F493769

General Info

Members Datasets Scaffolds Average Seq Length
1413 506 1413 101

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11918672|Ga0105249_119186721
Length 119
Sequence MGLTIISPQLKDTRAMATATKSRPKIAFVPFEDRVVIMPSEEMETMRGGLYIPDTAKEKPTQGEVIAVGPGRFEKGTRVPMELKVGDQVIYGKYSGTPYTVEGDEYVIIKASDVLAKLA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
134 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
135 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
153 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
243 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
268 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
269 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
270 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
271 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
272 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
298 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
301 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
302 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
303 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
304 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
305 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
306 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
309 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
310 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
311 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
312 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
313 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
314 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
315 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
316 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
317 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
318 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
319 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
320 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
321 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
322 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
323 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
324 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
325 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
326 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
327 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
328 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
329 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
330 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
331 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
332 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
333 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
334 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
335 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
336 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
337 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
338 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
341 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
342 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
368 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
389 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
390 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
417 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
418 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
419 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
420 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
421 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
422 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
423 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
427 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
428 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
429 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
430 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
431 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
432 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
433 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
434 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
435 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
436 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
437 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
438 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
439 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
440 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
443 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
444 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
445 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
458 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
461 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
462 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
463 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
464 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
465 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
466 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
467 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
468 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
469 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
470 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
471 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
472 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
473 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
474 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
475 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
476 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
477 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
478 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
479 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
480 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
481 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
485 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
486 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
487 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
488 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
489 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 6.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 4.25
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1017945 3300001977 Unclassified 1003
2 JGI24739J22299_10153085 3300001989 Bacteria 681
3 JGI24739J22299_10173906 3300001989 Bacteria 634
4 JGI24735J21928_10150096 3300002067 Bacteria 673
5 JGI24738J21930_10113188 3300002075 Bacteria 585
6 Ga0006759J45824_1142513 3300003163 Bacteria 511
7 Ga0006770J48903_1017217 3300003305 Bacteria 1036
8 Ga0006770J48903_1052527 3300003305 Bacteria 543
9 rootH1_10160366 3300003323 Bacteria 1241
10 Ga0007410J51695_1095721 3300003574 Bacteria 549
11 Ga0007409J51694_1061563 3300003575 Unclassified 1029
12 Ga0006562J51391_1014982 3300003578 Bacteria 2573
13 Ga0007429J51699_1055138 3300003579 Bacteria 570
14 Ga0007429J51699_1137424 3300003579 Bacteria 696
15 Ga0032354_1070555 3300003693 Unclassified 896
16 Ga0058858_1018058 3300004785 Bacteria 927
17 Ga0058859_10150003 3300004798 Bacteria 573
18 Ga0058859_11723421 3300004798 Bacteria 1127
19 Ga0058863_11573035 3300004799 Bacteria 502
20 Ga0058861_10068965 3300004800 Bacteria 843
21 Ga0058861_11782770 3300004800 Bacteria 589
22 Ga0058861_12050521 3300004800 Bacteria 1584
23 Ga0058860_11567160 3300004801 Unclassified 506
24 Ga0058860_12083350 3300004801 Bacteria 1042
25 Ga0058860_12124474 3300004801 Bacteria 518
26 Ga0058862_10000625 3300004803 Bacteria 1300
27 Ga0058862_10109779 3300004803 Bacteria 580
28 Ga0058862_12763569 3300004803 Bacteria 2124
29 Ga0058862_12811975 3300004803 Bacteria 842
30 Ga0065704_10501280 3300005289 Bacteria 667
31 Ga0065712_10135028 3300005290 Bacteria 1506
32 Ga0065715_10029592 3300005293 Bacteria 1814
33 Ga0065715_10340438 3300005293 Bacteria 967
34 Ga0065715_10879663 3300005293 Bacteria 581
35 Ga0065715_11021616 3300005293 Bacteria 528
36 Ga0065707_10031412 3300005295 Bacteria 1115
37 Ga0065707_10362525 3300005295 Bacteria 902
38 Ga0065707_11040338 3300005295 Bacteria 529
39 Ga0070658_10124301 3300005327 Bacteria 2146
40 Ga0070658_10404733 3300005327 Bacteria 1172
41 Ga0070658_10951538 3300005327 Bacteria 747
42 Ga0070658_10983028 3300005327 Bacteria 734
43 Ga0070676_10005779 3300005328 Bacteria 6596
44 Ga0070676_10017473 3300005328 Bacteria 3970
45 Ga0070676_10022558 3300005328 Bacteria 3530
46 Ga0070676_10064597 3300005328 Bacteria 2183
47 Ga0070676_10141119 3300005328 Bacteria 1534
48 Ga0070676_10674108 3300005328 Bacteria 753
49 Ga0070676_11531196 3300005328 Bacteria 514
50 Ga0070683_100001069 3300005329 Bacteria 20558
51 Ga0070683_100624396 3300005329 Bacteria 1031
52 Ga0070683_100757092 3300005329 Bacteria 931
53 Ga0070683_102332946 3300005329 Bacteria 513
54 Ga0070690_100004480 3300005330 Bacteria 7764
55 Ga0070690_100054140 3300005330 Unclassified 2568
56 Ga0070690_100410129 3300005330 Bacteria 997
57 Ga0070690_100441175 3300005330 Bacteria 963
58 Ga0070670_100438972 3300005331 Bacteria 1156
59 Ga0070670_100497695 3300005331 Bacteria 1083
60 Ga0070670_101223806 3300005331 Bacteria 686
61 Ga0070670_101831978 3300005331 Bacteria 559
62 Ga0070677_10213428 3300005333 Bacteria 938
63 Ga0070677_10273013 3300005333 Bacteria 849
64 Ga0070677_10371001 3300005333 Bacteria 747
65 Ga0068869_100009804 3300005334 Bacteria 6220
66 Ga0068869_100329731 3300005334 Bacteria 1240
67 Ga0068869_100546191 3300005334 Bacteria 973
68 Ga0070666_10039792 3300005335 Bacteria 3135
69 Ga0070666_11459008 3300005335 Bacteria 511
70 Ga0070680_100004792 3300005336 Bacteria 10179
71 Ga0070680_100006737 3300005336 Bacteria 8749
72 Ga0070680_100088267 3300005336 Bacteria 2565
73 Ga0070680_100137496 3300005336 Bacteria 2047
74 Ga0070680_100187460 3300005336 Bacteria 1743
75 Ga0070680_100272285 3300005336 Bacteria 1434
76 Ga0070680_100448545 3300005336 Bacteria 1102
77 Ga0070680_100537067 3300005336 Bacteria 1002
78 Ga0070680_100765095 3300005336 Bacteria 832
79 Ga0070680_101248983 3300005336 Bacteria 643
80 Ga0070680_101594546 3300005336 Bacteria 565
81 Ga0070682_100007747 3300005337 Bacteria 6050
82 Ga0070682_100214328 3300005337 Bacteria 1366
83 Ga0070682_100469768 3300005337 Bacteria 968
84 Ga0070682_100763886 3300005337 Bacteria 782
85 Ga0070682_101228404 3300005337 Bacteria 634
86 Ga0068868_100129570 3300005338 Bacteria 2063
87 Ga0068868_100443867 3300005338 Bacteria 1127
88 Ga0068868_100616415 3300005338 Bacteria 963
89 Ga0068868_100863010 3300005338 Bacteria 820
90 Ga0070660_100085863 3300005339 Bacteria 2475
91 Ga0070660_100532077 3300005339 Bacteria 979
92 Ga0070660_100605271 3300005339 Bacteria 916
93 Ga0070660_100843691 3300005339 Bacteria 771
94 Ga0070689_100425244 3300005340 Bacteria 1126
95 Ga0070689_100439515 3300005340 Unclassified 1108
96 Ga0070691_10056788 3300005341 Bacteria 1877
97 Ga0070691_10061118 3300005341 Bacteria 1812
98 Ga0070691_10504669 3300005341 Bacteria 700
99 Ga0070691_10575289 3300005341 Bacteria 661
100 Ga0070687_100045251 3300005343 Bacteria 2246
101 Ga0070687_100065162 3300005343 Bacteria 1937
102 Ga0070661_100064642 3300005344 Bacteria 2688
103 Ga0070661_100081807 3300005344 Bacteria 2385
104 Ga0070661_100150702 3300005344 Bacteria 1758
105 Ga0070661_100276089 3300005344 Bacteria 1302
106 Ga0070661_100521069 3300005344 Bacteria 953
107 Ga0070692_10446872 3300005345 Bacteria 826
108 Ga0070692_10857641 3300005345 Bacteria 624
109 Ga0070692_11334128 3300005345 Bacteria 516
110 Ga0070668_100047542 3300005347 Bacteria 3299
111 Ga0070668_101828465 3300005347 Bacteria 559
112 Ga0070669_100003047 3300005353 Bacteria 12052
113 Ga0070669_100062064 3300005353 Bacteria 2747
114 Ga0070669_100147225 3300005353 Bacteria 1820
115 Ga0070669_100234851 3300005353 Bacteria 1455
116 Ga0070669_101758867 3300005353 Bacteria 541
117 Ga0070675_100010521 3300005354 Bacteria 7226
118 Ga0070675_100119041 3300005354 Unclassified 2243
119 Ga0070675_100143621 3300005354 Bacteria 2042
120 Ga0070675_100333811 3300005354 Bacteria 1341
121 Ga0070671_100005351 3300005355 Bacteria 10234
122 Ga0070671_100111032 3300005355 Bacteria 2303
123 Ga0070671_100630053 3300005355 Bacteria 928
124 Ga0070671_100631672 3300005355 Bacteria 926
125 Ga0070671_101469942 3300005355 Bacteria 603
126 Ga0070674_100001645 3300005356 Bacteria 12049
127 Ga0070674_100206660 3300005356 Bacteria 1519
128 Ga0070674_101633682 3300005356 Bacteria 582
129 Ga0070673_100065427 3300005364 Bacteria 2900
130 Ga0070673_100198810 3300005364 Bacteria 1726
131 Ga0070688_100116415 3300005365 Bacteria 1784
132 Ga0070688_100352674 3300005365 Bacteria 1077
133 Ga0070659_100024636 3300005366 Bacteria 4614
134 Ga0070659_100101267 3300005366 Bacteria 2319
135 Ga0070659_100287795 3300005366 Bacteria 1368
136 Ga0070659_100617920 3300005366 Bacteria 932
137 Ga0070659_101915838 3300005366 Bacteria 532
138 Ga0070667_100033201 3300005367 Bacteria 4311
139 Ga0070667_100468174 3300005367 Bacteria 1153
140 Ga0070667_101486696 3300005367 Bacteria 636
141 Ga0070709_10010524 3300005434 Bacteria 5126
142 Ga0070709_10307781 3300005434 Bacteria 1159
143 Ga0070709_11464173 3300005434 Bacteria 554
144 Ga0070709_11637348 3300005434 Bacteria 525
145 Ga0070714_100012646 3300005435 Bacteria 6740
146 Ga0070714_100962981 3300005435 Bacteria 830
147 Ga0070713_100069801 3300005436 Bacteria 2964
148 Ga0070713_100351522 3300005436 Bacteria 1368
149 Ga0070713_100498520 3300005436 Bacteria 1149
150 Ga0070710_10039481 3300005437 Bacteria 2598
151 Ga0070710_11084603 3300005437 Bacteria 587
152 Ga0070701_10362308 3300005438 Bacteria 909
153 Ga0070711_100372464 3300005439 Bacteria 1153
154 Ga0070705_100004513 3300005440 Bacteria 6781
155 Ga0070705_100046854 3300005440 Bacteria 2495
156 Ga0070705_100217229 3300005440 Bacteria 1322
157 Ga0070705_100663556 3300005440 Bacteria 815
158 Ga0070705_101717346 3300005440 Bacteria 531
159 Ga0070700_100484401 3300005441 Bacteria 948
160 Ga0070694_100065463 3300005444 Bacteria 2490
161 Ga0070694_100218981 3300005444 Bacteria 1427
162 Ga0070694_100243246 3300005444 Bacteria 1358
163 Ga0070694_100259424 3300005444 Bacteria 1318
164 Ga0070694_101208692 3300005444 Bacteria 634
165 Ga0070694_101942568 3300005444 Bacteria 503
166 Ga0070708_100000480 3300005445 Bacteria 30280
167 Ga0070708_100086499 3300005445 Bacteria 2847
168 Ga0070708_100176264 3300005445 Bacteria 1998
169 Ga0070708_100224161 3300005445 Bacteria 1763
170 Ga0070708_100252627 3300005445 Bacteria 1656
171 Ga0070708_100404918 3300005445 Bacteria 1286
172 Ga0070708_100847685 3300005445 Bacteria 859
173 Ga0070708_101283457 3300005445 Bacteria 684
174 Ga0070663_100450178 3300005455 Bacteria 1061
175 Ga0070663_100857926 3300005455 Bacteria 782
176 Ga0070663_101202298 3300005455 Bacteria 666
177 Ga0070663_101204184 3300005455 Bacteria 665
178 Ga0070678_100002017 3300005456 Bacteria 10980
179 Ga0070678_100132020 3300005456 Bacteria 1985
180 Ga0070678_101269732 3300005456 Bacteria 684
181 Ga0070662_100001156 3300005457 Bacteria 16193
182 Ga0070662_100160783 3300005457 Bacteria 1757
183 Ga0070662_101214325 3300005457 Bacteria 648
184 Ga0070662_101316449 3300005457 Bacteria 622
185 Ga0070681_10006976 3300005458 Bacteria 10993
186 Ga0070681_10085276 3300005458 Bacteria 3111
187 Ga0070681_10102285 3300005458 Bacteria 2810
188 Ga0070681_10287672 3300005458 Bacteria 1554
189 Ga0070681_10380842 3300005458 Bacteria 1321
190 Ga0070681_10468889 3300005458 Bacteria 1172
191 Ga0070681_10491091 3300005458 Bacteria 1141
192 Ga0070681_10500030 3300005458 Bacteria 1129
193 Ga0070681_11587399 3300005458 Bacteria 580
194 Ga0068867_100000759 3300005459 Bacteria 21719
195 Ga0068867_100056644 3300005459 Bacteria 2900
196 Ga0068867_100411982 3300005459 Bacteria 1142
197 Ga0070685_10033417 3300005466 Bacteria 2889
198 Ga0070685_10516453 3300005466 Bacteria 847
199 Ga0070706_100129191 3300005467 Bacteria 2357
200 Ga0070706_100163214 3300005467 Bacteria 2080
201 Ga0070706_100212481 3300005467 Bacteria 1806
202 Ga0070706_100448273 3300005467 Bacteria 1201
203 Ga0070706_100536274 3300005467 Bacteria 1089
204 Ga0070706_100716034 3300005467 Bacteria 928
205 Ga0070707_100000409 3300005468 Bacteria 42487
206 Ga0070707_100023799 3300005468 Bacteria 5793
207 Ga0070707_100033031 3300005468 Bacteria 4932
208 Ga0070707_100162363 3300005468 Bacteria 2177
209 Ga0070707_100172977 3300005468 Bacteria 2104
210 Ga0070707_100256290 3300005468 Bacteria 1702
211 Ga0070707_100292565 3300005468 Bacteria 1583
212 Ga0070707_100314329 3300005468 Bacteria 1522
213 Ga0070707_100558413 3300005468 Bacteria 1107
214 Ga0070707_100768564 3300005468 Bacteria 927
215 Ga0070707_101479720 3300005468 Bacteria 646
216 Ga0070707_102288806 3300005468 Bacteria 508
217 Ga0070698_100018255 3300005471 Bacteria 7387
218 Ga0070698_100020032 3300005471 Bacteria 7012
219 Ga0070698_100101549 3300005471 Bacteria 2847
220 Ga0070698_100510801 3300005471 Bacteria 1140
221 Ga0070698_100743688 3300005471 Bacteria 924
222 Ga0070698_100793109 3300005471 Bacteria 891
223 Ga0070698_101256764 3300005471 Bacteria 690
224 Ga0070698_101440831 3300005471 Bacteria 640
225 Ga0070699_100000092 3300005518 Bacteria 86686
226 Ga0070699_100005907 3300005518 Bacteria 10696
227 Ga0070699_100066677 3300005518 Bacteria 3125
228 Ga0070699_100242105 3300005518 Bacteria 1610
229 Ga0070699_100262589 3300005518 Bacteria 1544
230 Ga0070699_100285581 3300005518 Bacteria 1478
231 Ga0070699_100505206 3300005518 Bacteria 1098
232 Ga0070699_100628596 3300005518 Bacteria 980
233 Ga0070699_100898119 3300005518 Bacteria 811
234 Ga0070699_101100650 3300005518 Bacteria 729
235 Ga0070699_101104301 3300005518 Bacteria 727
236 Ga0070699_101912559 3300005518 Bacteria 543
237 Ga0070699_102180378 3300005518 Bacteria 506
238 Ga0070679_100012235 3300005530 Bacteria 8197
239 Ga0070679_100024190 3300005530 Bacteria 5951
240 Ga0070679_100029083 3300005530 Bacteria 5451
241 Ga0070679_100036806 3300005530 Bacteria 4857
242 Ga0070679_100142459 3300005530 Bacteria 2376
243 Ga0070679_100193864 3300005530 Bacteria 2000
244 Ga0070679_100627738 3300005530 Bacteria 1017
245 Ga0070679_101090511 3300005530 Bacteria 743
246 Ga0070679_101197442 3300005530 Bacteria 705
247 Ga0070679_101650682 3300005530 Bacteria 589
248 Ga0070679_102128088 3300005530 Bacteria 511
249 Ga0070684_100000326 3300005535 Bacteria 32933
250 Ga0070684_100013532 3300005535 Bacteria 6582
251 Ga0070684_100099104 3300005535 Bacteria 2600
252 Ga0070684_100105047 3300005535 Bacteria 2527
253 Ga0070684_100417840 3300005535 Bacteria 1238
254 Ga0070684_101280834 3300005535 Bacteria 690
255 Ga0070684_101299637 3300005535 Bacteria 685
256 Ga0070684_101813731 3300005535 Bacteria 576
257 Ga0070684_102227742 3300005535 Bacteria 517
258 Ga0070697_100005779 3300005536 Bacteria 9539
259 Ga0070697_100044318 3300005536 Bacteria 3602
260 Ga0070697_100083526 3300005536 Bacteria 2634
261 Ga0070697_100093526 3300005536 Bacteria 2489
262 Ga0070697_100195298 3300005536 Bacteria 1718
263 Ga0070697_100219566 3300005536 Bacteria 1620
264 Ga0070697_100296028 3300005536 Bacteria 1391
265 Ga0070697_100297776 3300005536 Bacteria 1386
266 Ga0070697_100501203 3300005536 Bacteria 1062
267 Ga0070697_100857270 3300005536 Bacteria 805
268 Ga0068853_100008476 3300005539 Bacteria 8262
269 Ga0068853_100238338 3300005539 Bacteria 1666
270 Ga0068853_101092882 3300005539 Bacteria 769
271 Ga0068853_101281858 3300005539 Bacteria 708
272 Ga0068853_101917283 3300005539 Bacteria 574
273 Ga0068853_102327201 3300005539 Bacteria 519
274 Ga0068853_102474451 3300005539 Bacteria 503
275 Ga0070672_100241186 3300005543 Bacteria 1520
276 Ga0070672_101386323 3300005543 Bacteria 629
277 Ga0070672_101462454 3300005543 Bacteria 612
278 Ga0070672_101666467 3300005543 Bacteria 573
279 Ga0070686_100160677 3300005544 Bacteria 1582
280 Ga0070686_100300936 3300005544 Bacteria 1189
281 Ga0070686_100730023 3300005544 Bacteria 793
282 Ga0070695_100046229 3300005545 Bacteria 2777
283 Ga0070695_100095824 3300005545 Bacteria 1989
284 Ga0070695_100312876 3300005545 Bacteria 1165
285 Ga0070695_101582349 3300005545 Bacteria 547
286 Ga0070696_100003048 3300005546 Bacteria 11126
287 Ga0070696_100013055 3300005546 Bacteria 5574
288 Ga0070696_100064398 3300005546 Bacteria 2568
289 Ga0070696_100153436 3300005546 Bacteria 1692
290 Ga0070696_100370580 3300005546 Bacteria 1114
291 Ga0070696_100453076 3300005546 Bacteria 1013
292 Ga0070696_100990012 3300005546 Bacteria 702
293 Ga0070693_100015975 3300005547 Bacteria 3877
294 Ga0070693_100303135 3300005547 Bacteria 1078
295 Ga0070693_100319342 3300005547 Bacteria 1053
296 Ga0070693_100506005 3300005547 Bacteria 857
297 Ga0070693_100885869 3300005547 Bacteria 668
298 Ga0070693_101449685 3300005547 Bacteria 535
299 Ga0070665_100011744 3300005548 Bacteria 8844
300 Ga0070665_100965551 3300005548 Bacteria 865
301 Ga0070665_101528570 3300005548 Bacteria 676
302 Ga0070704_100056890 3300005549 Bacteria 2779
303 Ga0070704_100116000 3300005549 Bacteria 2047
304 Ga0070704_100431466 3300005549 Bacteria 1131
305 Ga0070704_100486200 3300005549 Bacteria 1069
306 Ga0070704_100752816 3300005549 Bacteria 867
307 Ga0070704_100833708 3300005549 Bacteria 826
308 Ga0068855_100081814 3300005563 Bacteria 3742
309 Ga0068855_100404096 3300005563 Bacteria 1496
310 Ga0068855_100577451 3300005563 Bacteria 1214
311 Ga0068855_101774665 3300005563 Bacteria 627
312 Ga0068855_102163024 3300005563 Bacteria 559
313 Ga0070664_100004494 3300005564 Bacteria 11191
314 Ga0070664_100132457 3300005564 Bacteria 2190
315 Ga0070664_100136105 3300005564 Bacteria 2160
316 Ga0070664_100245714 3300005564 Bacteria 1607
317 Ga0070664_100245745 3300005564 Bacteria 1607
318 Ga0070664_100460027 3300005564 Bacteria 1169
319 Ga0070664_101254215 3300005564 Bacteria 700
320 Ga0070664_101275582 3300005564 Bacteria 694
321 Ga0070664_101426181 3300005564 Bacteria 655
322 Ga0068857_100007935 3300005577 Bacteria 9161
323 Ga0068857_100032526 3300005577 Bacteria 4613
324 Ga0068857_100075686 3300005577 Bacteria 3001
325 Ga0068857_100648026 3300005577 Bacteria 1001
326 Ga0068857_101523931 3300005577 Bacteria 652
327 Ga0068857_101757341 3300005577 Bacteria 607
328 Ga0068854_100003432 3300005578 Bacteria 9880
329 Ga0068854_100131928 3300005578 Bacteria 1909
330 Ga0068854_100170652 3300005578 Bacteria 1692
331 Ga0068854_101894065 3300005578 Bacteria 548
332 Ga0068854_101962452 3300005578 Bacteria 539
333 Ga0068856_100119705 3300005614 Bacteria 2634
334 Ga0068856_100269836 3300005614 Bacteria 1717
335 Ga0068856_100522275 3300005614 Bacteria 1208
336 Ga0068856_100738213 3300005614 Bacteria 1005
337 Ga0070702_100118342 3300005615 Bacteria 1654
338 Ga0070702_100228920 3300005615 Bacteria 1248
339 Ga0070702_100626702 3300005615 Bacteria 810
340 Ga0068852_100005278 3300005616 Bacteria 9224
341 Ga0068852_100065709 3300005616 Bacteria 3166
342 Ga0068852_100127253 3300005616 Bacteria 2341
343 Ga0068852_100376150 3300005616 Bacteria 1392
344 Ga0068852_100927148 3300005616 Bacteria 888
345 Ga0068852_101050239 3300005616 Unclassified 834
346 Ga0068852_101605732 3300005616 Bacteria 673
347 Ga0068859_100629297 3300005617 Bacteria 1165
348 Ga0068859_100885997 3300005617 Bacteria 978
349 Ga0068859_100937576 3300005617 Bacteria 949
350 Ga0068859_101283992 3300005617 Bacteria 807
351 Ga0068859_101764026 3300005617 Bacteria 684
352 Ga0068864_100512406 3300005618 Bacteria 1155
353 Ga0068864_100513615 3300005618 Unclassified 1154
354 Ga0068864_101031802 3300005618 Bacteria 816
355 Ga0068864_101054928 3300005618 Bacteria 807
356 Ga0068864_101180369 3300005618 Bacteria 764
357 Ga0068864_101877037 3300005618 Bacteria 605
358 Ga0068864_102062129 3300005618 Bacteria 577
359 Ga0068866_10000404 3300005718 Bacteria 20120
360 Ga0068861_100176137 3300005719 Bacteria 1776
361 Ga0068861_100198429 3300005719 Bacteria 1683
362 Ga0068851_10021773 3300005834 Bacteria 3114
363 Ga0068870_10030395 3300005840 Bacteria 2729
364 Ga0068870_10866419 3300005840 Bacteria 636
365 Ga0068863_100078093 3300005841 Bacteria 3134
366 Ga0068863_100217663 3300005841 Bacteria 1839
367 Ga0068863_100263845 3300005841 Bacteria 1666
368 Ga0068863_101381658 3300005841 Bacteria 712
369 Ga0068863_101610255 3300005841 Bacteria 658
370 Ga0068863_102633411 3300005841 Bacteria 512
371 Ga0068858_100077874 3300005842 Bacteria 3080
372 Ga0068858_100901461 3300005842 Unclassified 865
373 Ga0068858_101388984 3300005842 Bacteria 692
374 Ga0068860_100208880 3300005843 Bacteria 1893
375 Ga0068860_100254541 3300005843 Bacteria 1710
376 Ga0068860_100576869 3300005843 Bacteria 1129
377 Ga0068860_100904091 3300005843 Bacteria 899
378 Ga0068860_101028444 3300005843 Bacteria 842
379 Ga0068860_101029457 3300005843 Bacteria 842
380 Ga0068860_101173858 3300005843 Bacteria 788
381 Ga0068862_100590872 3300005844 Bacteria 1065
382 Ga0068862_101039616 3300005844 Bacteria 812
383 Ga0068862_101097672 3300005844 Bacteria 791
384 Ga0068862_101459169 3300005844 Bacteria 689
385 Ga0068862_101594291 3300005844 Bacteria 660
386 Ga0068862_101961398 3300005844 Bacteria 596
387 Ga0081455_10800432 3300005937 Bacteria 592
388 Ga0070717_10213212 3300006028 Bacteria 1695
389 Ga0075364_10102673 3300006051 Bacteria 1904
390 Ga0075432_10311200 3300006058 Bacteria 657
391 Ga0075432_10434716 3300006058 Bacteria 573
392 Ga0070715_10065850 3300006163 Bacteria 1605
393 Ga0070715_10457432 3300006163 Bacteria 722
394 Ga0070716_100004886 3300006173 Bacteria 6447
395 Ga0070716_100171570 3300006173 Bacteria 1416
396 Ga0070716_101690437 3300006173 Bacteria 522
397 Ga0070712_100436871 3300006175 Bacteria 1088
398 Ga0070712_101902792 3300006175 Bacteria 521
399 Ga0075362_10638651 3300006177 Bacteria 552
400 Ga0075366_10104654 3300006195 Bacteria 1700
401 Ga0097621_100963727 3300006237 Bacteria 797
402 Ga0097621_101217495 3300006237 Bacteria 709
403 Ga0097621_101281850 3300006237 Bacteria 692
404 Ga0075370_10322826 3300006353 Bacteria 920
405 Ga0068871_100375186 3300006358 Bacteria 1262
406 Ga0068871_100391742 3300006358 Bacteria 1236
407 Ga0068871_101463415 3300006358 Bacteria 645
408 Ga0068871_101608985 3300006358 Bacteria 615
409 Ga0075428_100446670 3300006844 Bacteria 1385
410 Ga0075428_100835125 3300006844 Bacteria 979
411 Ga0075428_101479644 3300006844 Bacteria 712
412 Ga0075428_102526401 3300006844 Bacteria 526
413 Ga0075430_100715140 3300006846 Bacteria 826
414 Ga0075430_100929367 3300006846 Bacteria 717
415 Ga0075431_100136198 3300006847 Bacteria 2532
416 Ga0075431_100147269 3300006847 Bacteria 2426
417 Ga0075431_100341443 3300006847 Bacteria 1507
418 Ga0075431_100591123 3300006847 Bacteria 1095
419 Ga0075433_10409775 3300006852 Bacteria 1196
420 Ga0075433_10468029 3300006852 Bacteria 1110
421 Ga0075434_100506556 3300006871 Bacteria 1228
422 Ga0075434_100702695 3300006871 Bacteria 1029
423 Ga0075434_101129355 3300006871 Bacteria 797
424 Ga0075429_101074736 3300006880 Bacteria 703
425 Ga0068865_100005654 3300006881 Bacteria 7590
426 Ga0068865_100407770 3300006881 Bacteria 1114
427 Ga0068865_100755444 3300006881 Bacteria 835
428 Ga0075436_100008314 3300006914 Bacteria 7099
429 Ga0075436_100389956 3300006914 Bacteria 1008
430 Ga0075436_100910751 3300006914 Bacteria 658
431 Ga0075436_100913257 3300006914 Bacteria 657
432 Ga0075436_100990790 3300006914 Bacteria 630
433 Ga0097620_100629275 3300006931 Bacteria 1165
434 Ga0097620_100885962 3300006931 Bacteria 978
435 Ga0097620_100937552 3300006931 Bacteria 949
436 Ga0097620_101283884 3300006931 Bacteria 807
437 Ga0097620_101764035 3300006931 Bacteria 684
438 Ga0075435_100170485 3300007076 Bacteria 1836
439 Ga0075435_101211370 3300007076 Bacteria 661
440 Ga0075435_101427843 3300007076 Bacteria 607
441 Ga0105240_10208118 3300009093 Unclassified 2288
442 Ga0105240_10225714 3300009093 Bacteria 2179
443 Ga0105240_10747923 3300009093 Bacteria 1063
444 Ga0105240_11157464 3300009093 Bacteria 821
445 Ga0111539_10433129 3300009094 Bacteria 1531
446 Ga0111539_10567643 3300009094 Bacteria 1321
447 Ga0111539_10691486 3300009094 Bacteria 1187
448 Ga0111539_11315244 3300009094 Bacteria 839
449 Ga0105245_10000082 3300009098 Bacteria 95636
450 Ga0105245_10025517 3300009098 Bacteria 5198
451 Ga0105245_10161584 3300009098 Bacteria 2126
452 Ga0105247_10193790 3300009101 Bacteria 1362
453 Ga0114129_10150508 3300009147 Bacteria 3185
454 Ga0114129_10331483 3300009147 Bacteria 2020
455 Ga0114129_10393376 3300009147 Bacteria 1828
456 Ga0114129_10507958 3300009147 Bacteria 1573
457 Ga0114129_10968006 3300009147 Bacteria 1074
458 Ga0114129_11187811 3300009147 Bacteria 951
459 Ga0114129_11409747 3300009147 Bacteria 859
460 Ga0114129_11798651 3300009147 Bacteria 745
461 Ga0114129_13403684 3300009147 Bacteria 511
462 Ga0105243_10003111 3300009148 Bacteria 13635
463 Ga0105243_10392916 3300009148 Bacteria 1286
464 Ga0105241_10009451 3300009174 Bacteria 7161
465 Ga0105241_10543631 3300009174 Bacteria 1042
466 Ga0105241_10717181 3300009174 Bacteria 914
467 Ga0105241_11800170 3300009174 Bacteria 598
468 Ga0105242_10003345 3300009176 Bacteria 12474
469 Ga0105242_10023463 3300009176 Bacteria 4861
470 Ga0105242_10647666 3300009176 Bacteria 1027
471 Ga0105242_10667366 3300009176 Bacteria 1013
472 Ga0105242_11760108 3300009176 Bacteria 657
473 Ga0105242_11814616 3300009176 Unclassified 648
474 Ga0105248_10026828 3300009177 Bacteria 6408
475 Ga0105248_10282138 3300009177 Bacteria 1870
476 Ga0105248_10623999 3300009177 Bacteria 1216
477 Ga0105248_13432348 3300009177 Bacteria 503
478 Ga0105248_13461920 3300009177 Bacteria 501
479 Ga0105237_10281100 3300009545 Bacteria 1667
480 Ga0105237_11289889 3300009545 Bacteria 737
481 Ga0105237_12221910 3300009545 Bacteria 558
482 Ga0105238_10231835 3300009551 Bacteria 1823
483 Ga0105238_10275029 3300009551 Bacteria 1665
484 Ga0105238_10321897 3300009551 Bacteria 1532
485 Ga0105238_10472384 3300009551 Bacteria 1253
486 Ga0105238_10953504 3300009551 Bacteria 878
487 Ga0105238_11734694 3300009551 Bacteria 656
488 Ga0105249_10030534 3300009553 Bacteria 4872
489 Ga0105249_11024306 3300009553 Bacteria 895
490 Ga0105249_11625372 3300009553 Bacteria 719
491 Ga0105249_11918672 3300009553 Bacteria 665
492 Ga0105249_12648435 3300009553 Bacteria 574
493 Ga0105239_10005836 3300010375 Bacteria 14347
494 Ga0105239_10159505 3300010375 Bacteria 2519
495 Ga0105239_10881783 3300010375 Bacteria 1027
496 Ga0105246_10262910 3300011119 Bacteria 1375
497 Ga0105246_10496521 3300011119 Bacteria 1035
498 Ga0157329_1024032 3300012491 Bacteria 592
499 Ga0157345_1033817 3300012498 Bacteria 586
500 Ga0157327_1006565 3300012512 Bacteria 983
501 Ga0157373_10206900 3300013100 Bacteria 1383
502 Ga0157373_10223200 3300013100 Bacteria 1330
503 Ga0157373_10248359 3300013100 Bacteria 1258
504 Ga0157373_10522516 3300013100 Bacteria 859
505 Ga0157373_11271784 3300013100 Bacteria 556
506 Ga0157371_10224768 3300013102 Bacteria 1348
507 Ga0157371_10272488 3300013102 Bacteria 1222
508 Ga0157371_10422242 3300013102 Bacteria 978
509 Ga0157370_10044459 3300013104 Bacteria 4269
510 Ga0157370_10152532 3300013104 Bacteria 2150
511 Ga0157370_10815091 3300013104 Bacteria 849
512 Ga0157370_11458628 3300013104 Bacteria 615
513 Ga0157369_10070857 3300013105 Bacteria 3744
514 Ga0157369_10073266 3300013105 Bacteria 3675
515 Ga0157369_12086848 3300013105 Bacteria 575
516 Ga0157374_10684999 3300013296 Bacteria 1038
517 Ga0157378_10000577 3300013297 Bacteria 34569
518 Ga0157378_10162097 3300013297 Bacteria 2092
519 Ga0157378_11034898 3300013297 Bacteria 856
520 Ga0157378_11353924 3300013297 Bacteria 754
521 Ga0163162_10429741 3300013306 Bacteria 1453
522 Ga0163162_10872426 3300013306 Bacteria 1014
523 Ga0163162_12717583 3300013306 Bacteria 570
524 Ga0157372_10081879 3300013307 Bacteria 3654
525 Ga0157372_10147504 3300013307 Bacteria 2713
526 Ga0157372_10227076 3300013307 Bacteria 2164
527 Ga0157372_10295081 3300013307 Bacteria 1885
528 Ga0157372_10453519 3300013307 Bacteria 1494
529 Ga0157372_10893734 3300013307 Bacteria 1031
530 Ga0157372_12513007 3300013307 Bacteria 591
531 Ga0157375_10047633 3300013308 Bacteria 4188
532 Ga0157375_10733745 3300013308 Bacteria 1140
533 Ga0157375_11140263 3300013308 Bacteria 913
534 Ga0157375_11230699 3300013308 Bacteria 879
535 Ga0157375_12909552 3300013308 Bacteria 572
536 Ga0163163_10117853 3300014325 Bacteria 2687
537 Ga0163163_11350123 3300014325 Bacteria 775
538 Ga0157380_10365752 3300014326 Bacteria 1355
539 Ga0157380_10881154 3300014326 Bacteria 919
540 Ga0157380_12539380 3300014326 Bacteria 578
541 Ga0182008_10348653 3300014497 Bacteria 785
542 Ga0157377_10030601 3300014745 Bacteria 2917
543 Ga0157377_11012458 3300014745 Bacteria 630
544 Ga0157377_11085084 3300014745 Bacteria 612
545 Ga0157379_10275152 3300014968 Bacteria 1531
546 Ga0157379_11097937 3300014968 Bacteria 762
547 Ga0157376_10025735 3300014969 Bacteria 4638
548 Ga0157376_10396069 3300014969 Bacteria 1334
549 Ga0157376_11231086 3300014969 Bacteria 777
550 Ga0157376_11969980 3300014969 Bacteria 622
551 Ga0157376_12187452 3300014969 Bacteria 592
552 Ga0163161_10078147 3300017792 Bacteria 2432
553 Ga0206355_1229164 3300020076 Bacteria 1392
554 Ga0206355_1675750 3300020076 Bacteria 590
555 Ga0206355_1700556 3300020076 Bacteria 528
556 Ga0206351_10347809 3300020077 Bacteria 614
557 Ga0206351_10550909 3300020077 Bacteria 683
558 Ga0206351_10662335 3300020077 Bacteria 1078
559 Ga0206351_10734128 3300020077 Bacteria 732
560 Ga0206352_11006934 3300020078 Bacteria 650
561 Ga0206350_10009095 3300020080 Bacteria 1019
562 Ga0206350_11339704 3300020080 Bacteria 611
563 Ga0206350_11600674 3300020080 Bacteria 2001
564 Ga0206354_11041843 3300020081 Bacteria 792
565 Ga0206353_10256562 3300020082 Bacteria 821
566 Ga0206353_11560491 3300020082 Bacteria 936
567 Ga0154015_1166432 3300020610 Bacteria 843
568 Ga0154015_1563880 3300020610 Bacteria 725
569 Ga0224712_10102578 3300022467 Bacteria 1215
570 Ga0224712_10383109 3300022467 Bacteria 668
571 Ga0256744_150842 3300023309 Bacteria 812
572 Ga0207697_10018429 3300025315 Bacteria 2863
573 Ga0207697_10145258 3300025315 Bacteria 1030
574 Ga0207656_10104086 3300025321 Bacteria 1304
575 Ga0207653_10427838 3300025885 Bacteria 519
576 Ga0207682_10048598 3300025893 Bacteria 1749
577 Ga0207682_10055623 3300025893 Bacteria 1646
578 Ga0207682_10138248 3300025893 Bacteria 1092
579 Ga0207692_10161191 3300025898 Bacteria 1293
580 Ga0207642_10000405 3300025899 Bacteria 12984
581 Ga0207688_10166726 3300025901 Bacteria 1308
582 Ga0207680_10032117 3300025903 Bacteria 2981
583 Ga0207647_10244479 3300025904 Bacteria 1030
584 Ga0207685_10403253 3300025905 Bacteria 701
585 Ga0207699_10034084 3300025906 Bacteria 2884
586 Ga0207699_10319613 3300025906 Bacteria 1088
587 Ga0207645_10005407 3300025907 Bacteria 9262
588 Ga0207645_10017875 3300025907 Bacteria 4676
589 Ga0207645_10135011 3300025907 Bacteria 1607
590 Ga0207645_10217388 3300025907 Bacteria 1259
591 Ga0207645_11055275 3300025907 Bacteria 549
592 Ga0207643_10003848 3300025908 Bacteria 8076
593 Ga0207643_10413708 3300025908 Bacteria 854
594 Ga0207643_11002474 3300025908 Bacteria 540
595 Ga0207705_10024161 3300025909 Bacteria 4337
596 Ga0207705_10395806 3300025909 Bacteria 1068
597 Ga0207705_10764772 3300025909 Bacteria 750
598 Ga0207705_10972144 3300025909 Bacteria 656
599 Ga0207684_10059226 3300025910 Bacteria 3251
600 Ga0207684_10119427 3300025910 Bacteria 2260
601 Ga0207684_11272122 3300025910 Bacteria 607
602 Ga0207654_10429889 3300025911 Bacteria 923
603 Ga0207654_10527224 3300025911 Bacteria 837
604 Ga0207654_10715486 3300025911 Bacteria 720
605 Ga0207707_10004691 3300025912 Bacteria 12001
606 Ga0207707_10070111 3300025912 Bacteria 3055
607 Ga0207707_10129960 3300025912 Bacteria 2203
608 Ga0207707_10267494 3300025912 Bacteria 1482
609 Ga0207707_10598707 3300025912 Bacteria 933
610 Ga0207707_10775716 3300025912 Bacteria 800
611 Ga0207707_10837354 3300025912 Bacteria 764
612 Ga0207707_10893897 3300025912 Bacteria 735
613 Ga0207707_11179558 3300025912 Bacteria 621
614 Ga0207695_10192700 3300025913 Bacteria 1955
615 Ga0207695_10301987 3300025913 Bacteria 1492
616 Ga0207695_10377356 3300025913 Bacteria 1304
617 Ga0207695_10856306 3300025913 Bacteria 789
618 Ga0207671_10702703 3300025914 Bacteria 804
619 Ga0207693_10319734 3300025915 Bacteria 1215
620 Ga0207663_10066171 3300025916 Bacteria 2312
621 Ga0207663_10320756 3300025916 Bacteria 1164
622 Ga0207663_11244044 3300025916 Bacteria 600
623 Ga0207660_10001699 3300025917 Bacteria 14765
624 Ga0207660_10061959 3300025917 Bacteria 2694
625 Ga0207660_10120341 3300025917 Bacteria 1988
626 Ga0207660_10188180 3300025917 Bacteria 1606
627 Ga0207660_10200051 3300025917 Bacteria 1560
628 Ga0207660_10247526 3300025917 Bacteria 1406
629 Ga0207660_10302396 3300025917 Bacteria 1274
630 Ga0207660_10530818 3300025917 Bacteria 956
631 Ga0207660_10840584 3300025917 Bacteria 749
632 Ga0207660_10990615 3300025917 Bacteria 686
633 Ga0207662_10002838 3300025918 Bacteria 8759
634 Ga0207662_10145691 3300025918 Bacteria 1503
635 Ga0207657_10035732 3300025919 Bacteria 4453
636 Ga0207657_10141222 3300025919 Bacteria 1967
637 Ga0207657_10251232 3300025919 Bacteria 1409
638 Ga0207657_10619799 3300025919 Bacteria 843
639 Ga0207649_10123547 3300025920 Bacteria 1748
640 Ga0207649_10363850 3300025920 Bacteria 1074
641 Ga0207649_10477255 3300025920 Bacteria 945
642 Ga0207649_10748592 3300025920 Bacteria 760
643 Ga0207649_11479492 3300025920 Bacteria 538
644 Ga0207649_11485440 3300025920 Bacteria 536
645 Ga0207652_10010917 3300025921 Bacteria 7321
646 Ga0207652_10045176 3300025921 Bacteria 3754
647 Ga0207652_10139310 3300025921 Bacteria 2168
648 Ga0207652_10196417 3300025921 Bacteria 1815
649 Ga0207652_10295615 3300025921 Bacteria 1461
650 Ga0207652_10330421 3300025921 Bacteria 1376
651 Ga0207652_10433045 3300025921 Bacteria 1186
652 Ga0207652_10546292 3300025921 Bacteria 1041
653 Ga0207652_10584527 3300025921 Bacteria 1002
654 Ga0207652_10652349 3300025921 Bacteria 941
655 Ga0207652_10673396 3300025921 Bacteria 924
656 Ga0207646_10001673 3300025922 Bacteria 27062
657 Ga0207646_10033666 3300025922 Bacteria 4632
658 Ga0207646_10168228 3300025922 Bacteria 1979
659 Ga0207646_10419294 3300025922 Bacteria 1208
660 Ga0207646_10573772 3300025922 Bacteria 1013
661 Ga0207646_10776853 3300025922 Bacteria 854
662 Ga0207646_10863831 3300025922 Bacteria 804
663 Ga0207681_10002648 3300025923 Bacteria 11344
664 Ga0207681_10273253 3300025923 Bacteria 1327
665 Ga0207694_10009441 3300025924 Bacteria 7355
666 Ga0207694_10521156 3300025924 Bacteria 996
667 Ga0207694_10552811 3300025924 Bacteria 966
668 Ga0207694_10719173 3300025924 Bacteria 842
669 Ga0207694_10910627 3300025924 Bacteria 744
670 Ga0207650_10053915 3300025925 Bacteria 2981
671 Ga0207659_10000902 3300025926 Bacteria 17672
672 Ga0207659_10091679 3300025926 Bacteria 2270
673 Ga0207659_10384418 3300025926 Bacteria 1171
674 Ga0207659_11595348 3300025926 Bacteria 557
675 Ga0207687_10000288 3300025927 Bacteria 34782
676 Ga0207687_10109312 3300025927 Bacteria 2048
677 Ga0207687_10175767 3300025927 Bacteria 1655
678 Ga0207687_10196971 3300025927 Bacteria 1572
679 Ga0207700_10356570 3300025928 Bacteria 1274
680 Ga0207700_10424367 3300025928 Bacteria 1169
681 Ga0207664_10051400 3300025929 Bacteria 3254
682 Ga0207664_10094655 3300025929 Bacteria 2455
683 Ga0207644_10007504 3300025931 Bacteria 7112
684 Ga0207644_10088997 3300025931 Bacteria 2297
685 Ga0207644_10276806 3300025931 Bacteria 1346
686 Ga0207690_10136294 3300025932 Bacteria 1803
687 Ga0207690_10189337 3300025932 Bacteria 1555
688 Ga0207690_11409742 3300025932 Bacteria 582
689 Ga0207706_10000105 3300025933 Bacteria 88610
690 Ga0207706_10076892 3300025933 Bacteria 2936
691 Ga0207706_10089932 3300025933 Bacteria 2699
692 Ga0207706_10436537 3300025933 Bacteria 1134
693 Ga0207706_10444829 3300025933 Bacteria 1121
694 Ga0207706_10899012 3300025933 Bacteria 748
695 Ga0207706_11100982 3300025933 Bacteria 664
696 Ga0207686_10000323 3300025934 Bacteria 34416
697 Ga0207686_10497711 3300025934 Bacteria 945
698 Ga0207686_11109485 3300025934 Bacteria 645
699 Ga0207709_10001805 3300025935 Bacteria 14313
700 Ga0207709_10191320 3300025935 Bacteria 1454
701 Ga0207670_10009329 3300025936 Bacteria 5596
702 Ga0207670_10999456 3300025936 Bacteria 704
703 Ga0207669_10012485 3300025937 Bacteria 4179
704 Ga0207669_10297958 3300025937 Bacteria 1224
705 Ga0207669_11399657 3300025937 Bacteria 595
706 Ga0207665_10000486 3300025939 Bacteria 26908
707 Ga0207665_10880324 3300025939 Bacteria 710
708 Ga0207691_10887326 3300025940 Bacteria 747
709 Ga0207691_11191058 3300025940 Bacteria 632
710 Ga0207691_11247499 3300025940 Bacteria 615
711 Ga0207711_10009631 3300025941 Bacteria 8049
712 Ga0207711_10617721 3300025941 Bacteria 1011
713 Ga0207711_10870341 3300025941 Bacteria 838
714 Ga0207711_11530862 3300025941 Bacteria 610
715 Ga0207689_10018455 3300025942 Bacteria 5887
716 Ga0207689_10157603 3300025942 Bacteria 1871
717 Ga0207689_10511255 3300025942 Bacteria 1007
718 Ga0207689_11040244 3300025942 Bacteria 691
719 Ga0207689_11431291 3300025942 Bacteria 579
720 Ga0207661_10006266 3300025944 Bacteria 8414
721 Ga0207661_10107789 3300025944 Bacteria 2350
722 Ga0207661_10380586 3300025944 Bacteria 1277
723 Ga0207661_10640929 3300025944 Bacteria 976
724 Ga0207661_11205630 3300025944 Bacteria 696
725 Ga0207661_11558771 3300025944 Bacteria 605
726 Ga0207661_11962204 3300025944 Bacteria 531
727 Ga0207679_10010117 3300025945 Bacteria 6064
728 Ga0207679_10193448 3300025945 Bacteria 1693
729 Ga0207679_10291104 3300025945 Bacteria 1404
730 Ga0207679_10543840 3300025945 Bacteria 1041
731 Ga0207679_11014810 3300025945 Bacteria 761
732 Ga0207679_11481074 3300025945 Bacteria 623
733 Ga0207679_11646702 3300025945 Bacteria 588
734 Ga0207667_10029258 3300025949 Bacteria 5975
735 Ga0207667_10031423 3300025949 Bacteria 5732
736 Ga0207667_10239433 3300025949 Bacteria 1857
737 Ga0207667_10927691 3300025949 Bacteria 861
738 Ga0207667_11082659 3300025949 Bacteria 785
739 Ga0207667_11904797 3300025949 Bacteria 557
740 Ga0207651_10092780 3300025960 Bacteria 2215
741 Ga0207651_10121830 3300025960 Bacteria 1979
742 Ga0207651_10572322 3300025960 Bacteria 984
743 Ga0207651_10627053 3300025960 Bacteria 942
744 Ga0207651_11996530 3300025960 Bacteria 521
745 Ga0207712_10024599 3300025961 Bacteria 3991
746 Ga0207712_10700092 3300025961 Bacteria 884
747 Ga0207712_11455101 3300025961 Bacteria 613
748 Ga0207712_11567463 3300025961 Unclassified 590
749 Ga0207668_10311790 3300025972 Bacteria 1302
750 Ga0207668_10358350 3300025972 Bacteria 1221
751 Ga0207640_10004935 3300025981 Bacteria 7248
752 Ga0207640_10016300 3300025981 Bacteria 4319
753 Ga0207640_10043092 3300025981 Bacteria 2882
754 Ga0207640_10164632 3300025981 Bacteria 1645
755 Ga0207640_10407637 3300025981 Bacteria 1109
756 Ga0207640_10528203 3300025981 Bacteria 987
757 Ga0207640_10679627 3300025981 Bacteria 880
758 Ga0207640_11608610 3300025981 Bacteria 585
759 Ga0207640_12199657 3300025981 Bacteria 501
760 Ga0207658_10472545 3300025986 Bacteria 1113
761 Ga0207658_10731189 3300025986 Bacteria 895
762 Ga0207658_10998264 3300025986 Bacteria 764
763 Ga0207677_10006894 3300026023 Bacteria 6245
764 Ga0207677_10013904 3300026023 Bacteria 4678
765 Ga0207677_10198868 3300026023 Bacteria 1591
766 Ga0207703_10022018 3300026035 Bacteria 4992
767 Ga0207703_10067157 3300026035 Bacteria 2951
768 Ga0207703_11200295 3300026035 Bacteria 729
769 Ga0207703_12250013 3300026035 Bacteria 521
770 Ga0207639_10005399 3300026041 Bacteria 8643
771 Ga0207639_10575069 3300026041 Bacteria 1037
772 Ga0207639_12260585 3300026041 Bacteria 505
773 Ga0207678_10011920 3300026067 Bacteria 7635
774 Ga0207678_10059909 3300026067 Bacteria 3275
775 Ga0207678_10272137 3300026067 Bacteria 1452
776 Ga0207678_10443592 3300026067 Bacteria 1127
777 Ga0207678_11164862 3300026067 Bacteria 683
778 Ga0207708_10019638 3300026075 Bacteria 5096
779 Ga0207708_10025473 3300026075 Bacteria 4474
780 Ga0207708_10211327 3300026075 Bacteria 1551
781 Ga0207708_11753825 3300026075 Bacteria 545
782 Ga0207702_10024571 3300026078 Bacteria 5000
783 Ga0207702_10146028 3300026078 Bacteria 2146
784 Ga0207702_10217218 3300026078 Bacteria 1780
785 Ga0207702_10835587 3300026078 Bacteria 911
786 Ga0207702_10891786 3300026078 Bacteria 881
787 Ga0207641_10063850 3300026088 Bacteria 3146
788 Ga0207641_10128053 3300026088 Bacteria 2276
789 Ga0207641_11908720 3300026088 Bacteria 595
790 Ga0207641_12343158 3300026088 Bacteria 533
791 Ga0207648_10000284 3300026089 Bacteria 55162
792 Ga0207648_10045452 3300026089 Bacteria 3851
793 Ga0207648_10374992 3300026089 Bacteria 1286
794 Ga0207676_10283086 3300026095 Bacteria 1506
795 Ga0207676_10301287 3300026095 Bacteria 1464
796 Ga0207676_10468466 3300026095 Bacteria 1191
797 Ga0207676_10998438 3300026095 Bacteria 825
798 Ga0207676_11021709 3300026095 Bacteria 815
799 Ga0207676_11488756 3300026095 Bacteria 674
800 Ga0207676_11608624 3300026095 Bacteria 647
801 Ga0207676_11792619 3300026095 Bacteria 612
802 Ga0207674_10008143 3300026116 Bacteria 12151
803 Ga0207674_10019801 3300026116 Bacteria 7282
804 Ga0207674_10631637 3300026116 Bacteria 1034
805 Ga0207674_10677041 3300026116 Bacteria 996
806 Ga0207674_10734191 3300026116 Bacteria 953
807 Ga0207674_10775844 3300026116 Bacteria 925
808 Ga0207674_11036545 3300026116 Bacteria 790
809 Ga0207675_100033436 3300026118 Bacteria 4791
810 Ga0207675_100208012 3300026118 Bacteria 1881
811 Ga0207675_100421917 3300026118 Bacteria 1317
812 Ga0207683_10007614 3300026121 Bacteria 9274
813 Ga0207683_10193544 3300026121 Bacteria 1847
814 Ga0207698_10005024 3300026142 Bacteria 8116
815 Ga0207698_10033457 3300026142 Bacteria 3736
816 Ga0207698_10040229 3300026142 Bacteria 3471
817 Ga0207698_10472832 3300026142 Bacteria 1214
818 Ga0207698_10707898 3300026142 Bacteria 1003
819 Ga0209967_1046460 3300027364 Bacteria 664
820 Ga0210000_1037007 3300027462 Bacteria 770
821 Ga0209995_1034417 3300027471 Bacteria 851
822 Ga0209968_1090654 3300027526 Bacteria 554
823 Ga0209999_1002779 3300027543 Bacteria 3097
824 Ga0210002_1016324 3300027617 Bacteria 1174
825 Ga0209971_1052119 3300027682 Bacteria 989
826 Ga0209998_10022296 3300027717 Bacteria 1365
827 Ga0209974_10052889 3300027876 Bacteria 1367
828 Ga0207428_10453432 3300027907 Bacteria 935
829 Ga0207428_10607995 3300027907 Bacteria 787
830 Ga0268266_10004596 3300028379 Bacteria 13175
831 Ga0268266_10868934 3300028379 Bacteria 872
832 Ga0268266_11949311 3300028379 Bacteria 561
833 Ga0268265_11603200 3300028380 Bacteria 656
834 Ga0268265_11876387 3300028380 Bacteria 606
835 Ga0268265_12198753 3300028380 Bacteria 559
836 Ga0268264_10159852 3300028381 Bacteria 2028
837 Ga0268264_10207215 3300028381 Bacteria 1798
838 Ga0268264_10659599 3300028381 Bacteria 1036
839 Ga0268264_10784427 3300028381 Bacteria 951
840 Ga0307517_10152441 3300028786 Bacteria 1581
841 Ga0265338_10253066 3300028800 Bacteria 1298
842 Ga0310982_107480 3300029283 Bacteria 705
843 Ga0265768_113673 3300030963 Bacteria 551
844 Ga0265332_10010941 3300031238 Bacteria 4030
845 Ga0307509_10000029 3300031507 Bacteria 215555
846 Ga0307509_10047926 3300031507 Bacteria 4593
847 Ga0307509_10077718 3300031507 Bacteria 3442
848 Ga0307408_100038948 3300031548 Bacteria 3356
849 Ga0307408_100042108 3300031548 Bacteria 3241
850 Ga0307408_100080846 3300031548 Bacteria 2428
851 Ga0307408_100127270 3300031548 Bacteria 1982
852 Ga0307408_100127488 3300031548 Bacteria 1981
853 Ga0307408_100281377 3300031548 Bacteria 1385
854 Ga0307408_100283082 3300031548 Bacteria 1381
855 Ga0307408_100341016 3300031548 Bacteria 1268
856 Ga0307408_100496108 3300031548 Bacteria 1068
857 Ga0307408_100818339 3300031548 Bacteria 847
858 Ga0307408_101251135 3300031548 Bacteria 694
859 Ga0307408_101623658 3300031548 Bacteria 614
860 Ga0307408_101680848 3300031548 Bacteria 604
861 Ga0307508_10172700 3300031616 Bacteria 1765
862 Ga0307508_10341816 3300031616 Bacteria 1088
863 Ga0316575_10057696 3300031665 Bacteria 1548
864 Ga0316578_10400910 3300031728 Bacteria 813
865 Ga0307516_10055293 3300031730 Bacteria 3875
866 Ga0307405_10004381 3300031731 Bacteria 6664
867 Ga0307405_10044041 3300031731 Bacteria 2727
868 Ga0307405_10079146 3300031731 Bacteria 2141
869 Ga0307405_10083608 3300031731 Bacteria 2093
870 Ga0307405_10147946 3300031731 Bacteria 1648
871 Ga0307405_10169124 3300031731 Bacteria 1557
872 Ga0307405_10573142 3300031731 Bacteria 917
873 Ga0307405_10747967 3300031731 Bacteria 814
874 Ga0307405_10820350 3300031731 Bacteria 781
875 Ga0307405_11125075 3300031731 Bacteria 676
876 Ga0307405_11354087 3300031731 Bacteria 621
877 Ga0316577_10048972 3300031733 Bacteria 2359
878 Ga0307413_10014416 3300031824 Bacteria 4014
879 Ga0307413_10035638 3300031824 Bacteria 2856
880 Ga0307413_10058773 3300031824 Bacteria 2358
881 Ga0307413_10059631 3300031824 Bacteria 2345
882 Ga0307413_10060403 3300031824 Bacteria 2333
883 Ga0307413_10087503 3300031824 Bacteria 2018
884 Ga0307413_10150582 3300031824 Bacteria 1620
885 Ga0307413_10218377 3300031824 Bacteria 1390
886 Ga0307413_10342224 3300031824 Bacteria 1151
887 Ga0307413_10392207 3300031824 Bacteria 1085
888 Ga0307413_10468586 3300031824 Bacteria 1004
889 Ga0307410_10034302 3300031852 Bacteria 3285
890 Ga0307410_10065573 3300031852 Bacteria 2498
891 Ga0307410_10140619 3300031852 Bacteria 1785
892 Ga0307410_10207505 3300031852 Bacteria 1499
893 Ga0307410_10260410 3300031852 Bacteria 1352
894 Ga0307410_10382688 3300031852 Bacteria 1132
895 Ga0307410_10581451 3300031852 Bacteria 932
896 Ga0307410_10645984 3300031852 Bacteria 887
897 Ga0307410_11440394 3300031852 Bacteria 605
898 Ga0326468_10041234 3300031889 Bacteria 660
899 Ga0307406_10026696 3300031901 Bacteria 3471
900 Ga0307406_10131096 3300031901 Bacteria 1760
901 Ga0307406_10243877 3300031901 Bacteria 1349
902 Ga0307406_10370010 3300031901 Bacteria 1126
903 Ga0307406_10470084 3300031901 Bacteria 1013
904 Ga0307406_10633266 3300031901 Bacteria 886
905 Ga0307406_11685902 3300031901 Bacteria 561
906 Ga0307407_10011805 3300031903 Bacteria 4176
907 Ga0307407_10022385 3300031903 Bacteria 3278
908 Ga0307407_10082262 3300031903 Bacteria 1951
909 Ga0307407_10349400 3300031903 Bacteria 1047
910 Ga0307407_10369785 3300031903 Bacteria 1020
911 Ga0307407_10426655 3300031903 Bacteria 957
912 Ga0307407_10442645 3300031903 Bacteria 941
913 Ga0307407_10534508 3300031903 Bacteria 864
914 Ga0307407_10603483 3300031903 Bacteria 817
915 Ga0307407_10785336 3300031903 Bacteria 723
916 Ga0307407_10840624 3300031903 Bacteria 701
917 Ga0307407_11244714 3300031903 Bacteria 582
918 Ga0307407_11686280 3300031903 Bacteria 504
919 Ga0307412_10009640 3300031911 Bacteria 5546
920 Ga0307412_10016955 3300031911 Bacteria 4352
921 Ga0307412_10055983 3300031911 Bacteria 2626
922 Ga0307412_10157667 3300031911 Bacteria 1682
923 Ga0307412_10163670 3300031911 Bacteria 1656
924 Ga0307412_10165007 3300031911 Bacteria 1650
925 Ga0307412_10451830 3300031911 Bacteria 1059
926 Ga0307412_10729531 3300031911 Bacteria 853
927 Ga0307412_11114318 3300031911 Bacteria 703
928 Ga0307412_11501822 3300031911 Bacteria 612
929 Ga0307409_100044098 3300031995 Bacteria 3356
930 Ga0307409_100049673 3300031995 Bacteria 3199
931 Ga0307409_100101758 3300031995 Bacteria 2385
932 Ga0307409_100108550 3300031995 Bacteria 2321
933 Ga0307409_100170107 3300031995 Bacteria 1917
934 Ga0307409_100257418 3300031995 Bacteria 1599
935 Ga0307409_100395582 3300031995 Bacteria 1318
936 Ga0307409_100496453 3300031995 Bacteria 1187
937 Ga0307409_100847684 3300031995 Bacteria 924
938 Ga0307409_101259152 3300031995 Bacteria 764
939 Ga0307409_101304133 3300031995 Bacteria 751
940 Ga0307416_100158774 3300032002 Bacteria 2086
941 Ga0307416_100164768 3300032002 Bacteria 2054
942 Ga0307416_100167255 3300032002 Bacteria 2041
943 Ga0307416_100197546 3300032002 Bacteria 1904
944 Ga0307416_100203336 3300032002 Bacteria 1881
945 Ga0307416_100229017 3300032002 Bacteria 1790
946 Ga0307416_100318693 3300032002 Bacteria 1555
947 Ga0307416_100400679 3300032002 Bacteria 1409
948 Ga0307416_100588081 3300032002 Bacteria 1191
949 Ga0307416_100703942 3300032002 Bacteria 1099
950 Ga0307416_100747185 3300032002 Bacteria 1071
951 Ga0307416_100879121 3300032002 Bacteria 995
952 Ga0307416_100886965 3300032002 Bacteria 991
953 Ga0307416_101185740 3300032002 Bacteria 869
954 Ga0307416_101282796 3300032002 Bacteria 838
955 Ga0307416_101299562 3300032002 Bacteria 833
956 Ga0307416_102159419 3300032002 Bacteria 658
957 Ga0307416_102821040 3300032002 Bacteria 581
958 Ga0307416_103589622 3300032002 Bacteria 519
959 Ga0307414_10003807 3300032004 Bacteria 8111
960 Ga0307414_10067314 3300032004 Bacteria 2565
961 Ga0307414_10177225 3300032004 Bacteria 1711
962 Ga0307414_10347994 3300032004 Bacteria 1271
963 Ga0307414_10546906 3300032004 Bacteria 1031
964 Ga0307414_10810240 3300032004 Bacteria 854
965 Ga0307414_10821820 3300032004 Bacteria 848
966 Ga0307411_10010875 3300032005 Bacteria 4877
967 Ga0307411_10018853 3300032005 Bacteria 3970
968 Ga0307411_10034864 3300032005 Bacteria 3136
969 Ga0307411_10144361 3300032005 Bacteria 1759
970 Ga0307411_10396082 3300032005 Bacteria 1140
971 Ga0307411_10523286 3300032005 Bacteria 1007
972 Ga0307415_100003847 3300032126 Bacteria 7701
973 Ga0307415_100335641 3300032126 Bacteria 1266
974 Ga0307415_100745811 3300032126 Bacteria 888
975 Ga0307415_101177721 3300032126 Bacteria 721
976 Ga0307415_101297155 3300032126 Bacteria 689
977 Ga0307415_101449927 3300032126 Bacteria 655
978 Ga0307415_102081726 3300032126 Bacteria 554
979 Ga0307415_102533515 3300032126 Bacteria 505
980 Ga0316593_10406614 3300032168 Bacteria 527
981 Ga0307507_10187294 3300033179 Bacteria 1464
982 Ga0316596_1100435 3300033541 Bacteria 782
983 Ga0373948_0104669 3300034817 Bacteria 670
984 Ga0373950_0035776 3300034818 Bacteria 935
985 Ga0373958_0040713 3300034819 Bacteria 949
986 Ga0373959_0050477 3300034820 Bacteria 897
987 Ga0373938_0063141 3300034957 Bacteria 871
988 Ga0373926_0287478 3300035083 Bacteria 641
989 Ga0373929_0086202 3300035085 Bacteria 773
990 Ga0373949_0005273 3300035090 Bacteria 2891
991 Ga0373949_0032384 3300035090 Bacteria 1251
992 Ga0373949_0041542 3300035090 Bacteria 1132
993 Ga0373949_0130164 3300035090 Bacteria 713
994 Ga0373932_0194997 3300035112 Bacteria 717
995 Ga0373936_0000001 3300035113 Bacteria 456155
996 Ga0373939_0166704 3300035114 Bacteria 812
997 Ga0373939_0200844 3300035114 Bacteria 754
998 Ga0373941_0133309 3300035115 Bacteria 897
999 Ga0373956_0332661 3300035119 Bacteria 724
1000 Ga0373956_0421403 3300035119 Bacteria 637
1001 Ga0373960_0387443 3300035121 Bacteria 537
1002 Ga0373946_0344464 3300035171 Bacteria 744
1003 Ga0373955_0587387 3300035172 Bacteria 682
1004 Ga0373942_0104818 3300035207 Bacteria 868
1005 Ga0373961_0000001 3300035241 Bacteria 199721
1006 Ga0373961_0034817 3300035241 Bacteria 1426
1007 Ga0373961_0166180 3300035241 Bacteria 761
1008 Ga0373962_0251979 3300035242 Bacteria 613
1009 Ga0316574_0063591 3300035398 Bacteria 2321
1010 Ga0316574_0969945 3300035398 Bacteria 512
1011 Ga0373931_0203221 3300035691 Bacteria 1185
1012 Ga0373931_0462043 3300035691 Bacteria 813
1013 Ga0373931_0540172 3300035691 Bacteria 756
1014 Ga0373931_0865850 3300035691 Bacteria 606
1015 Ga0373933_0885142 3300035724 Bacteria 588
1016 Ga0373947_0563508 3300035725 Bacteria 776
1017 Ga0373937_1480800 3300036401 Bacteria 626
1018 Ga0316584_0074425 3300036712 Bacteria 2546
1019 Ga0395899_0011864 3300037312 Bacteria 6671
1020 Ga0395899_0124689 3300037312 Bacteria 1842
1021 Ga0395900_1277603 3300037418 Bacteria 648
1022 Ga0395900_1428789 3300037418 Bacteria 605
1023 Ga0395900_1656624 3300037418 Bacteria 551
1024 Ga0395898_0038342 3300037466 Bacteria 4750
1025 Ga0395905_0119324 3300037471 Bacteria 2479
1026 Ga0395905_0441651 3300037471 Bacteria 1198
1027 Ga0395905_0777548 3300037471 Bacteria 860
1028 Ga0395905_1417469 3300037471 Bacteria 599
1029 Ga0395901_0182000 3300038443 Bacteria 2204
1030 Ga0395901_1988056 3300038443 Bacteria 528
1031 Ga0242419_005398 3300038698 Bacteria 909
1032 Ga0242420_004350 3300038996 Bacteria 2138
1033 Ga0242420_006711 3300038996 Bacteria 1825
1034 Ga0436365_1236418 3300039437 Bacteria 885
1035 Ga0436365_1827961 3300039437 Bacteria 1303
1036 Ga0436363_0933504 3300039450 Bacteria 2032
1037 Ga0439436_0020957 3300041404 Bacteria 1945
1038 Ga0439436_0032287 3300041404 Bacteria 1518
1039 Ga0439438_063807 3300041405 Bacteria 919
1040 Ga0439439_0115416 3300041406 Bacteria 746
1041 Ga0439447_057324 3300041407 Bacteria 921
1042 Ga0439461_0044522 3300041410 Bacteria 968
1043 Ga0439461_0166033 3300041410 Bacteria 578
1044 Ga0439466_0047339 3300041411 Bacteria 1417
1045 Ga0439466_0079827 3300041411 Bacteria 1033
1046 Ga0439465_0323764 3300041413 Bacteria 579
1047 Ga0451789_0947159 3300041443 Bacteria 758
1048 Ga0451791_1316043 3300041451 Bacteria 549
1049 Ga0451802_0276746 3300041460 Bacteria 661
1050 Ga0451805_081734 3300041461 Bacteria 744
1051 Ga0451808_06737 3300041464 Bacteria 622
1052 Ga0451807_0294446 3300041486 Bacteria 968
1053 Ga0451807_1937924 3300041486 Bacteria 536
1054 Ga0451835_0596095 3300041492 Bacteria 944
1055 Ga0451841_0658728 3300041498 Bacteria 756
1056 Ga0451849_1401345 3300041505 Bacteria 2121
1057 Ga0451851_0196687 3300041507 Bacteria 1087
1058 Ga0451855_1580001 3300041511 Bacteria 1051
1059 Ga0451853_1965433 3300041512 Bacteria 1506
1060 Ga0439433_0003003 3300041999 Bacteria 3615
1061 Ga0439433_0039156 3300041999 Bacteria 1100
1062 Ga0439442_000012 3300042002 Bacteria 49187
1063 Ga0439443_091325 3300042003 Bacteria 575
1064 Ga0439445_0136378 3300042004 Bacteria 710
1065 Ga0439432_097365 3300042006 Bacteria 882
1066 Ga0439449_0029379 3300042007 Bacteria 2048
1067 Ga0439449_0033278 3300042007 Bacteria 1920
1068 Ga0439455_0065069 3300042012 Bacteria 972
1069 Ga0439457_035060 3300042014 Bacteria 1115
1070 Ga0439462_0023095 3300042015 Bacteria 1630
1071 Ga0450911_012401 3300042115 Bacteria 1153
1072 Ga0450920_004890 3300042122 Bacteria 2368
1073 Ga0450920_006036 3300042122 Bacteria 2168
1074 Ga0450898_045670 3300042134 Bacteria 837
1075 Ga0450906_028800 3300042145 Bacteria 983
1076 Ga0450907_000415 3300042146 Bacteria 12830
1077 Ga0450907_021368 3300042146 Bacteria 1088
1078 Ga0450910_060166 3300042147 Bacteria 640
1079 Ga0450908_006541 3300042184 Bacteria 2209
1080 Ga0439434_0000031 3300042435 Bacteria 33054
1081 Ga0439434_0023852 3300042435 Bacteria 1843
1082 Ga0439434_0057754 3300042435 Bacteria 1210
1083 Ga0439434_0178087 3300042435 Bacteria 711
1084 Ga0439444_0132977 3300042437 Bacteria 590
1085 Ga0439444_0152842 3300042437 Bacteria 559
1086 Ga0450918_000869 3300042531 Bacteria 6368
1087 Ga0451577_0000001 3300042876 Bacteria 2461803
1088 Ga0451577_0018850 3300042876 Bacteria 6351
1089 Ga0451577_0461331 3300042876 Bacteria 1154
1090 Ga0453683_0163376 3300044673 Bacteria 1409
1091 Ga0466965_0687816 3300044683 Bacteria 586
1092 Ga0466966_0013970 3300044684 Bacteria 5316
1093 Ga0453684_0019316 3300044712 Bacteria 10386
1094 Ga0453684_0677429 3300044712 Bacteria 1123
1095 Ga0466970_0822108 3300044765 Bacteria 545
1096 Ga0466959_0072807 3300045049 Bacteria 2486
1097 Ga0451576_1145132 3300045051 Bacteria 813
1098 Ga0451576_1570374 3300045051 Bacteria 683
1099 Ga0466967_1576409 3300045976 Bacteria 654
1100 Ga0495590_0104703 3300046457 Bacteria 1007
1101 Ga0495584_0401090 3300046491 Bacteria 697
1102 Ga0495585_0310154 3300046492 Bacteria 774
1103 Ga0495594_0380017 3300046499 Bacteria 804
1104 Ga0495620_0357079 3300046515 Bacteria 554
1105 Ga0495630_0263965 3300046517 Bacteria 1315
1106 Ga0495663_0401218 3300046525 Bacteria 504
1107 Ga0495586_0078526 3300046535 Bacteria 1811
1108 Ga0495587_0309835 3300046536 Bacteria 882
1109 Ga0495621_0032870 3300046539 Bacteria 1786
1110 Ga0495621_0500183 3300046539 Unclassified 524
1111 Ga0495622_0024248 3300046557 Bacteria 2833
1112 Ga0495667_0150431 3300046559 Bacteria 1499
1113 Ga0495635_0084621 3300046663 Bacteria 2170
1114 Ga0495588_0007818 3300046674 Bacteria 4883
1115 Ga0495623_0219777 3300046679 Bacteria 1083
1116 Ga0495658_0463577 3300046683 Bacteria 810
1117 Ga0495600_0424218 3300046809 Bacteria 825
1118 Ga0495604_0369152 3300047317 Bacteria 950
1119 Ga0495604_1009718 3300047317 Bacteria 514
1120 Ga0495677_0151955 3300047445 Bacteria 892
1121 Ga0495685_136166 3300047447 Bacteria 801
1122 Ga0495681_0298583 3300047470 Bacteria 624
1123 Ga0496100_0292564 3300048903 Bacteria 1217
1124 Ga0496100_1332312 3300048903 Bacteria 567
1125 Ga0496100_1676063 3300048903 Bacteria 503
1126 Ga0496101_0113841 3300048904 Bacteria 2039
1127 Ga0496101_0175258 3300048904 Bacteria 1649
1128 Ga0496101_1211165 3300048904 Bacteria 591
1129 Ga0496101_1403313 3300048904 Bacteria 545
1130 Ga0496102_0084843 3300048905 Bacteria 2924
1131 Ga0496102_0107907 3300048905 Bacteria 2593
1132 Ga0496102_0597811 3300048905 Bacteria 1026
1133 Ga0496102_0693815 3300048905 Bacteria 941
1134 Ga0496103_0121752 3300048906 Bacteria 1662
1135 Ga0496103_0638605 3300048906 Bacteria 677
1136 Ga0496104_0006303 3300048907 Bacteria 10433
1137 Ga0496104_0492225 3300048907 Bacteria 1137
1138 Ga0496104_0515166 3300048907 Bacteria 1107
1139 Ga0496105_0448317 3300048908 Bacteria 1019
1140 Ga0496106_0146128 3300048909 Bacteria 1863
1141 Ga0496106_0245621 3300048909 Bacteria 1430
1142 Ga0496106_0292915 3300048909 Bacteria 1305
1143 Ga0496106_0363572 3300048909 Bacteria 1162
1144 Ga0496106_0407880 3300048909 Bacteria 1092
1145 Ga0496106_0658431 3300048909 Bacteria 836
1146 Ga0496106_1016349 3300048909 Bacteria 652
1147 Ga0496106_1588372 3300048909 Bacteria 501
1148 Ga0496107_0931869 3300048910 Bacteria 632
1149 Ga0496108_0005557 3300048911 Bacteria 10202
1150 Ga0496108_0009201 3300048911 Bacteria 7995
1151 Ga0496108_0078456 3300048911 Bacteria 2795
1152 Ga0496108_0701929 3300048911 Bacteria 877
1153 Ga0496108_0965168 3300048911 Bacteria 729
1154 Ga0496109_0022966 3300048912 Bacteria 5530
1155 Ga0496109_0233095 3300048912 Bacteria 1732
1156 Ga0496109_0582877 3300048912 Bacteria 1054
1157 Ga0496109_0644441 3300048912 Bacteria 996
1158 Ga0496109_2037380 3300048912 Bacteria 506
1159 Ga0496110_0129583 3300048913 Bacteria 2277
1160 Ga0496110_0240181 3300048913 Bacteria 1648
1161 Ga0496111_0467027 3300048914 Bacteria 930
1162 Ga0496112_0148753 3300048915 Bacteria 2309
1163 Ga0496112_0432552 3300048915 Bacteria 1254
1164 Ga0496112_0625396 3300048915 Bacteria 1007
1165 Ga0496113_0046902 3300048916 Bacteria 3209
1166 Ga0496113_0081115 3300048916 Bacteria 2486
1167 Ga0496113_0700111 3300048916 Bacteria 808
1168 Ga0496113_0766954 3300048916 Bacteria 767
1169 Ga0496114_0008966 3300048917 Bacteria 7932
1170 Ga0496114_0094823 3300048917 Bacteria 2539
1171 Ga0496114_0150261 3300048917 Bacteria 2020
1172 Ga0496115_0096451 3300048918 Bacteria 2421
1173 Ga0496115_0664119 3300048918 Bacteria 823
1174 Ga0496115_0672896 3300048918 Bacteria 816
1175 Ga0496115_0968997 3300048918 Bacteria 652
1176 Ga0501306_066075 3300049127 Bacteria 603
1177 Ga0501308_002288 3300049128 Bacteria 1663
1178 Ga0501308_036473 3300049128 Bacteria 679
1179 Ga0501304_016458 3300049160 Bacteria 700
1180 Ga0501304_036655 3300049160 Bacteria 537
1181 Ga0501290_100117 3300049513 Bacteria 515
1182 Ga0501296_027669 3300049519 Bacteria 751
1183 Ga0501311_060777 3300049527 Bacteria 610
1184 Ga0501311_075253 3300049527 Bacteria 566
1185 Ga0501311_078438 3300049527 Bacteria 558
1186 Ga0501315_084027 3300049531 Bacteria 544
1187 Ga0501315_092029 3300049531 Bacteria 526
1188 Ga0501316_023358 3300049532 Bacteria 793
1189 Ga0501316_044099 3300049532 Bacteria 628
1190 Ga0501316_053541 3300049532 Bacteria 585
1191 Ga0501317_004354 3300049533 Bacteria 1468
1192 Ga0501318_075407 3300049534 Bacteria 539
1193 Ga0501320_019113 3300049536 Bacteria 779
1194 Ga0501321_001077 3300049537 Bacteria 2063
1195 Ga0501321_055844 3300049537 Bacteria 587
1196 Ga0501322_010210 3300049538 Bacteria 721
1197 Ga0501323_003862 3300049539 Bacteria 1554
1198 Ga0501323_022872 3300049539 Bacteria 836
1199 Ga0501323_032530 3300049539 Bacteria 738
1200 Ga0501324_015038 3300049540 Bacteria 747
1201 Ga0501324_018809 3300049540 Bacteria 694
1202 Ga0501325_016317 3300049541 Bacteria 741
1203 Ga0501325_022661 3300049541 Bacteria 673
1204 Ga0501332_08295 3300049548 Bacteria 672
1205 Ga0501333_000957 3300049549 Bacteria 1471
1206 Ga0501032_0002375 3300049569 Bacteria 14697
1207 Ga0501032_0205226 3300049569 Bacteria 1286
1208 Ga0501033_0222059 3300049570 Bacteria 1345
1209 Ga0501033_1017149 3300049570 Bacteria 553
1210 Ga0501034_0478097 3300049571 Bacteria 1161
1211 Ga0501034_1200893 3300049571 Bacteria 637
1212 Ga0501036_0049128 3300049572 Bacteria 3572
1213 Ga0501036_0301206 3300049572 Bacteria 1341
1214 Ga0501036_0715550 3300049572 Bacteria 827
1215 Ga0501036_1349747 3300049572 Bacteria 579
1216 Ga0501036_1641935 3300049572 Bacteria 518
1217 Ga0501036_1695644 3300049572 Bacteria 509
1218 Ga0501037_0044275 3300049573 Bacteria 3268
1219 Ga0501037_0442789 3300049573 Bacteria 887
1220 Ga0501037_0463031 3300049573 Bacteria 864
1221 Ga0501038_0699477 3300049574 Bacteria 759
1222 Ga0501038_0904316 3300049574 Bacteria 651
1223 Ga0501039_0031107 3300049575 Bacteria 4114
1224 Ga0501039_0299904 3300049575 Bacteria 1263
1225 Ga0501040_0049193 3300049576 Bacteria 2882
1226 Ga0501040_0112219 3300049576 Bacteria 1907
1227 Ga0501040_0157057 3300049576 Bacteria 1607
1228 Ga0501040_0521425 3300049576 Unclassified 857
1229 Ga0501041_0139617 3300049577 Bacteria 1511
1230 Ga0501041_0164873 3300049577 Bacteria 1386
1231 Ga0501042_0318212 3300049578 Bacteria 1124
1232 Ga0501042_0564905 3300049578 Bacteria 827
1233 Ga0501042_1147443 3300049578 Bacteria 566
1234 Ga0501043_0080857 3300049579 Bacteria 2553
1235 Ga0501046_0045733 3300049580 Bacteria 3476
1236 Ga0501048_0797553 3300049582 Bacteria 678
1237 Ga0501067_0098438 3300049583 Bacteria 1624
1238 Ga0501067_0199831 3300049583 Bacteria 1113
1239 Ga0501067_0258146 3300049583 Bacteria 970
1240 Ga0501067_0390614 3300049583 Bacteria 776
1241 Ga0501067_0740853 3300049583 Bacteria 553
1242 Ga0501068_0061584 3300049584 Bacteria 2280
1243 Ga0501068_0235984 3300049584 Bacteria 1163
1244 Ga0501068_0498985 3300049584 Bacteria 789
1245 Ga0501069_0024665 3300049585 Bacteria 3281
1246 Ga0501069_0202088 3300049585 Bacteria 1152
1247 Ga0501069_0219825 3300049585 Bacteria 1104
1248 Ga0501069_0303562 3300049585 Bacteria 936
1249 Ga0501069_0568409 3300049585 Bacteria 679
1250 Ga0501070_0027238 3300049586 Bacteria 4794
1251 Ga0501070_0085902 3300049586 Bacteria 2605
1252 Ga0501070_0473066 3300049586 Bacteria 1008
1253 Ga0501070_0598170 3300049586 Bacteria 879
1254 Ga0501071_0022608 3300049587 Bacteria 4384
1255 Ga0501071_0209315 3300049587 Bacteria 1466
1256 Ga0501071_0774729 3300049587 Bacteria 739
1257 Ga0501072_0039534 3300049588 Bacteria 3704
1258 Ga0501072_0065137 3300049588 Bacteria 2873
1259 Ga0501072_0309226 3300049588 Bacteria 1256
1260 Ga0501072_0509073 3300049588 Bacteria 952
1261 Ga0501072_0703780 3300049588 Bacteria 794
1262 Ga0501074_0129833 3300049590 Bacteria 1803
1263 Ga0501074_0503048 3300049590 Bacteria 858
1264 Ga0501074_1282492 3300049590 Unclassified 513
1265 Ga0501075_0187165 3300049591 Bacteria 1579
1266 Ga0501075_0249461 3300049591 Bacteria 1353
1267 Ga0501075_1296848 3300049591 Unclassified 552
1268 Ga0501076_0019885 3300049592 Bacteria 5135
1269 Ga0501076_0292687 3300049592 Bacteria 1334
1270 Ga0501076_0480822 3300049592 Bacteria 1023
1271 Ga0501076_1032015 3300049592 Bacteria 677
1272 Ga0501077_0084305 3300049593 Bacteria 2014
1273 Ga0501077_0110034 3300049593 Bacteria 1746
1274 Ga0501077_0173903 3300049593 Bacteria 1368
1275 Ga0501201_047924 3300049651 Bacteria 527
1276 Ga0501206_035144 3300049653 Bacteria 757
1277 Ga0501209_216804 3300049656 Bacteria 592
1278 Ga0501217_262437 3300049661 Bacteria 560
1279 Ga0501217_298442 3300049661 Bacteria 531
1280 Ga0501224_065209 3300049664 Bacteria 572
1281 Ga0501233_171317 3300049668 Bacteria 617
1282 Ga0501247_067000 3300049677 Bacteria 561
1283 Ga0501249_043288 3300049679 Bacteria 1024
1284 Ga0501257_239723 3300049686 Bacteria 534
1285 Ga0501258_041249 3300049687 Bacteria 617
1286 Ga0501259_050586 3300049688 Bacteria 842
1287 Ga0501225_0105716 3300049705 Bacteria 826
1288 Ga0501225_0157881 3300049705 Bacteria 695
1289 Ga0501079_0072197 3300049741 Bacteria 2667
1290 Ga0501079_1026882 3300049741 Bacteria 649
1291 Ga0501079_1163359 3300049741 Bacteria 608
1292 Ga0501080_0246481 3300049742 Bacteria 1629
1293 Ga0501080_0274379 3300049742 Bacteria 1534
1294 Ga0501080_0518965 3300049742 Bacteria 1063
1295 Ga0501080_0527496 3300049742 Bacteria 1053
1296 Ga0501080_0844723 3300049742 Bacteria 801
1297 Ga0501081_0097965 3300049743 Bacteria 2070
1298 Ga0501081_0292707 3300049743 Bacteria 1194
1299 Ga0501083_0270410 3300049744 Bacteria 1106
1300 Ga0501083_0387893 3300049744 Bacteria 908
1301 Ga0501083_0693752 3300049744 Bacteria 662
1302 Ga0501083_1169878 3300049744 Bacteria 500
1303 Ga0501264_033477 3300049761 Bacteria 601
1304 Ga0501266_048627 3300049763 Bacteria 650
1305 Ga0501273_080115 3300049770 Bacteria 542
1306 Ga0501273_086341 3300049770 Bacteria 528
1307 Ga0501283_137411 3300049779 Bacteria 500
1308 Ga0501044_0369903 3300049823 Bacteria 1350
1309 Ga0501044_0712922 3300049823 Bacteria 888
1310 Ga0501044_0736726 3300049823 Bacteria 869
1311 Ga0501044_1426621 3300049823 Bacteria 558
1312 Ga0501045_0374149 3300049824 Bacteria 1060
1313 Ga0501045_0607603 3300049824 Bacteria 810
1314 Ga0501045_1307130 3300049824 Bacteria 528
1315 nmdc:mga00v17_381822_c1 3300050491 Bacteria 916
1316 nmdc:mga0k408_47265_c1 3300050493 Bacteria 2487
1317 nmdc:mga07m45_628578_c1 3300050496 Bacteria 619
1318 nmdc:mga05p37_1016723_c1 3300050507 Bacteria 878
1319 nmdc:mga05p37_160415_c1 3300050507 Bacteria 2747
1320 nmdc:mga05p37_1626423_c1 3300050507 Bacteria 635
1321 nmdc:mga05p37_249930_c1 3300050507 Bacteria 2127
1322 nmdc:mga05p37_483494_c1 3300050507 Bacteria 1425
1323 nmdc:mga05p37_636196_c1 3300050507 Unclassified 1197
1324 nmdc:mga05p37_67303_c1 3300050507 Bacteria 4406
1325 nmdc:mga05p37_728397_c1 3300050507 Bacteria 1097
1326 nmdc:mga05p37_922531_c1 3300050507 Bacteria 938
1327 nmdc:mga09592_338617_c1 3300050508 Bacteria 1302
1328 nmdc:mga09592_623402_c1 3300050508 Bacteria 923
1329 nmdc:mga0qj67_819791_c1 3300050509 Bacteria 736
1330 nmdc:mga06r32_186107_c1 3300050510 Bacteria 2063
1331 nmdc:mga06r32_534480_c1 3300050510 Bacteria 1147
1332 nmdc:mga06r32_602822_c1 3300050510 Bacteria 1069
1333 nmdc:mga08y16_114735_c1 3300050511 Bacteria 2804
1334 nmdc:mga08y16_142866_c1 3300050511 Bacteria 2488
1335 nmdc:mga08y16_946504_c1 3300050511 Bacteria 845
1336 nmdc:mga0n895_120980_c1 3300050512 Bacteria 2639
1337 nmdc:mga0n895_1917392_c1 3300050512 Bacteria 551
1338 nmdc:mga0n895_2199608_c1 3300050512 Bacteria 507
1339 nmdc:mga0n895_441913_c1 3300050512 Bacteria 1314
1340 nmdc:mga0n895_859021_c1 3300050512 Bacteria 895
1341 nmdc:mga0rr50_145771_c1 3300050513 Bacteria 1909
1342 nmdc:mga0rr50_375931_c1 3300050513 Bacteria 1197
1343 nmdc:mga0rr50_600645_c1 3300050513 Bacteria 938
1344 nmdc:mga0rr50_741140_c1 3300050513 Bacteria 838
1345 nmdc:mga08x19_13948_c1 3300050514 Bacteria 4868
1346 nmdc:mga08x19_271491_c1 3300050514 Bacteria 1174
1347 nmdc:mga08x19_699764_c1 3300050514 Bacteria 719
1348 nmdc:mga08x19_838218_c1 3300050514 Bacteria 653
1349 nmdc:mga0a205_120580_c1 3300050515 Bacteria 2522
1350 nmdc:mga0a205_21314_c1 3300050515 Bacteria 6130
1351 Ga0500635_0155248 3300053080 Bacteria 875
1352 Ga0500578_0240697 3300053086 Bacteria 1093
1353 Ga0500646_0011933 3300053090 Bacteria 2239
1354 Ga0500583_0071482 3300053092 Bacteria 1660
1355 Ga0500566_0025437 3300053094 Bacteria 3471
1356 Ga0500566_0127039 3300053094 Bacteria 1368
1357 Ga0500640_006375 3300053095 Bacteria 4497
1358 Ga0500572_150433 3300053111 Bacteria 760
1359 Ga0500591_208188 3300053115 Bacteria 665
1360 Ga0500594_0189517 3300053118 Bacteria 673
1361 Ga0500595_000465 3300053119 Bacteria 25155
1362 Ga0500597_056291 3300053120 Bacteria 1683
1363 Ga0500614_000040 3300053123 Bacteria 27788
1364 Ga0500642_0109796 3300053130 Bacteria 1287
1365 Ga0500658_0308124 3300053134 Bacteria 728
1366 Ga0500559_0145679 3300053136 Bacteria 1110
1367 Ga0500564_327281 3300053138 Bacteria 578
1368 Ga0500585_180530 3300053144 Bacteria 716
1369 Ga0500588_0242700 3300053146 Bacteria 675
1370 Ga0500603_007909 3300053150 Bacteria 2343
1371 Ga0500619_145053 3300053154 Bacteria 808
1372 Ga0500638_233021 3300053162 Bacteria 754
1373 Ga0500639_259964 3300053163 Bacteria 687
1374 Ga0500636_0061113 3300053177 Bacteria 2199
1375 Ga0501084_0029023 3300054114 Bacteria 4625
1376 Ga0501084_0046520 3300054114 Bacteria 3635
1377 Ga0501084_0175659 3300054114 Bacteria 1808
1378 Ga0501084_0705931 3300054114 Bacteria 850
1379 Ga0500661_033843 3300055283 Bacteria 903
1380 Ga0590071_005505 3300059421 Bacteria 3041
1381 Ga0590071_024241 3300059421 Bacteria 1437
1382 Ga0590074_008331 3300059423 Bacteria 1726
1383 Ga0590074_010196 3300059423 Bacteria 1570
1384 Ga0590075_065515 3300059424 Bacteria 937
1385 Ga0590077_009251 3300059426 Bacteria 2018
1386 Ga0590077_013609 3300059426 Bacteria 1692
1387 Ga0587084_079802 3300059477 Bacteria 632
1388 Ga0587066_047237 3300059490 Bacteria 834
1389 Ga0587070_015773 3300059491 Bacteria 1201
1390 Ga0587077_070905 3300059493 Bacteria 778
1391 Ga0587082_061609 3300059504 Bacteria 741
1392 Ga0587083_0262872 3300059505 Unclassified 519
1393 Ga0587090_004357 3300059510 Bacteria 1714
1394 Ga0587090_089570 3300059510 Bacteria 628
1395 Ga0587098_021026 3300059604 Bacteria 829
1396 Ga0587109_057260 3300059624 Bacteria 813
1397 Ga0587128_033952 3300059630 Bacteria 861
1398 Ga0587128_047718 3300059630 Bacteria 772
1399 Ga0587072_003555 3300059643 Bacteria 2200
1400 Ga0587072_200191 3300059643 Bacteria 507
1401 Ga0587075_061053 3300059644 Bacteria 680
1402 Ga0587078_016647 3300059646 Bacteria 897
1403 Ga0587079_123748 3300059647 Bacteria 642
1404 Ga0587107_020131 3300059652 Bacteria 922
1405 Ga0587114_044750 3300059655 Bacteria 730
1406 Ga0501082_0073796 3300060353 Bacteria 2938
1407 Ga0501082_0144012 3300060353 Bacteria 2068
1408 Ga0501082_0259257 3300060353 Bacteria 1512
1409 Ga0501082_0851237 3300060353 Bacteria 798
1410 Ga0530510_0331631 3300061734 Bacteria 1141
1411 Ga0530510_0743561 3300061734 Bacteria 748
1412 Ga0530510_0765706 3300061734 Bacteria 736
1413 Ga0530510_0926384 3300061734 Bacteria 666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10775844 Ga0207674_107758442 85
2 3300044683 Ga0466965_0687816 Ga0466965_0687816_26_289 85
3 3300003163 Ga0006759J45824_1142513 Ga0006759J45824_11425131 94
4 3300003305 Ga0006770J48903_1017217 Ga0006770J48903_10172171 94
5 3300003305 Ga0006770J48903_1052527 Ga0006770J48903_10525271 94
6 3300003579 Ga0007429J51699_1137424 Ga0007429J51699_11374241 94
7 3300004785 Ga0058858_1018058 Ga0058858_10180581 94
8 3300004798 Ga0058859_10150003 Ga0058859_101500032 94
9 3300004800 Ga0058861_10068965 Ga0058861_100689652 94
10 3300004803 Ga0058862_10109779 Ga0058862_101097792 94
11 3300005328 Ga0070676_11531196 Ga0070676_115311961 94
12 3300005329 Ga0070683_100624396 Ga0070683_1006243961 94
13 3300005330 Ga0070690_100004480 Ga0070690_1000044809 94
14 3300005330 Ga0070690_100441175 Ga0070690_1004411752 94
15 3300005338 Ga0068868_100443867 Ga0068868_1004438672 94
16 3300005345 Ga0070692_11334128 Ga0070692_113341282 94
17 3300005365 Ga0070688_100352674 Ga0070688_1003526742 94
18 3300005434 Ga0070709_11637348 Ga0070709_116373482 94
19 3300005456 Ga0070678_101269732 Ga0070678_1012697322 94
20 3300005466 Ga0070685_10516453 Ga0070685_105164532 94
21 3300005468 Ga0070707_102288806 Ga0070707_1022888061 94
22 3300005530 Ga0070679_100029083 Ga0070679_1000290832 94
23 3300005535 Ga0070684_101299637 Ga0070684_1012996371 94
24 3300005545 Ga0070695_101582349 Ga0070695_1015823491 94
25 3300005548 Ga0070665_100011744 Ga0070665_1000117445 94
26 3300005548 Ga0070665_100965551 Ga0070665_1009655512 94
27 3300005549 Ga0070704_100752816 Ga0070704_1007528162 94
28 3300005577 Ga0068857_100075686 Ga0068857_1000756862 94
29 3300005578 Ga0068854_101894065 Ga0068854_1018940651 94
30 3300005614 Ga0068856_100269836 Ga0068856_1002698362 94
31 3300005617 Ga0068859_100885997 Ga0068859_1008859972 94
32 3300005618 Ga0068864_101180369 Ga0068864_1011803691 94
33 3300005618 Ga0068864_102062129 Ga0068864_1020621291 94
34 3300005841 Ga0068863_101610255 Ga0068863_1016102551 94
35 3300005843 Ga0068860_100576869 Ga0068860_1005768692 94
36 3300005937 Ga0081455_10800432 Ga0081455_108004322 94
37 3300006028 Ga0070717_10213212 Ga0070717_102132122 94
38 3300006051 Ga0075364_10102673 Ga0075364_101026732 94
39 3300006177 Ga0075362_10638651 Ga0075362_106386512 94
40 3300006195 Ga0075366_10104654 Ga0075366_101046542 94
41 3300006237 Ga0097621_100963727 Ga0097621_1009637272 94
42 3300006237 Ga0097621_101217495 Ga0097621_1012174952 94
43 3300006847 Ga0075431_100341443 Ga0075431_1003414432 94
44 3300006881 Ga0068865_100755444 Ga0068865_1007554442 94
45 3300006931 Ga0097620_100885962 Ga0097620_1008859622 94
46 3300009098 Ga0105245_10000082 Ga0105245_1000008219 94
47 3300009177 Ga0105248_10623999 Ga0105248_106239992 94
48 3300009177 Ga0105248_13461920 Ga0105248_134619201 94
49 3300009545 Ga0105237_12221910 Ga0105237_122219101 94
50 3300009553 Ga0105249_10030534 Ga0105249_100305346 94
51 3300013297 Ga0157378_11034898 Ga0157378_110348982 94
52 3300014325 Ga0163163_11350123 Ga0163163_113501232 94
53 3300014969 Ga0157376_11231086 Ga0157376_112310862 94
54 3300014969 Ga0157376_11969980 Ga0157376_119699801 94
55 3300020080 Ga0206350_11600674 Ga0206350_116006741 94
56 3300023309 Ga0256744_150842 Ga0256744_1508421 94
57 3300025912 Ga0207707_11179558 Ga0207707_111795582 94
58 3300025914 Ga0207671_10702703 Ga0207671_107027031 94
59 3300025917 Ga0207660_10247526 Ga0207660_102475262 94
60 3300025921 Ga0207652_10330421 Ga0207652_103304212 94
61 3300025924 Ga0207694_10521156 Ga0207694_105211562 94
62 3300025927 Ga0207687_10000288 Ga0207687_1000028820 94
63 3300025941 Ga0207711_11530862 Ga0207711_115308621 94
64 3300025942 Ga0207689_10157603 Ga0207689_101576032 94
65 3300025944 Ga0207661_11205630 Ga0207661_112056302 94
66 3300025944 Ga0207661_11558771 Ga0207661_115587712 94
67 3300025961 Ga0207712_10024599 Ga0207712_100245992 94
68 3300025981 Ga0207640_10528203 Ga0207640_105282032 94
69 3300026078 Ga0207702_10146028 Ga0207702_101460282 94
70 3300026088 Ga0207641_11908720 Ga0207641_119087202 94
71 3300026095 Ga0207676_10468466 Ga0207676_104684662 94
72 3300026095 Ga0207676_11021709 Ga0207676_110217092 94
73 3300026095 Ga0207676_11488756 Ga0207676_114887562 94
74 3300026116 Ga0207674_11036545 Ga0207674_110365451 94
75 3300026142 Ga0207698_10707898 Ga0207698_107078982 94
76 3300028379 Ga0268266_10004596 Ga0268266_100045966 94
77 3300028379 Ga0268266_10868934 Ga0268266_108689342 94
78 3300028786 Ga0307517_10152441 Ga0307517_101524412 94
79 3300028800 Ga0265338_10253066 Ga0265338_102530662 94
80 3300029283 Ga0310982_107480 Ga0310982_1074802 94
81 3300031238 Ga0265332_10010941 Ga0265332_100109412 94
82 3300031507 Ga0307509_10000029 Ga0307509_10000029108 94
83 3300031507 Ga0307509_10047926 Ga0307509_100479265 94
84 3300031507 Ga0307509_10077718 Ga0307509_100777182 94
85 3300031616 Ga0307508_10172700 Ga0307508_101727003 94
86 3300031616 Ga0307508_10341816 Ga0307508_103418162 94
87 3300031665 Ga0316575_10057696 Ga0316575_100576961 94
88 3300031728 Ga0316578_10400910 Ga0316578_104009101 94
89 3300031730 Ga0307516_10055293 Ga0307516_100552935 94
90 3300031733 Ga0316577_10048972 Ga0316577_100489722 94
91 3300032168 Ga0316593_10406614 Ga0316593_104066141 94
92 3300033179 Ga0307507_10187294 Ga0307507_101872942 94
93 3300033541 Ga0316596_1100435 Ga0316596_11004351 94
94 3300034819 Ga0373958_0040713 Ga0373958_0040713_90_377 94
95 3300035083 Ga0373926_0287478 Ga0373926_0287478_156_446 94
96 3300035090 Ga0373949_0005273 Ga0373949_0005273_2066_2353 94
97 3300035113 Ga0373936_0000001 Ga0373936_0000001_232599_232886 94
98 3300035115 Ga0373941_0133309 Ga0373941_0133309_251_538 94
99 3300035119 Ga0373956_0332661 Ga0373956_0332661_189_479 94
100 3300035119 Ga0373956_0421403 Ga0373956_0421403_206_493 94
101 3300035121 Ga0373960_0387443 Ga0373960_0387443_127_414 94
102 3300035241 Ga0373961_0000001 Ga0373961_0000001_29834_30121 94
103 3300035398 Ga0316574_0063591 Ga0316574_0063591_1887_2177 94
104 3300035398 Ga0316574_0969945 Ga0316574_0969945_40_330 94
105 3300035691 Ga0373931_0203221 Ga0373931_0203221_216_503 94
106 3300035725 Ga0373947_0563508 Ga0373947_0563508_171_461 94
107 3300036712 Ga0316584_0074425 Ga0316584_0074425_1957_2247 94
108 3300039437 Ga0436365_1236418 Ga0436365_1236418_518_808 94
109 3300039450 Ga0436363_0933504 Ga0436363_0933504_1190_1477 94
110 3300041461 Ga0451805_081734 Ga0451805_081734_325_615 94
111 3300041486 Ga0451807_1937924 Ga0451807_1937924_221_508 94
112 3300041492 Ga0451835_0596095 Ga0451835_0596095_420_710 94
113 3300041498 Ga0451841_0658728 Ga0451841_0658728_250_540 94
114 3300041505 Ga0451849_1401345 Ga0451849_1401345_1696_1986 94
115 3300041507 Ga0451851_0196687 Ga0451851_0196687_386_676 94
116 3300041511 Ga0451855_1580001 Ga0451855_1580001_393_683 94
117 3300041512 Ga0451853_1965433 Ga0451853_1965433_240_530 94
118 3300045051 Ga0451576_1570374 Ga0451576_1570374_241_531 94
119 3300046457 Ga0495590_0104703 Ga0495590_0104703_521_808 94
120 3300046517 Ga0495630_0263965 Ga0495630_0263965_959_1246 94
121 3300046557 Ga0495622_0024248 Ga0495622_0024248_2148_2435 94
122 3300046683 Ga0495658_0463577 Ga0495658_0463577_55_342 94
123 3300048908 Ga0496105_0448317 Ga0496105_0448317_584_874 94
124 3300048917 Ga0496114_0094823 Ga0496114_0094823_1563_1853 94
125 3300048918 Ga0496115_0672896 Ga0496115_0672896_473_760 94
126 3300048918 Ga0496115_0968997 Ga0496115_0968997_28_318 94
127 3300049536 Ga0501320_019113 Ga0501320_019113_53_340 94
128 3300049539 Ga0501323_032530 Ga0501323_032530_58_345 94
129 3300049570 Ga0501033_1017149 Ga0501033_1017149_82_369 94
130 3300049571 Ga0501034_0478097 Ga0501034_0478097_762_1049 94
131 3300049583 Ga0501067_0199831 Ga0501067_0199831_369_659 94
132 3300049584 Ga0501068_0061584 Ga0501068_0061584_1895_2182 94
133 3300049584 Ga0501068_0235984 Ga0501068_0235984_714_1004 94
134 3300049585 Ga0501069_0202088 Ga0501069_0202088_334_621 94
135 3300049586 Ga0501070_0027238 Ga0501070_0027238_2942_3229 94
136 3300049586 Ga0501070_0473066 Ga0501070_0473066_76_363 94
137 3300049587 Ga0501071_0209315 Ga0501071_0209315_898_1185 94
138 3300049588 Ga0501072_0309226 Ga0501072_0309226_750_1037 94
139 3300049742 Ga0501080_0246481 Ga0501080_0246481_1230_1517 94
140 3300049743 Ga0501081_0292707 Ga0501081_0292707_338_625 94
141 3300049744 Ga0501083_0387893 Ga0501083_0387893_415_702 94
142 3300049744 Ga0501083_1169878 Ga0501083_1169878_64_351 94
143 3300050491 nmdc:mga00v17_381822_c1 nmdc:mga00v17_381822_c1_406_696 94
144 3300050493 nmdc:mga0k408_47265_c1 nmdc:mga0k408_47265_c1_1150_1440 94
145 3300050510 nmdc:mga06r32_602822_c1 nmdc:mga06r32_602822_c1_560_850 94
146 3300053080 Ga0500635_0155248 Ga0500635_0155248_395_682 94
147 3300053086 Ga0500578_0240697 Ga0500578_0240697_168_455 94
148 3300053090 Ga0500646_0011933 Ga0500646_0011933_240_527 94
149 3300053092 Ga0500583_0071482 Ga0500583_0071482_191_478 94
150 3300053094 Ga0500566_0025437 Ga0500566_0025437_600_887 94
151 3300053094 Ga0500566_0127039 Ga0500566_0127039_572_859 94
152 3300053095 Ga0500640_006375 Ga0500640_006375_393_680 94
153 3300053111 Ga0500572_150433 Ga0500572_150433_182_469 94
154 3300053115 Ga0500591_208188 Ga0500591_208188_281_568 94
155 3300053118 Ga0500594_0189517 Ga0500594_0189517_285_572 94
156 3300053119 Ga0500595_000465 Ga0500595_000465_23232_23519 94
157 3300053120 Ga0500597_056291 Ga0500597_056291_358_645 94
158 3300053123 Ga0500614_000040 Ga0500614_000040_9063_9350 94
159 3300053130 Ga0500642_0109796 Ga0500642_0109796_890_1177 94
160 3300053134 Ga0500658_0308124 Ga0500658_0308124_208_495 94
161 3300053136 Ga0500559_0145679 Ga0500559_0145679_411_698 94
162 3300053138 Ga0500564_327281 Ga0500564_327281_132_419 94
163 3300053144 Ga0500585_180530 Ga0500585_180530_234_521 94
164 3300053146 Ga0500588_0242700 Ga0500588_0242700_246_533 94
165 3300053150 Ga0500603_007909 Ga0500603_007909_1899_2186 94
166 3300053154 Ga0500619_145053 Ga0500619_145053_476_763 94
167 3300053162 Ga0500638_233021 Ga0500638_233021_185_472 94
168 3300053163 Ga0500639_259964 Ga0500639_259964_126_413 94
169 3300053177 Ga0500636_0061113 Ga0500636_0061113_663_950 94
170 3300055283 Ga0500661_033843 Ga0500661_033843_29_316 94
171 3300059491 Ga0587070_015773 Ga0587070_015773_790_1080 94
172 3300059604 Ga0587098_021026 Ga0587098_021026_486_776 94
173 3300059624 Ga0587109_057260 Ga0587109_057260_58_345 94
174 3300060353 Ga0501082_0144012 Ga0501082_0144012_513_800 94
175 3300003578 Ga0006562J51391_1014982 Ga0006562J51391_10149822 95
176 3300005327 Ga0070658_10983028 Ga0070658_109830281 95
177 3300005331 Ga0070670_101223806 Ga0070670_1012238062 95
178 3300005468 Ga0070707_100162363 Ga0070707_1001623632 95
179 3300006058 Ga0075432_10311200 Ga0075432_103112001 95
180 3300006353 Ga0075370_10322826 Ga0075370_103228262 95
181 3300006844 Ga0075428_102526401 Ga0075428_1025264011 95
182 3300009147 Ga0114129_10150508 Ga0114129_101505083 95
183 3300013102 Ga0157371_10422242 Ga0157371_104222421 95
184 3300013105 Ga0157369_12086848 Ga0157369_120868481 95
185 3300013307 Ga0157372_10893734 Ga0157372_108937342 95
186 3300014497 Ga0182008_10348653 Ga0182008_103486531 95
187 3300020076 Ga0206355_1229164 Ga0206355_12291641 95
188 3300020076 Ga0206355_1700556 Ga0206355_17005562 95
189 3300020082 Ga0206353_11560491 Ga0206353_115604912 95
190 3300022467 Ga0224712_10383109 Ga0224712_103831091 95
191 3300025909 Ga0207705_10395806 Ga0207705_103958061 95
192 3300026116 Ga0207674_10677041 Ga0207674_106770412 95
193 3300030963 Ga0265768_113673 Ga0265768_1136731 95
194 3300031548 Ga0307408_100042108 Ga0307408_1000421083 95
195 3300031548 Ga0307408_100080846 Ga0307408_1000808462 95
196 3300031548 Ga0307408_100127270 Ga0307408_1001272702 95
197 3300031548 Ga0307408_100127488 Ga0307408_1001274882 95
198 3300031548 Ga0307408_100281377 Ga0307408_1002813771 95
199 3300031548 Ga0307408_100283082 Ga0307408_1002830821 95
200 3300031548 Ga0307408_101251135 Ga0307408_1012511352 95
201 3300031731 Ga0307405_10044041 Ga0307405_100440413 95
202 3300031731 Ga0307405_10083608 Ga0307405_100836081 95
203 3300031731 Ga0307405_10147946 Ga0307405_101479462 95
204 3300031731 Ga0307405_10169124 Ga0307405_101691242 95
205 3300031824 Ga0307413_10035638 Ga0307413_100356382 95
206 3300031824 Ga0307413_10060403 Ga0307413_100604032 95
207 3300031824 Ga0307413_10392207 Ga0307413_103922071 95
208 3300031852 Ga0307410_10034302 Ga0307410_100343022 95
209 3300031852 Ga0307410_10140619 Ga0307410_101406192 95
210 3300031852 Ga0307410_10260410 Ga0307410_102604101 95
211 3300031903 Ga0307407_10011805 Ga0307407_100118053 95
212 3300031903 Ga0307407_10082262 Ga0307407_100822622 95
213 3300031903 Ga0307407_10369785 Ga0307407_103697852 95
214 3300031903 Ga0307407_10534508 Ga0307407_105345082 95
215 3300031903 Ga0307407_11686280 Ga0307407_116862801 95
216 3300031911 Ga0307412_10009640 Ga0307412_100096404 95
217 3300031911 Ga0307412_10055983 Ga0307412_100559832 95
218 3300031911 Ga0307412_10157667 Ga0307412_101576673 95
219 3300031911 Ga0307412_10163670 Ga0307412_101636702 95
220 3300031911 Ga0307412_10165007 Ga0307412_101650072 95
221 3300031911 Ga0307412_10451830 Ga0307412_104518302 95
222 3300031911 Ga0307412_11501822 Ga0307412_115018221 95
223 3300031995 Ga0307409_100257418 Ga0307409_1002574182 95
224 3300031995 Ga0307409_100395582 Ga0307409_1003955821 95
225 3300031995 Ga0307409_100496453 Ga0307409_1004964532 95
226 3300031995 Ga0307409_100847684 Ga0307409_1008476842 95
227 3300032002 Ga0307416_100167255 Ga0307416_1001672552 95
228 3300032002 Ga0307416_100203336 Ga0307416_1002033362 95
229 3300032002 Ga0307416_100400679 Ga0307416_1004006792 95
230 3300032002 Ga0307416_100588081 Ga0307416_1005880812 95
231 3300032002 Ga0307416_100879121 Ga0307416_1008791212 95
232 3300032004 Ga0307414_10810240 Ga0307414_108102401 95
233 3300032004 Ga0307414_10821820 Ga0307414_108218202 95
234 3300032005 Ga0307411_10396082 Ga0307411_103960822 95
235 3300032126 Ga0307415_100335641 Ga0307415_1003356413 95
236 3300032126 Ga0307415_100745811 Ga0307415_1007458111 95
237 3300037312 Ga0395899_0011864 Ga0395899_0011864_1314_1607 95
238 3300037312 Ga0395899_0124689 Ga0395899_0124689_400_693 95
239 3300037466 Ga0395898_0038342 Ga0395898_0038342_4302_4595 95
240 3300037471 Ga0395905_0441651 Ga0395905_0441651_266_559 95
241 3300038443 Ga0395901_0182000 Ga0395901_0182000_1015_1308 95
242 3300041404 Ga0439436_0020957 Ga0439436_0020957_1181_1474 95
243 3300041404 Ga0439436_0032287 Ga0439436_0032287_246_539 95
244 3300041405 Ga0439438_063807 Ga0439438_063807_339_632 95
245 3300041407 Ga0439447_057324 Ga0439447_057324_16_309 95
246 3300041410 Ga0439461_0044522 Ga0439461_0044522_363_656 95
247 3300041411 Ga0439466_0047339 Ga0439466_0047339_1089_1382 95
248 3300041413 Ga0439465_0323764 Ga0439465_0323764_262_555 95
249 3300041999 Ga0439433_0003003 Ga0439433_0003003_2616_2909 95
250 3300041999 Ga0439433_0039156 Ga0439433_0039156_511_804 95
251 3300042002 Ga0439442_000012 Ga0439442_000012_38536_38829 95
252 3300042006 Ga0439432_097365 Ga0439432_097365_31_324 95
253 3300042007 Ga0439449_0029379 Ga0439449_0029379_860_1153 95
254 3300042007 Ga0439449_0033278 Ga0439449_0033278_337_630 95
255 3300042014 Ga0439457_035060 Ga0439457_035060_34_327 95
256 3300042015 Ga0439462_0023095 Ga0439462_0023095_165_458 95
257 3300042115 Ga0450911_012401 Ga0450911_012401_402_695 95
258 3300042122 Ga0450920_004890 Ga0450920_004890_820_1113 95
259 3300042122 Ga0450920_006036 Ga0450920_006036_1770_2063 95
260 3300042134 Ga0450898_045670 Ga0450898_045670_302_595 95
261 3300042145 Ga0450906_028800 Ga0450906_028800_644_937 95
262 3300042146 Ga0450907_000415 Ga0450907_000415_1890_2183 95
263 3300042146 Ga0450907_021368 Ga0450907_021368_663_956 95
264 3300042147 Ga0450910_060166 Ga0450910_060166_28_321 95
265 3300042184 Ga0450908_006541 Ga0450908_006541_1027_1320 95
266 3300042435 Ga0439434_0000031 Ga0439434_0000031_10822_11115 95
267 3300042435 Ga0439434_0023852 Ga0439434_0023852_662_955 95
268 3300042531 Ga0450918_000869 Ga0450918_000869_1014_1307 95
269 3300044765 Ga0466970_0822108 Ga0466970_0822108_28_321 95
270 3300046535 Ga0495586_0078526 Ga0495586_0078526_1289_1582 95
271 3300048904 Ga0496101_1211165 Ga0496101_1211165_101_394 95
272 3300048906 Ga0496103_0121752 Ga0496103_0121752_644_937 95
273 3300048909 Ga0496106_1588372 Ga0496106_1588372_47_340 95
274 3300048916 Ga0496113_0081115 Ga0496113_0081115_515_808 95
275 3300049128 Ga0501308_002288 Ga0501308_002288_1274_1567 95
276 3300049128 Ga0501308_036473 Ga0501308_036473_102_395 95
277 3300049160 Ga0501304_016458 Ga0501304_016458_312_605 95
278 3300049527 Ga0501311_075253 Ga0501311_075253_233_526 95
279 3300049527 Ga0501311_078438 Ga0501311_078438_225_518 95
280 3300049531 Ga0501315_084027 Ga0501315_084027_233_526 95
281 3300049532 Ga0501316_023358 Ga0501316_023358_14_307 95
282 3300049532 Ga0501316_053541 Ga0501316_053541_26_319 95
283 3300049533 Ga0501317_004354 Ga0501317_004354_1073_1366 95
284 3300049534 Ga0501318_075407 Ga0501318_075407_35_328 95
285 3300049537 Ga0501321_001077 Ga0501321_001077_1263_1556 95
286 3300049537 Ga0501321_055844 Ga0501321_055844_244_537 95
287 3300049538 Ga0501322_010210 Ga0501322_010210_113_406 95
288 3300049539 Ga0501323_003862 Ga0501323_003862_970_1263 95
289 3300049540 Ga0501324_015038 Ga0501324_015038_119_412 95
290 3300049540 Ga0501324_018809 Ga0501324_018809_26_319 95
291 3300049541 Ga0501325_016317 Ga0501325_016317_108_401 95
292 3300049541 Ga0501325_022661 Ga0501325_022661_309_602 95
293 3300049548 Ga0501332_08295 Ga0501332_08295_40_333 95
294 3300049549 Ga0501333_000957 Ga0501333_000957_1134_1427 95
295 3300049569 Ga0501032_0002375 Ga0501032_0002375_7842_8135 95
296 3300049569 Ga0501032_0205226 Ga0501032_0205226_607_900 95
297 3300049570 Ga0501033_0222059 Ga0501033_0222059_613_906 95
298 3300049572 Ga0501036_0049128 Ga0501036_0049128_3210_3503 95
299 3300049573 Ga0501037_0044275 Ga0501037_0044275_1386_1679 95
300 3300049574 Ga0501038_0904316 Ga0501038_0904316_166_459 95
301 3300049575 Ga0501039_0031107 Ga0501039_0031107_2715_3008 95
302 3300049579 Ga0501043_0080857 Ga0501043_0080857_563_856 95
303 3300049586 Ga0501070_0085902 Ga0501070_0085902_1206_1499 95
304 3300049656 Ga0501209_216804 Ga0501209_216804_170_463 95
305 3300049823 Ga0501044_0369903 Ga0501044_0369903_1033_1326 95
306 3300049824 Ga0501045_1307130 Ga0501045_1307130_206_499 95
307 3300050496 nmdc:mga07m45_628578_c1 nmdc:mga07m45_628578_c1_200_493 95
308 3300059510 Ga0587090_004357 Ga0587090_004357_168_461 95
309 3300059630 Ga0587128_047718 Ga0587128_047718_263_556 95
310 3300059643 Ga0587072_003555 Ga0587072_003555_1715_2008 95
311 3300009093 Ga0105240_11157464 Ga0105240_111574642 96
312 3300009176 Ga0105242_11760108 Ga0105242_117601081 96
313 3300009545 Ga0105237_10281100 Ga0105237_102811003 96
314 3300009551 Ga0105238_10231835 Ga0105238_102318353 96
315 3300010375 Ga0105239_10159505 Ga0105239_101595052 96
316 3300014969 Ga0157376_10025735 Ga0157376_100257352 96
317 3300025913 Ga0207695_10856306 Ga0207695_108563062 96
318 3300027617 Ga0210002_1016324 Ga0210002_10163242 96
319 3300041451 Ga0451791_1316043 Ga0451791_1316043_84_380 96
320 3300041460 Ga0451802_0276746 Ga0451802_0276746_175_471 96
321 3300041464 Ga0451808_06737 Ga0451808_06737_83_379 96
322 3300041486 Ga0451807_0294446 Ga0451807_0294446_317_613 96
323 3300044684 Ga0466966_0013970 Ga0466966_0013970_2218_2508 96
324 3300045049 Ga0466959_0072807 Ga0466959_0072807_298_588 96
325 3300049160 Ga0501304_036655 Ga0501304_036655_73_369 96
326 3300005467 Ga0070706_100716034 Ga0070706_1007160342 97
327 3300005468 Ga0070707_100558413 Ga0070707_1005584132 97
328 3300005468 Ga0070707_100768564 Ga0070707_1007685642 97
329 3300005471 Ga0070698_100793109 Ga0070698_1007931092 97
330 3300005536 Ga0070697_100857270 Ga0070697_1008572702 97
331 3300006175 Ga0070712_101902792 Ga0070712_1019027921 97
332 3300025915 Ga0207693_10319734 Ga0207693_103197341 97
333 3300025928 Ga0207700_10424367 Ga0207700_104243672 97
334 3300005327 Ga0070658_10404733 Ga0070658_104047332 98
335 3300005329 Ga0070683_100757092 Ga0070683_1007570922 98
336 3300005344 Ga0070661_100150702 Ga0070661_1001507022 98
337 3300005535 Ga0070684_101813731 Ga0070684_1018137312 98
338 3300005547 Ga0070693_100885869 Ga0070693_1008858692 98
339 3300046539 Ga0495621_0500183 Ga0495621_0500183_108_404 98
340 3300005616 Ga0068852_101605732 Ga0068852_1016057322 99
341 3300031824 Ga0307413_10342224 Ga0307413_103422242 99
342 3300005328 Ga0070676_10674108 Ga0070676_106741081 100
343 3300005329 Ga0070683_102332946 Ga0070683_1023329461 100
344 3300005336 Ga0070680_100187460 Ga0070680_1001874602 100
345 3300005339 Ga0070660_100085863 Ga0070660_1000858633 100
346 3300005339 Ga0070660_100532077 Ga0070660_1005320771 100
347 3300005341 Ga0070691_10061118 Ga0070691_100611181 100
348 3300005344 Ga0070661_100081807 Ga0070661_1000818072 100
349 3300005366 Ga0070659_101915838 Ga0070659_1019158382 100
350 3300005444 Ga0070694_100243246 Ga0070694_1002432462 100
351 3300005458 Ga0070681_10287672 Ga0070681_102876721 100
352 3300005458 Ga0070681_10468889 Ga0070681_104688892 100
353 3300005458 Ga0070681_11587399 Ga0070681_115873991 100
354 3300005468 Ga0070707_101479720 Ga0070707_1014797201 100
355 3300005471 Ga0070698_100018255 Ga0070698_1000182557 100
356 3300005530 Ga0070679_101650682 Ga0070679_1016506821 100
357 3300005530 Ga0070679_102128088 Ga0070679_1021280881 100
358 3300005535 Ga0070684_100099104 Ga0070684_1000991041 100
359 3300005535 Ga0070684_102227742 Ga0070684_1022277421 100
360 3300005539 Ga0068853_101281858 Ga0068853_1012818582 100
361 3300005546 Ga0070696_100153436 Ga0070696_1001534362 100
362 3300005563 Ga0068855_100404096 Ga0068855_1004040962 100
363 3300005563 Ga0068855_100577451 Ga0068855_1005774512 100
364 3300005563 Ga0068855_101774665 Ga0068855_1017746652 100
365 3300005564 Ga0070664_100460027 Ga0070664_1004600272 100
366 3300005614 Ga0068856_100119705 Ga0068856_1001197052 100
367 3300005614 Ga0068856_100522275 Ga0068856_1005222752 100
368 3300005616 Ga0068852_100065709 Ga0068852_1000657094 100
369 3300005616 Ga0068852_100127253 Ga0068852_1001272532 100
370 3300006914 Ga0075436_100389956 Ga0075436_1003899562 100
371 3300009093 Ga0105240_10225714 Ga0105240_102257142 100
372 3300009551 Ga0105238_10953504 Ga0105238_109535042 100
373 3300013100 Ga0157373_10248359 Ga0157373_102483592 100
374 3300013102 Ga0157371_10224768 Ga0157371_102247682 100
375 3300013102 Ga0157371_10272488 Ga0157371_102724882 100
376 3300013104 Ga0157370_10152532 Ga0157370_101525322 100
377 3300013104 Ga0157370_11458628 Ga0157370_114586282 100
378 3300013105 Ga0157369_10070857 Ga0157369_100708572 100
379 3300013105 Ga0157369_10073266 Ga0157369_100732664 100
380 3300013307 Ga0157372_10081879 Ga0157372_100818792 100
381 3300013307 Ga0157372_10295081 Ga0157372_102950812 100
382 3300020076 Ga0206355_1675750 Ga0206355_16757502 100
383 3300020077 Ga0206351_10734128 Ga0206351_107341282 100
384 3300025907 Ga0207645_10217388 Ga0207645_102173882 100
385 3300025909 Ga0207705_10024161 Ga0207705_100241613 100
386 3300025909 Ga0207705_10764772 Ga0207705_107647722 100
387 3300025912 Ga0207707_10837354 Ga0207707_108373542 100
388 3300025912 Ga0207707_10893897 Ga0207707_108938971 100
389 3300025913 Ga0207695_10377356 Ga0207695_103773562 100
390 3300025917 Ga0207660_10061959 Ga0207660_100619592 100
391 3300025919 Ga0207657_10035732 Ga0207657_100357323 100
392 3300025919 Ga0207657_10141222 Ga0207657_101412222 100
393 3300025920 Ga0207649_11485440 Ga0207649_114854401 100
394 3300025921 Ga0207652_10546292 Ga0207652_105462922 100
395 3300025921 Ga0207652_10584527 Ga0207652_105845271 100
396 3300025922 Ga0207646_10776853 Ga0207646_107768532 100
397 3300025924 Ga0207694_10910627 Ga0207694_109106272 100
398 3300025933 Ga0207706_10436537 Ga0207706_104365372 100
399 3300025933 Ga0207706_10444829 Ga0207706_104448292 100
400 3300025944 Ga0207661_10640929 Ga0207661_106409292 100
401 3300025944 Ga0207661_11962204 Ga0207661_119622041 100
402 3300025945 Ga0207679_10291104 Ga0207679_102911043 100
403 3300025949 Ga0207667_10031423 Ga0207667_100314234 100
404 3300025949 Ga0207667_10239433 Ga0207667_102394332 100
405 3300025949 Ga0207667_10927691 Ga0207667_109276911 100
406 3300025981 Ga0207640_10016300 Ga0207640_100163004 100
407 3300025981 Ga0207640_10407637 Ga0207640_104076372 100
408 3300026041 Ga0207639_12260585 Ga0207639_122605851 100
409 3300026067 Ga0207678_10011920 Ga0207678_100119204 100
410 3300026078 Ga0207702_10217218 Ga0207702_102172182 100
411 3300026078 Ga0207702_10891786 Ga0207702_108917861 100
412 3300026142 Ga0207698_10040229 Ga0207698_100402295 100
413 3300026142 Ga0207698_10472832 Ga0207698_104728321 100
414 3300031731 Ga0307405_11125075 Ga0307405_111250752 100
415 3300031824 Ga0307413_10059631 Ga0307413_100596312 100
416 3300031852 Ga0307410_10207505 Ga0307410_102075052 100
417 3300031903 Ga0307407_10785336 Ga0307407_107853362 100
418 3300031995 Ga0307409_100101758 Ga0307409_1001017582 100
419 3300031995 Ga0307409_101259152 Ga0307409_1012591522 100
420 3300032002 Ga0307416_101299562 Ga0307416_1012995622 100
421 3300032004 Ga0307414_10177225 Ga0307414_101772252 100
422 3300032005 Ga0307411_10010875 Ga0307411_100108755 100
423 3300035090 Ga0373949_0130164 Ga0373949_0130164_54_356 100
424 3300035241 Ga0373961_0166180 Ga0373961_0166180_84_386 100
425 3300035242 Ga0373962_0251979 Ga0373962_0251979_269_571 100
426 3300035724 Ga0373933_0885142 Ga0373933_0885142_136_438 100
427 3300042435 Ga0439434_0178087 Ga0439434_0178087_45_356 100
428 3300042876 Ga0451577_0000001 Ga0451577_0000001_41636_41938 100
429 3300042876 Ga0451577_0461331 Ga0451577_0461331_471_773 100
430 3300047317 Ga0495604_0369152 Ga0495604_0369152_344_652 100
431 3300049572 Ga0501036_1349747 Ga0501036_1349747_225_533 100
432 3300049576 Ga0501040_0157057 Ga0501040_0157057_994_1302 100
433 3300049583 Ga0501067_0098438 Ga0501067_0098438_183_485 100
434 3300049585 Ga0501069_0568409 Ga0501069_0568409_71_373 100
435 3300049587 Ga0501071_0774729 Ga0501071_0774729_283_591 100
436 3300049590 Ga0501074_0503048 Ga0501074_0503048_223_531 100
437 3300049592 Ga0501076_0480822 Ga0501076_0480822_140_448 100
438 3300049742 Ga0501080_0274379 Ga0501080_0274379_107_415 100
439 3300049743 Ga0501081_0097965 Ga0501081_0097965_1546_1854 100
440 3300054114 Ga0501084_0046520 Ga0501084_0046520_2599_2907 100
441 3300060353 Ga0501082_0259257 Ga0501082_0259257_418_726 100
442 3300060353 Ga0501082_0851237 Ga0501082_0851237_223_525 100
443 3300061734 Ga0530510_0331631 Ga0530510_0331631_170_478 100
444 3300061734 Ga0530510_0926384 Ga0530510_0926384_282_590 100
445 3300004799 Ga0058863_11573035 Ga0058863_115730351 101
446 3300004801 Ga0058860_11567160 Ga0058860_115671601 101
447 3300004803 Ga0058862_10000625 Ga0058862_100006251 101
448 3300004803 Ga0058862_12811975 Ga0058862_128119751 101
449 3300005295 Ga0065707_10031412 Ga0065707_100314122 101
450 3300005327 Ga0070658_10951538 Ga0070658_109515382 101
451 3300005336 Ga0070680_100004792 Ga0070680_1000047924 101
452 3300005337 Ga0070682_100469768 Ga0070682_1004697682 101
453 3300005339 Ga0070660_100605271 Ga0070660_1006052712 101
454 3300005344 Ga0070661_100064642 Ga0070661_1000646422 101
455 3300005366 Ga0070659_100287795 Ga0070659_1002877951 101
456 3300005434 Ga0070709_10307781 Ga0070709_103077812 101
457 3300005434 Ga0070709_11464173 Ga0070709_114641732 101
458 3300005435 Ga0070714_100012646 Ga0070714_1000126462 101
459 3300005435 Ga0070714_100962981 Ga0070714_1009629812 101
460 3300005436 Ga0070713_100351522 Ga0070713_1003515222 101
461 3300005455 Ga0070663_100450178 Ga0070663_1004501782 101
462 3300005458 Ga0070681_10102285 Ga0070681_101022852 101
463 3300005467 Ga0070706_100536274 Ga0070706_1005362742 101
464 3300005530 Ga0070679_100036806 Ga0070679_1000368064 101
465 3300005536 Ga0070697_100296028 Ga0070697_1002960282 101
466 3300005539 Ga0068853_100008476 Ga0068853_1000084765 101
467 3300005539 Ga0068853_101917283 Ga0068853_1019172832 101
468 3300005547 Ga0070693_101449685 Ga0070693_1014496851 101
469 3300005563 Ga0068855_100081814 Ga0068855_1000818143 101
470 3300005578 Ga0068854_100131928 Ga0068854_1001319281 101
471 3300005616 Ga0068852_100005278 Ga0068852_1000052785 101
472 3300006844 Ga0075428_100835125 Ga0075428_1008351252 101
473 3300006846 Ga0075430_100929367 Ga0075430_1009293671 101
474 3300006847 Ga0075431_100591123 Ga0075431_1005911232 101
475 3300006852 Ga0075433_10409775 Ga0075433_104097753 101
476 3300006871 Ga0075434_101129355 Ga0075434_1011293552 101
477 3300006914 Ga0075436_100990790 Ga0075436_1009907902 101
478 3300007076 Ga0075435_101211370 Ga0075435_1012113701 101
479 3300009093 Ga0105240_10747923 Ga0105240_107479231 101
480 3300009094 Ga0111539_10433129 Ga0111539_104331292 101
481 3300009147 Ga0114129_10393376 Ga0114129_103933761 101
482 3300009147 Ga0114129_10507958 Ga0114129_105079582 101
483 3300009147 Ga0114129_10968006 Ga0114129_109680062 101
484 3300009174 Ga0105241_10717181 Ga0105241_107171811 101
485 3300009551 Ga0105238_10321897 Ga0105238_103218972 101
486 3300009551 Ga0105238_11734694 Ga0105238_117346942 101
487 3300013100 Ga0157373_10223200 Ga0157373_102232002 101
488 3300013104 Ga0157370_10044459 Ga0157370_100444594 101
489 3300013307 Ga0157372_10227076 Ga0157372_102270762 101
490 3300013307 Ga0157372_10453519 Ga0157372_104535192 101
491 3300014326 Ga0157380_10881154 Ga0157380_108811542 101
492 3300020077 Ga0206351_10347809 Ga0206351_103478091 101
493 3300020610 Ga0154015_1166432 Ga0154015_11664321 101
494 3300025885 Ga0207653_10427838 Ga0207653_104278381 101
495 3300025909 Ga0207705_10972144 Ga0207705_109721441 101
496 3300025911 Ga0207654_10715486 Ga0207654_107154861 101
497 3300025912 Ga0207707_10070111 Ga0207707_100701113 101
498 3300025913 Ga0207695_10301987 Ga0207695_103019872 101
499 3300025917 Ga0207660_10530818 Ga0207660_105308182 101
500 3300025919 Ga0207657_10619799 Ga0207657_106197992 101
501 3300025920 Ga0207649_10477255 Ga0207649_104772551 101
502 3300025921 Ga0207652_10045176 Ga0207652_100451762 101
503 3300025924 Ga0207694_10009441 Ga0207694_100094414 101
504 3300025929 Ga0207664_10094655 Ga0207664_100946553 101
505 3300025933 Ga0207706_11100982 Ga0207706_111009822 101
506 3300025939 Ga0207665_10880324 Ga0207665_108803241 101
507 3300025949 Ga0207667_10029258 Ga0207667_100292587 101
508 3300025981 Ga0207640_10043092 Ga0207640_100430921 101
509 3300026041 Ga0207639_10005399 Ga0207639_100053998 101
510 3300026067 Ga0207678_10272137 Ga0207678_102721372 101
511 3300026078 Ga0207702_10024571 Ga0207702_100245717 101
512 3300026142 Ga0207698_10005024 Ga0207698_100050246 101
513 3300027907 Ga0207428_10453432 Ga0207428_104534321 101
514 3300031824 Ga0307413_10218377 Ga0307413_102183772 101
515 3300031852 Ga0307410_10065573 Ga0307410_100655732 101
516 3300031903 Ga0307407_10442645 Ga0307407_104426451 101
517 3300031995 Ga0307409_100044098 Ga0307409_1000440984 101
518 3300032002 Ga0307416_100886965 Ga0307416_1008869652 101
519 3300032002 Ga0307416_103589622 Ga0307416_1035896222 101
520 3300032005 Ga0307411_10034864 Ga0307411_100348644 101
521 3300041411 Ga0439466_0079827 Ga0439466_0079827_665_976 101
522 3300042003 Ga0439443_091325 Ga0439443_091325_232_549 101
523 3300042435 Ga0439434_0057754 Ga0439434_0057754_549_860 101
524 3300046491 Ga0495584_0401090 Ga0495584_0401090_373_684 101
525 3300049571 Ga0501034_1200893 Ga0501034_1200893_305_616 101
526 3300049572 Ga0501036_0301206 Ga0501036_0301206_358_669 101
527 3300049572 Ga0501036_0715550 Ga0501036_0715550_194_505 101
528 3300049572 Ga0501036_1695644 Ga0501036_1695644_69_380 101
529 3300049573 Ga0501037_0442789 Ga0501037_0442789_116_445 101
530 3300049574 Ga0501038_0699477 Ga0501038_0699477_239_568 101
531 3300049575 Ga0501039_0299904 Ga0501039_0299904_209_538 101
532 3300049576 Ga0501040_0049193 Ga0501040_0049193_879_1208 101
533 3300049577 Ga0501041_0139617 Ga0501041_0139617_695_1024 101
534 3300049578 Ga0501042_1147443 Ga0501042_1147443_167_478 101
535 3300049580 Ga0501046_0045733 Ga0501046_0045733_2603_2932 101
536 3300049582 Ga0501048_0797553 Ga0501048_0797553_324_635 101
537 3300049584 Ga0501068_0498985 Ga0501068_0498985_449_778 101
538 3300049587 Ga0501071_0022608 Ga0501071_0022608_225_554 101
539 3300049588 Ga0501072_0065137 Ga0501072_0065137_1059_1370 101
540 3300049588 Ga0501072_0509073 Ga0501072_0509073_109_420 101
541 3300049590 Ga0501074_0129833 Ga0501074_0129833_621_950 101
542 3300049591 Ga0501075_0187165 Ga0501075_0187165_156_485 101
543 3300049591 Ga0501075_1296848 Ga0501075_1296848_48_359 101
544 3300049592 Ga0501076_0019885 Ga0501076_0019885_3418_3729 101
545 3300049593 Ga0501077_0110034 Ga0501077_0110034_182_499 101
546 3300049668 Ga0501233_171317 Ga0501233_171317_35_352 101
547 3300049741 Ga0501079_1026882 Ga0501079_1026882_296_625 101
548 3300049742 Ga0501080_0844723 Ga0501080_0844723_213_542 101
549 3300049744 Ga0501083_0270410 Ga0501083_0270410_39_368 101
550 3300049823 Ga0501044_0712922 Ga0501044_0712922_501_830 101
551 3300049824 Ga0501045_0607603 Ga0501045_0607603_134_463 101
552 3300050507 nmdc:mga05p37_160415_c1 nmdc:mga05p37_160415_c1_146_460 101
553 3300050507 nmdc:mga05p37_1626423_c1 nmdc:mga05p37_1626423_c1_266_583 101
554 3300050507 nmdc:mga05p37_728397_c1 nmdc:mga05p37_728397_c1_637_948 101
555 3300050510 nmdc:mga06r32_186107_c1 nmdc:mga06r32_186107_c1_1285_1596 101
556 3300050511 nmdc:mga08y16_114735_c1 nmdc:mga08y16_114735_c1_1371_1682 101
557 3300050512 nmdc:mga0n895_1917392_c1 nmdc:mga0n895_1917392_c1_149_463 101
558 3300050513 nmdc:mga0rr50_600645_c1 nmdc:mga0rr50_600645_c1_449_763 101
559 3300050513 nmdc:mga0rr50_741140_c1 nmdc:mga0rr50_741140_c1_81_395 101
560 3300054114 Ga0501084_0705931 Ga0501084_0705931_331_660 101
561 3300059421 Ga0590071_024241 Ga0590071_024241_1068_1379 101
562 3300059423 Ga0590074_010196 Ga0590074_010196_207_518 101
563 3300059424 Ga0590075_065515 Ga0590075_065515_96_407 101
564 3300059426 Ga0590077_013609 Ga0590077_013609_1185_1496 101
565 3300060353 Ga0501082_0073796 Ga0501082_0073796_1699_2010 101
566 3300061734 Ga0530510_0765706 Ga0530510_0765706_133_462 101
567 3300001977 JGI24746J21847_1017945 JGI24746J21847_10179451 102
568 3300001989 JGI24739J22299_10153085 JGI24739J22299_101530852 102
569 3300001989 JGI24739J22299_10173906 JGI24739J22299_101739061 102
570 3300002067 JGI24735J21928_10150096 JGI24735J21928_101500962 102
571 3300002075 JGI24738J21930_10113188 JGI24738J21930_101131882 102
572 3300003323 rootH1_10160366 rootH1_101603662 102
573 3300003574 Ga0007410J51695_1095721 Ga0007410J51695_10957211 102
574 3300003575 Ga0007409J51694_1061563 Ga0007409J51694_10615631 102
575 3300003579 Ga0007429J51699_1055138 Ga0007429J51699_10551381 102
576 3300003693 Ga0032354_1070555 Ga0032354_10705551 102
577 3300004798 Ga0058859_11723421 Ga0058859_117234212 102
578 3300004800 Ga0058861_11782770 Ga0058861_117827701 102
579 3300004800 Ga0058861_12050521 Ga0058861_120505211 102
580 3300004801 Ga0058860_12083350 Ga0058860_120833501 102
581 3300004801 Ga0058860_12124474 Ga0058860_121244741 102
582 3300004803 Ga0058862_12763569 Ga0058862_127635692 102
583 3300005289 Ga0065704_10501280 Ga0065704_105012801 102
584 3300005290 Ga0065712_10135028 Ga0065712_101350281 102
585 3300005293 Ga0065715_10029592 Ga0065715_100295922 102
586 3300005293 Ga0065715_10340438 Ga0065715_103404382 102
587 3300005293 Ga0065715_10879663 Ga0065715_108796632 102
588 3300005293 Ga0065715_11021616 Ga0065715_110216161 102
589 3300005295 Ga0065707_10362525 Ga0065707_103625251 102
590 3300005295 Ga0065707_11040338 Ga0065707_110403381 102
591 3300005327 Ga0070658_10124301 Ga0070658_101243012 102
592 3300005328 Ga0070676_10005779 Ga0070676_100057794 102
593 3300005328 Ga0070676_10017473 Ga0070676_100174732 102
594 3300005328 Ga0070676_10022558 Ga0070676_100225582 102
595 3300005328 Ga0070676_10064597 Ga0070676_100645972 102
596 3300005328 Ga0070676_10141119 Ga0070676_101411192 102
597 3300005329 Ga0070683_100001069 Ga0070683_10000106923 102
598 3300005330 Ga0070690_100054140 Ga0070690_1000541403 102
599 3300005330 Ga0070690_100410129 Ga0070690_1004101292 102
600 3300005331 Ga0070670_100438972 Ga0070670_1004389722 102
601 3300005331 Ga0070670_100497695 Ga0070670_1004976951 102
602 3300005331 Ga0070670_101831978 Ga0070670_1018319782 102
603 3300005333 Ga0070677_10213428 Ga0070677_102134282 102
604 3300005333 Ga0070677_10273013 Ga0070677_102730132 102
605 3300005333 Ga0070677_10371001 Ga0070677_103710012 102
606 3300005334 Ga0068869_100009804 Ga0068869_1000098046 102
607 3300005334 Ga0068869_100329731 Ga0068869_1003297312 102
608 3300005334 Ga0068869_100546191 Ga0068869_1005461912 102
609 3300005335 Ga0070666_10039792 Ga0070666_100397922 102
610 3300005335 Ga0070666_11459008 Ga0070666_114590081 102
611 3300005336 Ga0070680_100006737 Ga0070680_1000067372 102
612 3300005336 Ga0070680_100088267 Ga0070680_1000882672 102
613 3300005336 Ga0070680_100137496 Ga0070680_1001374962 102
614 3300005336 Ga0070680_100272285 Ga0070680_1002722852 102
615 3300005336 Ga0070680_100448545 Ga0070680_1004485452 102
616 3300005336 Ga0070680_100537067 Ga0070680_1005370672 102
617 3300005336 Ga0070680_100765095 Ga0070680_1007650952 102
618 3300005336 Ga0070680_101248983 Ga0070680_1012489831 102
619 3300005336 Ga0070680_101594546 Ga0070680_1015945461 102
620 3300005337 Ga0070682_100007747 Ga0070682_1000077472 102
621 3300005337 Ga0070682_100214328 Ga0070682_1002143281 102
622 3300005337 Ga0070682_100763886 Ga0070682_1007638862 102
623 3300005337 Ga0070682_101228404 Ga0070682_1012284042 102
624 3300005338 Ga0068868_100129570 Ga0068868_1001295702 102
625 3300005338 Ga0068868_100616415 Ga0068868_1006164152 102
626 3300005338 Ga0068868_100863010 Ga0068868_1008630102 102
627 3300005339 Ga0070660_100843691 Ga0070660_1008436912 102
628 3300005340 Ga0070689_100425244 Ga0070689_1004252442 102
629 3300005340 Ga0070689_100439515 Ga0070689_1004395152 102
630 3300005341 Ga0070691_10056788 Ga0070691_100567882 102
631 3300005341 Ga0070691_10504669 Ga0070691_105046692 102
632 3300005341 Ga0070691_10575289 Ga0070691_105752891 102
633 3300005343 Ga0070687_100045251 Ga0070687_1000452512 102
634 3300005343 Ga0070687_100065162 Ga0070687_1000651622 102
635 3300005344 Ga0070661_100276089 Ga0070661_1002760892 102
636 3300005344 Ga0070661_100521069 Ga0070661_1005210691 102
637 3300005345 Ga0070692_10446872 Ga0070692_104468721 102
638 3300005345 Ga0070692_10857641 Ga0070692_108576412 102
639 3300005347 Ga0070668_100047542 Ga0070668_1000475422 102
640 3300005347 Ga0070668_101828465 Ga0070668_1018284652 102
641 3300005353 Ga0070669_100003047 Ga0070669_1000030474 102
642 3300005353 Ga0070669_100062064 Ga0070669_1000620642 102
643 3300005353 Ga0070669_100147225 Ga0070669_1001472252 102
644 3300005353 Ga0070669_100234851 Ga0070669_1002348512 102
645 3300005353 Ga0070669_101758867 Ga0070669_1017588672 102
646 3300005354 Ga0070675_100010521 Ga0070675_1000105217 102
647 3300005354 Ga0070675_100119041 Ga0070675_1001190411 102
648 3300005354 Ga0070675_100143621 Ga0070675_1001436212 102
649 3300005354 Ga0070675_100333811 Ga0070675_1003338112 102
650 3300005355 Ga0070671_100005351 Ga0070671_10000535110 102
651 3300005355 Ga0070671_100111032 Ga0070671_1001110322 102
652 3300005355 Ga0070671_100630053 Ga0070671_1006300532 102
653 3300005355 Ga0070671_100631672 Ga0070671_1006316721 102
654 3300005355 Ga0070671_101469942 Ga0070671_1014699421 102
655 3300005356 Ga0070674_100001645 Ga0070674_10000164512 102
656 3300005356 Ga0070674_100206660 Ga0070674_1002066602 102
657 3300005356 Ga0070674_101633682 Ga0070674_1016336821 102
658 3300005364 Ga0070673_100065427 Ga0070673_1000654272 102
659 3300005364 Ga0070673_100198810 Ga0070673_1001988102 102
660 3300005365 Ga0070688_100116415 Ga0070688_1001164152 102
661 3300005366 Ga0070659_100024636 Ga0070659_1000246362 102
662 3300005366 Ga0070659_100101267 Ga0070659_1001012671 102
663 3300005366 Ga0070659_100617920 Ga0070659_1006179202 102
664 3300005367 Ga0070667_100033201 Ga0070667_1000332012 102
665 3300005367 Ga0070667_100468174 Ga0070667_1004681742 102
666 3300005367 Ga0070667_101486696 Ga0070667_1014866961 102
667 3300005434 Ga0070709_10010524 Ga0070709_100105244 102
668 3300005436 Ga0070713_100069801 Ga0070713_1000698012 102
669 3300005436 Ga0070713_100498520 Ga0070713_1004985201 102
670 3300005437 Ga0070710_10039481 Ga0070710_100394813 102
671 3300005437 Ga0070710_11084603 Ga0070710_110846031 102
672 3300005438 Ga0070701_10362308 Ga0070701_103623081 102
673 3300005439 Ga0070711_100372464 Ga0070711_1003724642 102
674 3300005440 Ga0070705_100004513 Ga0070705_1000045132 102
675 3300005440 Ga0070705_100046854 Ga0070705_1000468542 102
676 3300005440 Ga0070705_100217229 Ga0070705_1002172293 102
677 3300005440 Ga0070705_100663556 Ga0070705_1006635562 102
678 3300005440 Ga0070705_101717346 Ga0070705_1017173461 102
679 3300005441 Ga0070700_100484401 Ga0070700_1004844011 102
680 3300005444 Ga0070694_100065463 Ga0070694_1000654632 102
681 3300005444 Ga0070694_100218981 Ga0070694_1002189812 102
682 3300005444 Ga0070694_100259424 Ga0070694_1002594242 102
683 3300005444 Ga0070694_101208692 Ga0070694_1012086921 102
684 3300005444 Ga0070694_101942568 Ga0070694_1019425681 102
685 3300005445 Ga0070708_100000480 Ga0070708_10000048013 102
686 3300005445 Ga0070708_100086499 Ga0070708_1000864992 102
687 3300005445 Ga0070708_100176264 Ga0070708_1001762642 102
688 3300005445 Ga0070708_100224161 Ga0070708_1002241612 102
689 3300005445 Ga0070708_100252627 Ga0070708_1002526273 102
690 3300005445 Ga0070708_100404918 Ga0070708_1004049182 102
691 3300005445 Ga0070708_100847685 Ga0070708_1008476852 102
692 3300005445 Ga0070708_101283457 Ga0070708_1012834571 102
693 3300005455 Ga0070663_100857926 Ga0070663_1008579261 102
694 3300005455 Ga0070663_101202298 Ga0070663_1012022981 102
695 3300005455 Ga0070663_101204184 Ga0070663_1012041841 102
696 3300005456 Ga0070678_100002017 Ga0070678_1000020178 102
697 3300005456 Ga0070678_100132020 Ga0070678_1001320202 102
698 3300005457 Ga0070662_100001156 Ga0070662_10000115613 102
699 3300005457 Ga0070662_100160783 Ga0070662_1001607831 102
700 3300005457 Ga0070662_101214325 Ga0070662_1012143251 102
701 3300005457 Ga0070662_101316449 Ga0070662_1013164491 102
702 3300005458 Ga0070681_10006976 Ga0070681_1000697610 102
703 3300005458 Ga0070681_10085276 Ga0070681_100852762 102
704 3300005458 Ga0070681_10380842 Ga0070681_103808422 102
705 3300005458 Ga0070681_10491091 Ga0070681_104910911 102
706 3300005458 Ga0070681_10500030 Ga0070681_105000302 102
707 3300005459 Ga0068867_100000759 Ga0068867_1000007598 102
708 3300005459 Ga0068867_100056644 Ga0068867_1000566442 102
709 3300005459 Ga0068867_100411982 Ga0068867_1004119822 102
710 3300005466 Ga0070685_10033417 Ga0070685_100334172 102
711 3300005467 Ga0070706_100129191 Ga0070706_1001291912 102
712 3300005467 Ga0070706_100163214 Ga0070706_1001632144 102
713 3300005467 Ga0070706_100212481 Ga0070706_1002124811 102
714 3300005467 Ga0070706_100448273 Ga0070706_1004482731 102
715 3300005468 Ga0070707_100000409 Ga0070707_10000040914 102
716 3300005468 Ga0070707_100023799 Ga0070707_1000237995 102
717 3300005468 Ga0070707_100033031 Ga0070707_1000330312 102
718 3300005468 Ga0070707_100172977 Ga0070707_1001729772 102
719 3300005468 Ga0070707_100256290 Ga0070707_1002562902 102
720 3300005468 Ga0070707_100292565 Ga0070707_1002925654 102
721 3300005468 Ga0070707_100314329 Ga0070707_1003143293 102
722 3300005471 Ga0070698_100020032 Ga0070698_1000200324 102
723 3300005471 Ga0070698_100101549 Ga0070698_1001015492 102
724 3300005471 Ga0070698_100510801 Ga0070698_1005108011 102
725 3300005471 Ga0070698_100743688 Ga0070698_1007436882 102
726 3300005471 Ga0070698_101256764 Ga0070698_1012567641 102
727 3300005471 Ga0070698_101440831 Ga0070698_1014408311 102
728 3300005518 Ga0070699_100000092 Ga0070699_1000000922 102
729 3300005518 Ga0070699_100005907 Ga0070699_1000059072 102
730 3300005518 Ga0070699_100066677 Ga0070699_1000666772 102
731 3300005518 Ga0070699_100242105 Ga0070699_1002421052 102
732 3300005518 Ga0070699_100262589 Ga0070699_1002625892 102
733 3300005518 Ga0070699_100285581 Ga0070699_1002855812 102
734 3300005518 Ga0070699_100505206 Ga0070699_1005052061 102
735 3300005518 Ga0070699_100628596 Ga0070699_1006285961 102
736 3300005518 Ga0070699_100898119 Ga0070699_1008981191 102
737 3300005518 Ga0070699_101100650 Ga0070699_1011006501 102
738 3300005518 Ga0070699_101104301 Ga0070699_1011043012 102
739 3300005518 Ga0070699_101912559 Ga0070699_1019125592 102
740 3300005518 Ga0070699_102180378 Ga0070699_1021803781 102
741 3300005530 Ga0070679_100012235 Ga0070679_1000122358 102
742 3300005530 Ga0070679_100024190 Ga0070679_1000241902 102
743 3300005530 Ga0070679_100142459 Ga0070679_1001424594 102
744 3300005530 Ga0070679_100193864 Ga0070679_1001938643 102
745 3300005530 Ga0070679_100627738 Ga0070679_1006277381 102
746 3300005530 Ga0070679_101090511 Ga0070679_1010905112 102
747 3300005530 Ga0070679_101197442 Ga0070679_1011974422 102
748 3300005535 Ga0070684_100000326 Ga0070684_1000003266 102
749 3300005535 Ga0070684_100013532 Ga0070684_1000135322 102
750 3300005535 Ga0070684_100105047 Ga0070684_1001050472 102
751 3300005535 Ga0070684_100417840 Ga0070684_1004178402 102
752 3300005535 Ga0070684_101280834 Ga0070684_1012808341 102
753 3300005536 Ga0070697_100005779 Ga0070697_1000057794 102
754 3300005536 Ga0070697_100044318 Ga0070697_1000443185 102
755 3300005536 Ga0070697_100083526 Ga0070697_1000835262 102
756 3300005536 Ga0070697_100093526 Ga0070697_1000935262 102
757 3300005536 Ga0070697_100195298 Ga0070697_1001952982 102
758 3300005536 Ga0070697_100219566 Ga0070697_1002195663 102
759 3300005536 Ga0070697_100297776 Ga0070697_1002977762 102
760 3300005536 Ga0070697_100501203 Ga0070697_1005012032 102
761 3300005539 Ga0068853_100238338 Ga0068853_1002383382 102
762 3300005539 Ga0068853_101092882 Ga0068853_1010928822 102
763 3300005539 Ga0068853_102327201 Ga0068853_1023272011 102
764 3300005539 Ga0068853_102474451 Ga0068853_1024744511 102
765 3300005543 Ga0070672_100241186 Ga0070672_1002411862 102
766 3300005543 Ga0070672_101386323 Ga0070672_1013863232 102
767 3300005543 Ga0070672_101462454 Ga0070672_1014624542 102
768 3300005543 Ga0070672_101666467 Ga0070672_1016664671 102
769 3300005544 Ga0070686_100160677 Ga0070686_1001606772 102
770 3300005544 Ga0070686_100300936 Ga0070686_1003009362 102
771 3300005544 Ga0070686_100730023 Ga0070686_1007300231 102
772 3300005545 Ga0070695_100046229 Ga0070695_1000462293 102
773 3300005545 Ga0070695_100095824 Ga0070695_1000958242 102
774 3300005545 Ga0070695_100312876 Ga0070695_1003128762 102
775 3300005546 Ga0070696_100003048 Ga0070696_1000030482 102
776 3300005546 Ga0070696_100013055 Ga0070696_1000130557 102
777 3300005546 Ga0070696_100064398 Ga0070696_1000643982 102
778 3300005546 Ga0070696_100370580 Ga0070696_1003705802 102
779 3300005546 Ga0070696_100453076 Ga0070696_1004530762 102
780 3300005546 Ga0070696_100990012 Ga0070696_1009900121 102
781 3300005547 Ga0070693_100015975 Ga0070693_1000159754 102
782 3300005547 Ga0070693_100303135 Ga0070693_1003031352 102
783 3300005547 Ga0070693_100319342 Ga0070693_1003193422 102
784 3300005547 Ga0070693_100506005 Ga0070693_1005060052 102
785 3300005548 Ga0070665_101528570 Ga0070665_1015285702 102
786 3300005549 Ga0070704_100056890 Ga0070704_1000568902 102
787 3300005549 Ga0070704_100116000 Ga0070704_1001160001 102
788 3300005549 Ga0070704_100431466 Ga0070704_1004314661 102
789 3300005549 Ga0070704_100486200 Ga0070704_1004862002 102
790 3300005549 Ga0070704_100833708 Ga0070704_1008337082 102
791 3300005563 Ga0068855_102163024 Ga0068855_1021630241 102
792 3300005564 Ga0070664_100004494 Ga0070664_10000449410 102
793 3300005564 Ga0070664_100132457 Ga0070664_1001324572 102
794 3300005564 Ga0070664_100136105 Ga0070664_1001361052 102
795 3300005564 Ga0070664_100245714 Ga0070664_1002457142 102
796 3300005564 Ga0070664_100245745 Ga0070664_1002457452 102
797 3300005564 Ga0070664_101254215 Ga0070664_1012542152 102
798 3300005564 Ga0070664_101275582 Ga0070664_1012755822 102
799 3300005564 Ga0070664_101426181 Ga0070664_1014261812 102
800 3300005577 Ga0068857_100007935 Ga0068857_1000079352 102
801 3300005577 Ga0068857_100032526 Ga0068857_1000325266 102
802 3300005577 Ga0068857_100648026 Ga0068857_1006480262 102
803 3300005577 Ga0068857_101523931 Ga0068857_1015239311 102
804 3300005577 Ga0068857_101757341 Ga0068857_1017573412 102
805 3300005578 Ga0068854_100003432 Ga0068854_1000034325 102
806 3300005578 Ga0068854_100170652 Ga0068854_1001706522 102
807 3300005578 Ga0068854_101962452 Ga0068854_1019624521 102
808 3300005614 Ga0068856_100738213 Ga0068856_1007382132 102
809 3300005615 Ga0070702_100118342 Ga0070702_1001183422 102
810 3300005615 Ga0070702_100228920 Ga0070702_1002289201 102
811 3300005615 Ga0070702_100626702 Ga0070702_1006267021 102
812 3300005616 Ga0068852_100376150 Ga0068852_1003761502 102
813 3300005616 Ga0068852_100927148 Ga0068852_1009271482 102
814 3300005616 Ga0068852_101050239 Ga0068852_1010502392 102
815 3300005617 Ga0068859_100629297 Ga0068859_1006292972 102
816 3300005617 Ga0068859_100937576 Ga0068859_1009375762 102
817 3300005617 Ga0068859_101283992 Ga0068859_1012839922 102
818 3300005617 Ga0068859_101764026 Ga0068859_1017640261 102
819 3300005618 Ga0068864_100512406 Ga0068864_1005124062 102
820 3300005618 Ga0068864_100513615 Ga0068864_1005136152 102
821 3300005618 Ga0068864_101031802 Ga0068864_1010318022 102
822 3300005618 Ga0068864_101054928 Ga0068864_1010549282 102
823 3300005618 Ga0068864_101877037 Ga0068864_1018770371 102
824 3300005718 Ga0068866_10000404 Ga0068866_1000040413 102
825 3300005719 Ga0068861_100176137 Ga0068861_1001761372 102
826 3300005719 Ga0068861_100198429 Ga0068861_1001984293 102
827 3300005834 Ga0068851_10021773 Ga0068851_100217731 102
828 3300005840 Ga0068870_10030395 Ga0068870_100303953 102
829 3300005840 Ga0068870_10866419 Ga0068870_108664191 102
830 3300005841 Ga0068863_100078093 Ga0068863_1000780932 102
831 3300005841 Ga0068863_100217663 Ga0068863_1002176632 102
832 3300005841 Ga0068863_100263845 Ga0068863_1002638452 102
833 3300005841 Ga0068863_101381658 Ga0068863_1013816581 102
834 3300005841 Ga0068863_102633411 Ga0068863_1026334112 102
835 3300005842 Ga0068858_100077874 Ga0068858_1000778744 102
836 3300005842 Ga0068858_100901461 Ga0068858_1009014612 102
837 3300005842 Ga0068858_101388984 Ga0068858_1013889841 102
838 3300005843 Ga0068860_100208880 Ga0068860_1002088802 102
839 3300005843 Ga0068860_100254541 Ga0068860_1002545412 102
840 3300005843 Ga0068860_100904091 Ga0068860_1009040912 102
841 3300005843 Ga0068860_101028444 Ga0068860_1010284442 102
842 3300005843 Ga0068860_101029457 Ga0068860_1010294572 102
843 3300005843 Ga0068860_101173858 Ga0068860_1011738582 102
844 3300005844 Ga0068862_100590872 Ga0068862_1005908722 102
845 3300005844 Ga0068862_101039616 Ga0068862_1010396162 102
846 3300005844 Ga0068862_101097672 Ga0068862_1010976721 102
847 3300005844 Ga0068862_101459169 Ga0068862_1014591692 102
848 3300005844 Ga0068862_101594291 Ga0068862_1015942912 102
849 3300005844 Ga0068862_101961398 Ga0068862_1019613982 102
850 3300006058 Ga0075432_10434716 Ga0075432_104347161 102
851 3300006163 Ga0070715_10065850 Ga0070715_100658501 102
852 3300006163 Ga0070715_10457432 Ga0070715_104574322 102
853 3300006173 Ga0070716_100004886 Ga0070716_1000048863 102
854 3300006173 Ga0070716_100171570 Ga0070716_1001715703 102
855 3300006173 Ga0070716_101690437 Ga0070716_1016904371 102
856 3300006175 Ga0070712_100436871 Ga0070712_1004368711 102
857 3300006237 Ga0097621_101281850 Ga0097621_1012818502 102
858 3300006358 Ga0068871_100375186 Ga0068871_1003751862 102
859 3300006358 Ga0068871_100391742 Ga0068871_1003917422 102
860 3300006358 Ga0068871_101463415 Ga0068871_1014634151 102
861 3300006358 Ga0068871_101608985 Ga0068871_1016089851 102
862 3300006844 Ga0075428_100446670 Ga0075428_1004466701 102
863 3300006844 Ga0075428_101479644 Ga0075428_1014796442 102
864 3300006846 Ga0075430_100715140 Ga0075430_1007151402 102
865 3300006847 Ga0075431_100136198 Ga0075431_1001361982 102
866 3300006847 Ga0075431_100147269 Ga0075431_1001472693 102
867 3300006852 Ga0075433_10468029 Ga0075433_104680292 102
868 3300006871 Ga0075434_100506556 Ga0075434_1005065562 102
869 3300006871 Ga0075434_100702695 Ga0075434_1007026952 102
870 3300006880 Ga0075429_101074736 Ga0075429_1010747362 102
871 3300006881 Ga0068865_100005654 Ga0068865_1000056545 102
872 3300006881 Ga0068865_100407770 Ga0068865_1004077702 102
873 3300006914 Ga0075436_100008314 Ga0075436_1000083142 102
874 3300006914 Ga0075436_100910751 Ga0075436_1009107512 102
875 3300006914 Ga0075436_100913257 Ga0075436_1009132571 102
876 3300006931 Ga0097620_100629275 Ga0097620_1006292752 102
877 3300006931 Ga0097620_100937552 Ga0097620_1009375522 102
878 3300006931 Ga0097620_101283884 Ga0097620_1012838842 102
879 3300006931 Ga0097620_101764035 Ga0097620_1017640351 102
880 3300007076 Ga0075435_100170485 Ga0075435_1001704852 102
881 3300007076 Ga0075435_101427843 Ga0075435_1014278432 102
882 3300009093 Ga0105240_10208118 Ga0105240_102081183 102
883 3300009094 Ga0111539_10567643 Ga0111539_105676432 102
884 3300009094 Ga0111539_10691486 Ga0111539_106914862 102
885 3300009094 Ga0111539_11315244 Ga0111539_113152441 102
886 3300009098 Ga0105245_10025517 Ga0105245_100255176 102
887 3300009098 Ga0105245_10161584 Ga0105245_101615842 102
888 3300009101 Ga0105247_10193790 Ga0105247_101937902 102
889 3300009147 Ga0114129_10331483 Ga0114129_103314833 102
890 3300009147 Ga0114129_11187811 Ga0114129_111878111 102
891 3300009147 Ga0114129_11409747 Ga0114129_114097471 102
892 3300009147 Ga0114129_11798651 Ga0114129_117986512 102
893 3300009147 Ga0114129_13403684 Ga0114129_134036842 102
894 3300009148 Ga0105243_10003111 Ga0105243_1000311114 102
895 3300009148 Ga0105243_10392916 Ga0105243_103929162 102
896 3300009174 Ga0105241_10009451 Ga0105241_100094512 102
897 3300009174 Ga0105241_10543631 Ga0105241_105436312 102
898 3300009174 Ga0105241_11800170 Ga0105241_118001701 102
899 3300009176 Ga0105242_10003345 Ga0105242_100033455 102
900 3300009176 Ga0105242_10023463 Ga0105242_100234636 102
901 3300009176 Ga0105242_10647666 Ga0105242_106476662 102
902 3300009176 Ga0105242_10667366 Ga0105242_106673662 102
903 3300009176 Ga0105242_11814616 Ga0105242_118146162 102
904 3300009177 Ga0105248_10026828 Ga0105248_100268284 102
905 3300009177 Ga0105248_10282138 Ga0105248_102821383 102
906 3300009177 Ga0105248_13432348 Ga0105248_134323481 102
907 3300009545 Ga0105237_11289889 Ga0105237_112898892 102
908 3300009551 Ga0105238_10275029 Ga0105238_102750292 102
909 3300009551 Ga0105238_10472384 Ga0105238_104723842 102
910 3300009553 Ga0105249_11024306 Ga0105249_110243061 102
911 3300009553 Ga0105249_11625372 Ga0105249_116253722 102
912 3300009553 Ga0105249_11918672 Ga0105249_119186721 102
913 3300009553 Ga0105249_12648435 Ga0105249_126484351 102
914 3300010375 Ga0105239_10005836 Ga0105239_100058362 102
915 3300010375 Ga0105239_10881783 Ga0105239_108817832 102
916 3300011119 Ga0105246_10262910 Ga0105246_102629102 102
917 3300011119 Ga0105246_10496521 Ga0105246_104965212 102
918 3300012491 Ga0157329_1024032 Ga0157329_10240321 102
919 3300012498 Ga0157345_1033817 Ga0157345_10338171 102
920 3300012512 Ga0157327_1006565 Ga0157327_10065651 102
921 3300013100 Ga0157373_10206900 Ga0157373_102069002 102
922 3300013100 Ga0157373_10522516 Ga0157373_105225162 102
923 3300013100 Ga0157373_11271784 Ga0157373_112717841 102
924 3300013104 Ga0157370_10815091 Ga0157370_108150912 102
925 3300013296 Ga0157374_10684999 Ga0157374_106849992 102
926 3300013297 Ga0157378_10000577 Ga0157378_1000057715 102
927 3300013297 Ga0157378_10162097 Ga0157378_101620973 102
928 3300013297 Ga0157378_11353924 Ga0157378_113539241 102
929 3300013306 Ga0163162_10429741 Ga0163162_104297412 102
930 3300013306 Ga0163162_10872426 Ga0163162_108724262 102
931 3300013306 Ga0163162_12717583 Ga0163162_127175832 102
932 3300013307 Ga0157372_10147504 Ga0157372_101475042 102
933 3300013307 Ga0157372_12513007 Ga0157372_125130072 102
934 3300013308 Ga0157375_10047633 Ga0157375_100476334 102
935 3300013308 Ga0157375_10733745 Ga0157375_107337452 102
936 3300013308 Ga0157375_11140263 Ga0157375_111402631 102
937 3300013308 Ga0157375_11230699 Ga0157375_112306991 102
938 3300013308 Ga0157375_12909552 Ga0157375_129095521 102
939 3300014325 Ga0163163_10117853 Ga0163163_101178532 102
940 3300014326 Ga0157380_10365752 Ga0157380_103657521 102
941 3300014326 Ga0157380_12539380 Ga0157380_125393801 102
942 3300014745 Ga0157377_10030601 Ga0157377_100306014 102
943 3300014745 Ga0157377_11012458 Ga0157377_110124581 102
944 3300014745 Ga0157377_11085084 Ga0157377_110850842 102
945 3300014968 Ga0157379_10275152 Ga0157379_102751521 102
946 3300014968 Ga0157379_11097937 Ga0157379_110979371 102
947 3300014969 Ga0157376_10396069 Ga0157376_103960692 102
948 3300014969 Ga0157376_12187452 Ga0157376_121874521 102
949 3300017792 Ga0163161_10078147 Ga0163161_100781472 102
950 3300020077 Ga0206351_10550909 Ga0206351_105509091 102
951 3300020077 Ga0206351_10662335 Ga0206351_106623351 102
952 3300020078 Ga0206352_11006934 Ga0206352_110069341 102
953 3300020080 Ga0206350_10009095 Ga0206350_100090951 102
954 3300020080 Ga0206350_11339704 Ga0206350_113397041 102
955 3300020081 Ga0206354_11041843 Ga0206354_110418432 102
956 3300020082 Ga0206353_10256562 Ga0206353_102565621 102
957 3300020610 Ga0154015_1563880 Ga0154015_15638802 102
958 3300022467 Ga0224712_10102578 Ga0224712_101025781 102
959 3300025315 Ga0207697_10018429 Ga0207697_100184293 102
960 3300025315 Ga0207697_10145258 Ga0207697_101452582 102
961 3300025321 Ga0207656_10104086 Ga0207656_101040861 102
962 3300025893 Ga0207682_10048598 Ga0207682_100485982 102
963 3300025893 Ga0207682_10055623 Ga0207682_100556232 102
964 3300025893 Ga0207682_10138248 Ga0207682_101382482 102
965 3300025898 Ga0207692_10161191 Ga0207692_101611911 102
966 3300025899 Ga0207642_10000405 Ga0207642_1000040513 102
967 3300025901 Ga0207688_10166726 Ga0207688_101667261 102
968 3300025903 Ga0207680_10032117 Ga0207680_100321172 102
969 3300025904 Ga0207647_10244479 Ga0207647_102444792 102
970 3300025905 Ga0207685_10403253 Ga0207685_104032531 102
971 3300025906 Ga0207699_10034084 Ga0207699_100340842 102
972 3300025906 Ga0207699_10319613 Ga0207699_103196132 102
973 3300025907 Ga0207645_10005407 Ga0207645_100054077 102
974 3300025907 Ga0207645_10017875 Ga0207645_100178754 102
975 3300025907 Ga0207645_10135011 Ga0207645_101350112 102
976 3300025907 Ga0207645_11055275 Ga0207645_110552751 102
977 3300025908 Ga0207643_10003848 Ga0207643_100038488 102
978 3300025908 Ga0207643_10413708 Ga0207643_104137081 102
979 3300025908 Ga0207643_11002474 Ga0207643_110024741 102
980 3300025910 Ga0207684_10059226 Ga0207684_100592263 102
981 3300025910 Ga0207684_10119427 Ga0207684_101194274 102
982 3300025910 Ga0207684_11272122 Ga0207684_112721222 102
983 3300025911 Ga0207654_10429889 Ga0207654_104298891 102
984 3300025911 Ga0207654_10527224 Ga0207654_105272242 102
985 3300025912 Ga0207707_10004691 Ga0207707_1000469111 102
986 3300025912 Ga0207707_10129960 Ga0207707_101299602 102
987 3300025912 Ga0207707_10267494 Ga0207707_102674942 102
988 3300025912 Ga0207707_10598707 Ga0207707_105987072 102
989 3300025912 Ga0207707_10775716 Ga0207707_107757161 102
990 3300025913 Ga0207695_10192700 Ga0207695_101927002 102
991 3300025916 Ga0207663_10066171 Ga0207663_100661712 102
992 3300025916 Ga0207663_10320756 Ga0207663_103207562 102
993 3300025916 Ga0207663_11244044 Ga0207663_112440441 102
994 3300025917 Ga0207660_10001699 Ga0207660_100016998 102
995 3300025917 Ga0207660_10120341 Ga0207660_101203412 102
996 3300025917 Ga0207660_10188180 Ga0207660_101881802 102
997 3300025917 Ga0207660_10200051 Ga0207660_102000513 102
998 3300025917 Ga0207660_10302396 Ga0207660_103023963 102
999 3300025917 Ga0207660_10840584 Ga0207660_108405842 102
1000 3300025917 Ga0207660_10990615 Ga0207660_109906152 102
1001 3300025918 Ga0207662_10002838 Ga0207662_100028388 102
1002 3300025918 Ga0207662_10145691 Ga0207662_101456912 102
1003 3300025919 Ga0207657_10251232 Ga0207657_102512322 102
1004 3300025920 Ga0207649_10123547 Ga0207649_101235472 102
1005 3300025920 Ga0207649_10363850 Ga0207649_103638502 102
1006 3300025920 Ga0207649_10748592 Ga0207649_107485922 102
1007 3300025920 Ga0207649_11479492 Ga0207649_114794921 102
1008 3300025921 Ga0207652_10010917 Ga0207652_100109177 102
1009 3300025921 Ga0207652_10139310 Ga0207652_101393102 102
1010 3300025921 Ga0207652_10196417 Ga0207652_101964172 102
1011 3300025921 Ga0207652_10295615 Ga0207652_102956152 102
1012 3300025921 Ga0207652_10433045 Ga0207652_104330452 102
1013 3300025921 Ga0207652_10652349 Ga0207652_106523492 102
1014 3300025921 Ga0207652_10673396 Ga0207652_106733961 102
1015 3300025922 Ga0207646_10001673 Ga0207646_1000167324 102
1016 3300025922 Ga0207646_10033666 Ga0207646_100336665 102
1017 3300025922 Ga0207646_10168228 Ga0207646_101682282 102
1018 3300025922 Ga0207646_10419294 Ga0207646_104192941 102
1019 3300025922 Ga0207646_10573772 Ga0207646_105737722 102
1020 3300025922 Ga0207646_10863831 Ga0207646_108638312 102
1021 3300025923 Ga0207681_10002648 Ga0207681_100026482 102
1022 3300025923 Ga0207681_10273253 Ga0207681_102732532 102
1023 3300025924 Ga0207694_10552811 Ga0207694_105528112 102
1024 3300025924 Ga0207694_10719173 Ga0207694_107191731 102
1025 3300025925 Ga0207650_10053915 Ga0207650_100539153 102
1026 3300025926 Ga0207659_10000902 Ga0207659_1000090211 102
1027 3300025926 Ga0207659_10091679 Ga0207659_100916792 102
1028 3300025926 Ga0207659_10384418 Ga0207659_103844181 102
1029 3300025926 Ga0207659_11595348 Ga0207659_115953482 102
1030 3300025927 Ga0207687_10109312 Ga0207687_101093122 102
1031 3300025927 Ga0207687_10175767 Ga0207687_101757672 102
1032 3300025927 Ga0207687_10196971 Ga0207687_101969712 102
1033 3300025928 Ga0207700_10356570 Ga0207700_103565702 102
1034 3300025929 Ga0207664_10051400 Ga0207664_100514004 102
1035 3300025931 Ga0207644_10007504 Ga0207644_100075047 102
1036 3300025931 Ga0207644_10088997 Ga0207644_100889972 102
1037 3300025931 Ga0207644_10276806 Ga0207644_102768062 102
1038 3300025932 Ga0207690_10136294 Ga0207690_101362944 102
1039 3300025932 Ga0207690_10189337 Ga0207690_101893372 102
1040 3300025932 Ga0207690_11409742 Ga0207690_114097422 102
1041 3300025933 Ga0207706_10000105 Ga0207706_1000010543 102
1042 3300025933 Ga0207706_10076892 Ga0207706_100768924 102
1043 3300025933 Ga0207706_10089932 Ga0207706_100899322 102
1044 3300025933 Ga0207706_10899012 Ga0207706_108990122 102
1045 3300025934 Ga0207686_10000323 Ga0207686_1000032312 102
1046 3300025934 Ga0207686_10497711 Ga0207686_104977112 102
1047 3300025934 Ga0207686_11109485 Ga0207686_111094851 102
1048 3300025935 Ga0207709_10001805 Ga0207709_1000180514 102
1049 3300025935 Ga0207709_10191320 Ga0207709_101913201 102
1050 3300025936 Ga0207670_10009329 Ga0207670_100093293 102
1051 3300025936 Ga0207670_10999456 Ga0207670_109994562 102
1052 3300025937 Ga0207669_10012485 Ga0207669_100124852 102
1053 3300025937 Ga0207669_10297958 Ga0207669_102979582 102
1054 3300025937 Ga0207669_11399657 Ga0207669_113996572 102
1055 3300025939 Ga0207665_10000486 Ga0207665_100004865 102
1056 3300025940 Ga0207691_10887326 Ga0207691_108873262 102
1057 3300025940 Ga0207691_11191058 Ga0207691_111910582 102
1058 3300025940 Ga0207691_11247499 Ga0207691_112474991 102
1059 3300025941 Ga0207711_10009631 Ga0207711_100096314 102
1060 3300025941 Ga0207711_10617721 Ga0207711_106177212 102
1061 3300025941 Ga0207711_10870341 Ga0207711_108703411 102
1062 3300025942 Ga0207689_10018455 Ga0207689_100184552 102
1063 3300025942 Ga0207689_10511255 Ga0207689_105112552 102
1064 3300025942 Ga0207689_11040244 Ga0207689_110402441 102
1065 3300025942 Ga0207689_11431291 Ga0207689_114312912 102
1066 3300025944 Ga0207661_10006266 Ga0207661_100062668 102
1067 3300025944 Ga0207661_10107789 Ga0207661_101077892 102
1068 3300025944 Ga0207661_10380586 Ga0207661_103805861 102
1069 3300025945 Ga0207679_10010117 Ga0207679_100101172 102
1070 3300025945 Ga0207679_10193448 Ga0207679_101934482 102
1071 3300025945 Ga0207679_10543840 Ga0207679_105438402 102
1072 3300025945 Ga0207679_11014810 Ga0207679_110148102 102
1073 3300025945 Ga0207679_11481074 Ga0207679_114810741 102
1074 3300025945 Ga0207679_11646702 Ga0207679_116467022 102
1075 3300025949 Ga0207667_11082659 Ga0207667_110826592 102
1076 3300025949 Ga0207667_11904797 Ga0207667_119047972 102
1077 3300025960 Ga0207651_10092780 Ga0207651_100927802 102
1078 3300025960 Ga0207651_10121830 Ga0207651_101218302 102
1079 3300025960 Ga0207651_10572322 Ga0207651_105723222 102
1080 3300025960 Ga0207651_10627053 Ga0207651_106270532 102
1081 3300025960 Ga0207651_11996530 Ga0207651_119965301 102
1082 3300025961 Ga0207712_10700092 Ga0207712_107000921 102
1083 3300025961 Ga0207712_11455101 Ga0207712_114551011 102
1084 3300025961 Ga0207712_11567463 Ga0207712_115674631 102
1085 3300025972 Ga0207668_10311790 Ga0207668_103117902 102
1086 3300025972 Ga0207668_10358350 Ga0207668_103583501 102
1087 3300025981 Ga0207640_10004935 Ga0207640_100049355 102
1088 3300025981 Ga0207640_10164632 Ga0207640_101646322 102
1089 3300025981 Ga0207640_10679627 Ga0207640_106796271 102
1090 3300025981 Ga0207640_11608610 Ga0207640_116086101 102
1091 3300025981 Ga0207640_12199657 Ga0207640_121996572 102
1092 3300025986 Ga0207658_10472545 Ga0207658_104725452 102
1093 3300025986 Ga0207658_10731189 Ga0207658_107311891 102
1094 3300025986 Ga0207658_10998264 Ga0207658_109982642 102
1095 3300026023 Ga0207677_10006894 Ga0207677_100068942 102
1096 3300026023 Ga0207677_10013904 Ga0207677_100139044 102
1097 3300026023 Ga0207677_10198868 Ga0207677_101988682 102
1098 3300026035 Ga0207703_10022018 Ga0207703_100220184 102
1099 3300026035 Ga0207703_10067157 Ga0207703_100671572 102
1100 3300026035 Ga0207703_11200295 Ga0207703_112002951 102
1101 3300026035 Ga0207703_12250013 Ga0207703_122500131 102
1102 3300026041 Ga0207639_10575069 Ga0207639_105750691 102
1103 3300026067 Ga0207678_10059909 Ga0207678_100599093 102
1104 3300026067 Ga0207678_10443592 Ga0207678_104435922 102
1105 3300026067 Ga0207678_11164862 Ga0207678_111648621 102
1106 3300026075 Ga0207708_10019638 Ga0207708_100196383 102
1107 3300026075 Ga0207708_10025473 Ga0207708_100254733 102
1108 3300026075 Ga0207708_10211327 Ga0207708_102113272 102
1109 3300026075 Ga0207708_11753825 Ga0207708_117538251 102
1110 3300026078 Ga0207702_10835587 Ga0207702_108355872 102
1111 3300026088 Ga0207641_10063850 Ga0207641_100638504 102
1112 3300026088 Ga0207641_10128053 Ga0207641_101280532 102
1113 3300026088 Ga0207641_12343158 Ga0207641_123431582 102
1114 3300026089 Ga0207648_10000284 Ga0207648_1000028425 102
1115 3300026089 Ga0207648_10045452 Ga0207648_100454525 102
1116 3300026089 Ga0207648_10374992 Ga0207648_103749921 102
1117 3300026095 Ga0207676_10283086 Ga0207676_102830863 102
1118 3300026095 Ga0207676_10301287 Ga0207676_103012872 102
1119 3300026095 Ga0207676_10998438 Ga0207676_109984381 102
1120 3300026095 Ga0207676_11608624 Ga0207676_116086241 102
1121 3300026095 Ga0207676_11792619 Ga0207676_117926192 102
1122 3300026116 Ga0207674_10008143 Ga0207674_100081432 102
1123 3300026116 Ga0207674_10019801 Ga0207674_100198017 102
1124 3300026116 Ga0207674_10631637 Ga0207674_106316372 102
1125 3300026116 Ga0207674_10734191 Ga0207674_107341912 102
1126 3300026118 Ga0207675_100033436 Ga0207675_1000334364 102
1127 3300026118 Ga0207675_100208012 Ga0207675_1002080122 102
1128 3300026118 Ga0207675_100421917 Ga0207675_1004219172 102
1129 3300026121 Ga0207683_10007614 Ga0207683_100076149 102
1130 3300026121 Ga0207683_10193544 Ga0207683_101935442 102
1131 3300026142 Ga0207698_10033457 Ga0207698_100334572 102
1132 3300027364 Ga0209967_1046460 Ga0209967_10464602 102
1133 3300027462 Ga0210000_1037007 Ga0210000_10370071 102
1134 3300027471 Ga0209995_1034417 Ga0209995_10344172 102
1135 3300027526 Ga0209968_1090654 Ga0209968_10906541 102
1136 3300027543 Ga0209999_1002779 Ga0209999_10027794 102
1137 3300027682 Ga0209971_1052119 Ga0209971_10521192 102
1138 3300027717 Ga0209998_10022296 Ga0209998_100222962 102
1139 3300027876 Ga0209974_10052889 Ga0209974_100528892 102
1140 3300027907 Ga0207428_10607995 Ga0207428_106079952 102
1141 3300028379 Ga0268266_11949311 Ga0268266_119493111 102
1142 3300028380 Ga0268265_11603200 Ga0268265_116032002 102
1143 3300028380 Ga0268265_11876387 Ga0268265_118763872 102
1144 3300028380 Ga0268265_12198753 Ga0268265_121987531 102
1145 3300028381 Ga0268264_10159852 Ga0268264_101598523 102
1146 3300028381 Ga0268264_10207215 Ga0268264_102072151 102
1147 3300028381 Ga0268264_10659599 Ga0268264_106595992 102
1148 3300028381 Ga0268264_10784427 Ga0268264_107844272 102
1149 3300031548 Ga0307408_100038948 Ga0307408_1000389484 102
1150 3300031548 Ga0307408_100341016 Ga0307408_1003410161 102
1151 3300031548 Ga0307408_100496108 Ga0307408_1004961081 102
1152 3300031548 Ga0307408_100818339 Ga0307408_1008183392 102
1153 3300031548 Ga0307408_101623658 Ga0307408_1016236582 102
1154 3300031548 Ga0307408_101680848 Ga0307408_1016808482 102
1155 3300031731 Ga0307405_10004381 Ga0307405_100043813 102
1156 3300031731 Ga0307405_10079146 Ga0307405_100791462 102
1157 3300031731 Ga0307405_10573142 Ga0307405_105731422 102
1158 3300031731 Ga0307405_10747967 Ga0307405_107479671 102
1159 3300031731 Ga0307405_10820350 Ga0307405_108203501 102
1160 3300031731 Ga0307405_11354087 Ga0307405_113540871 102
1161 3300031824 Ga0307413_10014416 Ga0307413_100144162 102
1162 3300031824 Ga0307413_10058773 Ga0307413_100587731 102
1163 3300031824 Ga0307413_10087503 Ga0307413_100875033 102
1164 3300031824 Ga0307413_10150582 Ga0307413_101505822 102
1165 3300031824 Ga0307413_10468586 Ga0307413_104685862 102
1166 3300031852 Ga0307410_10382688 Ga0307410_103826882 102
1167 3300031852 Ga0307410_10581451 Ga0307410_105814512 102
1168 3300031852 Ga0307410_10645984 Ga0307410_106459842 102
1169 3300031852 Ga0307410_11440394 Ga0307410_114403941 102
1170 3300031889 Ga0326468_10041234 Ga0326468_100412341 102
1171 3300031901 Ga0307406_10026696 Ga0307406_100266962 102
1172 3300031901 Ga0307406_10131096 Ga0307406_101310962 102
1173 3300031901 Ga0307406_10243877 Ga0307406_102438772 102
1174 3300031901 Ga0307406_10370010 Ga0307406_103700102 102
1175 3300031901 Ga0307406_10470084 Ga0307406_104700841 102
1176 3300031901 Ga0307406_10633266 Ga0307406_106332662 102
1177 3300031901 Ga0307406_11685902 Ga0307406_116859021 102
1178 3300031903 Ga0307407_10022385 Ga0307407_100223853 102
1179 3300031903 Ga0307407_10349400 Ga0307407_103494002 102
1180 3300031903 Ga0307407_10426655 Ga0307407_104266552 102
1181 3300031903 Ga0307407_10603483 Ga0307407_106034831 102
1182 3300031903 Ga0307407_10840624 Ga0307407_108406242 102
1183 3300031903 Ga0307407_11244714 Ga0307407_112447142 102
1184 3300031911 Ga0307412_10016955 Ga0307412_100169556 102
1185 3300031911 Ga0307412_10729531 Ga0307412_107295312 102
1186 3300031911 Ga0307412_11114318 Ga0307412_111143182 102
1187 3300031995 Ga0307409_100049673 Ga0307409_1000496733 102
1188 3300031995 Ga0307409_100108550 Ga0307409_1001085502 102
1189 3300031995 Ga0307409_100170107 Ga0307409_1001701071 102
1190 3300031995 Ga0307409_101304133 Ga0307409_1013041332 102
1191 3300032002 Ga0307416_100158774 Ga0307416_1001587741 102
1192 3300032002 Ga0307416_100164768 Ga0307416_1001647681 102
1193 3300032002 Ga0307416_100197546 Ga0307416_1001975463 102
1194 3300032002 Ga0307416_100229017 Ga0307416_1002290171 102
1195 3300032002 Ga0307416_100318693 Ga0307416_1003186932 102
1196 3300032002 Ga0307416_100703942 Ga0307416_1007039422 102
1197 3300032002 Ga0307416_100747185 Ga0307416_1007471852 102
1198 3300032002 Ga0307416_101185740 Ga0307416_1011857402 102
1199 3300032002 Ga0307416_101282796 Ga0307416_1012827962 102
1200 3300032002 Ga0307416_102159419 Ga0307416_1021594191 102
1201 3300032002 Ga0307416_102821040 Ga0307416_1028210401 102
1202 3300032004 Ga0307414_10003807 Ga0307414_100038077 102
1203 3300032004 Ga0307414_10067314 Ga0307414_100673142 102
1204 3300032004 Ga0307414_10347994 Ga0307414_103479942 102
1205 3300032004 Ga0307414_10546906 Ga0307414_105469061 102
1206 3300032005 Ga0307411_10018853 Ga0307411_100188533 102
1207 3300032005 Ga0307411_10144361 Ga0307411_101443612 102
1208 3300032005 Ga0307411_10523286 Ga0307411_105232861 102
1209 3300032126 Ga0307415_100003847 Ga0307415_1000038477 102
1210 3300032126 Ga0307415_101177721 Ga0307415_1011777212 102
1211 3300032126 Ga0307415_101297155 Ga0307415_1012971551 102
1212 3300032126 Ga0307415_101449927 Ga0307415_1014499271 102
1213 3300032126 Ga0307415_102081726 Ga0307415_1020817261 102
1214 3300032126 Ga0307415_102533515 Ga0307415_1025335151 102
1215 3300034817 Ga0373948_0104669 Ga0373948_0104669_193_513 102
1216 3300034818 Ga0373950_0035776 Ga0373950_0035776_149_463 102
1217 3300034820 Ga0373959_0050477 Ga0373959_0050477_373_687 102
1218 3300034957 Ga0373938_0063141 Ga0373938_0063141_404_718 102
1219 3300035085 Ga0373929_0086202 Ga0373929_0086202_127_441 102
1220 3300035090 Ga0373949_0032384 Ga0373949_0032384_89_403 102
1221 3300035090 Ga0373949_0041542 Ga0373949_0041542_801_1115 102
1222 3300035112 Ga0373932_0194997 Ga0373932_0194997_143_457 102
1223 3300035114 Ga0373939_0166704 Ga0373939_0166704_346_660 102
1224 3300035114 Ga0373939_0200844 Ga0373939_0200844_337_651 102
1225 3300035171 Ga0373946_0344464 Ga0373946_0344464_190_498 102
1226 3300035172 Ga0373955_0587387 Ga0373955_0587387_297_605 102
1227 3300035207 Ga0373942_0104818 Ga0373942_0104818_138_452 102
1228 3300035241 Ga0373961_0034817 Ga0373961_0034817_454_762 102
1229 3300035691 Ga0373931_0462043 Ga0373931_0462043_395_709 102
1230 3300035691 Ga0373931_0540172 Ga0373931_0540172_73_387 102
1231 3300035691 Ga0373931_0865850 Ga0373931_0865850_171_479 102
1232 3300036401 Ga0373937_1480800 Ga0373937_1480800_308_616 102
1233 3300037418 Ga0395900_1277603 Ga0395900_1277603_118_432 102
1234 3300037418 Ga0395900_1428789 Ga0395900_1428789_13_327 102
1235 3300037418 Ga0395900_1656624 Ga0395900_1656624_91_399 102
1236 3300037471 Ga0395905_0119324 Ga0395905_0119324_1257_1571 102
1237 3300037471 Ga0395905_0777548 Ga0395905_0777548_283_597 102
1238 3300037471 Ga0395905_1417469 Ga0395905_1417469_155_469 102
1239 3300038443 Ga0395901_1988056 Ga0395901_1988056_53_388 102
1240 3300038698 Ga0242419_005398 Ga0242419_005398_308_622 102
1241 3300038996 Ga0242420_004350 Ga0242420_004350_751_1065 102
1242 3300038996 Ga0242420_006711 Ga0242420_006711_1368_1682 102
1243 3300039437 Ga0436365_1827961 Ga0436365_1827961_497_805 102
1244 3300041406 Ga0439439_0115416 Ga0439439_0115416_93_401 102
1245 3300041410 Ga0439461_0166033 Ga0439461_0166033_82_396 102
1246 3300041443 Ga0451789_0947159 Ga0451789_0947159_161_469 102
1247 3300042004 Ga0439445_0136378 Ga0439445_0136378_156_464 102
1248 3300042012 Ga0439455_0065069 Ga0439455_0065069_412_726 102
1249 3300042437 Ga0439444_0132977 Ga0439444_0132977_193_507 102
1250 3300042437 Ga0439444_0152842 Ga0439444_0152842_193_507 102
1251 3300042876 Ga0451577_0018850 Ga0451577_0018850_4384_4692 102
1252 3300044673 Ga0453683_0163376 Ga0453683_0163376_1045_1359 102
1253 3300044712 Ga0453684_0019316 Ga0453684_0019316_5763_6071 102
1254 3300044712 Ga0453684_0677429 Ga0453684_0677429_639_953 102
1255 3300045051 Ga0451576_1145132 Ga0451576_1145132_390_713 102
1256 3300045976 Ga0466967_1576409 Ga0466967_1576409_311_625 102
1257 3300046492 Ga0495585_0310154 Ga0495585_0310154_284_592 102
1258 3300046499 Ga0495594_0380017 Ga0495594_0380017_283_597 102
1259 3300046515 Ga0495620_0357079 Ga0495620_0357079_217_525 102
1260 3300046525 Ga0495663_0401218 Ga0495663_0401218_155_463 102
1261 3300046536 Ga0495587_0309835 Ga0495587_0309835_353_661 102
1262 3300046539 Ga0495621_0032870 Ga0495621_0032870_445_759 102
1263 3300046559 Ga0495667_0150431 Ga0495667_0150431_306_614 102
1264 3300046663 Ga0495635_0084621 Ga0495635_0084621_1357_1665 102
1265 3300046674 Ga0495588_0007818 Ga0495588_0007818_1542_1850 102
1266 3300046679 Ga0495623_0219777 Ga0495623_0219777_35_343 102
1267 3300046809 Ga0495600_0424218 Ga0495600_0424218_163_471 102
1268 3300047317 Ga0495604_1009718 Ga0495604_1009718_192_500 102
1269 3300047445 Ga0495677_0151955 Ga0495677_0151955_11_319 102
1270 3300047447 Ga0495685_136166 Ga0495685_136166_137_445 102
1271 3300047470 Ga0495681_0298583 Ga0495681_0298583_211_519 102
1272 3300048903 Ga0496100_0292564 Ga0496100_0292564_203_517 102
1273 3300048903 Ga0496100_1332312 Ga0496100_1332312_199_513 102
1274 3300048903 Ga0496100_1676063 Ga0496100_1676063_11_325 102
1275 3300048904 Ga0496101_0113841 Ga0496101_0113841_1569_1883 102
1276 3300048904 Ga0496101_0175258 Ga0496101_0175258_959_1267 102
1277 3300048904 Ga0496101_1403313 Ga0496101_1403313_66_380 102
1278 3300048905 Ga0496102_0084843 Ga0496102_0084843_2396_2710 102
1279 3300048905 Ga0496102_0107907 Ga0496102_0107907_1225_1557 102
1280 3300048905 Ga0496102_0597811 Ga0496102_0597811_592_906 102
1281 3300048905 Ga0496102_0693815 Ga0496102_0693815_446_763 102
1282 3300048906 Ga0496103_0638605 Ga0496103_0638605_14_346 102
1283 3300048907 Ga0496104_0006303 Ga0496104_0006303_2550_2864 102
1284 3300048907 Ga0496104_0492225 Ga0496104_0492225_446_760 102
1285 3300048907 Ga0496104_0515166 Ga0496104_0515166_225_533 102
1286 3300048909 Ga0496106_0146128 Ga0496106_0146128_444_761 102
1287 3300048909 Ga0496106_0245621 Ga0496106_0245621_1072_1386 102
1288 3300048909 Ga0496106_0292915 Ga0496106_0292915_827_1159 102
1289 3300048909 Ga0496106_0363572 Ga0496106_0363572_303_617 102
1290 3300048909 Ga0496106_0407880 Ga0496106_0407880_725_1039 102
1291 3300048909 Ga0496106_0658431 Ga0496106_0658431_247_561 102
1292 3300048909 Ga0496106_1016349 Ga0496106_1016349_125_433 102
1293 3300048910 Ga0496107_0931869 Ga0496107_0931869_32_346 102
1294 3300048911 Ga0496108_0005557 Ga0496108_0005557_9548_9862 102
1295 3300048911 Ga0496108_0009201 Ga0496108_0009201_7271_7585 102
1296 3300048911 Ga0496108_0078456 Ga0496108_0078456_909_1223 102
1297 3300048911 Ga0496108_0701929 Ga0496108_0701929_232_546 102
1298 3300048911 Ga0496108_0965168 Ga0496108_0965168_385_693 102
1299 3300048912 Ga0496109_0022966 Ga0496109_0022966_1513_1827 102
1300 3300048912 Ga0496109_0233095 Ga0496109_0233095_1060_1374 102
1301 3300048912 Ga0496109_0582877 Ga0496109_0582877_684_998 102
1302 3300048912 Ga0496109_0644441 Ga0496109_0644441_574_882 102
1303 3300048912 Ga0496109_2037380 Ga0496109_2037380_141_455 102
1304 3300048913 Ga0496110_0129583 Ga0496110_0129583_1361_1675 102
1305 3300048913 Ga0496110_0240181 Ga0496110_0240181_924_1238 102
1306 3300048914 Ga0496111_0467027 Ga0496111_0467027_606_920 102
1307 3300048915 Ga0496112_0148753 Ga0496112_0148753_831_1145 102
1308 3300048915 Ga0496112_0432552 Ga0496112_0432552_552_860 102
1309 3300048915 Ga0496112_0625396 Ga0496112_0625396_329_643 102
1310 3300048916 Ga0496113_0046902 Ga0496113_0046902_2508_2822 102
1311 3300048916 Ga0496113_0700111 Ga0496113_0700111_55_369 102
1312 3300048916 Ga0496113_0766954 Ga0496113_0766954_263_571 102
1313 3300048917 Ga0496114_0008966 Ga0496114_0008966_2034_2348 102
1314 3300048917 Ga0496114_0150261 Ga0496114_0150261_177_491 102
1315 3300048918 Ga0496115_0096451 Ga0496115_0096451_399_713 102
1316 3300048918 Ga0496115_0664119 Ga0496115_0664119_49_366 102
1317 3300049127 Ga0501306_066075 Ga0501306_066075_215_529 102
1318 3300049513 Ga0501290_100117 Ga0501290_100117_185_493 102
1319 3300049519 Ga0501296_027669 Ga0501296_027669_386_694 102
1320 3300049527 Ga0501311_060777 Ga0501311_060777_70_384 102
1321 3300049531 Ga0501315_092029 Ga0501315_092029_74_388 102
1322 3300049532 Ga0501316_044099 Ga0501316_044099_74_388 102
1323 3300049539 Ga0501323_022872 Ga0501323_022872_74_388 102
1324 3300049572 Ga0501036_1641935 Ga0501036_1641935_127_441 102
1325 3300049573 Ga0501037_0463031 Ga0501037_0463031_361_675 102
1326 3300049576 Ga0501040_0112219 Ga0501040_0112219_1019_1333 102
1327 3300049576 Ga0501040_0521425 Ga0501040_0521425_532_846 102
1328 3300049577 Ga0501041_0164873 Ga0501041_0164873_579_893 102
1329 3300049578 Ga0501042_0318212 Ga0501042_0318212_266_580 102
1330 3300049578 Ga0501042_0564905 Ga0501042_0564905_429_743 102
1331 3300049583 Ga0501067_0258146 Ga0501067_0258146_158_511 102
1332 3300049583 Ga0501067_0390614 Ga0501067_0390614_155_469 102
1333 3300049583 Ga0501067_0740853 Ga0501067_0740853_192_524 102
1334 3300049585 Ga0501069_0024665 Ga0501069_0024665_2906_3220 102
1335 3300049585 Ga0501069_0219825 Ga0501069_0219825_709_1023 102
1336 3300049585 Ga0501069_0303562 Ga0501069_0303562_220_573 102
1337 3300049586 Ga0501070_0598170 Ga0501070_0598170_275_589 102
1338 3300049588 Ga0501072_0039534 Ga0501072_0039534_1245_1559 102
1339 3300049588 Ga0501072_0703780 Ga0501072_0703780_168_482 102
1340 3300049590 Ga0501074_1282492 Ga0501074_1282492_90_404 102
1341 3300049591 Ga0501075_0249461 Ga0501075_0249461_626_940 102
1342 3300049592 Ga0501076_0292687 Ga0501076_0292687_530_844 102
1343 3300049592 Ga0501076_1032015 Ga0501076_1032015_341_655 102
1344 3300049593 Ga0501077_0084305 Ga0501077_0084305_179_493 102
1345 3300049593 Ga0501077_0173903 Ga0501077_0173903_720_1034 102
1346 3300049651 Ga0501201_047924 Ga0501201_047924_148_456 102
1347 3300049653 Ga0501206_035144 Ga0501206_035144_388_702 102
1348 3300049661 Ga0501217_262437 Ga0501217_262437_166_480 102
1349 3300049661 Ga0501217_298442 Ga0501217_298442_101_409 102
1350 3300049664 Ga0501224_065209 Ga0501224_065209_57_365 102
1351 3300049677 Ga0501247_067000 Ga0501247_067000_105_419 102
1352 3300049679 Ga0501249_043288 Ga0501249_043288_419_733 102
1353 3300049686 Ga0501257_239723 Ga0501257_239723_143_457 102
1354 3300049687 Ga0501258_041249 Ga0501258_041249_154_462 102
1355 3300049688 Ga0501259_050586 Ga0501259_050586_164_472 102
1356 3300049705 Ga0501225_0105716 Ga0501225_0105716_287_601 102
1357 3300049705 Ga0501225_0157881 Ga0501225_0157881_191_499 102
1358 3300049741 Ga0501079_0072197 Ga0501079_0072197_167_481 102
1359 3300049741 Ga0501079_1163359 Ga0501079_1163359_149_463 102
1360 3300049742 Ga0501080_0518965 Ga0501080_0518965_201_515 102
1361 3300049742 Ga0501080_0527496 Ga0501080_0527496_590_904 102
1362 3300049744 Ga0501083_0693752 Ga0501083_0693752_45_359 102
1363 3300049761 Ga0501264_033477 Ga0501264_033477_36_350 102
1364 3300049763 Ga0501266_048627 Ga0501266_048627_254_568 102
1365 3300049770 Ga0501273_080115 Ga0501273_080115_62_370 102
1366 3300049770 Ga0501273_086341 Ga0501273_086341_130_438 102
1367 3300049779 Ga0501283_137411 Ga0501283_137411_128_442 102
1368 3300049823 Ga0501044_0736726 Ga0501044_0736726_304_618 102
1369 3300049823 Ga0501044_1426621 Ga0501044_1426621_95_409 102
1370 3300049824 Ga0501045_0374149 Ga0501045_0374149_257_571 102
1371 3300050507 nmdc:mga05p37_1016723_c1 nmdc:mga05p37_1016723_c1_343_657 102
1372 3300050507 nmdc:mga05p37_249930_c1 nmdc:mga05p37_249930_c1_1217_1531 102
1373 3300050507 nmdc:mga05p37_483494_c1 nmdc:mga05p37_483494_c1_192_506 102
1374 3300050507 nmdc:mga05p37_636196_c1 nmdc:mga05p37_636196_c1_209_565 102
1375 3300050507 nmdc:mga05p37_67303_c1 nmdc:mga05p37_67303_c1_1293_1625 102
1376 3300050507 nmdc:mga05p37_922531_c1 nmdc:mga05p37_922531_c1_252_566 102
1377 3300050508 nmdc:mga09592_338617_c1 nmdc:mga09592_338617_c1_497_811 102
1378 3300050508 nmdc:mga09592_623402_c1 nmdc:mga09592_623402_c1_340_654 102
1379 3300050509 nmdc:mga0qj67_819791_c1 nmdc:mga0qj67_819791_c1_72_404 102
1380 3300050510 nmdc:mga06r32_534480_c1 nmdc:mga06r32_534480_c1_469_783 102
1381 3300050511 nmdc:mga08y16_142866_c1 nmdc:mga08y16_142866_c1_1840_2148 102
1382 3300050511 nmdc:mga08y16_946504_c1 nmdc:mga08y16_946504_c1_380_694 102
1383 3300050512 nmdc:mga0n895_120980_c1 nmdc:mga0n895_120980_c1_510_833 102
1384 3300050512 nmdc:mga0n895_2199608_c1 nmdc:mga0n895_2199608_c1_74_388 102
1385 3300050512 nmdc:mga0n895_441913_c1 nmdc:mga0n895_441913_c1_181_495 102
1386 3300050512 nmdc:mga0n895_859021_c1 nmdc:mga0n895_859021_c1_323_637 102
1387 3300050513 nmdc:mga0rr50_145771_c1 nmdc:mga0rr50_145771_c1_1396_1704 102
1388 3300050513 nmdc:mga0rr50_375931_c1 nmdc:mga0rr50_375931_c1_579_893 102
1389 3300050514 nmdc:mga08x19_13948_c1 nmdc:mga08x19_13948_c1_4288_4596 102
1390 3300050514 nmdc:mga08x19_271491_c1 nmdc:mga08x19_271491_c1_156_470 102
1391 3300050514 nmdc:mga08x19_699764_c1 nmdc:mga08x19_699764_c1_272_580 102
1392 3300050514 nmdc:mga08x19_838218_c1 nmdc:mga08x19_838218_c1_37_345 102
1393 3300050515 nmdc:mga0a205_120580_c1 nmdc:mga0a205_120580_c1_562_876 102
1394 3300050515 nmdc:mga0a205_21314_c1 nmdc:mga0a205_21314_c1_1882_2196 102
1395 3300054114 Ga0501084_0029023 Ga0501084_0029023_3889_4203 102
1396 3300054114 Ga0501084_0175659 Ga0501084_0175659_964_1278 102
1397 3300059421 Ga0590071_005505 Ga0590071_005505_1237_1551 102
1398 3300059423 Ga0590074_008331 Ga0590074_008331_343_657 102
1399 3300059426 Ga0590077_009251 Ga0590077_009251_313_627 102
1400 3300059477 Ga0587084_079802 Ga0587084_079802_248_562 102
1401 3300059490 Ga0587066_047237 Ga0587066_047237_407_721 102
1402 3300059493 Ga0587077_070905 Ga0587077_070905_76_390 102
1403 3300059504 Ga0587082_061609 Ga0587082_061609_121_435 102
1404 3300059505 Ga0587083_0262872 Ga0587083_0262872_123_437 102
1405 3300059510 Ga0587090_089570 Ga0587090_089570_103_417 102
1406 3300059630 Ga0587128_033952 Ga0587128_033952_475_789 102
1407 3300059643 Ga0587072_200191 Ga0587072_200191_135_443 102
1408 3300059644 Ga0587075_061053 Ga0587075_061053_112_426 102
1409 3300059646 Ga0587078_016647 Ga0587078_016647_65_373 102
1410 3300059647 Ga0587079_123748 Ga0587079_123748_58_390 102
1411 3300059652 Ga0587107_020131 Ga0587107_020131_102_416 102
1412 3300059655 Ga0587114_044750 Ga0587114_044750_114_428 102
1413 3300061734 Ga0530510_0743561 Ga0530510_0743561_279_593 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

27

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.9425 10 102
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.9305 10 102
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9303 10 102
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9183 10 102
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.8793 10 102
ID Description Score Start End Superfamily
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9425 10 102 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9403 10 102 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9305 10 102 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9281 10 102 2.30.33.40
af_Q8IDZ8_162_258_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8214 9 101 2.30.33.40

Feature Viewer

pLDDT pTM Quality
83.38 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map