 | 102 |
| 621 | 3300005337 | Ga0070682_100214328 | Ga0070682_1002143281 | 102 |
| 622 | 3300005337 | Ga0070682_100763886 | Ga0070682_1007638862 | 102 |
| 623 | 3300005337 | Ga0070682_101228404 | Ga0070682_1012284042 | 102 |
| 624 | 3300005338 | Ga0068868_100129570 | Ga0068868_1001295702 | 102 |
| 625 | 3300005338 | Ga0068868_100616415 | Ga0068868_1006164152 | 102 |
| 626 | 3300005338 | Ga0068868_100863010 | Ga0068868_1008630102 | 102 |
| 627 | 3300005339 | Ga0070660_100843691 | Ga0070660_1008436912 | 102 |
| 628 | 3300005340 | Ga0070689_100425244 | Ga0070689_1004252442 | 102 |
| 629 | 3300005340 | Ga0070689_100439515 | Ga0070689_1004395152 | 102 |
| 630 | 3300005341 | Ga0070691_10056788 | Ga0070691_100567882 | 102 |
| 631 | 3300005341 | Ga0070691_10504669 | Ga0070691_105046692 | 102 |
| 632 | 3300005341 | Ga0070691_10575289 | Ga0070691_105752891 | 102 |
| 633 | 3300005343 | Ga0070687_100045251 | Ga0070687_1000452512 | 102 |
| 634 | 3300005343 | Ga0070687_100065162 | Ga0070687_1000651622 | 102 |
| 635 | 3300005344 | Ga0070661_100276089 | Ga0070661_1002760892 | 102 |
| 636 | 3300005344 | Ga0070661_100521069 | Ga0070661_1005210691 | 102 |
| 637 | 3300005345 | Ga0070692_10446872 | Ga0070692_104468721 | 102 |
| 638 | 3300005345 | Ga0070692_10857641 | Ga0070692_108576412 | 102 |
| 639 | 3300005347 | Ga0070668_100047542 | Ga0070668_1000475422 | 102 |
| 640 | 3300005347 | Ga0070668_101828465 | Ga0070668_1018284652 | 102 |
| 641 | 3300005353 | Ga0070669_100003047 | Ga0070669_1000030474 | 102 |
| 642 | 3300005353 | Ga0070669_100062064 | Ga0070669_1000620642 | 102 |
| 643 | 3300005353 | Ga0070669_100147225 | Ga0070669_1001472252 | 102 |
| 644 | 3300005353 | Ga0070669_100234851 | Ga0070669_1002348512 | 102 |
| 645 | 3300005353 | Ga0070669_101758867 | Ga0070669_1017588672 | 102 |
| 646 | 3300005354 | Ga0070675_100010521 | Ga0070675_1000105217 | 102 |
| 647 | 3300005354 | Ga0070675_100119041 | Ga0070675_1001190411 | 102 |
| 648 | 3300005354 | Ga0070675_100143621 | Ga0070675_1001436212 | 102 |
| 649 | 3300005354 | Ga0070675_100333811 | Ga0070675_1003338112 | 102 |
| 650 | 3300005355 | Ga0070671_100005351 | Ga0070671_10000535110 | 102 |
| 651 | 3300005355 | Ga0070671_100111032 | Ga0070671_1001110322 | 102 |
| 652 | 3300005355 | Ga0070671_100630053 | Ga0070671_1006300532 | 102 |
| 653 | 3300005355 | Ga0070671_100631672 | Ga0070671_1006316721 | 102 |
| 654 | 3300005355 | Ga0070671_101469942 | Ga0070671_1014699421 | 102 |
| 655 | 3300005356 | Ga0070674_100001645 | Ga0070674_10000164512 | 102 |
| 656 | 3300005356 | Ga0070674_100206660 | Ga0070674_1002066602 | 102 |
| 657 | 3300005356 | Ga0070674_101633682 | Ga0070674_1016336821 | 102 |
| 658 | 3300005364 | Ga0070673_100065427 | Ga0070673_1000654272 | 102 |
| 659 | 3300005364 | Ga0070673_100198810 | Ga0070673_1001988102 | 102 |
| 660 | 3300005365 | Ga0070688_100116415 | Ga0070688_1001164152 | 102 |
| 661 | 3300005366 | Ga0070659_100024636 | Ga0070659_1000246362 | 102 |
| 662 | 3300005366 | Ga0070659_100101267 | Ga0070659_1001012671 | 102 |
| 663 | 3300005366 | Ga0070659_100617920 | Ga0070659_1006179202 | 102 |
| 664 | 3300005367 | Ga0070667_100033201 | Ga0070667_1000332012 | 102 |
| 665 | 3300005367 | Ga0070667_100468174 | Ga0070667_1004681742 | 102 |
| 666 | 3300005367 | Ga0070667_101486696 | Ga0070667_1014866961 | 102 |
| 667 | 3300005434 | Ga0070709_10010524 | Ga0070709_100105244 | 102 |
| 668 | 3300005436 | Ga0070713_100069801 | Ga0070713_1000698012 | 102 |
| 669 | 3300005436 | Ga0070713_100498520 | Ga0070713_1004985201 | 102 |
| 670 | 3300005437 | Ga0070710_10039481 | Ga0070710_100394813 | 102 |
| 671 | 3300005437 | Ga0070710_11084603 | Ga0070710_110846031 | 102 |
| 672 | 3300005438 | Ga0070701_10362308 | Ga0070701_103623081 | 102 |
| 673 | 3300005439 | Ga0070711_100372464 | Ga0070711_1003724642 | 102 |
| 674 | 3300005440 | Ga0070705_100004513 | Ga0070705_1000045132 | 102 |
| 675 | 3300005440 | Ga0070705_100046854 | Ga0070705_1000468542 | 102 |
| 676 | 3300005440 | Ga0070705_100217229 | Ga0070705_1002172293 | 102 |
| 677 | 3300005440 | Ga0070705_100663556 | Ga0070705_1006635562 | 102 |
| 678 | 3300005440 | Ga0070705_101717346 | Ga0070705_1017173461 | 102 |
| 679 | 3300005441 | Ga0070700_100484401 | Ga0070700_1004844011 | 102 |
| 680 | 3300005444 | Ga0070694_100065463 | Ga0070694_1000654632 | 102 |
| 681 | 3300005444 | Ga0070694_100218981 | Ga0070694_1002189812 | 102 |
| 682 | 3300005444 | Ga0070694_100259424 | Ga0070694_1002594242 | 102 |
| 683 | 3300005444 | Ga0070694_101208692 | Ga0070694_1012086921 | 102 |
| 684 | 3300005444 | Ga0070694_101942568 | Ga0070694_1019425681 | 102 |
| 685 | 3300005445 | Ga0070708_100000480 | Ga0070708_10000048013 | 102 |
| 686 | 3300005445 | Ga0070708_100086499 | Ga0070708_1000864992 | 102 |
| 687 | 3300005445 | Ga0070708_100176264 | Ga0070708_1001762642 | 102 |
| 688 | 3300005445 | Ga0070708_100224161 | Ga0070708_1002241612 | 102 |
| 689 | 3300005445 | Ga0070708_100252627 | Ga0070708_1002526273 | 102 |
| 690 | 3300005445 | Ga0070708_100404918 | Ga0070708_1004049182 | 102 |
| 691 | 3300005445 | Ga0070708_100847685 | Ga0070708_1008476852 | 102 |
| 692 | 3300005445 | Ga0070708_101283457 | Ga0070708_1012834571 | 102 |
| 693 | 3300005455 | Ga0070663_100857926 | Ga0070663_1008579261 | 102 |
| 694 | 3300005455 | Ga0070663_101202298 | Ga0070663_1012022981 | 102 |
| 695 | 3300005455 | Ga0070663_101204184 | Ga0070663_1012041841 | 102 |
| 696 | 3300005456 | Ga0070678_100002017 | Ga0070678_1000020178 | 102 |
| 697 | 3300005456 | Ga0070678_100132020 | Ga0070678_1001320202 | 102 |
| 698 | 3300005457 | Ga0070662_100001156 | Ga0070662_10000115613 | 102 |
| 699 | 3300005457 | Ga0070662_100160783 | Ga0070662_1001607831 | 102 |
| 700 | 3300005457 | Ga0070662_101214325 | Ga0070662_1012143251 | 102 |
| 701 | 3300005457 | Ga0070662_101316449 | Ga0070662_1013164491 | 102 |
| 702 | 3300005458 | Ga0070681_10006976 | Ga0070681_1000697610 | 102 |
| 703 | 3300005458 | Ga0070681_10085276 | Ga0070681_100852762 | 102 |
| 704 | 3300005458 | Ga0070681_10380842 | Ga0070681_103808422 | 102 |
| 705 | 3300005458 | Ga0070681_10491091 | Ga0070681_104910911 | 102 |
| 706 | 3300005458 | Ga0070681_10500030 | Ga0070681_105000302 | 102 |
| 707 | 3300005459 | Ga0068867_100000759 | Ga0068867_1000007598 | 102 |
| 708 | 3300005459 | Ga0068867_100056644 | Ga0068867_1000566442 | 102 |
| 709 | 3300005459 | Ga0068867_100411982 | Ga0068867_1004119822 | 102 |
| 710 | 3300005466 | Ga0070685_10033417 | Ga0070685_100334172 | 102 |
| 711 | 3300005467 | Ga0070706_100129191 | Ga0070706_1001291912 | 102 |
| 712 | 3300005467 | Ga0070706_100163214 | Ga0070706_1001632144 | 102 |
| 713 | 3300005467 | Ga0070706_100212481 | Ga0070706_1002124811 | 102 |
| 714 | 3300005467 | Ga0070706_100448273 | Ga0070706_1004482731 | 102 |
| 715 | 3300005468 | Ga0070707_100000409 | Ga0070707_10000040914 | 102 |
| 716 | 3300005468 | Ga0070707_100023799 | Ga0070707_1000237995 | 102 |
| 717 | 3300005468 | Ga0070707_100033031 | Ga0070707_1000330312 | 102 |
| 718 | 3300005468 | Ga0070707_100172977 | Ga0070707_1001729772 | 102 |
| 719 | 3300005468 | Ga0070707_100256290 | Ga0070707_1002562902 | 102 |
| 720 | 3300005468 | Ga0070707_100292565 | Ga0070707_1002925654 | 102 |
| 721 | 3300005468 | Ga0070707_100314329 | Ga0070707_1003143293 | 102 |
| 722 | 3300005471 | Ga0070698_100020032 | Ga0070698_1000200324 | 102 |
| 723 | 3300005471 | Ga0070698_100101549 | Ga0070698_1001015492 | 102 |
| 724 | 3300005471 | Ga0070698_100510801 | Ga0070698_1005108011 | 102 |
| 725 | 3300005471 | Ga0070698_100743688 | Ga0070698_1007436882 | 102 |
| 726 | 3300005471 | Ga0070698_101256764 | Ga0070698_1012567641 | 102 |
| 727 | 3300005471 | Ga0070698_101440831 | Ga0070698_1014408311 | 102 |
| 728 | 3300005518 | Ga0070699_100000092 | Ga0070699_1000000922 | 102 |
| 729 | 3300005518 | Ga0070699_100005907 | Ga0070699_1000059072 | 102 |
| 730 | 3300005518 | Ga0070699_100066677 | Ga0070699_1000666772 | 102 |
| 731 | 3300005518 | Ga0070699_100242105 | Ga0070699_1002421052 | 102 |
| 732 | 3300005518 | Ga0070699_100262589 | Ga0070699_1002625892 | 102 |
| 733 | 3300005518 | Ga0070699_100285581 | Ga0070699_1002855812 | 102 |
| 734 | 3300005518 | Ga0070699_100505206 | Ga0070699_1005052061 | 102 |
| 735 | 3300005518 | Ga0070699_100628596 | Ga0070699_1006285961 | 102 |
| 736 | 3300005518 | Ga0070699_100898119 | Ga0070699_1008981191 | 102 |
| 737 | 3300005518 | Ga0070699_101100650 | Ga0070699_1011006501 | 102 |
| 738 | 3300005518 | Ga0070699_101104301 | Ga0070699_1011043012 | 102 |
| 739 | 3300005518 | Ga0070699_101912559 | Ga0070699_1019125592 | 102 |
| 740 | 3300005518 | Ga0070699_102180378 | Ga0070699_1021803781 | 102 |
| 741 | 3300005530 | Ga0070679_100012235 | Ga0070679_1000122358 | 102 |
| 742 | 3300005530 | Ga0070679_100024190 | Ga0070679_1000241902 | 102 |
| 743 | 3300005530 | Ga0070679_100142459 | Ga0070679_1001424594 | 102 |
| 744 | 3300005530 | Ga0070679_100193864 | Ga0070679_1001938643 | 102 |
| 745 | 3300005530 | Ga0070679_100627738 | Ga0070679_1006277381 | 102 |
| 746 | 3300005530 | Ga0070679_101090511 | Ga0070679_1010905112 | 102 |
| 747 | 3300005530 | Ga0070679_101197442 | Ga0070679_1011974422 | 102 |
| 748 | 3300005535 | Ga0070684_100000326 | Ga0070684_1000003266 | 102 |
| 749 | 3300005535 | Ga0070684_100013532 | Ga0070684_1000135322 | 102 |
| 750 | 3300005535 | Ga0070684_100105047 | Ga0070684_1001050472 | 102 |
| 751 | 3300005535 | Ga0070684_100417840 | Ga0070684_1004178402 | 102 |
| 752 | 3300005535 | Ga0070684_101280834 | Ga0070684_1012808341 | 102 |
| 753 | 3300005536 | Ga0070697_100005779 | Ga0070697_1000057794 | 102 |
| 754 | 3300005536 | Ga0070697_100044318 | Ga0070697_1000443185 | 102 |
| 755 | 3300005536 | Ga0070697_100083526 | Ga0070697_1000835262 | 102 |
| 756 | 3300005536 | Ga0070697_100093526 | Ga0070697_1000935262 | 102 |
| 757 | 3300005536 | Ga0070697_100195298 | Ga0070697_1001952982 | 102 |
| 758 | 3300005536 | Ga0070697_100219566 | Ga0070697_1002195663 | 102 |
| 759 | 3300005536 | Ga0070697_100297776 | Ga0070697_1002977762 | 102 |
| 760 | 3300005536 | Ga0070697_100501203 | Ga0070697_1005012032 | 102 |
| 761 | 3300005539 | Ga0068853_100238338 | Ga0068853_1002383382 | 102 |
| 762 | 3300005539 | Ga0068853_101092882 | Ga0068853_1010928822 | 102 |
| 763 | 3300005539 | Ga0068853_102327201 | Ga0068853_1023272011 | 102 |
| 764 | 3300005539 | Ga0068853_102474451 | Ga0068853_1024744511 | 102 |
| 765 | 3300005543 | Ga0070672_100241186 | Ga0070672_1002411862 | 102 |
| 766 | 3300005543 | Ga0070672_101386323 | Ga0070672_1013863232 | 102 |
| 767 | 3300005543 | Ga0070672_101462454 | Ga0070672_1014624542 | 102 |
| 768 | 3300005543 | Ga0070672_101666467 | Ga0070672_1016664671 | 102 |
| 769 | 3300005544 | Ga0070686_100160677 | Ga0070686_1001606772 | 102 |
| 770 | 3300005544 | Ga0070686_100300936 | Ga0070686_1003009362 | 102 |
| 771 | 3300005544 | Ga0070686_100730023 | Ga0070686_1007300231 | 102 |
| 772 | 3300005545 | Ga0070695_100046229 | Ga0070695_1000462293 | 102 |
| 773 | 3300005545 | Ga0070695_100095824 | Ga0070695_1000958242 | 102 |
| 774 | 3300005545 | Ga0070695_100312876 | Ga0070695_1003128762 | 102 |
| 775 | 3300005546 | Ga0070696_100003048 | Ga0070696_1000030482 | 102 |
| 776 | 3300005546 | Ga0070696_100013055 | Ga0070696_1000130557 | 102 |
| 777 | 3300005546 | Ga0070696_100064398 | Ga0070696_1000643982 | 102 |
| 778 | 3300005546 | Ga0070696_100370580 | Ga0070696_1003705802 | 102 |
| 779 | 3300005546 | Ga0070696_100453076 | Ga0070696_1004530762 | 102 |
| 780 | 3300005546 | Ga0070696_100990012 | Ga0070696_1009900121 | 102 |
| 781 | 3300005547 | Ga0070693_100015975 | Ga0070693_1000159754 | 102 |
| 782 | 3300005547 | Ga0070693_100303135 | Ga0070693_1003031352 | 102 |
| 783 | 3300005547 | Ga0070693_100319342 | Ga0070693_1003193422 | 102 |
| 784 | 3300005547 | Ga0070693_100506005 | Ga0070693_1005060052 | 102 |
| 785 | 3300005548 | Ga0070665_101528570 | Ga0070665_1015285702 | 102 |
| 786 | 3300005549 | Ga0070704_100056890 | Ga0070704_1000568902 | 102 |
| 787 | 3300005549 | Ga0070704_100116000 | Ga0070704_1001160001 | 102 |
| 788 | 3300005549 | Ga0070704_100431466 | Ga0070704_1004314661 | 102 |
| 789 | 3300005549 | Ga0070704_100486200 | Ga0070704_1004862002 | 102 |
| 790 | 3300005549 | Ga0070704_100833708 | Ga0070704_1008337082 | 102 |
| 791 | 3300005563 | Ga0068855_102163024 | Ga0068855_1021630241 | 102 |
| 792 | 3300005564 | Ga0070664_100004494 | Ga0070664_10000449410 | 102 |
| 793 | 3300005564 | Ga0070664_100132457 | Ga0070664_1001324572 | 102 |
| 794 | 3300005564 | Ga0070664_100136105 | Ga0070664_1001361052 | 102 |
| 795 | 3300005564 | Ga0070664_100245714 | Ga0070664_1002457142 | 102 |
| 796 | 3300005564 | Ga0070664_100245745 | Ga0070664_1002457452 | 102 |
| 797 | 3300005564 | Ga0070664_101254215 | Ga0070664_1012542152 | 102 |
| 798 | 3300005564 | Ga0070664_101275582 | Ga0070664_1012755822 | 102 |
| 799 | 3300005564 | Ga0070664_101426181 | Ga0070664_1014261812 | 102 |
| 800 | 3300005577 | Ga0068857_100007935 | Ga0068857_1000079352 | 102 |
| 801 | 3300005577 | Ga0068857_100032526 | Ga0068857_1000325266 | 102 |
| 802 | 3300005577 | Ga0068857_100648026 | Ga0068857_1006480262 | 102 |
| 803 | 3300005577 | Ga0068857_101523931 | Ga0068857_1015239311 | 102 |
| 804 | 3300005577 | Ga0068857_101757341 | Ga0068857_1017573412 | 102 |
| 805 | 3300005578 | Ga0068854_100003432 | Ga0068854_1000034325 | 102 |
| 806 | 3300005578 | Ga0068854_100170652 | Ga0068854_1001706522 | 102 |
| 807 | 3300005578 | Ga0068854_101962452 | Ga0068854_1019624521 | 102 |
| 808 | 3300005614 | Ga0068856_100738213 | Ga0068856_1007382132 | 102 |
| 809 | 3300005615 | Ga0070702_100118342 | Ga0070702_1001183422 | 102 |
| 810 | 3300005615 | Ga0070702_100228920 | Ga0070702_1002289201 | 102 |
| 811 | 3300005615 | Ga0070702_100626702 | Ga0070702_1006267021 | 102 |
| 812 | 3300005616 | Ga0068852_100376150 | Ga0068852_1003761502 | 102 |
| 813 | 3300005616 | Ga0068852_100927148 | Ga0068852_1009271482 | 102 |
| 814 | 3300005616 | Ga0068852_101050239 | Ga0068852_1010502392 | 102 |
| 815 | 3300005617 | Ga0068859_100629297 | Ga0068859_1006292972 | 102 |
| 816 | 3300005617 | Ga0068859_100937576 | Ga0068859_1009375762 | 102 |
| 817 | 3300005617 | Ga0068859_101283992 | Ga0068859_1012839922 | 102 |
| 818 | 3300005617 | Ga0068859_101764026 | Ga0068859_1017640261 | 102 |
| 819 | 3300005618 | Ga0068864_100512406 | Ga0068864_1005124062 | 102 |
| 820 | 3300005618 | Ga0068864_100513615 | Ga0068864_1005136152 | 102 |
| 821 | 3300005618 | Ga0068864_101031802 | Ga0068864_1010318022 | 102 |
| 822 | 3300005618 | Ga0068864_101054928 | Ga0068864_1010549282 | 102 |
| 823 | 3300005618 | Ga0068864_101877037 | Ga0068864_1018770371 | 102 |
| 824 | 3300005718 | Ga0068866_10000404 | Ga0068866_1000040413 | 102 |
| 825 | 3300005719 | Ga0068861_100176137 | Ga0068861_1001761372 | 102 |
| 826 | 3300005719 | Ga0068861_100198429 | Ga0068861_1001984293 | 102 |
| 827 | 3300005834 | Ga0068851_10021773 | Ga0068851_100217731 | 102 |
| 828 | 3300005840 | Ga0068870_10030395 | Ga0068870_100303953 | 102 |
| 829 | 3300005840 | Ga0068870_10866419 | Ga0068870_108664191 | 102 |
| 830 | 3300005841 | Ga0068863_100078093 | Ga0068863_1000780932 | 102 |
| 831 | 3300005841 | Ga0068863_100217663 | Ga0068863_1002176632 | 102 |
| 832 | 3300005841 | Ga0068863_100263845 | Ga0068863_1002638452 | 102 |
| 833 | 3300005841 | Ga0068863_101381658 | Ga0068863_1013816581 | 102 |
| 834 | 3300005841 | Ga0068863_102633411 | Ga0068863_1026334112 | 102 |
| 835 | 3300005842 | Ga0068858_100077874 | Ga0068858_1000778744 | 102 |
| 836 | 3300005842 | Ga0068858_100901461 | Ga0068858_1009014612 | 102 |
| 837 | 3300005842 | Ga0068858_101388984 | Ga0068858_1013889841 | 102 |
| 838 | 3300005843 | Ga0068860_100208880 | Ga0068860_1002088802 | 102 |
| 839 | 3300005843 | Ga0068860_100254541 | Ga0068860_1002545412 | 102 |
| 840 | 3300005843 | Ga0068860_100904091 | Ga0068860_1009040912 | 102 |
| 841 | 3300005843 | Ga0068860_101028444 | Ga0068860_1010284442 | 102 |
| 842 | 3300005843 | Ga0068860_101029457 | Ga0068860_1010294572 | 102 |
| 843 | 3300005843 | Ga0068860_101173858 | Ga0068860_1011738582 | 102 |
| 844 | 3300005844 | Ga0068862_100590872 | Ga0068862_1005908722 | 102 |
| 845 | 3300005844 | Ga0068862_101039616 | Ga0068862_1010396162 | 102 |
| 846 | 3300005844 | Ga0068862_101097672 | Ga0068862_1010976721 | 102 |
| 847 | 3300005844 | Ga0068862_101459169 | Ga0068862_1014591692 | 102 |
| 848 | 3300005844 | Ga0068862_101594291 | Ga0068862_1015942912 | 102 |
| 849 | 3300005844 | Ga0068862_101961398 | Ga0068862_1019613982 | 102 |
| 850 | 3300006058 | Ga0075432_10434716 | Ga0075432_104347161 | 102 |
| 851 | 3300006163 | Ga0070715_10065850 | Ga0070715_100658501 | 102 |
| 852 | 3300006163 | Ga0070715_10457432 | Ga0070715_104574322 | 102 |
| 853 | 3300006173 | Ga0070716_100004886 | Ga0070716_1000048863 | 102 |
| 854 | 3300006173 | Ga0070716_100171570 | Ga0070716_1001715703 | 102 |
| 855 | 3300006173 | Ga0070716_101690437 | Ga0070716_1016904371 | 102 |
| 856 | 3300006175 | Ga0070712_100436871 | Ga0070712_1004368711 | 102 |
| 857 | 3300006237 | Ga0097621_101281850 | Ga0097621_1012818502 | 102 |
| 858 | 3300006358 | Ga0068871_100375186 | Ga0068871_1003751862 | 102 |
| 859 | 3300006358 | Ga0068871_100391742 | Ga0068871_1003917422 | 102 |
| 860 | 3300006358 | Ga0068871_101463415 | Ga0068871_1014634151 | 102 |
| 861 | 3300006358 | Ga0068871_101608985 | Ga0068871_1016089851 | 102 |
| 862 | 3300006844 | Ga0075428_100446670 | Ga0075428_1004466701 | 102 |
| 863 | 3300006844 | Ga0075428_101479644 | Ga0075428_1014796442 | 102 |
| 864 | 3300006846 | Ga0075430_100715140 | Ga0075430_1007151402 | 102 |
| 865 | 3300006847 | Ga0075431_100136198 | Ga0075431_1001361982 | 102 |
| 866 | 3300006847 | Ga0075431_100147269 | Ga0075431_1001472693 | 102 |
| 867 | 3300006852 | Ga0075433_10468029 | Ga0075433_104680292 | 102 |
| 868 | 3300006871 | Ga0075434_100506556 | Ga0075434_1005065562 | 102 |
| 869 | 3300006871 | Ga0075434_100702695 | Ga0075434_1007026952 | 102 |
| 870 | 3300006880 | Ga0075429_101074736 | Ga0075429_1010747362 | 102 |
| 871 | 3300006881 | Ga0068865_100005654 | Ga0068865_1000056545 | 102 |
| 872 | 3300006881 | Ga0068865_100407770 | Ga0068865_1004077702 | 102 |
| 873 | 3300006914 | Ga0075436_100008314 | Ga0075436_1000083142 | 102 |
| 874 | 3300006914 | Ga0075436_100910751 | Ga0075436_1009107512 | 102 |
| 875 | 3300006914 | Ga0075436_100913257 | Ga0075436_1009132571 | 102 |
| 876 | 3300006931 | Ga0097620_100629275 | Ga0097620_1006292752 | 102 |
| 877 | 3300006931 | Ga0097620_100937552 | Ga0097620_1009375522 | 102 |
| 878 | 3300006931 | Ga0097620_101283884 | Ga0097620_1012838842 | 102 |
| 879 | 3300006931 | Ga0097620_101764035 | Ga0097620_1017640351 | 102 |
| 880 | 3300007076 | Ga0075435_100170485 | Ga0075435_1001704852 | 102 |
| 881 | 3300007076 | Ga0075435_101427843 | Ga0075435_1014278432 | 102 |
| 882 | 3300009093 | Ga0105240_10208118 | Ga0105240_102081183 | 102 |
| 883 | 3300009094 | Ga0111539_10567643 | Ga0111539_105676432 | 102 |
| 884 | 3300009094 | Ga0111539_10691486 | Ga0111539_106914862 | 102 |
| 885 | 3300009094 | Ga0111539_11315244 | Ga0111539_113152441 | 102 |
| 886 | 3300009098 | Ga0105245_10025517 | Ga0105245_100255176 | 102 |
| 887 | 3300009098 | Ga0105245_10161584 | Ga0105245_101615842 | 102 |
| 888 | 3300009101 | Ga0105247_10193790 | Ga0105247_101937902 | 102 |
| 889 | 3300009147 | Ga0114129_10331483 | Ga0114129_103314833 | 102 |
| 890 | 3300009147 | Ga0114129_11187811 | Ga0114129_111878111 | 102 |
| 891 | 3300009147 | Ga0114129_11409747 | Ga0114129_114097471 | 102 |
| 892 | 3300009147 | Ga0114129_11798651 | Ga0114129_117986512 | 102 |
| 893 | 3300009147 | Ga0114129_13403684 | Ga0114129_134036842 | 102 |
| 894 | 3300009148 | Ga0105243_10003111 | Ga0105243_1000311114 | 102 |
| 895 | 3300009148 | Ga0105243_10392916 | Ga0105243_103929162 | 102 |
| 896 | 3300009174 | Ga0105241_10009451 | Ga0105241_100094512 | 102 |
| 897 | 3300009174 | Ga0105241_10543631 | Ga0105241_105436312 | 102 |
| 898 | 3300009174 | Ga0105241_11800170 | Ga0105241_118001701 | 102 |
| 899 | 3300009176 | Ga0105242_10003345 | Ga0105242_100033455 | 102 |
| 900 | 3300009176 | Ga0105242_10023463 | Ga0105242_100234636 | 102 |
| 901 | 3300009176 | Ga0105242_10647666 | Ga0105242_106476662 | 102 |
| 902 | 3300009176 | Ga0105242_10667366 | Ga0105242_106673662 | 102 |
| 903 | 3300009176 | Ga0105242_11814616 | Ga0105242_118146162 | 102 |
| 904 | 3300009177 | Ga0105248_10026828 | Ga0105248_100268284 | 102 |
| 905 | 3300009177 | Ga0105248_10282138 | Ga0105248_102821383 | 102 |
| 906 | 3300009177 | Ga0105248_13432348 | Ga0105248_134323481 | 102 |
| 907 | 3300009545 | Ga0105237_11289889 | Ga0105237_112898892 | 102 |
| 908 | 3300009551 | Ga0105238_10275029 | Ga0105238_102750292 | 102 |
| 909 | 3300009551 | Ga0105238_10472384 | Ga0105238_104723842 | 102 |
| 910 | 3300009553 | Ga0105249_11024306 | Ga0105249_110243061 | 102 |
| 911 | 3300009553 | Ga0105249_11625372 | Ga0105249_116253722 | 102 |
| 912 | 3300009553 | Ga0105249_11918672 | Ga0105249_119186721 | 102 |
| 913 | 3300009553 | Ga0105249_12648435 | Ga0105249_126484351 | 102 |
| 914 | 3300010375 | Ga0105239_10005836 | Ga0105239_100058362 | 102 |
| 915 | 3300010375 | Ga0105239_10881783 | Ga0105239_108817832 | 102 |
| 916 | 3300011119 | Ga0105246_10262910 | Ga0105246_102629102 | 102 |
| 917 | 3300011119 | Ga0105246_10496521 | Ga0105246_104965212 | 102 |
| 918 | 3300012491 | Ga0157329_1024032 | Ga0157329_10240321 | 102 |
| 919 | 3300012498 | Ga0157345_1033817 | Ga0157345_10338171 | 102 |
| 920 | 3300012512 | Ga0157327_1006565 | Ga0157327_10065651 | 102 |
| 921 | 3300013100 | Ga0157373_10206900 | Ga0157373_102069002 | 102 |
| 922 | 3300013100 | Ga0157373_10522516 | Ga0157373_105225162 | 102 |
| 923 | 3300013100 | Ga0157373_11271784 | Ga0157373_112717841 | 102 |
| 924 | 3300013104 | Ga0157370_10815091 | Ga0157370_108150912 | 102 |
| 925 | 3300013296 | Ga0157374_10684999 | Ga0157374_106849992 | 102 |
| 926 | 3300013297 | Ga0157378_10000577 | Ga0157378_1000057715 | 102 |
| 927 | 3300013297 | Ga0157378_10162097 | Ga0157378_101620973 | 102 |
| 928 | 3300013297 | Ga0157378_11353924 | Ga0157378_113539241 | 102 |
| 929 | 3300013306 | Ga0163162_10429741 | Ga0163162_104297412 | 102 |
| 930 | 3300013306 | Ga0163162_10872426 | Ga0163162_108724262 | 102 |
| 931 | 3300013306 | Ga0163162_12717583 | Ga0163162_127175832 | 102 |
| 932 | 3300013307 | Ga0157372_10147504 | Ga0157372_101475042 | 102 |
| 933 | 3300013307 | Ga0157372_12513007 | Ga0157372_125130072 | 102 |
| 934 | 3300013308 | Ga0157375_10047633 | Ga0157375_100476334 | 102 |
| 935 | 3300013308 | Ga0157375_10733745 | Ga0157375_107337452 | 102 |
| 936 | 3300013308 | Ga0157375_11140263 | Ga0157375_111402631 | 102 |
| 937 | 3300013308 | Ga0157375_11230699 | Ga0157375_112306991 | 102 |
| 938 | 3300013308 | Ga0157375_12909552 | Ga0157375_129095521 | 102 |
| 939 | 3300014325 | Ga0163163_10117853 | Ga0163163_101178532 | 102 |
| 940 | 3300014326 | Ga0157380_10365752 | Ga0157380_103657521 | 102 |
| 941 | 3300014326 | Ga0157380_12539380 | Ga0157380_125393801 | 102 |
| 942 | 3300014745 | Ga0157377_10030601 | Ga0157377_100306014 | 102 |
| 943 | 3300014745 | Ga0157377_11012458 | Ga0157377_110124581 | 102 |
| 944 | 3300014745 | Ga0157377_11085084 | Ga0157377_110850842 | 102 |
| 945 | 3300014968 | Ga0157379_10275152 | Ga0157379_102751521 | 102 |
| 946 | 3300014968 | Ga0157379_11097937 | Ga0157379_110979371 | 102 |
| 947 | 3300014969 | Ga0157376_10396069 | Ga0157376_103960692 | 102 |
| 948 | 3300014969 | Ga0157376_12187452 | Ga0157376_121874521 | 102 |
| 949 | 3300017792 | Ga0163161_10078147 | Ga0163161_100781472 | 102 |
| 950 | 3300020077 | Ga0206351_10550909 | Ga0206351_105509091 | 102 |
| 951 | 3300020077 | Ga0206351_10662335 | Ga0206351_106623351 | 102 |
| 952 | 3300020078 | Ga0206352_11006934 | Ga0206352_110069341 | 102 |
| 953 | 3300020080 | Ga0206350_10009095 | Ga0206350_100090951 | 102 |
| 954 | 3300020080 | Ga0206350_11339704 | Ga0206350_113397041 | 102 |
| 955 | 3300020081 | Ga0206354_11041843 | Ga0206354_110418432 | 102 |
| 956 | 3300020082 | Ga0206353_10256562 | Ga0206353_102565621 | 102 |
| 957 | 3300020610 | Ga0154015_1563880 | Ga0154015_15638802 | 102 |
| 958 | 3300022467 | Ga0224712_10102578 | Ga0224712_101025781 | 102 |
| 959 | 3300025315 | Ga0207697_10018429 | Ga0207697_100184293 | 102 |
| 960 | 3300025315 | Ga0207697_10145258 | Ga0207697_101452582 | 102 |
| 961 | 3300025321 | Ga0207656_10104086 | Ga0207656_101040861 | 102 |
| 962 | 3300025893 | Ga0207682_10048598 | Ga0207682_100485982 | 102 |
| 963 | 3300025893 | Ga0207682_10055623 | Ga0207682_100556232 | 102 |
| 964 | 3300025893 | Ga0207682_10138248 | Ga0207682_101382482 | 102 |
| 965 | 3300025898 | Ga0207692_10161191 | Ga0207692_101611911 | 102 |
| 966 | 3300025899 | Ga0207642_10000405 | Ga0207642_1000040513 | 102 |
| 967 | 3300025901 | Ga0207688_10166726 | Ga0207688_101667261 | 102 |
| 968 | 3300025903 | Ga0207680_10032117 | Ga0207680_100321172 | 102 |
| 969 | 3300025904 | Ga0207647_10244479 | Ga0207647_102444792 | 102 |
| 970 | 3300025905 | Ga0207685_10403253 | Ga0207685_104032531 | 102 |
| 971 | 3300025906 | Ga0207699_10034084 | Ga0207699_100340842 | 102 |
| 972 | 3300025906 | Ga0207699_10319613 | Ga0207699_103196132 | 102 |
| 973 | 3300025907 | Ga0207645_10005407 | Ga0207645_100054077 | 102 |
| 974 | 3300025907 | Ga0207645_10017875 | Ga0207645_100178754 | 102 |
| 975 | 3300025907 | Ga0207645_10135011 | Ga0207645_101350112 | 102 |
| 976 | 3300025907 | Ga0207645_11055275 | Ga0207645_110552751 | 102 |
| 977 | 3300025908 | Ga0207643_10003848 | Ga0207643_100038488 | 102 |
| 978 | 3300025908 | Ga0207643_10413708 | Ga0207643_104137081 | 102 |
| 979 | 3300025908 | Ga0207643_11002474 | Ga0207643_110024741 | 102 |
| 980 | 3300025910 | Ga0207684_10059226 | Ga0207684_100592263 | 102 |
| 981 | 3300025910 | Ga0207684_10119427 | Ga0207684_101194274 | 102 |
| 982 | 3300025910 | Ga0207684_11272122 | Ga0207684_112721222 | 102 |
| 983 | 3300025911 | Ga0207654_10429889 | Ga0207654_104298891 | 102 |
| 984 | 3300025911 | Ga0207654_10527224 | Ga0207654_105272242 | 102 |
| 985 | 3300025912 | Ga0207707_10004691 | Ga0207707_1000469111 | 102 |
| 986 | 3300025912 | Ga0207707_10129960 | Ga0207707_101299602 | 102 |
| 987 | 3300025912 | Ga0207707_10267494 | Ga0207707_102674942 | 102 |
| 988 | 3300025912 | Ga0207707_10598707 | Ga0207707_105987072 | 102 |
| 989 | 3300025912 | Ga0207707_10775716 | Ga0207707_107757161 | 102 |
| 990 | 3300025913 | Ga0207695_10192700 | Ga0207695_101927002 | 102 |
| 991 | 3300025916 | Ga0207663_10066171 | Ga0207663_100661712 | 102 |
| 992 | 3300025916 | Ga0207663_10320756 | Ga0207663_103207562 | 102 |
| 993 | 3300025916 | Ga0207663_11244044 | Ga0207663_112440441 | 102 |
| 994 | 3300025917 | Ga0207660_10001699 | Ga0207660_100016998 | 102 |
| 995 | 3300025917 | Ga0207660_10120341 | Ga0207660_101203412 | 102 |
| 996 | 3300025917 | Ga0207660_10188180 | Ga0207660_101881802 | 102 |
| 997 | 3300025917 | Ga0207660_10200051 | Ga0207660_102000513 | 102 |
| 998 | 3300025917 | Ga0207660_10302396 | Ga0207660_103023963 | 102 |
| 999 | 3300025917 | Ga0207660_10840584 | Ga0207660_108405842 | 102 |
| 1000 | 3300025917 | Ga0207660_10990615 | Ga0207660_109906152 | 102 |
| 1001 | 3300025918 | Ga0207662_10002838 | Ga0207662_100028388 | 102 |
| 1002 | 3300025918 | Ga0207662_10145691 | Ga0207662_101456912 | 102 |
| 1003 | 3300025919 | Ga0207657_10251232 | Ga0207657_102512322 | 102 |
| 1004 | 3300025920 | Ga0207649_10123547 | Ga0207649_101235472 | 102 |
| 1005 | 3300025920 | Ga0207649_10363850 | Ga0207649_103638502 | 102 |
| 1006 | 3300025920 | Ga0207649_10748592 | Ga0207649_107485922 | 102 |
| 1007 | 3300025920 | Ga0207649_11479492 | Ga0207649_114794921 | 102 |
| 1008 | 3300025921 | Ga0207652_10010917 | Ga0207652_100109177 | 102 |
| 1009 | 3300025921 | Ga0207652_10139310 | Ga0207652_101393102 | 102 |
| 1010 | 3300025921 | Ga0207652_10196417 | Ga0207652_101964172 | 102 |
| 1011 | 3300025921 | Ga0207652_10295615 | Ga0207652_102956152 | 102 |
| 1012 | 3300025921 | Ga0207652_10433045 | Ga0207652_104330452 | 102 |
| 1013 | 3300025921 | Ga0207652_10652349 | Ga0207652_106523492 | 102 |
| 1014 | 3300025921 | Ga0207652_10673396 | Ga0207652_106733961 | 102 |
| 1015 | 3300025922 | Ga0207646_10001673 | Ga0207646_1000167324 | 102 |
| 1016 | 3300025922 | Ga0207646_10033666 | Ga0207646_100336665 | 102 |
| 1017 | 3300025922 | Ga0207646_10168228 | Ga0207646_101682282 | 102 |
| 1018 | 3300025922 | Ga0207646_10419294 | Ga0207646_104192941 | 102 |
| 1019 | 3300025922 | Ga0207646_10573772 | Ga0207646_105737722 | 102 |
| 1020 | 3300025922 | Ga0207646_10863831 | Ga0207646_108638312 | 102 |
| 1021 | 3300025923 | Ga0207681_10002648 | Ga0207681_100026482 | 102 |
| 1022 | 3300025923 | Ga0207681_10273253 | Ga0207681_102732532 | 102 |
| 1023 | 3300025924 | Ga0207694_10552811 | Ga0207694_105528112 | 102 |
| 1024 | 3300025924 | Ga0207694_10719173 | Ga0207694_107191731 | 102 |
| 1025 | 3300025925 | Ga0207650_10053915 | Ga0207650_100539153 | 102 |
| 1026 | 3300025926 | Ga0207659_10000902 | Ga0207659_1000090211 | 102 |
| 1027 | 3300025926 | Ga0207659_10091679 | Ga0207659_100916792 | 102 |
| 1028 | 3300025926 | Ga0207659_10384418 | Ga0207659_103844181 | 102 |
| 1029 | 3300025926 | Ga0207659_11595348 | Ga0207659_115953482 | 102 |
| 1030 | 3300025927 | Ga0207687_10109312 | Ga0207687_101093122 | 102 |
| 1031 | 3300025927 | Ga0207687_10175767 | Ga0207687_101757672 | 102 |
| 1032 | 3300025927 | Ga0207687_10196971 | Ga0207687_101969712 | 102 |
| 1033 | 3300025928 | Ga0207700_10356570 | Ga0207700_103565702 | 102 |
| 1034 | 3300025929 | Ga0207664_10051400 | Ga0207664_100514004 | 102 |
| 1035 | 3300025931 | Ga0207644_10007504 | Ga0207644_100075047 | 102 |
| 1036 | 3300025931 | Ga0207644_10088997 | Ga0207644_100889972 | 102 |
| 1037 | 3300025931 | Ga0207644_10276806 | Ga0207644_102768062 | 102 |
| 1038 | 3300025932 | Ga0207690_10136294 | Ga0207690_101362944 | 102 |
| 1039 | 3300025932 | Ga0207690_10189337 | Ga0207690_101893372 | 102 |
| 1040 | 3300025932 | Ga0207690_11409742 | Ga0207690_114097422 | 102 |
| 1041 | 3300025933 | Ga0207706_10000105 | Ga0207706_1000010543 | 102 |
| 1042 | 3300025933 | Ga0207706_10076892 | Ga0207706_100768924 | 102 |
| 1043 | 3300025933 | Ga0207706_10089932 | Ga0207706_100899322 | 102 |
| 1044 | 3300025933 | Ga0207706_10899012 | Ga0207706_108990122 | 102 |
| 1045 | 3300025934 | Ga0207686_10000323 | Ga0207686_1000032312 | 102 |
| 1046 | 3300025934 | Ga0207686_10497711 | Ga0207686_104977112 | 102 |
| 1047 | 3300025934 | Ga0207686_11109485 | Ga0207686_111094851 | 102 |
| 1048 | 3300025935 | Ga0207709_10001805 | Ga0207709_1000180514 | 102 |
| 1049 | 3300025935 | Ga0207709_10191320 | Ga0207709_101913201 | 102 |
| 1050 | 3300025936 | Ga0207670_10009329 | Ga0207670_100093293 | 102 |
| 1051 | 3300025936 | Ga0207670_10999456 | Ga0207670_109994562 | 102 |
| 1052 | 3300025937 | Ga0207669_10012485 | Ga0207669_100124852 | 102 |
| 1053 | 3300025937 | Ga0207669_10297958 | Ga0207669_102979582 | 102 |
| 1054 | 3300025937 | Ga0207669_11399657 | Ga0207669_113996572 | 102 |
| 1055 | 3300025939 | Ga0207665_10000486 | Ga0207665_100004865 | 102 |
| 1056 | 3300025940 | Ga0207691_10887326 | Ga0207691_108873262 | 102 |
| 1057 | 3300025940 | Ga0207691_11191058 | Ga0207691_111910582 | 102 |
| 1058 | 3300025940 | Ga0207691_11247499 | Ga0207691_112474991 | 102 |
| 1059 | 3300025941 | Ga0207711_10009631 | Ga0207711_100096314 | 102 |
| 1060 | 3300025941 | Ga0207711_10617721 | Ga0207711_106177212 | 102 |
| 1061 | 3300025941 | Ga0207711_10870341 | Ga0207711_108703411 | 102 |
| 1062 | 3300025942 | Ga0207689_10018455 | Ga0207689_100184552 | 102 |
| 1063 | 3300025942 | Ga0207689_10511255 | Ga0207689_105112552 | 102 |
| 1064 | 3300025942 | Ga0207689_11040244 | Ga0207689_110402441 | 102 |
| 1065 | 3300025942 | Ga0207689_11431291 | Ga0207689_114312912 | 102 |
| 1066 | 3300025944 | Ga0207661_10006266 | Ga0207661_100062668 | 102 |
| 1067 | 3300025944 | Ga0207661_10107789 | Ga0207661_101077892 | 102 |
| 1068 | 3300025944 | Ga0207661_10380586 | Ga0207661_103805861 | 102 |
| 1069 | 3300025945 | Ga0207679_10010117 | Ga0207679_100101172 | 102 |
| 1070 | 3300025945 | Ga0207679_10193448 | Ga0207679_101934482 | 102 |
| 1071 | 3300025945 | Ga0207679_10543840 | Ga0207679_105438402 | 102 |
| 1072 | 3300025945 | Ga0207679_11014810 | Ga0207679_110148102 | 102 |
| 1073 | 3300025945 | Ga0207679_11481074 | Ga0207679_114810741 | 102 |
| 1074 | 3300025945 | Ga0207679_11646702 | Ga0207679_116467022 | 102 |
| 1075 | 3300025949 | Ga0207667_11082659 | Ga0207667_110826592 | 102 |
| 1076 | 3300025949 | Ga0207667_11904797 | Ga0207667_119047972 | 102 |
| 1077 | 3300025960 | Ga0207651_10092780 | Ga0207651_100927802 | 102 |
| 1078 | 3300025960 | Ga0207651_10121830 | Ga0207651_101218302 | 102 |
| 1079 | 3300025960 | Ga0207651_10572322 | Ga0207651_105723222 | 102 |
| 1080 | 3300025960 | Ga0207651_10627053 | Ga0207651_106270532 | 102 |
| 1081 | 3300025960 | Ga0207651_11996530 | Ga0207651_119965301 | 102 |
| 1082 | 3300025961 | Ga0207712_10700092 | Ga0207712_107000921 | 102 |
| 1083 | 3300025961 | Ga0207712_11455101 | Ga0207712_114551011 | 102 |
| 1084 | 3300025961 | Ga0207712_11567463 | Ga0207712_115674631 | 102 |
| 1085 | 3300025972 | Ga0207668_10311790 | Ga0207668_103117902 | 102 |
| 1086 | 3300025972 | Ga0207668_10358350 | Ga0207668_103583501 | 102 |
| 1087 | 3300025981 | Ga0207640_10004935 | Ga0207640_100049355 | 102 |
| 1088 | 3300025981 | Ga0207640_10164632 | Ga0207640_101646322 | 102 |
| 1089 | 3300025981 | Ga0207640_10679627 | Ga0207640_106796271 | 102 |
| 1090 | 3300025981 | Ga0207640_11608610 | Ga0207640_116086101 | 102 |
| 1091 | 3300025981 | Ga0207640_12199657 | Ga0207640_121996572 | 102 |
| 1092 | 3300025986 | Ga0207658_10472545 | Ga0207658_104725452 | 102 |
| 1093 | 3300025986 | Ga0207658_10731189 | Ga0207658_107311891 | 102 |
| 1094 | 3300025986 | Ga0207658_10998264 | Ga0207658_109982642 | 102 |
| 1095 | 3300026023 | Ga0207677_10006894 | Ga0207677_100068942 | 102 |
| 1096 | 3300026023 | Ga0207677_10013904 | Ga0207677_100139044 | 102 |
| 1097 | 3300026023 | Ga0207677_10198868 | Ga0207677_101988682 | 102 |
| 1098 | 3300026035 | Ga0207703_10022018 | Ga0207703_100220184 | 102 |
| 1099 | 3300026035 | Ga0207703_10067157 | Ga0207703_100671572 | 102 |
| 1100 | 3300026035 | Ga0207703_11200295 | Ga0207703_112002951 | 102 |
| 1101 | 3300026035 | Ga0207703_12250013 | Ga0207703_122500131 | 102 |
| 1102 | 3300026041 | Ga0207639_10575069 | Ga0207639_105750691 | 102 |
| 1103 | 3300026067 | Ga0207678_10059909 | Ga0207678_100599093 | 102 |
| 1104 | 3300026067 | Ga0207678_10443592 | Ga0207678_104435922 | 102 |
| 1105 | 3300026067 | Ga0207678_11164862 | Ga0207678_111648621 | 102 |
| 1106 | 3300026075 | Ga0207708_10019638 | Ga0207708_100196383 | 102 |
| 1107 | 3300026075 | Ga0207708_10025473 | Ga0207708_100254733 | 102 |
| 1108 | 3300026075 | Ga0207708_10211327 | Ga0207708_102113272 | 102 |
| 1109 | 3300026075 | Ga0207708_11753825 | Ga0207708_117538251 | 102 |
| 1110 | 3300026078 | Ga0207702_10835587 | Ga0207702_108355872 | 102 |
| 1111 | 3300026088 | Ga0207641_10063850 | Ga0207641_100638504 | 102 |
| 1112 | 3300026088 | Ga0207641_10128053 | Ga0207641_101280532 | 102 |
| 1113 | 3300026088 | Ga0207641_12343158 | Ga0207641_123431582 | 102 |
| 1114 | 3300026089 | Ga0207648_10000284 | Ga0207648_1000028425 | 102 |
| 1115 | 3300026089 | Ga0207648_10045452 | Ga0207648_100454525 | 102 |
| 1116 | 3300026089 | Ga0207648_10374992 | Ga0207648_103749921 | 102 |
| 1117 | 3300026095 | Ga0207676_10283086 | Ga0207676_102830863 | 102 |
| 1118 | 3300026095 | Ga0207676_10301287 | Ga0207676_103012872 | 102 |
| 1119 | 3300026095 | Ga0207676_10998438 | Ga0207676_109984381 | 102 |
| 1120 | 3300026095 | Ga0207676_11608624 | Ga0207676_116086241 | 102 |
| 1121 | 3300026095 | Ga0207676_11792619 | Ga0207676_117926192 | 102 |
| 1122 | 3300026116 | Ga0207674_10008143 | Ga0207674_100081432 | 102 |
| 1123 | 3300026116 | Ga0207674_10019801 | Ga0207674_100198017 | 102 |
| 1124 | 3300026116 | Ga0207674_10631637 | Ga0207674_106316372 | 102 |
| 1125 | 3300026116 | Ga0207674_10734191 | Ga0207674_107341912 | 102 |
| 1126 | 3300026118 | Ga0207675_100033436 | Ga0207675_1000334364 | 102 |
| 1127 | 3300026118 | Ga0207675_100208012 | Ga0207675_1002080122 | 102 |
| 1128 | 3300026118 | Ga0207675_100421917 | Ga0207675_1004219172 | 102 |
| 1129 | 3300026121 | Ga0207683_10007614 | Ga0207683_100076149 | 102 |
| 1130 | 3300026121 | Ga0207683_10193544 | Ga0207683_101935442 | 102 |
| 1131 | 3300026142 | Ga0207698_10033457 | Ga0207698_100334572 | 102 |
| 1132 | 3300027364 | Ga0209967_1046460 | Ga0209967_10464602 | 102 |
| 1133 | 3300027462 | Ga0210000_1037007 | Ga0210000_10370071 | 102 |
| 1134 | 3300027471 | Ga0209995_1034417 | Ga0209995_10344172 | 102 |
| 1135 | 3300027526 | Ga0209968_1090654 | Ga0209968_10906541 | 102 |
| 1136 | 3300027543 | Ga0209999_1002779 | Ga0209999_10027794 | 102 |
| 1137 | 3300027682 | Ga0209971_1052119 | Ga0209971_10521192 | 102 |
| 1138 | 3300027717 | Ga0209998_10022296 | Ga0209998_100222962 | 102 |
| 1139 | 3300027876 | Ga0209974_10052889 | Ga0209974_100528892 | 102 |
| 1140 | 3300027907 | Ga0207428_10607995 | Ga0207428_106079952 | 102 |
| 1141 | 3300028379 | Ga0268266_11949311 | Ga0268266_119493111 | 102 |
| 1142 | 3300028380 | Ga0268265_11603200 | Ga0268265_116032002 | 102 |
| 1143 | 3300028380 | Ga0268265_11876387 | Ga0268265_118763872 | 102 |
| 1144 | 3300028380 | Ga0268265_12198753 | Ga0268265_121987531 | 102 |
| 1145 | 3300028381 | Ga0268264_10159852 | Ga0268264_101598523 | 102 |
| 1146 | 3300028381 | Ga0268264_10207215 | Ga0268264_102072151 | 102 |
| 1147 | 3300028381 | Ga0268264_10659599 | Ga0268264_106595992 | 102 |
| 1148 | 3300028381 | Ga0268264_10784427 | Ga0268264_107844272 | 102 |
| 1149 | 3300031548 | Ga0307408_100038948 | Ga0307408_1000389484 | 102 |
| 1150 | 3300031548 | Ga0307408_100341016 | Ga0307408_1003410161 | 102 |
| 1151 | 3300031548 | Ga0307408_100496108 | Ga0307408_1004961081 | 102 |
| 1152 | 3300031548 | Ga0307408_100818339 | Ga0307408_1008183392 | 102 |
| 1153 | 3300031548 | Ga0307408_101623658 | Ga0307408_1016236582 | 102 |
| 1154 | 3300031548 | Ga0307408_101680848 | Ga0307408_1016808482 | 102 |
| 1155 | 3300031731 | Ga0307405_10004381 | Ga0307405_100043813 | 102 |
| 1156 | 3300031731 | Ga0307405_10079146 | Ga0307405_100791462 | 102 |
| 1157 | 3300031731 | Ga0307405_10573142 | Ga0307405_105731422 | 102 |
| 1158 | 3300031731 | Ga0307405_10747967 | Ga0307405_107479671 | 102 |
| 1159 | 3300031731 | Ga0307405_10820350 | Ga0307405_108203501 | 102 |
| 1160 | 3300031731 | Ga0307405_11354087 | Ga0307405_113540871 | 102 |
| 1161 | 3300031824 | Ga0307413_10014416 | Ga0307413_100144162 | 102 |
| 1162 | 3300031824 | Ga0307413_10058773 | Ga0307413_100587731 | 102 |
| 1163 | 3300031824 | Ga0307413_10087503 | Ga0307413_100875033 | 102 |
| 1164 | 3300031824 | Ga0307413_10150582 | Ga0307413_101505822 | 102 |
| 1165 | 3300031824 | Ga0307413_10468586 | Ga0307413_104685862 | 102 |
| 1166 | 3300031852 | Ga0307410_10382688 | Ga0307410_103826882 | 102 |
| 1167 | 3300031852 | Ga0307410_10581451 | Ga0307410_105814512 | 102 |
| 1168 | 3300031852 | Ga0307410_10645984 | Ga0307410_106459842 | 102 |
| 1169 | 3300031852 | Ga0307410_11440394 | Ga0307410_114403941 | 102 |
| 1170 | 3300031889 | Ga0326468_10041234 | Ga0326468_100412341 | 102 |
| 1171 | 3300031901 | Ga0307406_10026696 | Ga0307406_100266962 | 102 |
| 1172 | 3300031901 | Ga0307406_10131096 | Ga0307406_101310962 | 102 |
| 1173 | 3300031901 | Ga0307406_10243877 | Ga0307406_102438772 | 102 |
| 1174 | 3300031901 | Ga0307406_10370010 | Ga0307406_103700102 | 102 |
| 1175 | 3300031901 | Ga0307406_10470084 | Ga0307406_104700841 | 102 |
| 1176 | 3300031901 | Ga0307406_10633266 | Ga0307406_106332662 | 102 |
| 1177 | 3300031901 | Ga0307406_11685902 | Ga0307406_116859021 | 102 |
| 1178 | 3300031903 | Ga0307407_10022385 | Ga0307407_100223853 | 102 |
| 1179 | 3300031903 | Ga0307407_10349400 | Ga0307407_103494002 | 102 |
| 1180 | 3300031903 | Ga0307407_10426655 | Ga0307407_104266552 | 102 |
| 1181 | 3300031903 | Ga0307407_10603483 | Ga0307407_106034831 | 102 |
| 1182 | 3300031903 | Ga0307407_10840624 | Ga0307407_108406242 | 102 |
| 1183 | 3300031903 | Ga0307407_11244714 | Ga0307407_112447142 | 102 |
| 1184 | 3300031911 | Ga0307412_10016955 | Ga0307412_100169556 | 102 |
| 1185 | 3300031911 | Ga0307412_10729531 | Ga0307412_107295312 | 102 |
| 1186 | 3300031911 | Ga0307412_11114318 | Ga0307412_111143182 | 102 |
| 1187 | 3300031995 | Ga0307409_100049673 | Ga0307409_1000496733 | 102 |
| 1188 | 3300031995 | Ga0307409_100108550 | Ga0307409_1001085502 | 102 |
| 1189 | 3300031995 | Ga0307409_100170107 | Ga0307409_1001701071 | 102 |
| 1190 | 3300031995 | Ga0307409_101304133 | Ga0307409_1013041332 | 102 |
| 1191 | 3300032002 | Ga0307416_100158774 | Ga0307416_1001587741 | 102 |
| 1192 | 3300032002 | Ga0307416_100164768 | Ga0307416_1001647681 | 102 |
| 1193 | 3300032002 | Ga0307416_100197546 | Ga0307416_1001975463 | 102 |
| 1194 | 3300032002 | Ga0307416_100229017 | Ga0307416_1002290171 | 102 |
| 1195 | 3300032002 | Ga0307416_100318693 | Ga0307416_1003186932 | 102 |
| 1196 | 3300032002 | Ga0307416_100703942 | Ga0307416_1007039422 | 102 |
| 1197 | 3300032002 | Ga0307416_100747185 | Ga0307416_1007471852 | 102 |
| 1198 | 3300032002 | Ga0307416_101185740 | Ga0307416_1011857402 | 102 |
| 1199 | 3300032002 | Ga0307416_101282796 | Ga0307416_1012827962 | 102 |
| 1200 | 3300032002 | Ga0307416_102159419 | Ga0307416_1021594191 | 102 |
| 1201 | 3300032002 | Ga0307416_102821040 | Ga0307416_1028210401 | 102 |
| 1202 | 3300032004 | Ga0307414_10003807 | Ga0307414_100038077 | 102 |
| 1203 | 3300032004 | Ga0307414_10067314 | Ga0307414_100673142 | 102 |
| 1204 | 3300032004 | Ga0307414_10347994 | Ga0307414_103479942 | 102 |
| 1205 | 3300032004 | Ga0307414_10546906 | Ga0307414_105469061 | 102 |
| 1206 | 3300032005 | Ga0307411_10018853 | Ga0307411_100188533 | 102 |
| 1207 | 3300032005 | Ga0307411_10144361 | Ga0307411_101443612 | 102 |
| 1208 | 3300032005 | Ga0307411_10523286 | Ga0307411_105232861 | 102 |
| 1209 | 3300032126 | Ga0307415_100003847 | Ga0307415_1000038477 | 102 |
| 1210 | 3300032126 | Ga0307415_101177721 | Ga0307415_1011777212 | 102 |
| 1211 | 3300032126 | Ga0307415_101297155 | Ga0307415_1012971551 | 102 |
| 1212 | 3300032126 | Ga0307415_101449927 | Ga0307415_1014499271 | 102 |
| 1213 | 3300032126 | Ga0307415_102081726 | Ga0307415_1020817261 | 102 |
| 1214 | 3300032126 | Ga0307415_102533515 | Ga0307415_1025335151 | 102 |
| 1215 | 3300034817 | Ga0373948_0104669 | Ga0373948_0104669_193_513 | 102 |
| 1216 | 3300034818 | Ga0373950_0035776 | Ga0373950_0035776_149_463 | 102 |
| 1217 | 3300034820 | Ga0373959_0050477 | Ga0373959_0050477_373_687 | 102 |
| 1218 | 3300034957 | Ga0373938_0063141 | Ga0373938_0063141_404_718 | 102 |
| 1219 | 3300035085 | Ga0373929_0086202 | Ga0373929_0086202_127_441 | 102 |
| 1220 | 3300035090 | Ga0373949_0032384 | Ga0373949_0032384_89_403 | 102 |
| 1221 | 3300035090 | Ga0373949_0041542 | Ga0373949_0041542_801_1115 | 102 |
| 1222 | 3300035112 | Ga0373932_0194997 | Ga0373932_0194997_143_457 | 102 |
| 1223 | 3300035114 | Ga0373939_0166704 | Ga0373939_0166704_346_660 | 102 |
| 1224 | 3300035114 | Ga0373939_0200844 | Ga0373939_0200844_337_651 | 102 |
| 1225 | 3300035171 | Ga0373946_0344464 | Ga0373946_0344464_190_498 | 102 |
| 1226 | 3300035172 | Ga0373955_0587387 | Ga0373955_0587387_297_605 | 102 |
| 1227 | 3300035207 | Ga0373942_0104818 | Ga0373942_0104818_138_452 | 102 |
| 1228 | 3300035241 | Ga0373961_0034817 | Ga0373961_0034817_454_762 | 102 |
| 1229 | 3300035691 | Ga0373931_0462043 | Ga0373931_0462043_395_709 | 102 |
| 1230 | 3300035691 | Ga0373931_0540172 | Ga0373931_0540172_73_387 | 102 |
| 1231 | 3300035691 | Ga0373931_0865850 | Ga0373931_0865850_171_479 | 102 |
| 1232 | 3300036401 | Ga0373937_1480800 | Ga0373937_1480800_308_616 | 102 |
| 1233 | 3300037418 | Ga0395900_1277603 | Ga0395900_1277603_118_432 | 102 |
| 1234 | 3300037418 | Ga0395900_1428789 | Ga0395900_1428789_13_327 | 102 |
| 1235 | 3300037418 | Ga0395900_1656624 | Ga0395900_1656624_91_399 | 102 |
| 1236 | 3300037471 | Ga0395905_0119324 | Ga0395905_0119324_1257_1571 | 102 |
| 1237 | 3300037471 | Ga0395905_0777548 | Ga0395905_0777548_283_597 | 102 |
| 1238 | 3300037471 | Ga0395905_1417469 | Ga0395905_1417469_155_469 | 102 |
| 1239 | 3300038443 | Ga0395901_1988056 | Ga0395901_1988056_53_388 | 102 |
| 1240 | 3300038698 | Ga0242419_005398 | Ga0242419_005398_308_622 | 102 |
| 1241 | 3300038996 | Ga0242420_004350 | Ga0242420_004350_751_1065 | 102 |
| 1242 | 3300038996 | Ga0242420_006711 | Ga0242420_006711_1368_1682 | 102 |
| 1243 | 3300039437 | Ga0436365_1827961 | Ga0436365_1827961_497_805 | 102 |
| 1244 | 3300041406 | Ga0439439_0115416 | Ga0439439_0115416_93_401 | 102 |
| 1245 | 3300041410 | Ga0439461_0166033 | Ga0439461_0166033_82_396 | 102 |
| 1246 | 3300041443 | Ga0451789_0947159 | Ga0451789_0947159_161_469 | 102 |
| 1247 | 3300042004 | Ga0439445_0136378 | Ga0439445_0136378_156_464 | 102 |
| 1248 | 3300042012 | Ga0439455_0065069 | Ga0439455_0065069_412_726 | 102 |
| 1249 | 3300042437 | Ga0439444_0132977 | Ga0439444_0132977_193_507 | 102 |
| 1250 | 3300042437 | Ga0439444_0152842 | Ga0439444_0152842_193_507 | 102 |
| 1251 | 3300042876 | Ga0451577_0018850 | Ga0451577_0018850_4384_4692 | 102 |
| 1252 | 3300044673 | Ga0453683_0163376 | Ga0453683_0163376_1045_1359 | 102 |
| 1253 | 3300044712 | Ga0453684_0019316 | Ga0453684_0019316_5763_6071 | 102 |
| 1254 | 3300044712 | Ga0453684_0677429 | Ga0453684_0677429_639_953 | 102 |
| 1255 | 3300045051 | Ga0451576_1145132 | Ga0451576_1145132_390_713 | 102 |
| 1256 | 3300045976 | Ga0466967_1576409 | Ga0466967_1576409_311_625 | 102 |
| 1257 | 3300046492 | Ga0495585_0310154 | Ga0495585_0310154_284_592 | 102 |
| 1258 | 3300046499 | Ga0495594_0380017 | Ga0495594_0380017_283_597 | 102 |
| 1259 | 3300046515 | Ga0495620_0357079 | Ga0495620_0357079_217_525 | 102 |
| 1260 | 3300046525 | Ga0495663_0401218 | Ga0495663_0401218_155_463 | 102 |
| 1261 | 3300046536 | Ga0495587_0309835 | Ga0495587_0309835_353_661 | 102 |
| 1262 | 3300046539 | Ga0495621_0032870 | Ga0495621_0032870_445_759 | 102 |
| 1263 | 3300046559 | Ga0495667_0150431 | Ga0495667_0150431_306_614 | 102 |
| 1264 | 3300046663 | Ga0495635_0084621 | Ga0495635_0084621_1357_1665 | 102 |
| 1265 | 3300046674 | Ga0495588_0007818 | Ga0495588_0007818_1542_1850 | 102 |
| 1266 | 3300046679 | Ga0495623_0219777 | Ga0495623_0219777_35_343 | 102 |
| 1267 | 3300046809 | Ga0495600_0424218 | Ga0495600_0424218_163_471 | 102 |
| 1268 | 3300047317 | Ga0495604_1009718 | Ga0495604_1009718_192_500 | 102 |
| 1269 | 3300047445 | Ga0495677_0151955 | Ga0495677_0151955_11_319 | 102 |
| 1270 | 3300047447 | Ga0495685_136166 | Ga0495685_136166_137_445 | 102 |
| 1271 | 3300047470 | Ga0495681_0298583 | Ga0495681_0298583_211_519 | 102 |
| 1272 | 3300048903 | Ga0496100_0292564 | Ga0496100_0292564_203_517 | 102 |
| 1273 | 3300048903 | Ga0496100_1332312 | Ga0496100_1332312_199_513 | 102 |
| 1274 | 3300048903 | Ga0496100_1676063 | Ga0496100_1676063_11_325 | 102 |
| 1275 | 3300048904 | Ga0496101_0113841 | Ga0496101_0113841_1569_1883 | 102 |
| 1276 | 3300048904 | Ga0496101_0175258 | Ga0496101_0175258_959_1267 | 102 |
| 1277 | 3300048904 | Ga0496101_1403313 | Ga0496101_1403313_66_380 | 102 |
| 1278 | 3300048905 | Ga0496102_0084843 | Ga0496102_0084843_2396_2710 | 102 |
| 1279 | 3300048905 | Ga0496102_0107907 | Ga0496102_0107907_1225_1557 | 102 |
| 1280 | 3300048905 | Ga0496102_0597811 | Ga0496102_0597811_592_906 | 102 |
| 1281 | 3300048905 | Ga0496102_0693815 | Ga0496102_0693815_446_763 | 102 |
| 1282 | 3300048906 | Ga0496103_0638605 | Ga0496103_0638605_14_346 | 102 |
| 1283 | 3300048907 | Ga0496104_0006303 | Ga0496104_0006303_2550_2864 | 102 |
| 1284 | 3300048907 | Ga0496104_0492225 | Ga0496104_0492225_446_760 | 102 |
| 1285 | 3300048907 | Ga0496104_0515166 | Ga0496104_0515166_225_533 | 102 |
| 1286 | 3300048909 | Ga0496106_0146128 | Ga0496106_0146128_444_761 | 102 |
| 1287 | 3300048909 | Ga0496106_0245621 | Ga0496106_0245621_1072_1386 | 102 |
| 1288 | 3300048909 | Ga0496106_0292915 | Ga0496106_0292915_827_1159 | 102 |
| 1289 | 3300048909 | Ga0496106_0363572 | Ga0496106_0363572_303_617 | 102 |
| 1290 | 3300048909 | Ga0496106_0407880 | Ga0496106_0407880_725_1039 | 102 |
| 1291 | 3300048909 | Ga0496106_0658431 | Ga0496106_0658431_247_561 | 102 |
| 1292 | 3300048909 | Ga0496106_1016349 | Ga0496106_1016349_125_433 | 102 |
| 1293 | 3300048910 | Ga0496107_0931869 | Ga0496107_0931869_32_346 | 102 |
| 1294 | 3300048911 | Ga0496108_0005557 | Ga0496108_0005557_9548_9862 | 102 |
| 1295 | 3300048911 | Ga0496108_0009201 | Ga0496108_0009201_7271_7585 | 102 |
| 1296 | 3300048911 | Ga0496108_0078456 | Ga0496108_0078456_909_1223 | 102 |
| 1297 | 3300048911 | Ga0496108_0701929 | Ga0496108_0701929_232_546 | 102 |
| 1298 | 3300048911 | Ga0496108_0965168 | Ga0496108_0965168_385_693 | 102 |
| 1299 | 3300048912 | Ga0496109_0022966 | Ga0496109_0022966_1513_1827 | 102 |
| 1300 | 3300048912 | Ga0496109_0233095 | Ga0496109_0233095_1060_1374 | 102 |
| 1301 | 3300048912 | Ga0496109_0582877 | Ga0496109_0582877_684_998 | 102 |
| 1302 | 3300048912 | Ga0496109_0644441 | Ga0496109_0644441_574_882 | 102 |
| 1303 | 3300048912 | Ga0496109_2037380 | Ga0496109_2037380_141_455 | 102 |
| 1304 | 3300048913 | Ga0496110_0129583 | Ga0496110_0129583_1361_1675 | 102 |
| 1305 | 3300048913 | Ga0496110_0240181 | Ga0496110_0240181_924_1238 | 102 |
| 1306 | 3300048914 | Ga0496111_0467027 | Ga0496111_0467027_606_920 | 102 |
| 1307 | 3300048915 | Ga0496112_0148753 | Ga0496112_0148753_831_1145 | 102 |
| 1308 | 3300048915 | Ga0496112_0432552 | Ga0496112_0432552_552_860 | 102 |
| 1309 | 3300048915 | Ga0496112_0625396 | Ga0496112_0625396_329_643 | 102 |
| 1310 | 3300048916 | Ga0496113_0046902 | Ga0496113_0046902_2508_2822 | 102 |
| 1311 | 3300048916 | Ga0496113_0700111 | Ga0496113_0700111_55_369 | 102 |
| 1312 | 3300048916 | Ga0496113_0766954 | Ga0496113_0766954_263_571 | 102 |
| 1313 | 3300048917 | Ga0496114_0008966 | Ga0496114_0008966_2034_2348 | 102 |
| 1314 | 3300048917 | Ga0496114_0150261 | Ga0496114_0150261_177_491 | 102 |
| 1315 | 3300048918 | Ga0496115_0096451 | Ga0496115_0096451_399_713 | 102 |
| 1316 | 3300048918 | Ga0496115_0664119 | Ga0496115_0664119_49_366 | 102 |
| 1317 | 3300049127 | Ga0501306_066075 | Ga0501306_066075_215_529 | 102 |
| 1318 | 3300049513 | Ga0501290_100117 | Ga0501290_100117_185_493 | 102 |
| 1319 | 3300049519 | Ga0501296_027669 | Ga0501296_027669_386_694 | 102 |
| 1320 | 3300049527 | Ga0501311_060777 | Ga0501311_060777_70_384 | 102 |
| 1321 | 3300049531 | Ga0501315_092029 | Ga0501315_092029_74_388 | 102 |
| 1322 | 3300049532 | Ga0501316_044099 | Ga0501316_044099_74_388 | 102 |
| 1323 | 3300049539 | Ga0501323_022872 | Ga0501323_022872_74_388 | 102 |
| 1324 | 3300049572 | Ga0501036_1641935 | Ga0501036_1641935_127_441 | 102 |
| 1325 | 3300049573 | Ga0501037_0463031 | Ga0501037_0463031_361_675 | 102 |
| 1326 | 3300049576 | Ga0501040_0112219 | Ga0501040_0112219_1019_1333 | 102 |
| 1327 | 3300049576 | Ga0501040_0521425 | Ga0501040_0521425_532_846 | 102 |
| 1328 | 3300049577 | Ga0501041_0164873 | Ga0501041_0164873_579_893 | 102 |
| 1329 | 3300049578 | Ga0501042_0318212 | Ga0501042_0318212_266_580 | 102 |
| 1330 | 3300049578 | Ga0501042_0564905 | Ga0501042_0564905_429_743 | 102 |
| 1331 | 3300049583 | Ga0501067_0258146 | Ga0501067_0258146_158_511 | 102 |
| 1332 | 3300049583 | Ga0501067_0390614 | Ga0501067_0390614_155_469 | 102 |
| 1333 | 3300049583 | Ga0501067_0740853 | Ga0501067_0740853_192_524 | 102 |
| 1334 | 3300049585 | Ga0501069_0024665 | Ga0501069_0024665_2906_3220 | 102 |
| 1335 | 3300049585 | Ga0501069_0219825 | Ga0501069_0219825_709_1023 | 102 |
| 1336 | 3300049585 | Ga0501069_0303562 | Ga0501069_0303562_220_573 | 102 |
| 1337 | 3300049586 | Ga0501070_0598170 | Ga0501070_0598170_275_589 | 102 |
| 1338 | 3300049588 | Ga0501072_0039534 | Ga0501072_0039534_1245_1559 | 102 |
| 1339 | 3300049588 | Ga0501072_0703780 | Ga0501072_0703780_168_482 | 102 |
| 1340 | 3300049590 | Ga0501074_1282492 | Ga0501074_1282492_90_404 | 102 |
| 1341 | 3300049591 | Ga0501075_0249461 | Ga0501075_0249461_626_940 | 102 |
| 1342 | 3300049592 | Ga0501076_0292687 | Ga0501076_0292687_530_844 | 102 |
| 1343 | 3300049592 | Ga0501076_1032015 | Ga0501076_1032015_341_655 | 102 |
| 1344 | 3300049593 | Ga0501077_0084305 | Ga0501077_0084305_179_493 | 102 |
| 1345 | 3300049593 | Ga0501077_0173903 | Ga0501077_0173903_720_1034 | 102 |
| 1346 | 3300049651 | Ga0501201_047924 | Ga0501201_047924_148_456 | 102 |
| 1347 | 3300049653 | Ga0501206_035144 | Ga0501206_035144_388_702 | 102 |
| 1348 | 3300049661 | Ga0501217_262437 | Ga0501217_262437_166_480 | 102 |
| 1349 | 3300049661 | Ga0501217_298442 | Ga0501217_298442_101_409 | 102 |
| 1350 | 3300049664 | Ga0501224_065209 | Ga0501224_065209_57_365 | 102 |
| 1351 | 3300049677 | Ga0501247_067000 | Ga0501247_067000_105_419 | 102 |
| 1352 | 3300049679 | Ga0501249_043288 | Ga0501249_043288_419_733 | 102 |
| 1353 | 3300049686 | Ga0501257_239723 | Ga0501257_239723_143_457 | 102 |
| 1354 | 3300049687 | Ga0501258_041249 | Ga0501258_041249_154_462 | 102 |
| 1355 | 3300049688 | Ga0501259_050586 | Ga0501259_050586_164_472 | 102 |
| 1356 | 3300049705 | Ga0501225_0105716 | Ga0501225_0105716_287_601 | 102 |
| 1357 | 3300049705 | Ga0501225_0157881 | Ga0501225_0157881_191_499 | 102 |
| 1358 | 3300049741 | Ga0501079_0072197 | Ga0501079_0072197_167_481 | 102 |
| 1359 | 3300049741 | Ga0501079_1163359 | Ga0501079_1163359_149_463 | 102 |
| 1360 | 3300049742 | Ga0501080_0518965 | Ga0501080_0518965_201_515 | 102 |
| 1361 | 3300049742 | Ga0501080_0527496 | Ga0501080_0527496_590_904 | 102 |
| 1362 | 3300049744 | Ga0501083_0693752 | Ga0501083_0693752_45_359 | 102 |
| 1363 | 3300049761 | Ga0501264_033477 | Ga0501264_033477_36_350 | 102 |
| 1364 | 3300049763 | Ga0501266_048627 | Ga0501266_048627_254_568 | 102 |
| 1365 | 3300049770 | Ga0501273_080115 | Ga0501273_080115_62_370 | 102 |
| 1366 | 3300049770 | Ga0501273_086341 | Ga0501273_086341_130_438 | 102 |
| 1367 | 3300049779 | Ga0501283_137411 | Ga0501283_137411_128_442 | 102 |
| 1368 | 3300049823 | Ga0501044_0736726 | Ga0501044_0736726_304_618 | 102 |
| 1369 | 3300049823 | Ga0501044_1426621 | Ga0501044_1426621_95_409 | 102 |
| 1370 | 3300049824 | Ga0501045_0374149 | Ga0501045_0374149_257_571 | 102 |
| 1371 | 3300050507 | nmdc:mga05p37_1016723_c1 | nmdc:mga05p37_1016723_c1_343_657 | 102 |
| 1372 | 3300050507 | nmdc:mga05p37_249930_c1 | nmdc:mga05p37_249930_c1_1217_1531 | 102 |
| 1373 | 3300050507 | nmdc:mga05p37_483494_c1 | nmdc:mga05p37_483494_c1_192_506 | 102 |
| 1374 | 3300050507 | nmdc:mga05p37_636196_c1 | nmdc:mga05p37_636196_c1_209_565 | 102 |
| 1375 | 3300050507 | nmdc:mga05p37_67303_c1 | nmdc:mga05p37_67303_c1_1293_1625 | 102 |
| 1376 | 3300050507 | nmdc:mga05p37_922531_c1 | nmdc:mga05p37_922531_c1_252_566 | 102 |
| 1377 | 3300050508 | nmdc:mga09592_338617_c1 | nmdc:mga09592_338617_c1_497_811 | 102 |
| 1378 | 3300050508 | nmdc:mga09592_623402_c1 | nmdc:mga09592_623402_c1_340_654 | 102 |
| 1379 | 3300050509 | nmdc:mga0qj67_819791_c1 | nmdc:mga0qj67_819791_c1_72_404 | 102 |
| 1380 | 3300050510 | nmdc:mga06r32_534480_c1 | nmdc:mga06r32_534480_c1_469_783 | 102 |
| 1381 | 3300050511 | nmdc:mga08y16_142866_c1 | nmdc:mga08y16_142866_c1_1840_2148 | 102 |
| 1382 | 3300050511 | nmdc:mga08y16_946504_c1 | nmdc:mga08y16_946504_c1_380_694 | 102 |
| 1383 | 3300050512 | nmdc:mga0n895_120980_c1 | nmdc:mga0n895_120980_c1_510_833 | 102 |
| 1384 | 3300050512 | nmdc:mga0n895_2199608_c1 | nmdc:mga0n895_2199608_c1_74_388 | 102 |
| 1385 | 3300050512 | nmdc:mga0n895_441913_c1 | nmdc:mga0n895_441913_c1_181_495 | 102 |
| 1386 | 3300050512 | nmdc:mga0n895_859021_c1 | nmdc:mga0n895_859021_c1_323_637 | 102 |
| 1387 | 3300050513 | nmdc:mga0rr50_145771_c1 | nmdc:mga0rr50_145771_c1_1396_1704 | 102 |
| 1388 | 3300050513 | nmdc:mga0rr50_375931_c1 | nmdc:mga0rr50_375931_c1_579_893 | 102 |
| 1389 | 3300050514 | nmdc:mga08x19_13948_c1 | nmdc:mga08x19_13948_c1_4288_4596 | 102 |
| 1390 | 3300050514 | nmdc:mga08x19_271491_c1 | nmdc:mga08x19_271491_c1_156_470 | 102 |
| 1391 | 3300050514 | nmdc:mga08x19_699764_c1 | nmdc:mga08x19_699764_c1_272_580 | 102 |
| 1392 | 3300050514 | nmdc:mga08x19_838218_c1 | nmdc:mga08x19_838218_c1_37_345 | 102 |
| 1393 | 3300050515 | nmdc:mga0a205_120580_c1 | nmdc:mga0a205_120580_c1_562_876 | 102 |
| 1394 | 3300050515 | nmdc:mga0a205_21314_c1 | nmdc:mga0a205_21314_c1_1882_2196 | 102 |
| 1395 | 3300054114 | Ga0501084_0029023 | Ga0501084_0029023_3889_4203 | 102 |
| 1396 | 3300054114 | Ga0501084_0175659 | Ga0501084_0175659_964_1278 | 102 |
| 1397 | 3300059421 | Ga0590071_005505 | Ga0590071_005505_1237_1551 | 102 |
| 1398 | 3300059423 | Ga0590074_008331 | Ga0590074_008331_343_657 | 102 |
| 1399 | 3300059426 | Ga0590077_009251 | Ga0590077_009251_313_627 | 102 |
| 1400 | 3300059477 | Ga0587084_079802 | Ga0587084_079802_248_562 | 102 |
| 1401 | 3300059490 | Ga0587066_047237 | Ga0587066_047237_407_721 | 102 |
| 1402 | 3300059493 | Ga0587077_070905 | Ga0587077_070905_76_390 | 102 |
| 1403 | 3300059504 | Ga0587082_061609 | Ga0587082_061609_121_435 | 102 |
| 1404 | 3300059505 | Ga0587083_0262872 | Ga0587083_0262872_123_437 | 102 |
| 1405 | 3300059510 | Ga0587090_089570 | Ga0587090_089570_103_417 | 102 |
| 1406 | 3300059630 | Ga0587128_033952 | Ga0587128_033952_475_789 | 102 |
| 1407 | 3300059643 | Ga0587072_200191 | Ga0587072_200191_135_443 | 102 |
| 1408 | 3300059644 | Ga0587075_061053 | Ga0587075_061053_112_426 | 102 |
| 1409 | 3300059646 | Ga0587078_016647 | Ga0587078_016647_65_373 | 102 |
| 1410 | 3300059647 | Ga0587079_123748 | Ga0587079_123748_58_390 | 102 |
| 1411 | 3300059652 | Ga0587107_020131 | Ga0587107_020131_102_416 | 102 |
| 1412 | 3300059655 | Ga0587114_044750 | Ga0587114_044750_114_428 | 102 |
| 1413 | 3300061734 | Ga0530510_0743561 | Ga0530510_0743561_279_593 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.9425 | 10 | 102 |
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.9305 | 10 | 102 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9303 | 10 | 102 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9183 | 10 | 102 |
| 1wnr-assembly1.cif.gz_G | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8793 | 10 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9425 | 10 | 102 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9403 | 10 | 102 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9305 | 10 | 102 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9281 | 10 | 102 | 2.30.33.40 |
| af_Q8IDZ8_162_258_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8214 | 9 | 101 | 2.30.33.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G1W4N5-F1-model_v4 | 10 kDa chaperonin | 0.9565 | 39 | 102 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A847P7T2-F1-model_v4 | 10 kDa chaperonin | 0.9477 | 10 | 102 |
GO:0005524
GO:0044183 |
| AF-A0A7X8RDF5-F1-model_v4 | 10 kDa chaperonin | 0.9358 | 38 | 102 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A847P7T2-F1-model_v4 | 10 kDa chaperonin | 0.9358 | 10 | 102 |
GO:0005524
GO:0044183 |
| AF-A0A0G1W4N5-F1-model_v4 | 10 kDa chaperonin | 0.9287 | 39 | 102 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar