F493772

General Info

Members Datasets Scaffolds Average Seq Length
1413 474 1409 400

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0043636|Ga0495672_0043636_1275_2618
Length 447
Sequence LLGFALLRDAKRLDWLAHSSFMAAVAAGPGRTDSSEKYRAAKDLLMSKNSSRPVGRHFLQIPGPTVLPDRVLRAMDTPIVDHRGPEFAKLAKKCLEGIKTIFKTTNPVIIYTATGTGAWEAALVNTLSPGDRVLMVETGQFATLWKVMAEKIGLKPEFIKTDWRIGADPAAVEEHLRADKNKGIKAVCVLHNETSTGCLSPIAEIRKAIDAAGHPALLLVDTISSLASTDYRHDEWGVDVTIGGAQKGLMMPPGMSFNAVSDKALAAAKTSKSLKSFWAWDDMLNMNKIGFFPYTPATQMLHGLAEGIAMLHEEGLDNVFARHDRLAEATRRAVRAWGLETLCRDPKYHSPTITAVLLPDGHDADAFRNLALENFNISYGASFGRFAGKYFRIGHLGDINDGTLMGALSITEMSLALAGIPHKKGGAQAALDYLISAHAGPARAAAE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
4 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
162 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
247 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
271 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
272 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
273 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
274 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
278 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
281 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
286 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
291 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
296 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
297 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
298 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
318 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
319 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
337 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
338 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
352 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
353 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
354 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
355 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
359 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
360 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
431 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
436 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
437 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
438 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
439 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
440 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
451 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
455 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
456 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
457 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
458 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
462 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
463 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
464 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
467 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
468 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
469 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
474 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.21
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0.07
Rhizoplane 7.43
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544940 2209111006 Bacteria 6190
2 ARSoilYngRDRAFT_c00304 3300000042 Bacteria 7132
3 ARcpr5yngRDRAFT_c000272 3300000043 Bacteria 7388
4 ARSoilOldRDRAFT_c000214 3300000044 Bacteria 9160
5 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
6 JGI24032J14994_100282 3300001430 Bacteria 2688
7 JGI24752J21851_1004296 3300001976 Bacteria 1869
8 JGI24746J21847_1000731 3300001977 Bacteria 5060
9 JGI24739J22299_10001029 3300001989 Bacteria 10330
10 JGI24737J22298_10003738 3300001990 Bacteria 5357
11 JGI24750J21931_1000454 3300002070 Bacteria 6552
12 JGI24745J21846_1000597 3300002073 Bacteria 3242
13 JGI24748J21848_1000322 3300002074 Bacteria 5523
14 JGI24738J21930_10000204 3300002075 Bacteria 15817
15 JGI24749J21850_1000784 3300002076 Bacteria 4569
16 JGI24744J21845_10000415 3300002077 Bacteria 7430
17 JGI24035J26624_1001030 3300002126 Bacteria 2638
18 JGI24742J22300_10000274 3300002244 Bacteria 7712
19 JGI25406J46586_10004133 3300003203 Bacteria 6775
20 Ga0065704_10094564 3300005289 Bacteria 2537
21 Ga0065715_10100109 3300005293 Bacteria 3336
22 Ga0070658_10097815 3300005327 Bacteria 2423
23 Ga0070676_10027337 3300005328 Bacteria 3234
24 Ga0070683_100002577 3300005329 Bacteria 14491
25 Ga0070683_100005380 3300005329 Bacteria 10677
26 Ga0070690_100001748 3300005330 Bacteria 11484
27 Ga0070690_100009386 3300005330 Bacteria 5666
28 Ga0070690_100084160 3300005330 Bacteria 2085
29 Ga0070690_100125995 3300005330 Bacteria 1724
30 Ga0070670_100001397 3300005331 Bacteria 19363
31 Ga0070670_100017125 3300005331 Bacteria 6218
32 Ga0070677_10000229 3300005333 Bacteria 19338
33 Ga0068869_100001282 3300005334 Bacteria 14862
34 Ga0070666_10000097 3300005335 Bacteria 60322
35 Ga0070680_100027599 3300005336 Bacteria 4546
36 Ga0070680_100035476 3300005336 Bacteria 4027
37 Ga0070680_100071310 3300005336 Bacteria 2854
38 Ga0070680_100091392 3300005336 Bacteria 2520
39 Ga0070680_100243692 3300005336 Bacteria 1519
40 Ga0070682_100000675 3300005337 Bacteria 20548
41 Ga0070682_100001697 3300005337 Bacteria 12242
42 Ga0070682_100031360 3300005337 Bacteria 3214
43 Ga0070682_100070557 3300005337 Bacteria 2234
44 Ga0068868_100002052 3300005338 Bacteria 13842
45 Ga0070660_100000067 3300005339 Bacteria 61507
46 Ga0070660_100056087 3300005339 Bacteria 3047
47 Ga0070660_100061459 3300005339 Bacteria 2917
48 Ga0070660_100101479 3300005339 Bacteria 2280
49 Ga0070660_100257046 3300005339 Bacteria 1425
50 Ga0070689_100000641 3300005340 Bacteria 21134
51 Ga0070689_100001711 3300005340 Bacteria 14023
52 Ga0070689_100006940 3300005340 Bacteria 7887
53 Ga0070691_10020802 3300005341 Bacteria 3033
54 Ga0070691_10089065 3300005341 Bacteria 1519
55 Ga0070687_100000218 3300005343 Bacteria 20067
56 Ga0070687_100001093 3300005343 Bacteria 9319
57 Ga0070687_100066350 3300005343 Bacteria 1922
58 Ga0070661_100000128 3300005344 Bacteria 63056
59 Ga0070661_100004793 3300005344 Bacteria 9315
60 Ga0070661_100024299 3300005344 Bacteria 4346
61 Ga0070661_100104975 3300005344 Bacteria 2105
62 Ga0070661_100109554 3300005344 Unclassified 2061
63 Ga0070692_10002696 3300005345 Bacteria 6958
64 Ga0070668_100000193 3300005347 Bacteria 39976
65 Ga0070668_100000683 3300005347 Bacteria 23113
66 Ga0070668_100101309 3300005347 Bacteria 2282
67 Ga0070668_100253420 3300005347 Bacteria 1462
68 Ga0070669_100000491 3300005353 Bacteria 29967
69 Ga0070669_100000634 3300005353 Bacteria 26021
70 Ga0070675_100000582 3300005354 Bacteria 25039
71 Ga0070675_100004418 3300005354 Bacteria 10717
72 Ga0070675_100107453 3300005354 Bacteria 2356
73 Ga0070671_100000220 3300005355 Bacteria 38135
74 Ga0070671_100001574 3300005355 Bacteria 17176
75 Ga0070671_100012024 3300005355 Bacteria 6964
76 Ga0070671_100015677 3300005355 Bacteria 6125
77 Ga0070671_100111434 3300005355 Bacteria 2299
78 Ga0070674_100000597 3300005356 Bacteria 18264
79 Ga0070673_100004830 3300005364 Bacteria 8569
80 Ga0070673_100139049 3300005364 Bacteria 2047
81 Ga0070673_100225235 3300005364 Bacteria 1625
82 Ga0070688_100000044 3300005365 Bacteria 59408
83 Ga0070688_100009424 3300005365 Bacteria 5339
84 Ga0070688_100078900 3300005365 Bacteria 2125
85 Ga0070688_100103971 3300005365 Bacteria 1877
86 Ga0070688_100138171 3300005365 Bacteria 1652
87 Ga0070659_100000229 3300005366 Bacteria 43553
88 Ga0070659_100007671 3300005366 Bacteria 7847
89 Ga0070659_100019887 3300005366 Bacteria 5095
90 Ga0070659_100116315 3300005366 Bacteria 2162
91 Ga0070659_100172848 3300005366 Bacteria 1770
92 Ga0070667_100008393 3300005367 Bacteria 8566
93 Ga0070667_100022925 3300005367 Bacteria 5176
94 Ga0070667_100073763 3300005367 Bacteria 2910
95 Ga0070667_100107883 3300005367 Bacteria 2411
96 Ga0070667_100180076 3300005367 Bacteria 1869
97 Ga0070667_100228210 3300005367 Bacteria 1659
98 Ga0070667_100333995 3300005367 Bacteria 1370
99 Ga0070703_10004414 3300005406 Bacteria 3958
100 Ga0070709_10001382 3300005434 Bacteria 13210
101 Ga0070709_10013388 3300005434 Bacteria 4610
102 Ga0070709_10014889 3300005434 Bacteria 4412
103 Ga0070714_100016309 3300005435 Bacteria 5994
104 Ga0070713_100000958 3300005436 Bacteria 18465
105 Ga0070713_100016743 3300005436 Bacteria 5519
106 Ga0070713_100048126 3300005436 Bacteria 3508
107 Ga0070713_100049325 3300005436 Bacteria 3473
108 Ga0070710_10015209 3300005437 Bacteria 3890
109 Ga0070710_10025049 3300005437 Bacteria 3155
110 Ga0070710_10079108 3300005437 Bacteria 1915
111 Ga0070711_100079498 3300005439 Bacteria 2332
112 Ga0070711_100087791 3300005439 Bacteria 2234
113 Ga0070711_100106163 3300005439 Bacteria 2053
114 Ga0070711_100148068 3300005439 Bacteria 1767
115 Ga0070711_100187319 3300005439 Bacteria 1588
116 Ga0070711_100192184 3300005439 Bacteria 1570
117 Ga0070705_100000316 3300005440 Bacteria 28568
118 Ga0070705_100003618 3300005440 Bacteria 7571
119 Ga0070705_100004210 3300005440 Bacteria 7025
120 Ga0070705_100020000 3300005440 Bacteria 3534
121 Ga0070705_100023437 3300005440 Bacteria 3315
122 Ga0070700_100001484 3300005441 Bacteria 11685
123 Ga0070700_100004074 3300005441 Bacteria 7605
124 Ga0070700_100011885 3300005441 Bacteria 4836
125 Ga0070700_100017923 3300005441 Bacteria 4060
126 Ga0070694_100016830 3300005444 Bacteria 4609
127 Ga0070694_100039439 3300005444 Bacteria 3144
128 Ga0070708_100064969 3300005445 Bacteria 3271
129 Ga0070708_100075946 3300005445 Bacteria 3033
130 Ga0070663_100000609 3300005455 Bacteria 19152
131 Ga0070663_100003347 3300005455 Bacteria 9252
132 Ga0070663_100054069 3300005455 Bacteria 2869
133 Ga0070663_100116308 3300005455 Bacteria 2015
134 Ga0070678_100003089 3300005456 Bacteria 9230
135 Ga0070678_100117865 3300005456 Bacteria 2089
136 Ga0070662_100000123 3300005457 Bacteria 43210
137 Ga0070662_100061176 3300005457 Bacteria 2748
138 Ga0070662_100098773 3300005457 Bacteria 2205
139 Ga0070662_100124373 3300005457 Bacteria 1980
140 Ga0070681_10003982 3300005458 Bacteria 13937
141 Ga0070681_10034795 3300005458 Bacteria 5059
142 Ga0070681_10057230 3300005458 Bacteria 3879
143 Ga0070681_10111415 3300005458 Bacteria 2676
144 Ga0070681_10129351 3300005458 Bacteria 2457
145 Ga0070681_10322834 3300005458 Bacteria 1453
146 Ga0068867_100034674 3300005459 Bacteria 3659
147 Ga0068867_100109289 3300005459 Bacteria 2122
148 Ga0068867_100147307 3300005459 Bacteria 1846
149 Ga0068867_100168976 3300005459 Bacteria 1730
150 Ga0070685_10000237 3300005466 Bacteria 36563
151 Ga0070685_10006590 3300005466 Bacteria 5924
152 Ga0070685_10029591 3300005466 Bacteria 3044
153 Ga0070699_100007988 3300005518 Bacteria 9186
154 Ga0070699_100039831 3300005518 Bacteria 4069
155 Ga0070699_100284848 3300005518 Bacteria 1480
156 Ga0070679_100001633 3300005530 Bacteria 20196
157 Ga0070679_100006811 3300005530 Bacteria 10657
158 Ga0070679_100009228 3300005530 Bacteria 9321
159 Ga0070679_100026691 3300005530 Bacteria 5678
160 Ga0070679_100056977 3300005530 Bacteria 3894
161 Ga0070679_100123336 3300005530 Bacteria 2574
162 Ga0070679_100133292 3300005530 Bacteria 2465
163 Ga0070679_100144721 3300005530 Bacteria 2355
164 Ga0070684_100000334 3300005535 Bacteria 32646
165 Ga0070684_100123419 3300005535 Bacteria 2331
166 Ga0070684_100245473 3300005535 Bacteria 1636
167 Ga0070697_100003600 3300005536 Bacteria 11905
168 Ga0070697_100009083 3300005536 Bacteria 7765
169 Ga0068853_100000219 3300005539 Bacteria 40398
170 Ga0068853_100037274 3300005539 Bacteria 4137
171 Ga0068853_100038804 3300005539 Bacteria 4058
172 Ga0068853_100286517 3300005539 Bacteria 1519
173 Ga0070672_100000261 3300005543 Bacteria 29848
174 Ga0070672_100000494 3300005543 Bacteria 22934
175 Ga0070686_100001005 3300005544 Bacteria 16243
176 Ga0070686_100001041 3300005544 Bacteria 15960
177 Ga0070686_100013297 3300005544 Bacteria 4707
178 Ga0070686_100021526 3300005544 Bacteria 3835
179 Ga0070695_100001888 3300005545 Bacteria 11844
180 Ga0070695_100003969 3300005545 Bacteria 8645
181 Ga0070695_100010659 3300005545 Bacteria 5492
182 Ga0070695_100158014 3300005545 Bacteria 1589
183 Ga0070696_100014508 3300005546 Bacteria 5288
184 Ga0070696_100023309 3300005546 Bacteria 4207
185 Ga0070696_100078913 3300005546 Bacteria 2328
186 Ga0070696_100137496 3300005546 Bacteria 1782
187 Ga0070693_100000953 3300005547 Bacteria 12837
188 Ga0070693_100002565 3300005547 Bacteria 8373
189 Ga0070665_100005100 3300005548 Bacteria 13622
190 Ga0070704_100001952 3300005549 Bacteria 11412
191 Ga0070704_100004740 3300005549 Bacteria 7868
192 Ga0070704_100004907 3300005549 Bacteria 7764
193 Ga0068855_100003887 3300005563 Bacteria 18252
194 Ga0068855_100007678 3300005563 Bacteria 13030
195 Ga0068855_100021168 3300005563 Bacteria 7795
196 Ga0068855_100035592 3300005563 Bacteria 5930
197 Ga0068855_100048572 3300005563 Bacteria 5007
198 Ga0068855_100065618 3300005563 Bacteria 4232
199 Ga0070664_100000286 3300005564 Bacteria 36492
200 Ga0070664_100000892 3300005564 Bacteria 23198
201 Ga0070664_100096755 3300005564 Bacteria 2562
202 Ga0068857_100000087 3300005577 Bacteria 53140
203 Ga0068857_100011685 3300005577 Bacteria 7636
204 Ga0068857_100069992 3300005577 Bacteria 3125
205 Ga0068857_100203207 3300005577 Bacteria 1806
206 Ga0068854_100000147 3300005578 Bacteria 48950
207 Ga0068854_100002291 3300005578 Bacteria 11776
208 Ga0068854_100008595 3300005578 Bacteria 6573
209 Ga0068854_100030544 3300005578 Bacteria 3738
210 Ga0068854_100244409 3300005578 Bacteria 1430
211 Ga0068856_100002205 3300005614 Bacteria 20218
212 Ga0068856_100025100 3300005614 Bacteria 5808
213 Ga0068856_100028873 3300005614 Bacteria 5420
214 Ga0068856_100043343 3300005614 Bacteria 4427
215 Ga0068856_100075301 3300005614 Bacteria 3343
216 Ga0070702_100000852 3300005615 Bacteria 11770
217 Ga0070702_100005302 3300005615 Bacteria 5987
218 Ga0070702_100010159 3300005615 Bacteria 4627
219 Ga0070702_100046089 3300005615 Bacteria 2470
220 Ga0070702_100063772 3300005615 Bacteria 2153
221 Ga0068852_100000090 3300005616 Bacteria 64065
222 Ga0068852_100013777 3300005616 Bacteria 6198
223 Ga0068852_100175310 3300005616 Bacteria 2013
224 Ga0068852_100295377 3300005616 Bacteria 1567
225 Ga0068852_100315082 3300005616 Bacteria 1518
226 Ga0068859_100002117 3300005617 Bacteria 20218
227 Ga0068859_100103202 3300005617 Bacteria 2909
228 Ga0068859_100205436 3300005617 Bacteria 2055
229 Ga0068859_100259040 3300005617 Bacteria 1830
230 Ga0068864_100000739 3300005618 Bacteria 27394
231 Ga0068864_100000954 3300005618 Bacteria 24230
232 Ga0068864_100056355 3300005618 Bacteria 3395
233 Ga0068866_10000067 3300005718 Bacteria 41179
234 Ga0068866_10002553 3300005718 Bacteria 7504
235 Ga0068866_10006331 3300005718 Bacteria 4926
236 Ga0068861_100000381 3300005719 Bacteria 25556
237 Ga0068861_100005852 3300005719 Bacteria 8353
238 Ga0068861_100227344 3300005719 Bacteria 1580
239 Ga0068851_10000526 3300005834 Bacteria 16683
240 Ga0068870_10000010 3300005840 Bacteria 70177
241 Ga0068870_10002778 3300005840 Bacteria 7359
242 Ga0068863_100000615 3300005841 Bacteria 36107
243 Ga0068863_100013419 3300005841 Bacteria 7900
244 Ga0068863_100043776 3300005841 Bacteria 4250
245 Ga0068863_100079087 3300005841 Bacteria 3114
246 Ga0068858_100009423 3300005842 Bacteria 9316
247 Ga0068858_100019129 3300005842 Bacteria 6407
248 Ga0068860_100015907 3300005843 Bacteria 7342
249 Ga0068860_100129396 3300005843 Bacteria 2422
250 Ga0068860_100150951 3300005843 Bacteria 2237
251 Ga0068862_100007632 3300005844 Bacteria 8956
252 Ga0068862_100047113 3300005844 Bacteria 3678
253 Ga0081455_10000059 3300005937 Bacteria 119148
254 Ga0081455_10000689 3300005937 Bacteria 43834
255 Ga0081455_10007122 3300005937 Bacteria 11841
256 Ga0081455_10019181 3300005937 Bacteria 6480
257 Ga0081455_10071503 3300005937 Bacteria 2876
258 Ga0081538_10001357 3300005981 Bacteria 25199
259 Ga0081540_1000024 3300005983 Bacteria 158868
260 Ga0081540_1000234 3300005983 Bacteria 58203
261 Ga0081540_1003005 3300005983 Bacteria 13511
262 Ga0081539_10005746 3300005985 Bacteria 12400
263 Ga0070717_10000161 3300006028 Bacteria 50633
264 Ga0070717_10005842 3300006028 Bacteria 9018
265 Ga0075365_10042032 3300006038 Bacteria 2987
266 Ga0075364_10049729 3300006051 Bacteria 2735
267 Ga0070715_10014781 3300006163 Bacteria 2898
268 Ga0070716_100034186 3300006173 Bacteria 2785
269 Ga0070716_100076186 3300006173 Bacteria 1987
270 Ga0070712_100000205 3300006175 Bacteria 33282
271 Ga0070712_100003713 3300006175 Bacteria 9405
272 Ga0070712_100065773 3300006175 Bacteria 2574
273 Ga0070712_100117306 3300006175 Bacteria 1997
274 Ga0075367_10041064 3300006178 Bacteria 2703
275 Ga0075367_10050615 3300006178 Bacteria 2453
276 Ga0075367_10090639 3300006178 Bacteria 1860
277 Ga0075369_10005639 3300006186 Bacteria 4690
278 Ga0075366_10032474 3300006195 Bacteria 3072
279 Ga0075366_10089102 3300006195 Bacteria 1848
280 Ga0097621_100000553 3300006237 Bacteria 26270
281 Ga0097621_100002975 3300006237 Bacteria 11634
282 Ga0097621_100004734 3300006237 Bacteria 9509
283 Ga0097621_100012603 3300006237 Bacteria 6273
284 Ga0097621_100023826 3300006237 Bacteria 4770
285 Ga0097621_100080269 3300006237 Bacteria 2713
286 Ga0097621_100089649 3300006237 Bacteria 2572
287 Ga0097621_100108751 3300006237 Bacteria 2341
288 Ga0075370_10101595 3300006353 Bacteria 1664
289 Ga0068871_100000372 3300006358 Bacteria 31379
290 Ga0068871_100000753 3300006358 Bacteria 21845
291 Ga0068871_100165050 3300006358 Bacteria 1895
292 Ga0075428_100005672 3300006844 Bacteria 13875
293 Ga0075428_100014847 3300006844 Bacteria 8656
294 Ga0075428_100064595 3300006844 Bacteria 4009
295 Ga0075428_100068950 3300006844 Bacteria 3868
296 Ga0075428_100086234 3300006844 Bacteria 3424
297 Ga0075430_100000281 3300006846 Bacteria 35697
298 Ga0075430_100000304 3300006846 Bacteria 34813
299 Ga0075430_100010708 3300006846 Bacteria 7772
300 Ga0075430_100026357 3300006846 Bacteria 4946
301 Ga0075430_100064742 3300006846 Bacteria 3071
302 Ga0075430_100223321 3300006846 Bacteria 1563
303 Ga0075431_100001243 3300006847 Bacteria 23126
304 Ga0075431_100120956 3300006847 Bacteria 2702
305 Ga0075433_10000958 3300006852 Bacteria 20392
306 Ga0075433_10010499 3300006852 Bacteria 7436
307 Ga0075433_10054678 3300006852 Bacteria 3482
308 Ga0075434_100001677 3300006871 Bacteria 18913
309 Ga0075434_100064025 3300006871 Bacteria 3660
310 Ga0075434_100104021 3300006871 Bacteria 2848
311 Ga0075434_100241424 3300006871 Bacteria 1827
312 Ga0075434_100259136 3300006871 Bacteria 1758
313 Ga0075429_100000347 3300006880 Bacteria 33776
314 Ga0068865_100000156 3300006881 Bacteria 37229
315 Ga0068865_100002150 3300006881 Bacteria 11633
316 Ga0068865_100036714 3300006881 Bacteria 3305
317 Ga0075436_100019091 3300006914 Bacteria 4696
318 Ga0075436_100071457 3300006914 Bacteria 2399
319 Ga0097620_100002117 3300006931 Bacteria 20218
320 Ga0097620_100103193 3300006931 Bacteria 2909
321 Ga0097620_100205424 3300006931 Bacteria 2055
322 Ga0097620_100259014 3300006931 Bacteria 1830
323 Ga0075435_100009928 3300007076 Bacteria 6934
324 Ga0075435_100016723 3300007076 Bacteria 5534
325 Ga0075435_100050217 3300007076 Bacteria 3356
326 Ga0075435_100052152 3300007076 Bacteria 3297
327 Ga0075435_100174311 3300007076 Bacteria 1815
328 Ga0075435_100334844 3300007076 Bacteria 1297
329 Ga0099794_10031492 3300007265 Bacteria 2483
330 Ga0099795_10001813 3300007788 Bacteria 4809
331 Ga0099795_10011720 3300007788 Bacteria 2633
332 Ga0105251_10056219 3300009011 Bacteria 1863
333 Ga0105240_10001500 3300009093 Bacteria 39754
334 Ga0105240_10038846 3300009093 Bacteria 6102
335 Ga0111539_10002924 3300009094 Bacteria 22647
336 Ga0111539_10014188 3300009094 Bacteria 9950
337 Ga0111539_10022850 3300009094 Bacteria 7680
338 Ga0111539_10108638 3300009094 Bacteria 3256
339 Ga0111539_10202698 3300009094 Bacteria 2313
340 Ga0111539_10263811 3300009094 Bacteria 2005
341 Ga0111539_10414854 3300009094 Bacteria 1568
342 Ga0105245_10001287 3300009098 Bacteria 22612
343 Ga0105245_10002062 3300009098 Bacteria 18225
344 Ga0105245_10002978 3300009098 Bacteria 15190
345 Ga0105245_10044205 3300009098 Bacteria 3975
346 Ga0105245_10058528 3300009098 Bacteria 3469
347 Ga0105245_10069710 3300009098 Bacteria 3189
348 Ga0105247_10000294 3300009101 Bacteria 45240
349 Ga0105247_10005555 3300009101 Bacteria 7926
350 Ga0105247_10078966 3300009101 Bacteria 2071
351 Ga0114129_10004490 3300009147 Bacteria 19683
352 Ga0114129_10029420 3300009147 Bacteria 7781
353 Ga0114129_10094895 3300009147 Bacteria 4131
354 Ga0105243_10004518 3300009148 Bacteria 10996
355 Ga0105243_10033289 3300009148 Bacteria 3985
356 Ga0105243_10035007 3300009148 Bacteria 3892
357 Ga0105243_10138754 3300009148 Bacteria 2071
358 Ga0105243_10147810 3300009148 Bacteria 2012
359 Ga0105241_10000480 3300009174 Bacteria 30135
360 Ga0105241_10008748 3300009174 Bacteria 7439
361 Ga0105241_10011137 3300009174 Bacteria 6594
362 Ga0105241_10041377 3300009174 Bacteria 3481
363 Ga0105241_10086609 3300009174 Bacteria 2464
364 Ga0105241_10191994 3300009174 Bacteria 1701
365 Ga0105242_10000866 3300009176 Bacteria 23498
366 Ga0105242_10001180 3300009176 Bacteria 20574
367 Ga0105242_10061250 3300009176 Bacteria 3095
368 Ga0105242_10077831 3300009176 Bacteria 2767
369 Ga0105242_10388153 3300009176 Bacteria 1300
370 Ga0105248_10001732 3300009177 Bacteria 24242
371 Ga0105248_10002315 3300009177 Bacteria 21125
372 Ga0105248_10004805 3300009177 Bacteria 14953
373 Ga0105248_10007763 3300009177 Bacteria 11775
374 Ga0105248_10054088 3300009177 Bacteria 4502
375 Ga0105248_10058156 3300009177 Bacteria 4341
376 Ga0105248_10126951 3300009177 Bacteria 2877
377 Ga0105248_10171900 3300009177 Bacteria 2442
378 Ga0105237_10000241 3300009545 Bacteria 77735
379 Ga0105237_10056155 3300009545 Bacteria 3942
380 Ga0105237_10111417 3300009545 Bacteria 2729
381 Ga0105237_10286760 3300009545 Bacteria 1649
382 Ga0105237_10355511 3300009545 Bacteria 1469
383 Ga0105238_10001419 3300009551 Bacteria 23987
384 Ga0105238_10002026 3300009551 Bacteria 20463
385 Ga0105238_10149373 3300009551 Bacteria 2312
386 Ga0105238_10313787 3300009551 Bacteria 1553
387 Ga0105249_10000108 3300009553 Bacteria 113842
388 Ga0105249_10003046 3300009553 Bacteria 14463
389 Ga0105249_10037549 3300009553 Bacteria 4396
390 Ga0105249_10053893 3300009553 Bacteria 3677
391 Ga0105249_10239855 3300009553 Bacteria 1792
392 Ga0099796_10002054 3300010159 Bacteria 4299
393 Ga0099796_10003427 3300010159 Bacteria 3677
394 Ga0105239_10002853 3300010375 Bacteria 21617
395 Ga0105239_10019398 3300010375 Bacteria 7509
396 Ga0105239_10200500 3300010375 Bacteria 2235
397 Ga0105239_10305372 3300010375 Bacteria 1792
398 Ga0105239_10475769 3300010375 Bacteria 1419
399 Ga0105246_10001801 3300011119 Bacteria 12821
400 Ga0105246_10217654 3300011119 Bacteria 1495
401 Ga0157341_1002376 3300012494 Bacteria 1237
402 Ga0157373_10000334 3300013100 Bacteria 38219
403 Ga0157373_10003322 3300013100 Bacteria 12151
404 Ga0157371_10001142 3300013102 Bacteria 28611
405 Ga0157370_10021256 3300013104 Bacteria 6469
406 Ga0157370_10053855 3300013104 Bacteria 3836
407 Ga0157370_10075736 3300013104 Bacteria 3171
408 Ga0157370_10089394 3300013104 Bacteria 2893
409 Ga0157369_10001253 3300013105 Bacteria 31592
410 Ga0157369_10073153 3300013105 Bacteria 3678
411 Ga0157369_10088257 3300013105 Bacteria 3310
412 Ga0157374_10000447 3300013296 Bacteria 37491
413 Ga0157374_10024878 3300013296 Bacteria 5371
414 Ga0157374_10079484 3300013296 Bacteria 3108
415 Ga0157378_10001168 3300013297 Bacteria 23883
416 Ga0157378_10007833 3300013297 Bacteria 9324
417 Ga0157378_10101460 3300013297 Bacteria 2628
418 Ga0157378_10133412 3300013297 Bacteria 2301
419 Ga0163162_10000607 3300013306 Bacteria 33230
420 Ga0163162_10020177 3300013306 Bacteria 6545
421 Ga0163162_10086471 3300013306 Bacteria 3213
422 Ga0157372_10001186 3300013307 Bacteria 28190
423 Ga0157372_10001963 3300013307 Bacteria 22365
424 Ga0157372_10022732 3300013307 Bacteria 6788
425 Ga0157372_10023621 3300013307 Bacteria 6670
426 Ga0157372_10063627 3300013307 Bacteria 4137
427 Ga0157375_10006232 3300013308 Bacteria 10388
428 Ga0157375_10013281 3300013308 Bacteria 7325
429 Ga0157375_10018759 3300013308 Bacteria 6277
430 Ga0157375_10027696 3300013308 Bacteria 5301
431 Ga0157375_10370805 3300013308 Bacteria 1598
432 Ga0163163_10011096 3300014325 Bacteria 8155
433 Ga0163163_10052753 3300014325 Bacteria 4013
434 Ga0163163_10054941 3300014325 Bacteria 3935
435 Ga0163163_10184448 3300014325 Bacteria 2134
436 Ga0157380_10004561 3300014326 Bacteria 9615
437 Ga0157380_10047332 3300014326 Bacteria 3382
438 Ga0182008_10099598 3300014497 Bacteria 1436
439 Ga0157377_10000572 3300014745 Bacteria 15411
440 Ga0157377_10007004 3300014745 Bacteria 5417
441 Ga0157379_10000919 3300014968 Bacteria 23786
442 Ga0157379_10011946 3300014968 Bacteria 7587
443 Ga0157379_10062753 3300014968 Bacteria 3322
444 Ga0157379_10208854 3300014968 Bacteria 1767
445 Ga0157379_10234921 3300014968 Bacteria 1662
446 Ga0157376_10000171 3300014969 Bacteria 44976
447 Ga0157376_10116109 3300014969 Bacteria 2364
448 Ga0157376_10247042 3300014969 Bacteria 1665
449 Ga0163161_10005587 3300017792 Bacteria 8717
450 Ga0163161_10035003 3300017792 Bacteria 3593
451 Ga0206356_10633008 3300020070 Bacteria 3264
452 Ga0213872_10013229 3300021361 Bacteria 3870
453 Ga0213875_10000390 3300021388 Bacteria 39140
454 Ga0224712_10027215 3300022467 Bacteria 2032
455 Ga0224572_1012742 3300024225 Bacteria 1602
456 Ga0228598_1000876 3300024227 Bacteria 6507
457 Ga0228598_1008933 3300024227 Bacteria 2015
458 Ga0209233_1000010 3300025261 Bacteria 1194329
459 Ga0207666_1000940 3300025271 Bacteria 3455
460 Ga0207673_1000217 3300025290 Bacteria 5793
461 Ga0209758_1000244 3300025297 Bacteria 112497
462 Ga0207697_10000031 3300025315 Bacteria 51045
463 Ga0207697_10013153 3300025315 Bacteria 3455
464 Ga0207697_10072789 3300025315 Bacteria 1441
465 Ga0207656_10002604 3300025321 Bacteria 6099
466 Ga0207653_10001068 3300025885 Bacteria 8988
467 Ga0207682_10000048 3300025893 Bacteria 50998
468 Ga0207682_10004266 3300025893 Bacteria 6030
469 Ga0207692_10005709 3300025898 Bacteria 5001
470 Ga0207692_10020824 3300025898 Bacteria 2990
471 Ga0207642_10000907 3300025899 Bacteria 9284
472 Ga0207642_10001785 3300025899 Bacteria 6654
473 Ga0207642_10048896 3300025899 Bacteria 1898
474 Ga0207710_10001310 3300025900 Bacteria 12571
475 Ga0207710_10002593 3300025900 Bacteria 8350
476 Ga0207710_10033807 3300025900 Bacteria 2244
477 Ga0207710_10053272 3300025900 Bacteria 1820
478 Ga0207688_10000134 3300025901 Bacteria 31373
479 Ga0207688_10000211 3300025901 Bacteria 26007
480 Ga0207688_10005003 3300025901 Bacteria 7208
481 Ga0207680_10000292 3300025903 Bacteria 23978
482 Ga0207680_10005007 3300025903 Bacteria 6311
483 Ga0207680_10055343 3300025903 Bacteria 2390
484 Ga0207647_10031325 3300025904 Bacteria 3423
485 Ga0207647_10122135 3300025904 Bacteria 1535
486 Ga0207685_10042675 3300025905 Bacteria 1705
487 Ga0207699_10006284 3300025906 Bacteria 5739
488 Ga0207699_10145515 3300025906 Bacteria 1562
489 Ga0207645_10000528 3300025907 Bacteria 31825
490 Ga0207645_10000961 3300025907 Bacteria 23850
491 Ga0207643_10000016 3300025908 Bacteria 121792
492 Ga0207643_10000481 3300025908 Bacteria 25837
493 Ga0207643_10054941 3300025908 Bacteria 2264
494 Ga0207705_10004189 3300025909 Bacteria 10942
495 Ga0207705_10029325 3300025909 Bacteria 3922
496 Ga0207705_10032870 3300025909 Bacteria 3707
497 Ga0207705_10061824 3300025909 Bacteria 2705
498 Ga0207684_10128898 3300025910 Bacteria 2171
499 Ga0207654_10001993 3300025911 Bacteria 10496
500 Ga0207654_10002732 3300025911 Bacteria 8958
501 Ga0207654_10010727 3300025911 Bacteria 4665
502 Ga0207654_10014119 3300025911 Bacteria 4121
503 Ga0207654_10107215 3300025911 Bacteria 1732
504 Ga0207707_10008850 3300025912 Bacteria 8744
505 Ga0207707_10011083 3300025912 Bacteria 7839
506 Ga0207707_10027658 3300025912 Bacteria 4958
507 Ga0207707_10046663 3300025912 Bacteria 3774
508 Ga0207707_10051463 3300025912 Bacteria 3587
509 Ga0207707_10116154 3300025912 Bacteria 2338
510 Ga0207695_10014232 3300025913 Bacteria 9437
511 Ga0207695_10036837 3300025913 Bacteria 5283
512 Ga0207695_10142481 3300025913 Bacteria 2344
513 Ga0207671_10002205 3300025914 Bacteria 21139
514 Ga0207671_10094305 3300025914 Bacteria 2259
515 Ga0207693_10000988 3300025915 Bacteria 25527
516 Ga0207693_10002485 3300025915 Bacteria 16030
517 Ga0207693_10042682 3300025915 Bacteria 3570
518 Ga0207693_10047632 3300025915 Bacteria 3368
519 Ga0207693_10058273 3300025915 Bacteria 3026
520 Ga0207693_10078155 3300025915 Bacteria 2590
521 Ga0207663_10078819 3300025916 Bacteria 2149
522 Ga0207663_10144986 3300025916 Bacteria 1659
523 Ga0207663_10151817 3300025916 Bacteria 1626
524 Ga0207660_10000104 3300025917 Bacteria 47254
525 Ga0207660_10046815 3300025917 Bacteria 3054
526 Ga0207660_10068916 3300025917 Bacteria 2567
527 Ga0207660_10136568 3300025917 Bacteria 1871
528 Ga0207660_10140162 3300025917 Bacteria 1848
529 Ga0207660_10158164 3300025917 Bacteria 1746
530 Ga0207662_10000003 3300025918 Bacteria 148717
531 Ga0207662_10009440 3300025918 Bacteria 5369
532 Ga0207662_10178463 3300025918 Bacteria 1365
533 Ga0207657_10000009 3300025919 Bacteria 187503
534 Ga0207657_10011458 3300025919 Bacteria 8804
535 Ga0207657_10012103 3300025919 Bacteria 8526
536 Ga0207657_10054965 3300025919 Bacteria 3441
537 Ga0207657_10056087 3300025919 Bacteria 3401
538 Ga0207657_10095342 3300025919 Bacteria 2476
539 Ga0207649_10000141 3300025920 Bacteria 60047
540 Ga0207649_10001150 3300025920 Bacteria 15971
541 Ga0207652_10001464 3300025921 Bacteria 20891
542 Ga0207652_10016390 3300025921 Bacteria 6051
543 Ga0207652_10041916 3300025921 Bacteria 3893
544 Ga0207652_10059621 3300025921 Bacteria 3290
545 Ga0207646_10189150 3300025922 Bacteria 1859
546 Ga0207681_10000545 3300025923 Bacteria 25938
547 Ga0207694_10001005 3300025924 Bacteria 24646
548 Ga0207694_10004477 3300025924 Bacteria 10904
549 Ga0207694_10004833 3300025924 Bacteria 10456
550 Ga0207694_10104548 3300025924 Bacteria 2247
551 Ga0207650_10000492 3300025925 Bacteria 32885
552 Ga0207650_10013326 3300025925 Bacteria 5692
553 Ga0207650_10030995 3300025925 Bacteria 3858
554 Ga0207650_10093023 3300025925 Bacteria 2307
555 Ga0207659_10000052 3300025926 Bacteria 79692
556 Ga0207659_10000729 3300025926 Bacteria 19476
557 Ga0207687_10000097 3300025927 Bacteria 64441
558 Ga0207687_10000921 3300025927 Bacteria 20016
559 Ga0207687_10001401 3300025927 Bacteria 16462
560 Ga0207687_10004611 3300025927 Bacteria 9172
561 Ga0207687_10142195 3300025927 Bacteria 1821
562 Ga0207687_10172428 3300025927 Bacteria 1670
563 Ga0207700_10001350 3300025928 Bacteria 13908
564 Ga0207700_10021623 3300025928 Bacteria 4396
565 Ga0207700_10035397 3300025928 Bacteria 3596
566 Ga0207700_10047683 3300025928 Bacteria 3177
567 Ga0207700_10060502 3300025928 Bacteria 2869
568 Ga0207700_10067988 3300025928 Bacteria 2730
569 Ga0207700_10158297 3300025928 Bacteria 1879
570 Ga0207664_10212577 3300025929 Bacteria 1674
571 Ga0207664_10262621 3300025929 Bacteria 1510
572 Ga0207644_10000263 3300025931 Bacteria 35326
573 Ga0207644_10003247 3300025931 Bacteria 10488
574 Ga0207644_10027851 3300025931 Bacteria 3906
575 Ga0207644_10043821 3300025931 Bacteria 3176
576 Ga0207644_10047129 3300025931 Bacteria 3073
577 Ga0207690_10000631 3300025932 Bacteria 22647
578 Ga0207690_10001244 3300025932 Bacteria 16102
579 Ga0207690_10117517 3300025932 Bacteria 1925
580 Ga0207690_10187287 3300025932 Bacteria 1563
581 Ga0207706_10001434 3300025933 Bacteria 23873
582 Ga0207706_10016803 3300025933 Bacteria 6604
583 Ga0207706_10082864 3300025933 Bacteria 2819
584 Ga0207706_10096313 3300025933 Bacteria 2602
585 Ga0207706_10180533 3300025933 Bacteria 1854
586 Ga0207686_10001329 3300025934 Bacteria 14090
587 Ga0207686_10006655 3300025934 Bacteria 6232
588 Ga0207686_10026054 3300025934 Bacteria 3409
589 Ga0207686_10069394 3300025934 Bacteria 2261
590 Ga0207686_10130464 3300025934 Bacteria 1723
591 Ga0207709_10000349 3300025935 Bacteria 47453
592 Ga0207709_10006983 3300025935 Bacteria 6311
593 Ga0207709_10032785 3300025935 Bacteria 3045
594 Ga0207709_10088252 3300025935 Bacteria 2018
595 Ga0207709_10223328 3300025935 Bacteria 1360
596 Ga0207670_10000245 3300025936 Bacteria 33700
597 Ga0207670_10002128 3300025936 Bacteria 10357
598 Ga0207670_10006779 3300025936 Bacteria 6370
599 Ga0207670_10066215 3300025936 Bacteria 2481
600 Ga0207669_10000547 3300025937 Bacteria 16353
601 Ga0207704_10000156 3300025938 Bacteria 36588
602 Ga0207704_10000175 3300025938 Bacteria 33926
603 Ga0207704_10096144 3300025938 Bacteria 1961
604 Ga0207665_10001219 3300025939 Bacteria 17354
605 Ga0207665_10002363 3300025939 Bacteria 12741
606 Ga0207665_10043816 3300025939 Bacteria 2993
607 Ga0207691_10000730 3300025940 Bacteria 32487
608 Ga0207691_10013319 3300025940 Bacteria 7877
609 Ga0207691_10069796 3300025940 Bacteria 3174
610 Ga0207691_10244984 3300025940 Bacteria 1548
611 Ga0207711_10000070 3300025941 Bacteria 114551
612 Ga0207711_10002571 3300025941 Bacteria 16144
613 Ga0207711_10002853 3300025941 Bacteria 15157
614 Ga0207711_10005864 3300025941 Bacteria 10371
615 Ga0207711_10013998 3300025941 Bacteria 6662
616 Ga0207711_10018100 3300025941 Bacteria 5858
617 Ga0207711_10027221 3300025941 Bacteria 4802
618 Ga0207711_10128058 3300025941 Bacteria 2273
619 Ga0207689_10001326 3300025942 Bacteria 23870
620 Ga0207689_10004056 3300025942 Bacteria 13304
621 Ga0207689_10138168 3300025942 Bacteria 2007
622 Ga0207661_10002308 3300025944 Bacteria 13137
623 Ga0207661_10174866 3300025944 Bacteria 1871
624 Ga0207679_10000035 3300025945 Bacteria 144173
625 Ga0207679_10000364 3300025945 Bacteria 32844
626 Ga0207679_10016618 3300025945 Bacteria 4890
627 Ga0207679_10020337 3300025945 Bacteria 4479
628 Ga0207679_10323974 3300025945 Bacteria 1335
629 Ga0207667_10012973 3300025949 Bacteria 9565
630 Ga0207667_10040307 3300025949 Bacteria 4973
631 Ga0207667_10041576 3300025949 Bacteria 4888
632 Ga0207667_10061064 3300025949 Bacteria 3944
633 Ga0207667_10094323 3300025949 Bacteria 3089
634 Ga0207667_10193255 3300025949 Bacteria 2088
635 Ga0207651_10000030 3300025960 Bacteria 67091
636 Ga0207651_10000180 3300025960 Bacteria 27549
637 Ga0207651_10028433 3300025960 Bacteria 3527
638 Ga0207651_10283881 3300025960 Bacteria 1369
639 Ga0207712_10000318 3300025961 Bacteria 44007
640 Ga0207712_10000807 3300025961 Bacteria 23060
641 Ga0207712_10005766 3300025961 Bacteria 7805
642 Ga0207712_10007715 3300025961 Bacteria 6804
643 Ga0207712_10008152 3300025961 Bacteria 6626
644 Ga0207712_10096860 3300025961 Bacteria 2185
645 Ga0207668_10000354 3300025972 Bacteria 29853
646 Ga0207640_10000543 3300025981 Bacteria 22622
647 Ga0207658_10000141 3300025986 Bacteria 75673
648 Ga0207658_10007561 3300025986 Bacteria 7401
649 Ga0207658_10039126 3300025986 Bacteria 3421
650 Ga0207658_10143294 3300025986 Bacteria 1937
651 Ga0207677_10000028 3300026023 Bacteria 125165
652 Ga0207677_10024472 3300026023 Bacteria 3753
653 Ga0207677_10052769 3300026023 Unclassified 2764
654 Ga0207703_10000398 3300026035 Bacteria 46686
655 Ga0207703_10007050 3300026035 Bacteria 8940
656 Ga0207703_10082494 3300026035 Bacteria 2683
657 Ga0207703_10096500 3300026035 Bacteria 2496
658 Ga0207639_10003015 3300026041 Bacteria 11335
659 Ga0207639_10011648 3300026041 Bacteria 6111
660 Ga0207639_10037532 3300026041 Bacteria 3599
661 Ga0207678_10000569 3300026067 Bacteria 33786
662 Ga0207678_10011093 3300026067 Bacteria 7917
663 Ga0207678_10011310 3300026067 Bacteria 7832
664 Ga0207678_10012284 3300026067 Bacteria 7519
665 Ga0207678_10021743 3300026067 Bacteria 5626
666 Ga0207678_10094277 3300026067 Bacteria 2558
667 Ga0207708_10001083 3300026075 Bacteria 20415
668 Ga0207708_10008426 3300026075 Bacteria 7628
669 Ga0207708_10022276 3300026075 Bacteria 4784
670 Ga0207708_10043030 3300026075 Bacteria 3441
671 Ga0207708_10072078 3300026075 Bacteria 2647
672 Ga0207708_10161739 3300026075 Bacteria 1768
673 Ga0207702_10007732 3300026078 Bacteria 9125
674 Ga0207702_10049430 3300026078 Bacteria 3549
675 Ga0207702_10130316 3300026078 Bacteria 2262
676 Ga0207702_10185453 3300026078 Bacteria 1918
677 Ga0207641_10098827 3300026088 Bacteria 2567
678 Ga0207641_10269734 3300026088 Bacteria 1596
679 Ga0207648_10001728 3300026089 Bacteria 23923
680 Ga0207648_10024446 3300026089 Bacteria 5392
681 Ga0207648_10065584 3300026089 Bacteria 3165
682 Ga0207676_10000540 3300026095 Bacteria 31519
683 Ga0207676_10012389 3300026095 Bacteria 6109
684 Ga0207676_10074742 3300026095 Bacteria 2731
685 Ga0207674_10000103 3300026116 Bacteria 97454
686 Ga0207674_10030337 3300026116 Bacteria 5685
687 Ga0207674_10048205 3300026116 Bacteria 4361
688 Ga0207675_100000005 3300026118 Bacteria 199965
689 Ga0207675_100029681 3300026118 Bacteria 5092
690 Ga0207675_100357712 3300026118 Bacteria 1432
691 Ga0207683_10000089 3300026121 Bacteria 72911
692 Ga0207683_10002434 3300026121 Bacteria 16238
693 Ga0207683_10029607 3300026121 Bacteria 4741
694 Ga0207683_10038437 3300026121 Bacteria 4171
695 Ga0207683_10044230 3300026121 Bacteria 3893
696 Ga0207683_10047521 3300026121 Bacteria 3759
697 Ga0207683_10314626 3300026121 Bacteria 1433
698 Ga0207698_10002914 3300026142 Bacteria 10222
699 Ga0207698_10008587 3300026142 Bacteria 6472
700 Ga0209179_1002569 3300027512 Bacteria 2474
701 Ga0209179_1003591 3300027512 Bacteria 2252
702 Ga0209983_1008676 3300027665 Bacteria 2075
703 Ga0209588_1014155 3300027671 Bacteria 2440
704 Ga0209971_1003936 3300027682 Bacteria 3512
705 Ga0209966_1010017 3300027695 Bacteria 1701
706 Ga0209998_10005504 3300027717 Bacteria 2647
707 Ga0209974_10006900 3300027876 Bacteria 3937
708 Ga0207428_10000075 3300027907 Bacteria 137887
709 Ga0207428_10000428 3300027907 Bacteria 51964
710 Ga0207428_10003864 3300027907 Bacteria 14363
711 Ga0207428_10005944 3300027907 Bacteria 11299
712 Ga0207428_10058658 3300027907 Bacteria 3054
713 Ga0268266_10001132 3300028379 Bacteria 33205
714 Ga0268266_10190546 3300028379 Bacteria 1872
715 Ga0268266_10319663 3300028379 Bacteria 1452
716 Ga0268265_10000571 3300028380 Bacteria 37494
717 Ga0268265_10002724 3300028380 Bacteria 13063
718 Ga0268264_10000173 3300028381 Bacteria 138426
719 Ga0268264_10006427 3300028381 Bacteria 9896
720 Ga0268264_10007738 3300028381 Bacteria 8947
721 Ga0268264_10239177 3300028381 Bacteria 1681
722 Ga0265337_1009316 3300028556 Bacteria 3510
723 Ga0265760_10023089 3300031090 Bacteria 1806
724 Ga0265332_10001304 3300031238 Bacteria 14222
725 Ga0265325_10000675 3300031241 Bacteria 24875
726 Ga0265325_10001165 3300031241 Bacteria 18809
727 Ga0265325_10002317 3300031241 Bacteria 12919
728 Ga0265325_10013642 3300031241 Bacteria 4619
729 Ga0265340_10002000 3300031247 Bacteria 11666
730 Ga0265340_10040003 3300031247 Bacteria 2310
731 Ga0265339_10000078 3300031249 Bacteria 83767
732 Ga0265339_10004450 3300031249 Bacteria 9562
733 Ga0265339_10025129 3300031249 Bacteria 3422
734 Ga0265331_10008199 3300031250 Bacteria 5958
735 Ga0265316_10034356 3300031344 Bacteria 4120
736 Ga0265313_10001257 3300031595 Bacteria 24112
737 Ga0265313_10003528 3300031595 Bacteria 12614
738 Ga0265342_10000073 3300031712 Bacteria 106620
739 Ga0265342_10009074 3300031712 Bacteria 7054
740 Ga0265342_10040934 3300031712 Bacteria 2808
741 Ga0316576_10015534 3300031727 Bacteria 5114
742 Ga0307405_10019960 3300031731 Bacteria 3734
743 Ga0307410_10026531 3300031852 Bacteria 3648
744 Ga0307410_10066189 3300031852 Bacteria 2488
745 Ga0307406_10029752 3300031901 Bacteria 3309
746 Ga0307406_10168645 3300031901 Bacteria 1582
747 Ga0307407_10021394 3300031903 Bacteria 3334
748 Ga0307412_10040789 3300031911 Bacteria 3005
749 Ga0307409_100019041 3300031995 Bacteria 4636
750 Ga0307409_100095948 3300031995 Bacteria 2445
751 Ga0307416_100023574 3300032002 Bacteria 4469
752 Ga0307416_100082199 3300032002 Bacteria 2727
753 Ga0307416_100160768 3300032002 Bacteria 2076
754 Ga0307414_10247468 3300032004 Bacteria 1480
755 Ga0307415_100051270 3300032126 Bacteria 2799
756 Ga0307507_10129986 3300033179 Bacteria 1975
757 Ga0373930_0000010 3300034816 Bacteria 18514
758 Ga0373948_0000347 3300034817 Bacteria 5674
759 Ga0373950_0000467 3300034818 Bacteria 4931
760 Ga0373950_0003032 3300034818 Bacteria 2371
761 Ga0373958_0000061 3300034819 Bacteria 10881
762 Ga0373958_0005019 3300034819 Bacteria 1988
763 Ga0373959_0000871 3300034820 Bacteria 5106
764 Ga0373938_0000560 3300034957 Bacteria 6004
765 Ga0373938_0002538 3300034957 Bacteria 2946
766 Ga0373926_0005228 3300035083 Bacteria 4272
767 Ga0373926_0005557 3300035083 Bacteria 4158
768 Ga0373928_0002808 3300035084 Bacteria 3355
769 Ga0373928_0003542 3300035084 Bacteria 2978
770 Ga0373929_0000614 3300035085 Bacteria 6879
771 Ga0373934_0073574 3300035086 Bacteria 1368
772 Ga0373944_0000336 3300035089 Bacteria 10577
773 Ga0373944_0002458 3300035089 Bacteria 4706
774 Ga0373944_0010703 3300035089 Bacteria 2504
775 Ga0373944_0024972 3300035089 Bacteria 1756
776 Ga0373949_0000774 3300035090 Bacteria 10301
777 Ga0373949_0000971 3300035090 Bacteria 8901
778 Ga0373949_0002002 3300035090 Bacteria 5449
779 Ga0373951_0001322 3300035091 Bacteria 6536
780 Ga0373951_0001560 3300035091 Bacteria 6000
781 Ga0373951_0003392 3300035091 Bacteria 3874
782 Ga0373952_0000183 3300035092 Bacteria 9754
783 Ga0373952_0001726 3300035092 Bacteria 3973
784 Ga0373952_0003168 3300035092 Bacteria 2962
785 Ga0373923_0002037 3300035111 Bacteria 6091
786 Ga0373923_0003361 3300035111 Bacteria 5116
787 Ga0373932_0000029 3300035112 Bacteria 39605
788 Ga0373936_0003948 3300035113 Bacteria 5590
789 Ga0373936_0020990 3300035113 Bacteria 2539
790 Ga0373936_0026798 3300035113 Unclassified 2259
791 Ga0373939_0001168 3300035114 Bacteria 6431
792 Ga0373939_0001837 3300035114 Bacteria 5105
793 Ga0373939_0003700 3300035114 Bacteria 3600
794 Ga0373939_0003811 3300035114 Bacteria 3554
795 Ga0373939_0014559 3300035114 Bacteria 2043
796 Ga0373941_0002059 3300035115 Bacteria 4360
797 Ga0373941_0004243 3300035115 Bacteria 3296
798 Ga0373945_0002929 3300035116 Bacteria 5363
799 Ga0373945_0023460 3300035116 Bacteria 2131
800 Ga0373953_0000827 3300035117 Bacteria 8650
801 Ga0373953_0011278 3300035117 Bacteria 3133
802 Ga0373954_0010191 3300035118 Bacteria 4143
803 Ga0373954_0010455 3300035118 Bacteria 4097
804 Ga0373954_0031293 3300035118 Bacteria 2456
805 Ga0373954_0045073 3300035118 Bacteria 2059
806 Ga0373956_0021791 3300035119 Bacteria 2735
807 Ga0373957_0004933 3300035120 Bacteria 4104
808 Ga0373957_0043408 3300035120 Bacteria 1699
809 Ga0373957_0047469 3300035120 Bacteria 1633
810 Ga0373960_0000286 3300035121 Bacteria 9632
811 Ga0373960_0000460 3300035121 Bacteria 8020
812 Ga0373960_0002480 3300035121 Bacteria 4147
813 Ga0373943_0000208 3300035170 Bacteria 24045
814 Ga0373943_0004919 3300035170 Bacteria 6036
815 Ga0373943_0062573 3300035170 Bacteria 1863
816 Ga0373946_0006762 3300035171 Bacteria 4166
817 Ga0373946_0012293 3300035171 Bacteria 3202
818 Ga0373946_0038268 3300035171 Bacteria 1953
819 Ga0373955_0003607 3300035172 Bacteria 6807
820 Ga0373955_0009876 3300035172 Bacteria 4489
821 Ga0373955_0012269 3300035172 Bacteria 4116
822 Ga0373955_0012943 3300035172 Bacteria 4022
823 Ga0373955_0027626 3300035172 Bacteria 2935
824 Ga0373955_0092178 3300035172 Bacteria 1728
825 Ga0373942_0011455 3300035207 Bacteria 2103
826 Ga0373961_0008183 3300035241 Bacteria 2541
827 Ga0373962_0001597 3300035242 Bacteria 5377
828 Ga0373962_0006046 3300035242 Bacteria 2924
829 Ga0373962_0006897 3300035242 Bacteria 2765
830 Ga0316574_0000190 3300035398 Bacteria 21103
831 Ga0373924_0003276 3300035410 Bacteria 5544
832 Ga0373931_0001100 3300035691 Bacteria 11473
833 Ga0373931_0001939 3300035691 Bacteria 9066
834 Ga0373931_0002925 3300035691 Bacteria 7621
835 Ga0373931_0005699 3300035691 Bacteria 5785
836 Ga0373931_0012727 3300035691 Bacteria 4082
837 Ga0373931_0022590 3300035691 Bacteria 3167
838 Ga0373935_0000053 3300035692 Bacteria 46838
839 Ga0373935_0143199 3300035692 Bacteria 1616
840 Ga0373927_0005604 3300035695 Bacteria 8629
841 Ga0373927_0006191 3300035695 Bacteria 8171
842 Ga0373927_0019402 3300035695 Bacteria 4459
843 Ga0373927_0024353 3300035695 Bacteria 3960
844 Ga0373933_0005092 3300035724 Bacteria 7168
845 Ga0373933_0009842 3300035724 Bacteria 5231
846 Ga0373933_0031740 3300035724 Bacteria 3065
847 Ga0373933_0035823 3300035724 Bacteria 2901
848 Ga0373933_0074822 3300035724 Bacteria 2066
849 Ga0373933_0083486 3300035724 Bacteria 1962
850 Ga0373933_0174652 3300035724 Bacteria 1368
851 Ga0373947_0000828 3300035725 Bacteria 18664
852 Ga0373947_0001419 3300035725 Bacteria 14754
853 Ga0373947_0002816 3300035725 Bacteria 10397
854 Ga0373937_0000030 3300036401 Bacteria 122176
855 Ga0373937_0002800 3300036401 Bacteria 14571
856 Ga0373937_0005051 3300036401 Bacteria 11234
857 Ga0373937_0009617 3300036401 Bacteria 8417
858 Ga0373937_0020811 3300036401 Bacteria 5885
859 Ga0373937_0031458 3300036401 Bacteria 4809
860 Ga0373937_0043449 3300036401 Bacteria 4103
861 Ga0373937_0045928 3300036401 Bacteria 3992
862 Ga0373937_0267342 3300036401 Bacteria 1613
863 Ga0373925_0000002 3300037068 Bacteria 368879
864 Ga0373925_0001482 3300037068 Bacteria 20154
865 Ga0373925_0002517 3300037068 Bacteria 14636
866 Ga0373925_0007213 3300037068 Bacteria 8125
867 Ga0373925_0040153 3300037068 Bacteria 3463
868 Ga0373925_0047998 3300037068 Bacteria 3180
869 Ga0373925_0059697 3300037068 Bacteria 2861
870 Ga0373925_0072286 3300037068 Bacteria 2610
871 Ga0373925_0183188 3300037068 Bacteria 1659
872 Ga0395899_0012752 3300037312 Bacteria 6440
873 Ga0395900_0005902 3300037418 Bacteria 12789
874 Ga0395898_0004247 3300037466 Bacteria 15708
875 Ga0436364_0146559 3300037853 Bacteria 1278
876 Ga0436364_0346617 3300037853 Bacteria 24321
877 Ga0436364_0875825 3300037853 Bacteria 32110
878 Ga0436364_1179061 3300037853 Bacteria 2164
879 Ga0395901_0074958 3300038443 Bacteria 3529
880 Ga0436365_0042743 3300039437 Bacteria 2739
881 Ga0436365_0230544 3300039437 Bacteria 1874
882 Ga0436365_1613453 3300039437 Bacteria 24235
883 Ga0436360_0669824 3300039438 Bacteria 5067
884 Ga0436360_1310548 3300039438 Bacteria 8456
885 Ga0436361_0649288 3300039447 Bacteria 1360
886 Ga0436363_1075117 3300039450 Bacteria 3257
887 Ga0436362_0143155 3300039453 Bacteria 1380
888 Ga0436362_0214463 3300039453 Bacteria 12400
889 Ga0439453_0005243 3300041408 Bacteria 1967
890 Ga0439453_0019158 3300041408 Bacteria 1216
891 Ga0439448_0014430 3300042005 Bacteria 2382
892 Ga0439450_003822 3300042008 Bacteria 2524
893 Ga0451577_0055364 3300042876 Bacteria 3540
894 Ga0451577_0161116 3300042876 Bacteria 2020
895 Ga0466963_0000251 3300044694 Bacteria 23541
896 Ga0466963_0079248 3300044694 Bacteria 2222
897 Ga0466963_0117919 3300044694 Bacteria 1825
898 Ga0453684_0174128 3300044712 Bacteria 2533
899 Ga0466971_0034544 3300044719 Bacteria 2266
900 Ga0466957_0010694 3300044842 Bacteria 5276
901 Ga0466957_0050636 3300044842 Bacteria 2527
902 Ga0466957_0184933 3300044842 Bacteria 1362
903 Ga0466960_0044701 3300044901 Bacteria 2113
904 Ga0451576_0064133 3300045051 Bacteria 3827
905 Ga0466958_0018514 3300045836 Bacteria 4043
906 Ga0466967_0000282 3300045976 Bacteria 22536
907 Ga0466967_0002394 3300045976 Bacteria 11635
908 Ga0495617_008981 3300046452 Bacteria 3439
909 Ga0495617_020387 3300046452 Bacteria 2241
910 Ga0495592_0000046 3300046454 Bacteria 117345
911 Ga0495592_0062601 3300046454 Bacteria 2731
912 Ga0495603_0027302 3300046455 Bacteria 3446
913 Ga0495603_0029965 3300046455 Bacteria 3279
914 Ga0495603_0033820 3300046455 Bacteria 3075
915 Ga0495629_0001432 3300046459 Bacteria 18810
916 Ga0495629_0007816 3300046459 Bacteria 7866
917 Ga0495629_0098447 3300046459 Bacteria 2040
918 Ga0495629_0152256 3300046459 Bacteria 1607
919 Ga0495629_0152922 3300046459 Bacteria 1603
920 Ga0495641_0006021 3300046461 Bacteria 7982
921 Ga0495641_0019148 3300046461 Bacteria 3512
922 Ga0495651_0003743 3300046462 Bacteria 11639
923 Ga0495651_0017511 3300046462 Bacteria 5550
924 Ga0495651_0042983 3300046462 Bacteria 3506
925 Ga0495651_0165244 3300046462 Bacteria 1581
926 Ga0495653_0000006 3300046463 Bacteria 363285
927 Ga0495653_0002496 3300046463 Bacteria 14645
928 Ga0495653_0009473 3300046463 Bacteria 7971
929 Ga0495653_0011016 3300046463 Bacteria 7394
930 Ga0495580_0062016 3300046472 Bacteria 2624
931 Ga0495580_0091021 3300046472 Bacteria 2123
932 Ga0495580_0128713 3300046472 Bacteria 1757
933 Ga0495580_0167173 3300046472 Bacteria 1521
934 Ga0495582_0008968 3300046473 Bacteria 5518
935 Ga0495582_0012312 3300046473 Bacteria 4712
936 Ga0495582_0038395 3300046473 Bacteria 2635
937 Ga0495582_0041558 3300046473 Bacteria 2533
938 Ga0495605_0084584 3300046474 Bacteria 1479
939 Ga0495639_0008239 3300046475 Bacteria 4476
940 Ga0495639_0053477 3300046475 Bacteria 1840
941 Ga0495639_0074337 3300046475 Bacteria 1574
942 Ga0495662_0002559 3300046476 Bacteria 9184
943 Ga0495662_0019079 3300046476 Bacteria 3318
944 Ga0495662_0056650 3300046476 Bacteria 1893
945 Ga0495664_0000002 3300046477 Bacteria 625183
946 Ga0495664_0006418 3300046477 Bacteria 6493
947 Ga0495664_0010291 3300046477 Bacteria 5247
948 Ga0495584_0030822 3300046491 Bacteria 2716
949 Ga0495584_0039135 3300046491 Bacteria 2396
950 Ga0495584_0044409 3300046491 Bacteria 2243
951 Ga0495585_0001626 3300046492 Bacteria 17250
952 Ga0495585_0047972 3300046492 Bacteria 2376
953 Ga0495596_0073078 3300046500 Bacteria 1332
954 Ga0495608_0000006 3300046511 Bacteria 324334
955 Ga0495608_0009086 3300046511 Bacteria 6949
956 Ga0495608_0025821 3300046511 Bacteria 4009
957 Ga0495608_0063758 3300046511 Bacteria 2417
958 Ga0495618_0000282 3300046514 Bacteria 36848
959 Ga0495618_0006484 3300046514 Bacteria 7105
960 Ga0495618_0041757 3300046514 Bacteria 2889
961 Ga0495618_0044406 3300046514 Bacteria 2803
962 Ga0495618_0046707 3300046514 Bacteria 2733
963 Ga0495628_0000002 3300046516 Bacteria 589399
964 Ga0495628_0010231 3300046516 Bacteria 7980
965 Ga0495628_0038927 3300046516 Bacteria 3804
966 Ga0495630_0040689 3300046517 Bacteria 3473
967 Ga0495630_0102908 3300046517 Bacteria 2161
968 Ga0495630_0129088 3300046517 Bacteria 1919
969 Ga0495630_0256187 3300046517 Bacteria 1337
970 Ga0495632_0087319 3300046519 Bacteria 1483
971 Ga0495637_0046789 3300046520 Bacteria 1829
972 Ga0495644_0003879 3300046523 Bacteria 5886
973 Ga0495663_0002724 3300046525 Bacteria 5239
974 Ga0495666_0005027 3300046526 Bacteria 6691
975 Ga0495666_0016921 3300046526 Bacteria 3630
976 Ga0495666_0059989 3300046526 Bacteria 1819
977 Ga0495642_0046584 3300046528 Bacteria 1774
978 Ga0495652_0000004 3300046529 Bacteria 588877
979 Ga0495665_0018021 3300046531 Bacteria 3795
980 Ga0495665_0021287 3300046531 Bacteria 3483
981 Ga0495665_0034925 3300046531 Bacteria 2688
982 Ga0495640_0000007 3300046533 Bacteria 265481
983 Ga0495640_0010918 3300046533 Bacteria 7000
984 Ga0495640_0015636 3300046533 Bacteria 5703
985 Ga0495640_0030990 3300046533 Bacteria 3822
986 Ga0495640_0113213 3300046533 Bacteria 1770
987 Ga0495586_0021860 3300046535 Bacteria 3414
988 Ga0495586_0058892 3300046535 Bacteria 2086
989 Ga0495587_0000031 3300046536 Bacteria 126721
990 Ga0495587_0000506 3300046536 Bacteria 27235
991 Ga0495587_0011950 3300046536 Bacteria 5489
992 Ga0495587_0014386 3300046536 Bacteria 4965
993 Ga0495587_0071047 3300046536 Bacteria 2025
994 Ga0495598_0019932 3300046537 Bacteria 1764
995 Ga0495645_0000003 3300046543 Bacteria 570133
996 Ga0495645_0042265 3300046543 Bacteria 3323
997 Ga0495645_0046452 3300046543 Bacteria 3165
998 Ga0495622_0001095 3300046557 Bacteria 14157
999 Ga0495633_0003560 3300046558 Bacteria 10301
1000 Ga0495667_0000002 3300046559 Bacteria 437535
1001 Ga0495667_0005439 3300046559 Bacteria 8603
1002 Ga0495667_0006498 3300046559 Bacteria 7936
1003 Ga0495667_0013469 3300046559 Bacteria 5536
1004 Ga0495667_0082087 3300046559 Bacteria 2095
1005 Ga0495656_0000519 3300046615 Bacteria 12564
1006 Ga0495656_0010029 3300046615 Bacteria 3430
1007 Ga0495634_0000110 3300046642 Bacteria 68101
1008 Ga0495634_0006515 3300046642 Bacteria 8866
1009 Ga0495634_0007380 3300046642 Bacteria 8271
1010 Ga0495634_0026402 3300046642 Bacteria 4053
1011 Ga0495634_0083591 3300046642 Bacteria 2083
1012 Ga0495634_0172370 3300046642 Bacteria 1359
1013 Ga0495635_0000022 3300046663 Bacteria 160907
1014 Ga0495635_0007866 3300046663 Bacteria 7445
1015 Ga0495635_0015292 3300046663 Bacteria 5367
1016 Ga0495635_0030948 3300046663 Bacteria 3717
1017 Ga0495635_0085236 3300046663 Bacteria 2161
1018 Ga0495635_0157225 3300046663 Bacteria 1547
1019 Ga0495659_0002230 3300046664 Bacteria 6299
1020 Ga0495661_0094460 3300046665 Bacteria 1695
1021 Ga0495588_0006673 3300046674 Bacteria 5213
1022 Ga0495588_0029129 3300046674 Bacteria 2768
1023 Ga0495588_0046906 3300046674 Bacteria 2217
1024 Ga0495588_0129784 3300046674 Bacteria 1329
1025 Ga0495657_0000276 3300046675 Bacteria 46295
1026 Ga0495657_0018501 3300046675 Bacteria 5038
1027 Ga0495657_0027977 3300046675 Bacteria 3969
1028 Ga0495657_0096978 3300046675 Bacteria 1883
1029 Ga0495599_0000001 3300046678 Bacteria 537563
1030 Ga0495599_0005246 3300046678 Bacteria 7730
1031 Ga0495599_0024663 3300046678 Bacteria 3761
1032 Ga0495599_0039264 3300046678 Bacteria 2974
1033 Ga0495599_0164780 3300046678 Bacteria 1369
1034 Ga0495623_0000094 3300046679 Bacteria 53328
1035 Ga0495623_0003225 3300046679 Bacteria 10770
1036 Ga0495623_0010464 3300046679 Bacteria 6005
1037 Ga0495623_0026492 3300046679 Bacteria 3732
1038 Ga0495646_0000007 3300046680 Bacteria 236764
1039 Ga0495646_0003643 3300046680 Bacteria 9607
1040 Ga0495646_0009489 3300046680 Bacteria 6177
1041 Ga0495646_0010180 3300046680 Bacteria 5977
1042 Ga0495647_0006912 3300046681 Bacteria 3777
1043 Ga0495647_0027746 3300046681 Bacteria 2082
1044 Ga0495658_0000259 3300046683 Bacteria 29955
1045 Ga0495658_0005362 3300046683 Bacteria 6307
1046 Ga0495658_0021561 3300046683 Bacteria 3397
1047 Ga0495658_0043719 3300046683 Bacteria 2507
1048 Ga0495669_0056271 3300046684 Bacteria 1773
1049 Ga0495613_0003145 3300046689 Bacteria 12365
1050 Ga0495613_0058212 3300046689 Bacteria 2837
1051 Ga0495613_0070264 3300046689 Bacteria 2553
1052 Ga0495613_0082388 3300046689 Bacteria 2336
1053 Ga0495624_0029594 3300046690 Bacteria 3572
1054 Ga0495670_0004031 3300046691 Bacteria 7203
1055 Ga0495670_0019915 3300046691 Bacteria 3306
1056 Ga0495600_0000033 3300046809 Bacteria 83590
1057 Ga0495600_0001615 3300046809 Bacteria 12569
1058 Ga0495600_0006006 3300046809 Bacteria 7351
1059 Ga0495600_0028026 3300046809 Bacteria 3643
1060 Ga0495600_0035531 3300046809 Bacteria 3237
1061 Ga0495581_0007026 3300047315 Bacteria 6524
1062 Ga0495581_0021213 3300047315 Bacteria 3767
1063 Ga0495581_0053391 3300047315 Bacteria 2334
1064 Ga0495581_0117695 3300047315 Bacteria 1545
1065 Ga0495604_0000005 3300047317 Bacteria 424516
1066 Ga0495604_0000765 3300047317 Bacteria 27080
1067 Ga0495604_0003474 3300047317 Bacteria 12561
1068 Ga0495604_0031190 3300047317 Bacteria 4229
1069 Ga0495674_0000003 3300047319 Bacteria 562126
1070 Ga0495674_0008389 3300047319 Bacteria 9846
1071 Ga0495674_0036288 3300047319 Bacteria 4438
1072 Ga0495674_0066567 3300047319 Bacteria 3125
1073 Ga0495672_0043636 3300047320 Bacteria 2695
1074 Ga0495676_0025340 3300047321 Bacteria 5122
1075 Ga0495676_0072883 3300047321 Bacteria 2635
1076 Ga0495680_0000091 3300047322 Bacteria 81622
1077 Ga0495680_0001188 3300047322 Bacteria 28564
1078 Ga0495680_0004407 3300047322 Bacteria 13471
1079 Ga0495680_0016535 3300047322 Bacteria 6333
1080 Ga0495675_0000064 3300047444 Bacteria 74132
1081 Ga0495675_0001145 3300047444 Bacteria 16119
1082 Ga0495675_0021391 3300047444 Bacteria 4118
1083 Ga0495675_0086750 3300047444 Bacteria 1967
1084 Ga0495677_0013508 3300047445 Bacteria 2973
1085 Ga0495679_007558 3300047446 Bacteria 4515
1086 Ga0495679_023794 3300047446 Bacteria 2073
1087 Ga0495684_0000035 3300047471 Bacteria 107768
1088 Ga0495684_0003642 3300047471 Bacteria 12000
1089 Ga0495684_0023296 3300047471 Bacteria 4761
1090 Ga0495684_0026702 3300047471 Bacteria 4437
1091 Ga0495593_0000184 3300047673 Bacteria 32427
1092 Ga0495593_0006926 3300047673 Bacteria 6638
1093 Ga0495593_0007999 3300047673 Bacteria 6154
1094 Ga0495593_0011406 3300047673 Bacteria 5106
1095 Ga0495593_0027345 3300047673 Bacteria 3141
1096 Ga0495593_0045992 3300047673 Bacteria 2327
1097 Ga0495602_0000029 3300048088 Bacteria 142344
1098 Ga0495602_0016494 3300048088 Bacteria 7428
1099 Ga0495602_0044603 3300048088 Bacteria 4021
1100 Ga0495614_0003010 3300048089 Bacteria 7508
1101 Ga0496100_0000806 3300048903 Bacteria 15000
1102 Ga0496100_0012562 3300048903 Bacteria 4858
1103 Ga0496100_0040648 3300048903 Bacteria 2960
1104 Ga0496101_0000218 3300048904 Bacteria 42932
1105 Ga0496101_0002910 3300048904 Bacteria 10536
1106 Ga0496101_0003293 3300048904 Bacteria 10047
1107 Ga0496101_0016402 3300048904 Bacteria 5004
1108 Ga0496101_0039856 3300048904 Bacteria 3343
1109 Ga0496101_0086477 3300048904 Bacteria 2325
1110 Ga0496101_0090255 3300048904 Bacteria 2279
1111 Ga0496101_0091091 3300048904 Bacteria 2269
1112 Ga0496101_0167185 3300048904 Bacteria 1689
1113 Ga0496102_0004765 3300048905 Bacteria 11475
1114 Ga0496102_0007777 3300048905 Bacteria 9160
1115 Ga0496102_0015343 3300048905 Bacteria 6672
1116 Ga0496102_0015827 3300048905 Bacteria 6575
1117 Ga0496102_0023317 3300048905 Bacteria 5495
1118 Ga0496102_0047952 3300048905 Bacteria 3884
1119 Ga0496102_0228215 3300048905 Bacteria 1755
1120 Ga0496103_0019951 3300048906 Bacteria 4025
1121 Ga0496103_0051376 3300048906 Bacteria 2551
1122 Ga0496103_0055446 3300048906 Bacteria 2458
1123 Ga0496103_0070640 3300048906 Bacteria 2184
1124 Ga0496104_0000517 3300048907 Bacteria 33033
1125 Ga0496104_0000660 3300048907 Bacteria 29613
1126 Ga0496104_0000706 3300048907 Bacteria 28670
1127 Ga0496104_0002368 3300048907 Bacteria 16269
1128 Ga0496104_0005612 3300048907 Bacteria 10984
1129 Ga0496104_0007271 3300048907 Bacteria 9771
1130 Ga0496104_0041980 3300048907 Bacteria 4290
1131 Ga0496104_0060588 3300048907 Bacteria 3585
1132 Ga0496104_0105624 3300048907 Bacteria 2698
1133 Ga0496105_0002363 3300048908 Bacteria 13671
1134 Ga0496105_0004861 3300048908 Bacteria 10144
1135 Ga0496105_0028772 3300048908 Bacteria 4546
1136 Ga0496105_0034800 3300048908 Bacteria 4144
1137 Ga0496105_0107773 3300048908 Bacteria 2300
1138 Ga0496105_0146188 3300048908 Bacteria 1944
1139 Ga0496106_0000782 3300048909 Bacteria 22988
1140 Ga0496106_0003379 3300048909 Bacteria 11889
1141 Ga0496106_0004371 3300048909 Bacteria 10498
1142 Ga0496106_0014196 3300048909 Bacteria 5882
1143 Ga0496106_0044595 3300048909 Bacteria 3329
1144 Ga0496106_0078758 3300048909 Bacteria 2529
1145 Ga0496106_0088225 3300048909 Bacteria 2391
1146 Ga0496106_0092108 3300048909 Bacteria 2341
1147 Ga0496107_0003226 3300048910 Bacteria 10857
1148 Ga0496107_0005153 3300048910 Bacteria 8919
1149 Ga0496107_0006743 3300048910 Bacteria 7902
1150 Ga0496107_0023538 3300048910 Bacteria 4355
1151 Ga0496107_0038390 3300048910 Bacteria 3435
1152 Ga0496107_0172834 3300048910 Bacteria 1603
1153 Ga0496107_0195668 3300048910 Bacteria 1502
1154 Ga0496108_0003546 3300048911 Bacteria 12514
1155 Ga0496108_0019413 3300048911 Bacteria 5582
1156 Ga0496108_0021647 3300048911 Bacteria 5284
1157 Ga0496108_0034889 3300048911 Bacteria 4180
1158 Ga0496108_0082432 3300048911 Bacteria 2727
1159 Ga0496108_0131651 3300048911 Bacteria 2150
1160 Ga0496108_0211088 3300048911 Bacteria 1685
1161 Ga0496109_0000536 3300048912 Bacteria 32149
1162 Ga0496109_0000979 3300048912 Bacteria 23633
1163 Ga0496109_0014375 3300048912 Bacteria 6888
1164 Ga0496109_0032080 3300048912 Bacteria 4719
1165 Ga0496109_0080116 3300048912 Bacteria 3009
1166 Ga0496109_0148181 3300048912 Bacteria 2196
1167 Ga0496109_0215938 3300048912 Bacteria 1803
1168 Ga0496110_0003688 3300048913 Bacteria 11788
1169 Ga0496110_0023709 3300048913 Bacteria 5221
1170 Ga0496110_0027734 3300048913 Bacteria 4857
1171 Ga0496110_0048608 3300048913 Bacteria 3719
1172 Ga0496110_0097052 3300048913 Bacteria 2641
1173 Ga0496110_0122539 3300048913 Bacteria 2343
1174 Ga0496110_0140256 3300048913 Bacteria 2185
1175 Ga0496110_0190825 3300048913 Bacteria 1861
1176 Ga0496111_0001920 3300048914 Bacteria 12289
1177 Ga0496111_0012142 3300048914 Bacteria 5825
1178 Ga0496111_0021812 3300048914 Bacteria 4475
1179 Ga0496111_0042289 3300048914 Bacteria 3271
1180 Ga0496111_0099993 3300048914 Bacteria 2130
1181 Ga0496111_0242731 3300048914 Bacteria 1337
1182 Ga0496112_0000321 3300048915 Bacteria 30822
1183 Ga0496112_0001698 3300048915 Bacteria 17181
1184 Ga0496112_0067075 3300048915 Bacteria 3541
1185 Ga0496112_0083087 3300048915 Bacteria 3167
1186 Ga0496112_0256064 3300048915 Bacteria 1700
1187 Ga0496113_0031501 3300048916 Bacteria 3849
1188 Ga0496113_0060009 3300048916 Bacteria 2866
1189 Ga0496113_0063469 3300048916 Bacteria 2791
1190 Ga0496113_0097501 3300048916 Bacteria 2274
1191 Ga0496113_0108354 3300048916 Bacteria 2159
1192 Ga0496113_0293783 3300048916 Bacteria 1300
1193 Ga0496113_0295293 3300048916 Bacteria 1297
1194 Ga0496114_0001562 3300048917 Bacteria 17391
1195 Ga0496114_0005533 3300048917 Bacteria 9897
1196 Ga0496114_0009873 3300048917 Bacteria 7585
1197 Ga0496114_0056934 3300048917 Bacteria 3263
1198 Ga0496114_0104640 3300048917 Bacteria 2420
1199 Ga0496114_0199157 3300048917 Bacteria 1754
1200 Ga0496114_0304461 3300048917 Bacteria 1407
1201 Ga0496115_0004506 3300048918 Bacteria 10077
1202 Ga0496115_0005696 3300048918 Bacteria 9065
1203 Ga0496115_0005759 3300048918 Bacteria 9025
1204 Ga0496115_0021040 3300048918 Bacteria 5034
1205 Ga0496115_0074121 3300048918 Bacteria 2764
1206 Ga0496126_0048559 3300048929 Bacteria 3877
1207 Ga0501031_0001202 3300049568 Bacteria 15788
1208 Ga0501031_0011500 3300049568 Bacteria 5769
1209 Ga0501031_0094907 3300049568 Bacteria 1946
1210 Ga0501032_0019895 3300049569 Bacteria 4686
1211 Ga0501032_0034352 3300049569 Bacteria 3472
1212 Ga0501032_0043536 3300049569 Bacteria 3040
1213 Ga0501032_0049720 3300049569 Bacteria 2829
1214 Ga0501032_0073913 3300049569 Bacteria 2271
1215 Ga0501033_0012124 3300049570 Bacteria 6580
1216 Ga0501033_0033225 3300049570 Bacteria 3874
1217 Ga0501033_0101440 3300049570 Bacteria 2099
1218 Ga0501034_0001160 3300049571 Bacteria 36511
1219 Ga0501034_0003982 3300049571 Bacteria 16597
1220 Ga0501034_0021741 3300049571 Bacteria 6536
1221 Ga0501034_0041922 3300049571 Bacteria 4631
1222 Ga0501034_0135610 3300049571 Bacteria 2442
1223 Ga0501034_0217262 3300049571 Bacteria 1865
1224 Ga0501036_0000559 3300049572 Bacteria 26726
1225 Ga0501036_0003666 3300049572 Bacteria 12287
1226 Ga0501036_0044597 3300049572 Bacteria 3756
1227 Ga0501036_0066519 3300049572 Bacteria 3049
1228 Ga0501037_0004499 3300049573 Bacteria 10135
1229 Ga0501037_0027932 3300049573 Bacteria 4169
1230 Ga0501037_0031175 3300049573 Bacteria 3937
1231 Ga0501037_0043514 3300049573 Bacteria 3300
1232 Ga0501037_0109799 3300049573 Bacteria 1987
1233 Ga0501038_0026060 3300049574 Bacteria 5207
1234 Ga0501038_0063211 3300049574 Bacteria 3160
1235 Ga0501038_0108113 3300049574 Bacteria 2306
1236 Ga0501038_0194284 3300049574 Bacteria 1632
1237 Ga0501039_0029646 3300049575 Bacteria 4214
1238 Ga0501039_0037427 3300049575 Bacteria 3744
1239 Ga0501039_0114239 3300049575 Bacteria 2112
1240 Ga0501039_0205368 3300049575 Bacteria 1549
1241 Ga0501041_0007568 3300049577 Bacteria 6378
1242 Ga0501042_0046377 3300049578 Bacteria 3098
1243 Ga0501042_0086589 3300049578 Bacteria 2247
1244 Ga0501043_0008361 3300049579 Bacteria 8146
1245 Ga0501043_0028734 3300049579 Bacteria 4365
1246 Ga0501046_0023588 3300049580 Bacteria 5058
1247 Ga0501046_0024861 3300049580 Bacteria 4907
1248 Ga0501046_0129586 3300049580 Bacteria 1914
1249 Ga0501047_0000204 3300049581 Bacteria 71976
1250 Ga0501047_0005615 3300049581 Bacteria 11817
1251 Ga0501047_0018944 3300049581 Bacteria 6601
1252 Ga0501047_0043869 3300049581 Bacteria 4319
1253 Ga0501047_0069777 3300049581 Bacteria 3383
1254 Ga0501048_0000151 3300049582 Bacteria 42561
1255 Ga0501048_0061371 3300049582 Bacteria 2662
1256 Ga0501067_0025881 3300049583 Bacteria 3251
1257 Ga0501067_0029564 3300049583 Bacteria 3037
1258 Ga0501068_0052822 3300049584 Bacteria 2459
1259 Ga0501068_0158117 3300049584 Bacteria 1427
1260 Ga0501069_0017483 3300049585 Bacteria 3860
1261 Ga0501069_0020685 3300049585 Bacteria 3567
1262 Ga0501070_0003185 3300049586 Bacteria 14271
1263 Ga0501070_0006950 3300049586 Bacteria 9627
1264 Ga0501070_0017459 3300049586 Bacteria 6025
1265 Ga0501070_0052623 3300049586 Bacteria 3379
1266 Ga0501070_0059319 3300049586 Bacteria 3172
1267 Ga0501070_0070519 3300049586 Bacteria 2894
1268 Ga0501071_0059445 3300049587 Bacteria 2766
1269 Ga0501071_0064805 3300049587 Bacteria 2652
1270 Ga0501071_0155261 3300049587 Bacteria 1709
1271 Ga0501072_0020836 3300049588 Bacteria 5081
1272 Ga0501072_0101263 3300049588 Bacteria 2290
1273 Ga0501072_0127252 3300049588 Bacteria 2030
1274 Ga0501073_0012459 3300049589 Bacteria 6204
1275 Ga0501073_0029438 3300049589 Bacteria 3924
1276 Ga0501073_0035382 3300049589 Bacteria 3551
1277 Ga0501073_0092775 3300049589 Bacteria 2098
1278 Ga0501073_0093585 3300049589 Bacteria 2088
1279 Ga0501073_0115259 3300049589 Bacteria 1863
1280 Ga0501074_0019276 3300049590 Bacteria 4955
1281 Ga0501074_0036306 3300049590 Bacteria 3570
1282 Ga0501075_0000272 3300049591 Bacteria 28414
1283 Ga0501075_0018301 3300049591 Bacteria 5069
1284 Ga0501075_0043318 3300049591 Bacteria 3376
1285 Ga0501075_0164669 3300049591 Bacteria 1692
1286 Ga0501075_0176230 3300049591 Bacteria 1631
1287 Ga0501076_0012931 3300049592 Bacteria 6248
1288 Ga0501076_0076995 3300049592 Bacteria 2675
1289 Ga0501077_0033445 3300049593 Bacteria 3272
1290 Ga0501077_0125474 3300049593 Bacteria 1627
1291 Ga0501079_0002303 3300049741 Bacteria 13814
1292 Ga0501079_0002659 3300049741 Bacteria 12995
1293 Ga0501079_0191876 3300049741 Bacteria 1594
1294 Ga0501080_0000130 3300049742 Bacteria 53465
1295 Ga0501080_0007120 3300049742 Bacteria 10099
1296 Ga0501080_0021308 3300049742 Bacteria 5999
1297 Ga0501080_0120018 3300049742 Bacteria 2437
1298 Ga0501080_0192597 3300049742 Bacteria 1873
1299 Ga0501080_0243335 3300049742 Bacteria 1641
1300 Ga0501080_0411683 3300049742 Bacteria 1215
1301 Ga0501080_0423439 3300049742 Bacteria 1196
1302 Ga0501081_0001663 3300049743 Bacteria 13751
1303 Ga0501081_0064826 3300049743 Bacteria 2538
1304 Ga0501083_0003052 3300049744 Bacteria 11638
1305 Ga0501083_0013834 3300049744 Bacteria 5642
1306 Ga0501083_0039248 3300049744 Bacteria 3216
1307 Ga0501083_0069582 3300049744 Bacteria 2342
1308 Ga0501035_0000127 3300049822 Bacteria 92397
1309 Ga0501035_0106131 3300049822 Bacteria 2463
1310 Ga0501035_0169531 3300049822 Bacteria 1886
1311 Ga0501044_0000636 3300049823 Bacteria 42394
1312 Ga0501044_0016835 3300049823 Bacteria 7842
1313 Ga0501044_0062299 3300049823 Bacteria 3812
1314 Ga0501044_0071364 3300049823 Bacteria 3531
1315 Ga0501044_0097252 3300049823 Bacteria 2965
1316 Ga0501044_0106918 3300049823 Bacteria 2809
1317 Ga0501045_0036508 3300049824 Bacteria 3568
1318 Ga0501045_0222231 3300049824 Bacteria 1406
1319 nmdc:mga00v17_127190_c1 3300050491 Bacteria 1627
1320 nmdc:mga0yw44_108265_c1 3300050492 Bacteria 1778
1321 nmdc:mga0yw44_11835_c1 3300050492 Bacteria 4525
1322 nmdc:mga0yw44_22213_c1 3300050492 Bacteria 3554
1323 nmdc:mga0yw44_35578_c1 3300050492 Bacteria 2928
1324 nmdc:mga0yw44_72744_c1 3300050492 Bacteria 2137
1325 nmdc:mga0k408_11450_c1 3300050493 Bacteria 4831
1326 nmdc:mga0k408_77671_c1 3300050493 Bacteria 1941
1327 nmdc:mga06z11_143962_c1 3300050494 Bacteria 1349
1328 nmdc:mga06z11_28384_c1 3300050494 Bacteria 2684
1329 nmdc:mga06z11_85837_c1 3300050494 Bacteria 1699
1330 nmdc:mga07m45_38690_c1 3300050496 Bacteria 2662
1331 nmdc:mga05p37_294830_c1 3300050507 Bacteria 1929
1332 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
1333 nmdc:mga05p37_430232_c1 3300050507 Bacteria 1533
1334 nmdc:mga05p37_46630_c1 3300050507 Bacteria 5329
1335 nmdc:mga09592_1294_c1 3300050508 Bacteria 20103
1336 nmdc:mga09592_171704_c1 3300050508 Bacteria 1875
1337 nmdc:mga0qj67_1240_c1 3300050509 Bacteria 17825
1338 nmdc:mga0qj67_18455_c1 3300050509 Bacteria 5316
1339 nmdc:mga0qj67_24480_c1 3300050509 Bacteria 4653
1340 nmdc:mga0qj67_35930_c1 3300050509 Bacteria 3875
1341 nmdc:mga0qj67_52_c1 3300050509 Bacteria 84067
1342 nmdc:mga06r32_11750_c1 3300050510 Bacteria 7884
1343 nmdc:mga06r32_181844_c1 3300050510 Bacteria 2088
1344 nmdc:mga06r32_448_c1 3300050510 Bacteria 34999
1345 nmdc:mga08y16_14061_c1 3300050511 Bacteria 8424
1346 nmdc:mga08y16_2695_c1 3300050511 Bacteria 18225
1347 nmdc:mga08y16_28906_c1 3300050511 Bacteria 5844
1348 nmdc:mga08y16_31199_c1 3300050511 Bacteria 5607
1349 nmdc:mga08y16_3376_c1 3300050511 Bacteria 16552
1350 nmdc:mga08y16_38697_c1 3300050511 Bacteria 5006
1351 nmdc:mga08y16_49648_c1 3300050511 Bacteria 4391
1352 nmdc:mga08y16_997_c1 3300050511 Bacteria 27611
1353 nmdc:mga0n895_12777_c1 3300050512 Bacteria 7541
1354 nmdc:mga0n895_145644_c1 3300050512 Bacteria 2398
1355 nmdc:mga0n895_22456_c1 3300050512 Bacteria 5916
1356 nmdc:mga0n895_275109_c1 3300050512 Bacteria 1708
1357 nmdc:mga0n895_32961_c1 3300050512 Bacteria 4975
1358 nmdc:mga0n895_3595_c1 3300050512 Bacteria 12539
1359 nmdc:mga0n895_62132_c1 3300050512 Bacteria 3690
1360 nmdc:mga0rr50_12032_c2 3300050513 Bacteria 3690
1361 nmdc:mga0rr50_20582_c1 3300050513 Bacteria 4486
1362 nmdc:mga0rr50_35994_c1 3300050513 Bacteria 3560
1363 nmdc:mga0rr50_86337_c1 3300050513 Bacteria 2434
1364 nmdc:mga0rr50_86552_c1 3300050513 Bacteria 2431
1365 nmdc:mga08x19_10775_c1 3300050514 Bacteria 5496
1366 nmdc:mga08x19_14439_c1 3300050514 Bacteria 4789
1367 nmdc:mga08x19_217506_c1 3300050514 Bacteria 1312
1368 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
1369 nmdc:mga0a205_12561_c1 3300050515 Bacteria 7839
1370 nmdc:mga0a205_211641_c1 3300050515 Bacteria 1827
1371 nmdc:mga0a205_2192_c1 3300050515 Bacteria 17192
1372 nmdc:mga0a205_80086_c1 3300050515 Bacteria 3156
1373 nmdc:mga0sz30_43842_c1 3300050516 Bacteria 1884
1374 Ga0495601_0000008 3300053077 Bacteria 362152
1375 Ga0495601_0000848 3300053077 Bacteria 16636
1376 Ga0495601_0004954 3300053077 Bacteria 7728
1377 Ga0495601_0027558 3300053077 Bacteria 3513
1378 Ga0495601_0050418 3300053077 Bacteria 2625
1379 Ga0495601_0071861 3300053077 Bacteria 2210
1380 Ga0495601_0087987 3300053077 Bacteria 1997
1381 Ga0495612_0000026 3300053078 Bacteria 111627
1382 Ga0495612_0014324 3300053078 Bacteria 3189
1383 Ga0495612_0016661 3300053078 Bacteria 2944
1384 Ga0495655_0005621 3300053083 Bacteria 2226
1385 Ga0495595_0000024 3300053084 Bacteria 108008
1386 Ga0495595_0000585 3300053084 Bacteria 13949
1387 Ga0495595_0004473 3300053084 Bacteria 5628
1388 Ga0495595_0004734 3300053084 Bacteria 5473
1389 Ga0495619_0000002 3300053085 Bacteria 530226
1390 Ga0495619_0000016 3300053085 Bacteria 231442
1391 Ga0495619_0000558 3300053085 Bacteria 24594
1392 Ga0495619_0002388 3300053085 Bacteria 12328
1393 Ga0495619_0003397 3300053085 Bacteria 10285
1394 Ga0495619_0239071 3300053085 Bacteria 1258
1395 Ga0500641_0011105 3300053096 Bacteria 3264
1396 Ga0500595_010099 3300053119 Unclassified 3769
1397 Ga0500652_003911 3300053131 Bacteria 4555
1398 Ga0500636_0075475 3300053177 Bacteria 1950
1399 Ga0500637_0001315 3300053178 Bacteria 10471
1400 Ga0500645_008618 3300053730 Bacteria 3468
1401 Ga0501084_0027196 3300054114 Bacteria 4780
1402 Ga0501084_0226950 3300054114 Bacteria 1576
1403 Ga0500661_000712 3300055283 Bacteria 6211
1404 Ga0501082_0028193 3300060353 Bacteria 4838
1405 Ga0501082_0037146 3300060353 Bacteria 4197
1406 Ga0501082_0072166 3300060353 Bacteria 2973
1407 Ga0501082_0163258 3300060353 Bacteria 1936
1408 Ga0501082_0199090 3300060353 Bacteria 1743
1409 Ga0530510_0110320 3300061734 Bacteria 2014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0087987 Ga0495601_0087987_821_1942 365
2 3300025916 Ga0207663_10144986 Ga0207663_101449861 369
3 3300050513 nmdc:mga0rr50_35994_c1 nmdc:mga0rr50_35994_c1_20_1129 369
4 3300035086 Ga0373934_0073574 Ga0373934_0073574_194_1312 372
5 3300050514 nmdc:mga08x19_10775_c1 nmdc:mga08x19_10775_c1_26_1144 372
6 3300009011 Ga0105251_10056219 Ga0105251_100562192 373
7 3300009094 Ga0111539_10002924 Ga0111539_100029244 373
8 3300009094 Ga0111539_10014188 Ga0111539_100141883 373
9 3300009098 Ga0105245_10044205 Ga0105245_100442051 373
10 3300009101 Ga0105247_10005555 Ga0105247_100055552 373
11 3300009148 Ga0105243_10033289 Ga0105243_100332891 373
12 3300009174 Ga0105241_10008748 Ga0105241_100087483 373
13 3300009176 Ga0105242_10001180 Ga0105242_100011804 373
14 3300009176 Ga0105242_10388153 Ga0105242_103881531 373
15 3300009177 Ga0105248_10007763 Ga0105248_100077632 373
16 3300009545 Ga0105237_10056155 Ga0105237_100561554 373
17 3300009545 Ga0105237_10286760 Ga0105237_102867601 373
18 3300009551 Ga0105238_10313787 Ga0105238_103137872 373
19 3300009553 Ga0105249_10037549 Ga0105249_100375491 373
20 3300009553 Ga0105249_10053893 Ga0105249_100538931 373
21 3300010375 Ga0105239_10019398 Ga0105239_100193984 373
22 3300010375 Ga0105239_10200500 Ga0105239_102005003 373
23 3300011119 Ga0105246_10001801 Ga0105246_100018012 373
24 3300012494 Ga0157341_1002376 Ga0157341_10023761 373
25 3300013104 Ga0157370_10053855 Ga0157370_100538552 373
26 3300013296 Ga0157374_10024878 Ga0157374_100248785 373
27 3300013297 Ga0157378_10007833 Ga0157378_100078333 373
28 3300013306 Ga0163162_10020177 Ga0163162_100201773 373
29 3300013306 Ga0163162_10086471 Ga0163162_100864713 373
30 3300013307 Ga0157372_10063627 Ga0157372_100636273 373
31 3300013308 Ga0157375_10013281 Ga0157375_100132814 373
32 3300014325 Ga0163163_10011096 Ga0163163_100110962 373
33 3300014325 Ga0163163_10052753 Ga0163163_100527532 373
34 3300014326 Ga0157380_10004561 Ga0157380_100045617 373
35 3300014745 Ga0157377_10007004 Ga0157377_100070044 373
36 3300014968 Ga0157379_10011946 Ga0157379_100119462 373
37 3300034816 Ga0373930_0000010 Ga0373930_0000010_3161_4282 373
38 3300034817 Ga0373948_0000347 Ga0373948_0000347_3981_5102 373
39 3300034818 Ga0373950_0000467 Ga0373950_0000467_1414_2535 373
40 3300034818 Ga0373950_0003032 Ga0373950_0003032_1203_2324 373
41 3300034819 Ga0373958_0000061 Ga0373958_0000061_3656_4777 373
42 3300034819 Ga0373958_0005019 Ga0373958_0005019_287_1408 373
43 3300034820 Ga0373959_0000871 Ga0373959_0000871_103_1224 373
44 3300034957 Ga0373938_0000560 Ga0373938_0000560_4297_5418 373
45 3300035084 Ga0373928_0002808 Ga0373928_0002808_2104_3225 373
46 3300035084 Ga0373928_0003542 Ga0373928_0003542_1725_2846 373
47 3300035085 Ga0373929_0000614 Ga0373929_0000614_4242_5363 373
48 3300035089 Ga0373944_0024972 Ga0373944_0024972_548_1669 373
49 3300035090 Ga0373949_0000774 Ga0373949_0000774_5631_6752 373
50 3300035090 Ga0373949_0000971 Ga0373949_0000971_5067_6188 373
51 3300035091 Ga0373951_0001322 Ga0373951_0001322_2174_3295 373
52 3300035091 Ga0373951_0001560 Ga0373951_0001560_413_1534 373
53 3300035092 Ga0373952_0000183 Ga0373952_0000183_4156_5277 373
54 3300035112 Ga0373932_0000029 Ga0373932_0000029_3566_4687 373
55 3300035114 Ga0373939_0001837 Ga0373939_0001837_1932_3053 373
56 3300035114 Ga0373939_0014559 Ga0373939_0014559_846_1967 373
57 3300035115 Ga0373941_0002059 Ga0373941_0002059_2338_3459 373
58 3300035120 Ga0373957_0043408 Ga0373957_0043408_393_1514 373
59 3300035121 Ga0373960_0000286 Ga0373960_0000286_2271_3392 373
60 3300035121 Ga0373960_0002480 Ga0373960_0002480_1750_2871 373
61 3300035170 Ga0373943_0062573 Ga0373943_0062573_320_1441 373
62 3300035171 Ga0373946_0012293 Ga0373946_0012293_1914_3035 373
63 3300035207 Ga0373942_0011455 Ga0373942_0011455_133_1254 373
64 3300035241 Ga0373961_0008183 Ga0373961_0008183_1295_2416 373
65 3300035242 Ga0373962_0006046 Ga0373962_0006046_1555_2676 373
66 3300035242 Ga0373962_0006897 Ga0373962_0006897_1052_2173 373
67 3300035691 Ga0373931_0002925 Ga0373931_0002925_4928_6049 373
68 3300035691 Ga0373931_0012727 Ga0373931_0012727_2060_3181 373
69 3300035695 Ga0373927_0005604 Ga0373927_0005604_454_1575 373
70 3300035724 Ga0373933_0005092 Ga0373933_0005092_5982_7103 373
71 3300035725 Ga0373947_0001419 Ga0373947_0001419_547_1668 373
72 3300036401 Ga0373937_0043449 Ga0373937_0043449_2123_3244 373
73 3300037068 Ga0373925_0002517 Ga0373925_0002517_1367_2488 373
74 3300037068 Ga0373925_0183188 Ga0373925_0183188_476_1606 373
75 3300041408 Ga0439453_0019158 Ga0439453_0019158_81_1202 373
76 3300042008 Ga0439450_003822 Ga0439450_003822_223_1344 373
77 3300042876 Ga0451577_0055364 Ga0451577_0055364_926_2047 373
78 3300044712 Ga0453684_0174128 Ga0453684_0174128_141_1262 373
79 3300045051 Ga0451576_0064133 Ga0451576_0064133_2052_3173 373
80 3300046455 Ga0495603_0033820 Ga0495603_0033820_1915_3036 373
81 3300046459 Ga0495629_0001432 Ga0495629_0001432_598_1719 373
82 3300046461 Ga0495641_0019148 Ga0495641_0019148_2109_3230 373
83 3300046473 Ga0495582_0012312 Ga0495582_0012312_232_1353 373
84 3300046500 Ga0495596_0073078 Ga0495596_0073078_186_1307 373
85 3300046514 Ga0495618_0044406 Ga0495618_0044406_1592_2713 373
86 3300046663 Ga0495635_0085236 Ga0495635_0085236_1025_2146 373
87 3300046674 Ga0495588_0046906 Ga0495588_0046906_560_1681 373
88 3300046683 Ga0495658_0000259 Ga0495658_0000259_22926_24047 373
89 3300046689 Ga0495613_0003145 Ga0495613_0003145_4496_5617 373
90 3300047322 Ga0495680_0004407 Ga0495680_0004407_7780_8901 373
91 3300048904 Ga0496101_0039856 Ga0496101_0039856_1943_3064 373
92 3300048907 Ga0496104_0105624 Ga0496104_0105624_1121_2242 373
93 3300048908 Ga0496105_0146188 Ga0496105_0146188_400_1521 373
94 3300048909 Ga0496106_0003379 Ga0496106_0003379_10708_11835 373
95 3300048909 Ga0496106_0078758 Ga0496106_0078758_1376_2497 373
96 3300048911 Ga0496108_0131651 Ga0496108_0131651_11_1132 373
97 3300048913 Ga0496110_0122539 Ga0496110_0122539_233_1354 373
98 3300048914 Ga0496111_0099993 Ga0496111_0099993_231_1352 373
99 3300048916 Ga0496113_0097501 Ga0496113_0097501_325_1446 373
100 3300048916 Ga0496113_0293783 Ga0496113_0293783_144_1265 373
101 3300048917 Ga0496114_0104640 Ga0496114_0104640_481_1602 373
102 3300048918 Ga0496115_0074121 Ga0496115_0074121_1023_2144 373
103 3300048929 Ga0496126_0048559 Ga0496126_0048559_903_2027 373
104 3300049571 Ga0501034_0217262 Ga0501034_0217262_660_1781 373
105 3300049573 Ga0501037_0043514 Ga0501037_0043514_13_1134 373
106 3300049580 Ga0501046_0129586 Ga0501046_0129586_29_1150 373
107 3300049586 Ga0501070_0059319 Ga0501070_0059319_1388_2509 373
108 3300049742 Ga0501080_0423439 Ga0501080_0423439_11_1132 373
109 3300049744 Ga0501083_0069582 Ga0501083_0069582_968_2089 373
110 3300049822 Ga0501035_0106131 Ga0501035_0106131_734_1855 373
111 3300049824 Ga0501045_0222231 Ga0501045_0222231_20_1141 373
112 3300050507 nmdc:mga05p37_430232_c1 nmdc:mga05p37_430232_c1_390_1511 373
113 3300050509 nmdc:mga0qj67_1240_c1 nmdc:mga0qj67_1240_c1_16671_17792 373
114 3300050511 nmdc:mga08y16_2695_c1 nmdc:mga08y16_2695_c1_6363_7484 373
115 3300050511 nmdc:mga08y16_3376_c1 nmdc:mga08y16_3376_c1_13871_14992 373
116 3300050514 nmdc:mga08x19_217506_c1 nmdc:mga08x19_217506_c1_166_1287 373
117 3300050515 nmdc:mga0a205_211641_c1 nmdc:mga0a205_211641_c1_620_1741 373
118 3300053085 Ga0495619_0000558 Ga0495619_0000558_2784_3905 373
119 3300054114 Ga0501084_0226950 Ga0501084_0226950_379_1500 373
120 3300060353 Ga0501082_0163258 Ga0501082_0163258_597_1718 373
121 3300044694 Ga0466963_0117919 Ga0466963_0117919_57_1184 375
122 3300048916 Ga0496113_0295293 Ga0496113_0295293_13_1143 376
123 3300035172 Ga0373955_0003607 Ga0373955_0003607_3515_4648 377
124 3300035724 Ga0373933_0035823 Ga0373933_0035823_776_1915 377
125 3300048909 Ga0496106_0014196 Ga0496106_0014196_186_1325 379
126 3300049574 Ga0501038_0026060 Ga0501038_0026060_3002_4141 379
127 3300046533 Ga0495640_0113213 Ga0495640_0113213_586_1731 381
128 3300049571 Ga0501034_0003982 Ga0501034_0003982_1754_2899 381
129 3300049572 Ga0501036_0003666 Ga0501036_0003666_7220_8365 381
130 3300049574 Ga0501038_0063211 Ga0501038_0063211_1573_2718 381
131 3300049580 Ga0501046_0024861 Ga0501046_0024861_1375_2520 381
132 3300049581 Ga0501047_0000204 Ga0501047_0000204_757_1902 381
133 3300049582 Ga0501048_0000151 Ga0501048_0000151_13671_14816 381
134 3300049586 Ga0501070_0017459 Ga0501070_0017459_3130_4275 381
135 3300049742 Ga0501080_0000130 Ga0501080_0000130_49220_50365 381
136 3300049742 Ga0501080_0411683 Ga0501080_0411683_29_1174 381
137 3300049744 Ga0501083_0003052 Ga0501083_0003052_5744_6889 381
138 3300049823 Ga0501044_0000636 Ga0501044_0000636_13699_14844 381
139 3300060353 Ga0501082_0072166 Ga0501082_0072166_1461_2606 381
140 3300005337 Ga0070682_100070557 Ga0070682_1000705572 389
141 3300005445 Ga0070708_100064969 Ga0070708_1000649693 389
142 3300031727 Ga0316576_10015534 Ga0316576_100155342 389
143 3300032004 Ga0307414_10247468 Ga0307414_102474681 389
144 3300035398 Ga0316574_0000190 Ga0316574_0000190_11422_12606 389
145 3300046531 Ga0495665_0018021 Ga0495665_0018021_10_1179 389
146 3300046674 Ga0495588_0006673 Ga0495588_0006673_10_1179 389
147 3300053085 Ga0495619_0239071 Ga0495619_0239071_79_1248 389
148 3300005546 Ga0070696_100137496 Ga0070696_1001374961 391
149 3300044842 Ga0466957_0184933 Ga0466957_0184933_123_1331 391
150 3300045976 Ga0466967_0002394 Ga0466967_0002394_8725_9933 391
151 iso_pu_bacteria 8054563764 8054566849 391
152 3300005365 Ga0070688_100138171 Ga0070688_1001381712 392
153 3300035083 Ga0373926_0005228 Ga0373926_0005228_962_2170 392
154 3300035113 Ga0373936_0026798 Ga0373936_0026798_670_1878 392
155 3300037068 Ga0373925_0040153 Ga0373925_0040153_2074_3282 392
156 3300049588 Ga0501072_0127252 Ga0501072_0127252_290_1492 392
157 3300050493 nmdc:mga0k408_11450_c1 nmdc:mga0k408_11450_c1_1423_2610 392
158 iso_pu_bacteria 2835312727 2835317198 392
159 3300005336 Ga0070680_100071310 Ga0070680_1000713103 393
160 3300005339 Ga0070660_100061459 Ga0070660_1000614592 393
161 3300005458 Ga0070681_10003982 Ga0070681_1000398214 393
162 3300005530 Ga0070679_100123336 Ga0070679_1001233363 393
163 3300005563 Ga0068855_100021168 Ga0068855_1000211684 393
164 3300009093 Ga0105240_10038846 Ga0105240_100388465 393
165 3300013104 Ga0157370_10089394 Ga0157370_100893943 393
166 3300013105 Ga0157369_10088257 Ga0157369_100882573 393
167 3300025909 Ga0207705_10029325 Ga0207705_100293254 393
168 3300025912 Ga0207707_10046663 Ga0207707_100466632 393
169 3300025913 Ga0207695_10142481 Ga0207695_101424812 393
170 3300025921 Ga0207652_10041916 Ga0207652_100419162 393
171 3300025949 Ga0207667_10061064 Ga0207667_100610643 393
172 3300031995 Ga0307409_100095948 Ga0307409_1000959482 393
173 3300032002 Ga0307416_100160768 Ga0307416_1001607682 393
174 3300039438 Ga0436360_0669824 Ga0436360_0669824_1465_2649 393
175 3300050494 nmdc:mga06z11_143962_c1 nmdc:mga06z11_143962_c1_149_1336 393
176 3300005329 Ga0070683_100002577 Ga0070683_1000025772 394
177 3300005344 Ga0070661_100109554 Ga0070661_1001095542 394
178 3300005355 Ga0070671_100012024 Ga0070671_1000120245 394
179 3300005366 Ga0070659_100116315 Ga0070659_1001163151 394
180 3300005459 Ga0068867_100168976 Ga0068867_1001689762 394
181 3300005539 Ga0068853_100037274 Ga0068853_1000372742 394
182 3300005563 Ga0068855_100007678 Ga0068855_1000076783 394
183 3300005577 Ga0068857_100069992 Ga0068857_1000699922 394
184 3300005578 Ga0068854_100030544 Ga0068854_1000305442 394
185 3300005614 Ga0068856_100028873 Ga0068856_1000288733 394
186 3300005614 Ga0068856_100043343 Ga0068856_1000433435 394
187 3300005842 Ga0068858_100019129 Ga0068858_1000191294 394
188 3300006173 Ga0070716_100076186 Ga0070716_1000761862 394
189 3300009098 Ga0105245_10002978 Ga0105245_100029787 394
190 3300009174 Ga0105241_10041377 Ga0105241_100413772 394
191 3300009177 Ga0105248_10004805 Ga0105248_100048057 394
192 3300009545 Ga0105237_10111417 Ga0105237_101114172 394
193 3300009551 Ga0105238_10002026 Ga0105238_100020266 394
194 3300009553 Ga0105249_10003046 Ga0105249_100030467 394
195 3300013104 Ga0157370_10021256 Ga0157370_100212564 394
196 3300013307 Ga0157372_10001186 Ga0157372_100011866 394
197 3300013307 Ga0157372_10022732 Ga0157372_100227324 394
198 3300013308 Ga0157375_10018759 Ga0157375_100187592 394
199 3300025911 Ga0207654_10010727 Ga0207654_100107272 394
200 3300025913 Ga0207695_10014232 Ga0207695_100142328 394
201 3300025924 Ga0207694_10001005 Ga0207694_1000100510 394
202 3300025924 Ga0207694_10004833 Ga0207694_100048335 394
203 3300025927 Ga0207687_10004611 Ga0207687_100046112 394
204 3300025934 Ga0207686_10069394 Ga0207686_100693942 394
205 3300025941 Ga0207711_10002571 Ga0207711_100025717 394
206 3300025941 Ga0207711_10002853 Ga0207711_100028539 394
207 3300025949 Ga0207667_10012973 Ga0207667_100129734 394
208 3300025949 Ga0207667_10040307 Ga0207667_100403072 394
209 3300025960 Ga0207651_10028433 Ga0207651_100284332 394
210 3300025961 Ga0207712_10008152 Ga0207712_100081524 394
211 3300025986 Ga0207658_10039126 Ga0207658_100391262 394
212 3300026023 Ga0207677_10052769 Ga0207677_100527692 394
213 3300026035 Ga0207703_10082494 Ga0207703_100824942 394
214 3300026041 Ga0207639_10037532 Ga0207639_100375323 394
215 3300026078 Ga0207702_10049430 Ga0207702_100494303 394
216 3300026078 Ga0207702_10130316 Ga0207702_101303162 394
217 3300037853 Ga0436364_0875825 Ga0436364_0875825_17476_18726 394
218 3300039438 Ga0436360_1310548 Ga0436360_1310548_6176_7363 394
219 3300039453 Ga0436362_0214463 Ga0436362_0214463_10295_11482 394
220 3300046472 Ga0495580_0128713 Ga0495580_0128713_153_1349 394
221 3300046473 Ga0495582_0008968 Ga0495582_0008968_2780_3970 394
222 3300046475 Ga0495639_0053477 Ga0495639_0053477_473_1663 394
223 3300046531 Ga0495665_0034925 Ga0495665_0034925_716_1906 394
224 3300048909 Ga0496106_0088225 Ga0496106_0088225_1051_2235 394
225 3300048915 Ga0496112_0067075 Ga0496112_0067075_593_1786 394
226 3300049568 Ga0501031_0001202 Ga0501031_0001202_234_1418 394
227 3300049570 Ga0501033_0012124 Ga0501033_0012124_1550_2734 394
228 3300049570 Ga0501033_0033225 Ga0501033_0033225_263_1456 394
229 3300049573 Ga0501037_0109799 Ga0501037_0109799_446_1630 394
230 3300049574 Ga0501038_0108113 Ga0501038_0108113_699_1883 394
231 3300049575 Ga0501039_0114239 Ga0501039_0114239_696_1889 394
232 3300049577 Ga0501041_0007568 Ga0501041_0007568_4540_5733 394
233 3300049578 Ga0501042_0046377 Ga0501042_0046377_1588_2781 394
234 3300049581 Ga0501047_0018944 Ga0501047_0018944_620_1804 394
235 3300049582 Ga0501048_0061371 Ga0501048_0061371_716_1909 394
236 3300049586 Ga0501070_0070519 Ga0501070_0070519_507_1691 394
237 3300049591 Ga0501075_0000272 Ga0501075_0000272_290_1483 394
238 3300049593 Ga0501077_0033445 Ga0501077_0033445_1415_2608 394
239 3300049593 Ga0501077_0125474 Ga0501077_0125474_183_1376 394
240 3300049741 Ga0501079_0002303 Ga0501079_0002303_3297_4490 394
241 3300049742 Ga0501080_0007120 Ga0501080_0007120_910_2103 394
242 3300049743 Ga0501081_0001663 Ga0501081_0001663_1156_2349 394
243 3300049744 Ga0501083_0039248 Ga0501083_0039248_782_1975 394
244 3300049822 Ga0501035_0169531 Ga0501035_0169531_552_1736 394
245 3300049823 Ga0501044_0062299 Ga0501044_0062299_455_1639 394
246 3300049824 Ga0501045_0036508 Ga0501045_0036508_1296_2489 394
247 3300060353 Ga0501082_0037146 Ga0501082_0037146_457_1650 394
248 3300061734 Ga0530510_0110320 Ga0530510_0110320_770_1963 394
249 iso_pu_bacteria 2837678835 2837681831 394
250 3300005544 Ga0070686_100021526 Ga0070686_1000215262 395
251 3300006237 Ga0097621_100108751 Ga0097621_1001087512 395
252 3300009098 Ga0105245_10001287 Ga0105245_100012875 395
253 3300009177 Ga0105248_10126951 Ga0105248_101269511 395
254 3300013297 Ga0157378_10101460 Ga0157378_101014602 395
255 3300025261 Ga0209233_1000010 Ga0209233_1000010534 395
256 3300025927 Ga0207687_10001401 Ga0207687_100014015 395
257 3300026023 Ga0207677_10024472 Ga0207677_100244722 395
258 3300035692 Ga0373935_0143199 Ga0373935_0143199_412_1599 395
259 3300044694 Ga0466963_0000251 Ga0466963_0000251_2428_3663 395
260 3300045976 Ga0466967_0000282 Ga0466967_0000282_2456_3691 395
261 3300005436 Ga0070713_100049325 Ga0070713_1000493252 396
262 3300005455 Ga0070663_100054069 Ga0070663_1000540692 396
263 3300006195 Ga0075366_10032474 Ga0075366_100324742 396
264 3300009094 Ga0111539_10263811 Ga0111539_102638112 396
265 3300022467 Ga0224712_10027215 Ga0224712_100272152 396
266 3300031852 Ga0307410_10066189 Ga0307410_100661893 396
267 3300031901 Ga0307406_10168645 Ga0307406_101686452 396
268 3300032002 Ga0307416_100023574 Ga0307416_1000235744 396
269 3300048904 Ga0496101_0086477 Ga0496101_0086477_402_1592 396
270 3300048905 Ga0496102_0023317 Ga0496102_0023317_629_1819 396
271 3300048907 Ga0496104_0005612 Ga0496104_0005612_1394_2584 396
272 3300048909 Ga0496106_0044595 Ga0496106_0044595_675_1865 396
273 3300048912 Ga0496109_0080116 Ga0496109_0080116_450_1640 396
274 3300048915 Ga0496112_0083087 Ga0496112_0083087_719_1909 396
275 3300048918 Ga0496115_0005696 Ga0496115_0005696_413_1603 396
276 3300049568 Ga0501031_0011500 Ga0501031_0011500_771_1964 396
277 3300049569 Ga0501032_0034352 Ga0501032_0034352_1418_2611 396
278 3300049571 Ga0501034_0021741 Ga0501034_0021741_4795_5988 396
279 3300049572 Ga0501036_0066519 Ga0501036_0066519_33_1226 396
280 3300049573 Ga0501037_0004499 Ga0501037_0004499_1413_2606 396
281 3300049574 Ga0501038_0194284 Ga0501038_0194284_408_1601 396
282 3300049579 Ga0501043_0028734 Ga0501043_0028734_1689_2882 396
283 3300049581 Ga0501047_0043869 Ga0501047_0043869_2505_3698 396
284 3300049583 Ga0501067_0029564 Ga0501067_0029564_124_1317 396
285 3300049589 Ga0501073_0012459 Ga0501073_0012459_2989_4182 396
286 3300049589 Ga0501073_0092775 Ga0501073_0092775_219_1418 396
287 3300049744 Ga0501083_0013834 Ga0501083_0013834_2741_3940 396
288 3300049823 Ga0501044_0071364 Ga0501044_0071364_864_2057 396
289 3300005458 Ga0070681_10129351 Ga0070681_101293512 397
290 3300005937 Ga0081455_10000689 Ga0081455_1000068942 397
291 3300005983 Ga0081540_1000024 Ga0081540_1000024130 397
292 3300006844 Ga0075428_100005672 Ga0075428_1000056729 397
293 3300006846 Ga0075430_100010708 Ga0075430_1000107082 397
294 3300006846 Ga0075430_100026357 Ga0075430_1000263573 397
295 3300006847 Ga0075431_100120956 Ga0075431_1001209562 397
296 3300006852 Ga0075433_10010499 Ga0075433_100104992 397
297 3300006871 Ga0075434_100064025 Ga0075434_1000640253 397
298 3300007076 Ga0075435_100009928 Ga0075435_1000099282 397
299 3300009094 Ga0111539_10202698 Ga0111539_102026982 397
300 3300009094 Ga0111539_10414854 Ga0111539_104148542 397
301 3300009147 Ga0114129_10094895 Ga0114129_100948954 397
302 3300014969 Ga0157376_10247042 Ga0157376_102470421 397
303 3300025912 Ga0207707_10116154 Ga0207707_101161542 397
304 3300027907 Ga0207428_10005944 Ga0207428_1000594412 397
305 3300027907 Ga0207428_10058658 Ga0207428_100586582 397
306 3300035114 Ga0373939_0003811 Ga0373939_0003811_1946_3139 397
307 3300035691 Ga0373931_0001100 Ga0373931_0001100_4190_5383 397
308 3300049591 Ga0501075_0043318 Ga0501075_0043318_173_1366 397
309 3300049741 Ga0501079_0002659 Ga0501079_0002659_8800_9993 397
310 3300049741 Ga0501079_0191876 Ga0501079_0191876_350_1543 397
311 3300050509 nmdc:mga0qj67_18455_c1 nmdc:mga0qj67_18455_c1_698_1891 397
312 3300050509 nmdc:mga0qj67_35930_c1 nmdc:mga0qj67_35930_c1_1171_2364 397
313 3300050510 nmdc:mga06r32_11750_c1 nmdc:mga06r32_11750_c1_401_1594 397
314 3300050510 nmdc:mga06r32_181844_c1 nmdc:mga06r32_181844_c1_817_2010 397
315 3300050511 nmdc:mga08y16_28906_c1 nmdc:mga08y16_28906_c1_3527_4720 397
316 3300050511 nmdc:mga08y16_49648_c1 nmdc:mga08y16_49648_c1_401_1594 397
317 3300050512 nmdc:mga0n895_22456_c1 nmdc:mga0n895_22456_c1_1433_2626 397
318 3300050515 nmdc:mga0a205_2192_c1 nmdc:mga0a205_2192_c1_8140_9333 397
319 3300054114 Ga0501084_0027196 Ga0501084_0027196_1707_2900 397
320 3300060353 Ga0501082_0199090 Ga0501082_0199090_410_1603 397
321 3300005718 Ga0068866_10000067 Ga0068866_1000006736 398
322 3300006237 Ga0097621_100004734 Ga0097621_1000047347 398
323 3300014497 Ga0182008_10099598 Ga0182008_100995981 398
324 3300021388 Ga0213875_10000390 Ga0213875_1000039034 398
325 3300025910 Ga0207684_10128898 Ga0207684_101288982 398
326 3300037853 Ga0436364_0346617 Ga0436364_0346617_2680_3885 398
327 3300039437 Ga0436365_0230544 Ga0436365_0230544_641_1846 398
328 3300039447 Ga0436361_0649288 Ga0436361_0649288_144_1349 398
329 3300039450 Ga0436363_1075117 Ga0436363_1075117_1938_3137 398
330 iso_pu_bacteria 2643221547 2643758873 398
331 3300005364 Ga0070673_100139049 Ga0070673_1001390492 399
332 3300005440 Ga0070705_100003618 Ga0070705_1000036182 399
333 3300005441 Ga0070700_100011885 Ga0070700_1000118852 399
334 3300005456 Ga0070678_100117865 Ga0070678_1001178652 399
335 3300005459 Ga0068867_100147307 Ga0068867_1001473072 399
336 3300005518 Ga0070699_100039831 Ga0070699_1000398312 399
337 3300005536 Ga0070697_100009083 Ga0070697_1000090832 399
338 3300005546 Ga0070696_100078913 Ga0070696_1000789131 399
339 3300005549 Ga0070704_100004907 Ga0070704_1000049072 399
340 3300005577 Ga0068857_100011685 Ga0068857_1000116857 399
341 3300005615 Ga0070702_100046089 Ga0070702_1000460892 399
342 3300005618 Ga0068864_100056355 Ga0068864_1000563552 399
343 3300005843 Ga0068860_100015907 Ga0068860_1000159077 399
344 3300005844 Ga0068862_100007632 Ga0068862_1000076322 399
345 3300006237 Ga0097621_100089649 Ga0097621_1000896492 399
346 3300007788 Ga0099795_10001813 Ga0099795_100018135 399
347 3300009148 Ga0105243_10147810 Ga0105243_101478102 399
348 3300009176 Ga0105242_10061250 Ga0105242_100612503 399
349 3300009177 Ga0105248_10171900 Ga0105248_101719002 399
350 3300010159 Ga0099796_10002054 Ga0099796_100020542 399
351 3300014968 Ga0157379_10062753 Ga0157379_100627532 399
352 3300025885 Ga0207653_10001068 Ga0207653_100010682 399
353 3300025935 Ga0207709_10088252 Ga0207709_100882522 399
354 3300025941 Ga0207711_10128058 Ga0207711_101280582 399
355 3300025961 Ga0207712_10007715 Ga0207712_100077152 399
356 3300026067 Ga0207678_10011310 Ga0207678_100113107 399
357 3300026075 Ga0207708_10022276 Ga0207708_100222762 399
358 3300026095 Ga0207676_10012389 Ga0207676_100123892 399
359 3300026116 Ga0207674_10048205 Ga0207674_100482053 399
360 3300026121 Ga0207683_10044230 Ga0207683_100442302 399
361 3300027512 Ga0209179_1002569 Ga0209179_10025692 399
362 3300028381 Ga0268264_10006427 Ga0268264_1000642711 399
363 3300031731 Ga0307405_10019960 Ga0307405_100199602 399
364 3300031852 Ga0307410_10026531 Ga0307410_100265313 399
365 3300031901 Ga0307406_10029752 Ga0307406_100297522 399
366 3300031903 Ga0307407_10021394 Ga0307407_100213942 399
367 3300031911 Ga0307412_10040789 Ga0307412_100407892 399
368 3300031995 Ga0307409_100019041 Ga0307409_1000190412 399
369 3300032002 Ga0307416_100082199 Ga0307416_1000821992 399
370 3300032126 Ga0307415_100051270 Ga0307415_1000512702 399
371 3300033179 Ga0307507_10129986 Ga0307507_101299861 399
372 3300048905 Ga0496102_0015343 Ga0496102_0015343_4442_5641 399
373 3300049591 Ga0501075_0176230 Ga0501075_0176230_197_1402 399
374 3300050508 nmdc:mga09592_171704_c1 nmdc:mga09592_171704_c1_171_1397 399
375 3300050511 nmdc:mga08y16_14061_c1 nmdc:mga08y16_14061_c1_1077_2354 399
376 3300003203 JGI25406J46586_10004133 JGI25406J46586_100041333 400
377 3300005330 Ga0070690_100084160 Ga0070690_1000841601 400
378 3300005457 Ga0070662_100098773 Ga0070662_1000987732 400
379 3300005545 Ga0070695_100001888 Ga0070695_1000018882 400
380 3300005985 Ga0081539_10005746 Ga0081539_100057463 400
381 3300009174 Ga0105241_10086609 Ga0105241_100866092 400
382 3300025904 Ga0207647_10122135 Ga0207647_101221351 400
383 3300028379 Ga0268266_10190546 Ga0268266_101905461 400
384 3300035724 Ga0373933_0083486 Ga0373933_0083486_723_1925 400
385 3300042876 Ga0451577_0161116 Ga0451577_0161116_401_1612 400
386 3300046472 Ga0495580_0062016 Ga0495580_0062016_810_2075 400
387 3300046683 Ga0495658_0005362 Ga0495658_0005362_637_1902 400
388 3300049588 Ga0501072_0020836 Ga0501072_0020836_714_1919 400
389 3300053119 Ga0500595_010099 Ga0500595_010099_1724_2983 400
390 3300053178 Ga0500637_0001315 Ga0500637_0001315_1538_2797 400
391 3300053730 Ga0500645_008618 Ga0500645_008618_307_1512 400
392 3300055283 Ga0500661_000712 Ga0500661_000712_3949_5208 400
393 3300005530 Ga0070679_100026691 Ga0070679_1000266913 401
394 3300006871 Ga0075434_100259136 Ga0075434_1002591362 401
395 3300006914 Ga0075436_100071457 Ga0075436_1000714572 401
396 3300007076 Ga0075435_100334844 Ga0075435_1003348441 401
397 3300010159 Ga0099796_10003427 Ga0099796_100034272 401
398 3300025906 Ga0207699_10145515 Ga0207699_101455152 401
399 3300025939 Ga0207665_10043816 Ga0207665_100438162 401
400 3300027512 Ga0209179_1003591 Ga0209179_10035912 401
401 3300035111 Ga0373923_0002037 Ga0373923_0002037_886_2091 401
402 3300035117 Ga0373953_0000827 Ga0373953_0000827_175_1380 401
403 3300035118 Ga0373954_0031293 Ga0373954_0031293_152_1357 401
404 3300035120 Ga0373957_0047469 Ga0373957_0047469_206_1411 401
405 3300035170 Ga0373943_0004919 Ga0373943_0004919_177_1382 401
406 3300035172 Ga0373955_0027626 Ga0373955_0027626_1583_2788 401
407 3300035410 Ga0373924_0003276 Ga0373924_0003276_282_1487 401
408 3300035692 Ga0373935_0000053 Ga0373935_0000053_25019_26224 401
409 3300035725 Ga0373947_0000828 Ga0373947_0000828_14307_15512 401
410 3300036401 Ga0373937_0000030 Ga0373937_0000030_13442_14647 401
411 3300036401 Ga0373937_0267342 Ga0373937_0267342_362_1567 401
412 3300037068 Ga0373925_0000002 Ga0373925_0000002_51629_52834 401
413 3300046454 Ga0495592_0000046 Ga0495592_0000046_87272_88477 401
414 3300046459 Ga0495629_0152256 Ga0495629_0152256_225_1430 401
415 3300046462 Ga0495651_0042983 Ga0495651_0042983_155_1360 401
416 3300046463 Ga0495653_0000006 Ga0495653_0000006_51675_52880 401
417 3300046473 Ga0495582_0038395 Ga0495582_0038395_288_1493 401
418 3300046476 Ga0495662_0002559 Ga0495662_0002559_867_2072 401
419 3300046477 Ga0495664_0000002 Ga0495664_0000002_87309_88514 401
420 3300046511 Ga0495608_0000006 Ga0495608_0000006_126032_127237 401
421 3300046514 Ga0495618_0000282 Ga0495618_0000282_179_1384 401
422 3300046516 Ga0495628_0000002 Ga0495628_0000002_51592_52797 401
423 3300046517 Ga0495630_0256187 Ga0495630_0256187_41_1246 401
424 3300046529 Ga0495652_0000004 Ga0495652_0000004_535984_537189 401
425 3300046533 Ga0495640_0000007 Ga0495640_0000007_73718_74923 401
426 3300046536 Ga0495587_0000031 Ga0495587_0000031_51694_52899 401
427 3300046543 Ga0495645_0000003 Ga0495645_0000003_32945_34150 401
428 3300046559 Ga0495667_0000002 Ga0495667_0000002_384824_386029 401
429 3300046559 Ga0495667_0082087 Ga0495667_0082087_294_1499 401
430 3300046642 Ga0495634_0000110 Ga0495634_0000110_65700_66905 401
431 3300046663 Ga0495635_0000022 Ga0495635_0000022_21977_23182 401
432 3300046663 Ga0495635_0157225 Ga0495635_0157225_137_1342 401
433 3300046675 Ga0495657_0000276 Ga0495657_0000276_25073_26278 401
434 3300046678 Ga0495599_0000001 Ga0495599_0000001_190372_191577 401
435 3300046679 Ga0495623_0000094 Ga0495623_0000094_32880_34085 401
436 3300046680 Ga0495646_0000007 Ga0495646_0000007_45228_46433 401
437 3300046809 Ga0495600_0000033 Ga0495600_0000033_30788_31993 401
438 3300047315 Ga0495581_0053391 Ga0495581_0053391_223_1428 401
439 3300047317 Ga0495604_0000005 Ga0495604_0000005_77338_78543 401
440 3300047319 Ga0495674_0000003 Ga0495674_0000003_509227_510432 401
441 3300047322 Ga0495680_0000091 Ga0495680_0000091_47569_48774 401
442 3300047444 Ga0495675_0000064 Ga0495675_0000064_21336_22541 401
443 3300047471 Ga0495684_0000035 Ga0495684_0000035_32847_34052 401
444 3300047673 Ga0495593_0000184 Ga0495593_0000184_4431_5636 401
445 3300048088 Ga0495602_0000029 Ga0495602_0000029_32837_34042 401
446 3300050492 nmdc:mga0yw44_72744_c1 nmdc:mga0yw44_72744_c1_44_1249 401
447 3300050512 nmdc:mga0n895_62132_c1 nmdc:mga0n895_62132_c1_1483_2688 401
448 3300053077 Ga0495601_0000008 Ga0495601_0000008_269843_271048 401
449 3300053078 Ga0495612_0000026 Ga0495612_0000026_74911_76116 401
450 3300053084 Ga0495595_0000024 Ga0495595_0000024_32954_34159 401
451 3300053085 Ga0495619_0000002 Ga0495619_0000002_51697_52902 401
452 3300053131 Ga0500652_003911 Ga0500652_003911_2542_3750 401
453 2209111006 2214544940 2213593681 402
454 3300000042 ARSoilYngRDRAFT_c00304 ARSoilYngRDRAFT_003044 402
455 3300000043 ARcpr5yngRDRAFT_c000272 ARcpr5yngRDRAFT_0002725 402
456 3300000044 ARSoilOldRDRAFT_c000214 ARSoilOldRDRAFT_0002141 402
457 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_10000045 402
458 3300001430 JGI24032J14994_100282 JGI24032J14994_1002823 402
459 3300001976 JGI24752J21851_1004296 JGI24752J21851_10042961 402
460 3300001977 JGI24746J21847_1000731 JGI24746J21847_10007312 402
461 3300001989 JGI24739J22299_10001029 JGI24739J22299_100010294 402
462 3300001990 JGI24737J22298_10003738 JGI24737J22298_100037383 402
463 3300002070 JGI24750J21931_1000454 JGI24750J21931_10004542 402
464 3300002073 JGI24745J21846_1000597 JGI24745J21846_10005972 402
465 3300002074 JGI24748J21848_1000322 JGI24748J21848_10003224 402
466 3300002075 JGI24738J21930_10000204 JGI24738J21930_100002048 402
467 3300002076 JGI24749J21850_1000784 JGI24749J21850_10007843 402
468 3300002077 JGI24744J21845_10000415 JGI24744J21845_100004154 402
469 3300002126 JGI24035J26624_1001030 JGI24035J26624_10010302 402
470 3300002244 JGI24742J22300_10000274 JGI24742J22300_100002744 402
471 3300005289 Ga0065704_10094564 Ga0065704_100945642 402
472 3300005293 Ga0065715_10100109 Ga0065715_101001093 402
473 3300005327 Ga0070658_10097815 Ga0070658_100978152 402
474 3300005328 Ga0070676_10027337 Ga0070676_100273372 402
475 3300005329 Ga0070683_100005380 Ga0070683_1000053804 402
476 3300005330 Ga0070690_100001748 Ga0070690_1000017487 402
477 3300005330 Ga0070690_100009386 Ga0070690_1000093865 402
478 3300005330 Ga0070690_100125995 Ga0070690_1001259951 402
479 3300005331 Ga0070670_100001397 Ga0070670_1000013979 402
480 3300005331 Ga0070670_100017125 Ga0070670_1000171254 402
481 3300005333 Ga0070677_10000229 Ga0070677_1000022912 402
482 3300005334 Ga0068869_100001282 Ga0068869_1000012829 402
483 3300005335 Ga0070666_10000097 Ga0070666_1000009730 402
484 3300005336 Ga0070680_100027599 Ga0070680_1000275992 402
485 3300005336 Ga0070680_100035476 Ga0070680_1000354763 402
486 3300005336 Ga0070680_100091392 Ga0070680_1000913921 402
487 3300005336 Ga0070680_100243692 Ga0070680_1002436921 402
488 3300005337 Ga0070682_100000675 Ga0070682_10000067519 402
489 3300005337 Ga0070682_100001697 Ga0070682_1000016971 402
490 3300005337 Ga0070682_100031360 Ga0070682_1000313601 402
491 3300005338 Ga0068868_100002052 Ga0068868_1000020529 402
492 3300005339 Ga0070660_100000067 Ga0070660_10000006722 402
493 3300005339 Ga0070660_100056087 Ga0070660_1000560872 402
494 3300005339 Ga0070660_100101479 Ga0070660_1001014792 402
495 3300005339 Ga0070660_100257046 Ga0070660_1002570461 402
496 3300005340 Ga0070689_100000641 Ga0070689_10000064117 402
497 3300005340 Ga0070689_100001711 Ga0070689_1000017119 402
498 3300005340 Ga0070689_100006940 Ga0070689_1000069403 402
499 3300005341 Ga0070691_10020802 Ga0070691_100208022 402
500 3300005341 Ga0070691_10089065 Ga0070691_100890652 402
501 3300005343 Ga0070687_100000218 Ga0070687_1000002187 402
502 3300005343 Ga0070687_100001093 Ga0070687_1000010933 402
503 3300005343 Ga0070687_100066350 Ga0070687_1000663501 402
504 3300005344 Ga0070661_100000128 Ga0070661_10000012837 402
505 3300005344 Ga0070661_100004793 Ga0070661_1000047934 402
506 3300005344 Ga0070661_100024299 Ga0070661_1000242992 402
507 3300005344 Ga0070661_100104975 Ga0070661_1001049752 402
508 3300005345 Ga0070692_10002696 Ga0070692_100026962 402
509 3300005347 Ga0070668_100000193 Ga0070668_1000001935 402
510 3300005347 Ga0070668_100000683 Ga0070668_10000068316 402
511 3300005347 Ga0070668_100101309 Ga0070668_1001013092 402
512 3300005347 Ga0070668_100253420 Ga0070668_1002534201 402
513 3300005353 Ga0070669_100000491 Ga0070669_1000004917 402
514 3300005353 Ga0070669_100000634 Ga0070669_10000063423 402
515 3300005354 Ga0070675_100000582 Ga0070675_1000005824 402
516 3300005354 Ga0070675_100004418 Ga0070675_1000044189 402
517 3300005354 Ga0070675_100107453 Ga0070675_1001074531 402
518 3300005355 Ga0070671_100000220 Ga0070671_10000022010 402
519 3300005355 Ga0070671_100001574 Ga0070671_10000157414 402
520 3300005355 Ga0070671_100015677 Ga0070671_1000156772 402
521 3300005355 Ga0070671_100111434 Ga0070671_1001114342 402
522 3300005356 Ga0070674_100000597 Ga0070674_1000005971 402
523 3300005364 Ga0070673_100004830 Ga0070673_1000048304 402
524 3300005364 Ga0070673_100225235 Ga0070673_1002252351 402
525 3300005365 Ga0070688_100000044 Ga0070688_10000004421 402
526 3300005365 Ga0070688_100009424 Ga0070688_1000094242 402
527 3300005365 Ga0070688_100078900 Ga0070688_1000789002 402
528 3300005365 Ga0070688_100103971 Ga0070688_1001039712 402
529 3300005366 Ga0070659_100000229 Ga0070659_10000022933 402
530 3300005366 Ga0070659_100007671 Ga0070659_1000076713 402
531 3300005366 Ga0070659_100019887 Ga0070659_1000198874 402
532 3300005366 Ga0070659_100172848 Ga0070659_1001728481 402
533 3300005367 Ga0070667_100008393 Ga0070667_1000083932 402
534 3300005367 Ga0070667_100022925 Ga0070667_1000229251 402
535 3300005367 Ga0070667_100073763 Ga0070667_1000737632 402
536 3300005367 Ga0070667_100107883 Ga0070667_1001078832 402
537 3300005367 Ga0070667_100180076 Ga0070667_1001800762 402
538 3300005367 Ga0070667_100228210 Ga0070667_1002282101 402
539 3300005367 Ga0070667_100333995 Ga0070667_1003339951 402
540 3300005406 Ga0070703_10004414 Ga0070703_100044143 402
541 3300005434 Ga0070709_10001382 Ga0070709_100013821 402
542 3300005434 Ga0070709_10013388 Ga0070709_100133882 402
543 3300005434 Ga0070709_10014889 Ga0070709_100148892 402
544 3300005435 Ga0070714_100016309 Ga0070714_1000163095 402
545 3300005436 Ga0070713_100000958 Ga0070713_10000095812 402
546 3300005436 Ga0070713_100016743 Ga0070713_1000167432 402
547 3300005436 Ga0070713_100048126 Ga0070713_1000481262 402
548 3300005437 Ga0070710_10015209 Ga0070710_100152092 402
549 3300005437 Ga0070710_10025049 Ga0070710_100250492 402
550 3300005437 Ga0070710_10079108 Ga0070710_100791082 402
551 3300005439 Ga0070711_100079498 Ga0070711_1000794982 402
552 3300005439 Ga0070711_100087791 Ga0070711_1000877911 402
553 3300005439 Ga0070711_100106163 Ga0070711_1001061632 402
554 3300005439 Ga0070711_100148068 Ga0070711_1001480682 402
555 3300005439 Ga0070711_100187319 Ga0070711_1001873191 402
556 3300005439 Ga0070711_100192184 Ga0070711_1001921841 402
557 3300005440 Ga0070705_100000316 Ga0070705_10000031621 402
558 3300005440 Ga0070705_100004210 Ga0070705_1000042102 402
559 3300005440 Ga0070705_100020000 Ga0070705_1000200002 402
560 3300005440 Ga0070705_100023437 Ga0070705_1000234372 402
561 3300005441 Ga0070700_100001484 Ga0070700_1000014848 402
562 3300005441 Ga0070700_100004074 Ga0070700_1000040748 402
563 3300005441 Ga0070700_100017923 Ga0070700_1000179231 402
564 3300005444 Ga0070694_100016830 Ga0070694_1000168302 402
565 3300005444 Ga0070694_100039439 Ga0070694_1000394391 402
566 3300005445 Ga0070708_100075946 Ga0070708_1000759462 402
567 3300005455 Ga0070663_100000609 Ga0070663_10000060910 402
568 3300005455 Ga0070663_100003347 Ga0070663_1000033474 402
569 3300005455 Ga0070663_100116308 Ga0070663_1001163081 402
570 3300005456 Ga0070678_100003089 Ga0070678_1000030893 402
571 3300005457 Ga0070662_100000123 Ga0070662_10000012317 402
572 3300005457 Ga0070662_100061176 Ga0070662_1000611761 402
573 3300005457 Ga0070662_100124373 Ga0070662_1001243731 402
574 3300005458 Ga0070681_10034795 Ga0070681_100347951 402
575 3300005458 Ga0070681_10057230 Ga0070681_100572301 402
576 3300005458 Ga0070681_10111415 Ga0070681_101114152 402
577 3300005458 Ga0070681_10322834 Ga0070681_103228341 402
578 3300005459 Ga0068867_100034674 Ga0068867_1000346741 402
579 3300005459 Ga0068867_100109289 Ga0068867_1001092892 402
580 3300005466 Ga0070685_10000237 Ga0070685_1000023716 402
581 3300005466 Ga0070685_10006590 Ga0070685_100065903 402
582 3300005466 Ga0070685_10029591 Ga0070685_100295912 402
583 3300005518 Ga0070699_100007988 Ga0070699_1000079882 402
584 3300005518 Ga0070699_100284848 Ga0070699_1002848482 402
585 3300005530 Ga0070679_100001633 Ga0070679_10000163316 402
586 3300005530 Ga0070679_100006811 Ga0070679_1000068117 402
587 3300005530 Ga0070679_100009228 Ga0070679_1000092283 402
588 3300005530 Ga0070679_100056977 Ga0070679_1000569771 402
589 3300005530 Ga0070679_100133292 Ga0070679_1001332922 402
590 3300005530 Ga0070679_100144721 Ga0070679_1001447211 402
591 3300005535 Ga0070684_100000334 Ga0070684_10000033425 402
592 3300005535 Ga0070684_100123419 Ga0070684_1001234192 402
593 3300005535 Ga0070684_100245473 Ga0070684_1002454731 402
594 3300005536 Ga0070697_100003600 Ga0070697_10000360011 402
595 3300005539 Ga0068853_100000219 Ga0068853_10000021922 402
596 3300005539 Ga0068853_100038804 Ga0068853_1000388043 402
597 3300005539 Ga0068853_100286517 Ga0068853_1002865172 402
598 3300005543 Ga0070672_100000261 Ga0070672_1000002614 402
599 3300005543 Ga0070672_100000494 Ga0070672_10000049416 402
600 3300005544 Ga0070686_100001005 Ga0070686_10000100517 402
601 3300005544 Ga0070686_100001041 Ga0070686_10000104114 402
602 3300005544 Ga0070686_100013297 Ga0070686_1000132972 402
603 3300005545 Ga0070695_100003969 Ga0070695_1000039692 402
604 3300005545 Ga0070695_100010659 Ga0070695_1000106592 402
605 3300005545 Ga0070695_100158014 Ga0070695_1001580141 402
606 3300005546 Ga0070696_100014508 Ga0070696_1000145082 402
607 3300005546 Ga0070696_100023309 Ga0070696_1000233092 402
608 3300005547 Ga0070693_100000953 Ga0070693_1000009537 402
609 3300005547 Ga0070693_100002565 Ga0070693_1000025653 402
610 3300005548 Ga0070665_100005100 Ga0070665_1000051007 402
611 3300005549 Ga0070704_100001952 Ga0070704_1000019526 402
612 3300005549 Ga0070704_100004740 Ga0070704_1000047403 402
613 3300005563 Ga0068855_100003887 Ga0068855_10000388712 402
614 3300005563 Ga0068855_100035592 Ga0068855_1000355922 402
615 3300005563 Ga0068855_100048572 Ga0068855_1000485722 402
616 3300005563 Ga0068855_100065618 Ga0068855_1000656184 402
617 3300005564 Ga0070664_100000286 Ga0070664_10000028610 402
618 3300005564 Ga0070664_100000892 Ga0070664_10000089218 402
619 3300005564 Ga0070664_100096755 Ga0070664_1000967553 402
620 3300005577 Ga0068857_100000087 Ga0068857_10000008713 402
621 3300005577 Ga0068857_100203207 Ga0068857_1002032072 402
622 3300005578 Ga0068854_100000147 Ga0068854_10000014733 402
623 3300005578 Ga0068854_100002291 Ga0068854_1000022915 402
624 3300005578 Ga0068854_100008595 Ga0068854_1000085954 402
625 3300005578 Ga0068854_100244409 Ga0068854_1002444091 402
626 3300005614 Ga0068856_100002205 Ga0068856_10000220516 402
627 3300005614 Ga0068856_100025100 Ga0068856_1000251003 402
628 3300005614 Ga0068856_100075301 Ga0068856_1000753011 402
629 3300005615 Ga0070702_100000852 Ga0070702_1000008524 402
630 3300005615 Ga0070702_100005302 Ga0070702_1000053023 402
631 3300005615 Ga0070702_100010159 Ga0070702_1000101593 402
632 3300005615 Ga0070702_100063772 Ga0070702_1000637722 402
633 3300005616 Ga0068852_100000090 Ga0068852_10000009031 402
634 3300005616 Ga0068852_100013777 Ga0068852_1000137773 402
635 3300005616 Ga0068852_100175310 Ga0068852_1001753102 402
636 3300005616 Ga0068852_100295377 Ga0068852_1002953771 402
637 3300005616 Ga0068852_100315082 Ga0068852_1003150822 402
638 3300005617 Ga0068859_100002117 Ga0068859_1000021177 402
639 3300005617 Ga0068859_100103202 Ga0068859_1001032023 402
640 3300005617 Ga0068859_100205436 Ga0068859_1002054362 402
641 3300005617 Ga0068859_100259040 Ga0068859_1002590402 402
642 3300005618 Ga0068864_100000739 Ga0068864_10000073919 402
643 3300005618 Ga0068864_100000954 Ga0068864_1000009549 402
644 3300005718 Ga0068866_10002553 Ga0068866_100025534 402
645 3300005718 Ga0068866_10006331 Ga0068866_100063312 402
646 3300005719 Ga0068861_100000381 Ga0068861_10000038119 402
647 3300005719 Ga0068861_100005852 Ga0068861_1000058524 402
648 3300005719 Ga0068861_100227344 Ga0068861_1002273441 402
649 3300005834 Ga0068851_10000526 Ga0068851_1000052618 402
650 3300005840 Ga0068870_10000010 Ga0068870_1000001022 402
651 3300005840 Ga0068870_10002778 Ga0068870_100027783 402
652 3300005841 Ga0068863_100000615 Ga0068863_10000061521 402
653 3300005841 Ga0068863_100013419 Ga0068863_1000134194 402
654 3300005841 Ga0068863_100043776 Ga0068863_1000437762 402
655 3300005841 Ga0068863_100079087 Ga0068863_1000790872 402
656 3300005842 Ga0068858_100009423 Ga0068858_1000094234 402
657 3300005843 Ga0068860_100129396 Ga0068860_1001293962 402
658 3300005843 Ga0068860_100150951 Ga0068860_1001509512 402
659 3300005844 Ga0068862_100047113 Ga0068862_1000471131 402
660 3300005937 Ga0081455_10000059 Ga0081455_100000597 402
661 3300005937 Ga0081455_10007122 Ga0081455_100071227 402
662 3300005937 Ga0081455_10019181 Ga0081455_100191812 402
663 3300005937 Ga0081455_10071503 Ga0081455_100715032 402
664 3300005981 Ga0081538_10001357 Ga0081538_1000135717 402
665 3300005983 Ga0081540_1000234 Ga0081540_100023419 402
666 3300005983 Ga0081540_1003005 Ga0081540_10030058 402
667 3300006028 Ga0070717_10000161 Ga0070717_1000016137 402
668 3300006028 Ga0070717_10005842 Ga0070717_100058424 402
669 3300006038 Ga0075365_10042032 Ga0075365_100420321 402
670 3300006051 Ga0075364_10049729 Ga0075364_100497292 402
671 3300006163 Ga0070715_10014781 Ga0070715_100147812 402
672 3300006173 Ga0070716_100034186 Ga0070716_1000341862 402
673 3300006175 Ga0070712_100000205 Ga0070712_10000020518 402
674 3300006175 Ga0070712_100003713 Ga0070712_1000037132 402
675 3300006175 Ga0070712_100065773 Ga0070712_1000657732 402
676 3300006175 Ga0070712_100117306 Ga0070712_1001173062 402
677 3300006178 Ga0075367_10041064 Ga0075367_100410642 402
678 3300006178 Ga0075367_10050615 Ga0075367_100506152 402
679 3300006178 Ga0075367_10090639 Ga0075367_100906392 402
680 3300006186 Ga0075369_10005639 Ga0075369_100056391 402
681 3300006195 Ga0075366_10089102 Ga0075366_100891021 402
682 3300006237 Ga0097621_100000553 Ga0097621_1000005539 402
683 3300006237 Ga0097621_100002975 Ga0097621_1000029754 402
684 3300006237 Ga0097621_100012603 Ga0097621_1000126033 402
685 3300006237 Ga0097621_100023826 Ga0097621_1000238262 402
686 3300006237 Ga0097621_100080269 Ga0097621_1000802692 402
687 3300006353 Ga0075370_10101595 Ga0075370_101015951 402
688 3300006358 Ga0068871_100000372 Ga0068871_1000003727 402
689 3300006358 Ga0068871_100000753 Ga0068871_1000007534 402
690 3300006358 Ga0068871_100165050 Ga0068871_1001650501 402
691 3300006844 Ga0075428_100014847 Ga0075428_1000148476 402
692 3300006844 Ga0075428_100064595 Ga0075428_1000645953 402
693 3300006844 Ga0075428_100068950 Ga0075428_1000689502 402
694 3300006844 Ga0075428_100086234 Ga0075428_1000862342 402
695 3300006846 Ga0075430_100000281 Ga0075430_10000028119 402
696 3300006846 Ga0075430_100000304 Ga0075430_10000030414 402
697 3300006846 Ga0075430_100064742 Ga0075430_1000647422 402
698 3300006846 Ga0075430_100223321 Ga0075430_1002233212 402
699 3300006847 Ga0075431_100001243 Ga0075431_1000012437 402
700 3300006852 Ga0075433_10000958 Ga0075433_100009582 402
701 3300006852 Ga0075433_10054678 Ga0075433_100546782 402
702 3300006871 Ga0075434_100001677 Ga0075434_10000167717 402
703 3300006871 Ga0075434_100104021 Ga0075434_1001040212 402
704 3300006871 Ga0075434_100241424 Ga0075434_1002414242 402
705 3300006880 Ga0075429_100000347 Ga0075429_1000003476 402
706 3300006881 Ga0068865_100000156 Ga0068865_10000015626 402
707 3300006881 Ga0068865_100002150 Ga0068865_1000021504 402
708 3300006881 Ga0068865_100036714 Ga0068865_1000367143 402
709 3300006914 Ga0075436_100019091 Ga0075436_1000190912 402
710 3300006931 Ga0097620_100002117 Ga0097620_10000211716 402
711 3300006931 Ga0097620_100103193 Ga0097620_1001031933 402
712 3300006931 Ga0097620_100205424 Ga0097620_1002054242 402
713 3300006931 Ga0097620_100259014 Ga0097620_1002590142 402
714 3300007076 Ga0075435_100016723 Ga0075435_1000167236 402
715 3300007076 Ga0075435_100050217 Ga0075435_1000502172 402
716 3300007076 Ga0075435_100052152 Ga0075435_1000521522 402
717 3300007076 Ga0075435_100174311 Ga0075435_1001743112 402
718 3300007265 Ga0099794_10031492 Ga0099794_100314922 402
719 3300007788 Ga0099795_10011720 Ga0099795_100117202 402
720 3300009093 Ga0105240_10001500 Ga0105240_100015009 402
721 3300009094 Ga0111539_10022850 Ga0111539_100228502 402
722 3300009094 Ga0111539_10108638 Ga0111539_101086382 402
723 3300009098 Ga0105245_10002062 Ga0105245_100020628 402
724 3300009098 Ga0105245_10058528 Ga0105245_100585284 402
725 3300009098 Ga0105245_10069710 Ga0105245_100697102 402
726 3300009101 Ga0105247_10000294 Ga0105247_1000029431 402
727 3300009101 Ga0105247_10078966 Ga0105247_100789662 402
728 3300009147 Ga0114129_10004490 Ga0114129_100044908 402
729 3300009147 Ga0114129_10029420 Ga0114129_100294204 402
730 3300009148 Ga0105243_10004518 Ga0105243_100045189 402
731 3300009148 Ga0105243_10035007 Ga0105243_100350073 402
732 3300009148 Ga0105243_10138754 Ga0105243_101387542 402
733 3300009174 Ga0105241_10000480 Ga0105241_1000048021 402
734 3300009174 Ga0105241_10011137 Ga0105241_100111372 402
735 3300009174 Ga0105241_10191994 Ga0105241_101919941 402
736 3300009176 Ga0105242_10000866 Ga0105242_1000086619 402
737 3300009176 Ga0105242_10077831 Ga0105242_100778312 402
738 3300009177 Ga0105248_10001732 Ga0105248_1000173218 402
739 3300009177 Ga0105248_10002315 Ga0105248_1000231517 402
740 3300009177 Ga0105248_10054088 Ga0105248_100540883 402
741 3300009177 Ga0105248_10058156 Ga0105248_100581562 402
742 3300009545 Ga0105237_10000241 Ga0105237_100002414 402
743 3300009545 Ga0105237_10355511 Ga0105237_103555111 402
744 3300009551 Ga0105238_10001419 Ga0105238_1000141917 402
745 3300009551 Ga0105238_10149373 Ga0105238_101493732 402
746 3300009553 Ga0105249_10000108 Ga0105249_1000010821 402
747 3300009553 Ga0105249_10239855 Ga0105249_102398551 402
748 3300010375 Ga0105239_10002853 Ga0105239_1000285317 402
749 3300010375 Ga0105239_10305372 Ga0105239_103053722 402
750 3300010375 Ga0105239_10475769 Ga0105239_104757691 402
751 3300011119 Ga0105246_10217654 Ga0105246_102176541 402
752 3300013100 Ga0157373_10000334 Ga0157373_1000033427 402
753 3300013100 Ga0157373_10003322 Ga0157373_100033225 402
754 3300013102 Ga0157371_10001142 Ga0157371_100011423 402
755 3300013104 Ga0157370_10075736 Ga0157370_100757362 402
756 3300013105 Ga0157369_10001253 Ga0157369_100012539 402
757 3300013105 Ga0157369_10073153 Ga0157369_100731531 402
758 3300013296 Ga0157374_10000447 Ga0157374_1000044721 402
759 3300013296 Ga0157374_10079484 Ga0157374_100794842 402
760 3300013297 Ga0157378_10001168 Ga0157378_100011689 402
761 3300013297 Ga0157378_10133412 Ga0157378_101334122 402
762 3300013306 Ga0163162_10000607 Ga0163162_1000060721 402
763 3300013307 Ga0157372_10001963 Ga0157372_100019633 402
764 3300013307 Ga0157372_10023621 Ga0157372_100236213 402
765 3300013308 Ga0157375_10006232 Ga0157375_100062323 402
766 3300013308 Ga0157375_10027696 Ga0157375_100276962 402
767 3300013308 Ga0157375_10370805 Ga0157375_103708052 402
768 3300014325 Ga0163163_10054941 Ga0163163_100549413 402
769 3300014325 Ga0163163_10184448 Ga0163163_101844482 402
770 3300014326 Ga0157380_10047332 Ga0157380_100473321 402
771 3300014745 Ga0157377_10000572 Ga0157377_100005724 402
772 3300014968 Ga0157379_10000919 Ga0157379_100009199 402
773 3300014968 Ga0157379_10208854 Ga0157379_102088541 402
774 3300014968 Ga0157379_10234921 Ga0157379_102349212 402
775 3300014969 Ga0157376_10000171 Ga0157376_1000017124 402
776 3300014969 Ga0157376_10116109 Ga0157376_101161092 402
777 3300017792 Ga0163161_10005587 Ga0163161_100055874 402
778 3300017792 Ga0163161_10035003 Ga0163161_100350032 402
779 3300020070 Ga0206356_10633008 Ga0206356_106330082 402
780 3300021361 Ga0213872_10013229 Ga0213872_100132292 402
781 3300024225 Ga0224572_1012742 Ga0224572_10127421 402
782 3300024227 Ga0228598_1000876 Ga0228598_10008764 402
783 3300024227 Ga0228598_1008933 Ga0228598_10089331 402
784 3300025271 Ga0207666_1000940 Ga0207666_10009403 402
785 3300025290 Ga0207673_1000217 Ga0207673_10002172 402
786 3300025297 Ga0209758_1000244 Ga0209758_100024445 402
787 3300025315 Ga0207697_10000031 Ga0207697_1000003128 402
788 3300025315 Ga0207697_10013153 Ga0207697_100131531 402
789 3300025315 Ga0207697_10072789 Ga0207697_100727892 402
790 3300025321 Ga0207656_10002604 Ga0207656_100026043 402
791 3300025893 Ga0207682_10000048 Ga0207682_1000004845 402
792 3300025893 Ga0207682_10004266 Ga0207682_100042663 402
793 3300025898 Ga0207692_10005709 Ga0207692_100057092 402
794 3300025898 Ga0207692_10020824 Ga0207692_100208241 402
795 3300025899 Ga0207642_10000907 Ga0207642_100009073 402
796 3300025899 Ga0207642_10001785 Ga0207642_100017853 402
797 3300025899 Ga0207642_10048896 Ga0207642_100488961 402
798 3300025900 Ga0207710_10001310 Ga0207710_100013105 402
799 3300025900 Ga0207710_10002593 Ga0207710_100025933 402
800 3300025900 Ga0207710_10033807 Ga0207710_100338071 402
801 3300025900 Ga0207710_10053272 Ga0207710_100532722 402
802 3300025901 Ga0207688_10000134 Ga0207688_1000013419 402
803 3300025901 Ga0207688_10000211 Ga0207688_100002112 402
804 3300025901 Ga0207688_10005003 Ga0207688_100050032 402
805 3300025903 Ga0207680_10000292 Ga0207680_100002929 402
806 3300025903 Ga0207680_10005007 Ga0207680_100050074 402
807 3300025903 Ga0207680_10055343 Ga0207680_100553432 402
808 3300025904 Ga0207647_10031325 Ga0207647_100313253 402
809 3300025905 Ga0207685_10042675 Ga0207685_100426752 402
810 3300025906 Ga0207699_10006284 Ga0207699_100062843 402
811 3300025907 Ga0207645_10000528 Ga0207645_1000052826 402
812 3300025907 Ga0207645_10000961 Ga0207645_100009619 402
813 3300025908 Ga0207643_10000016 Ga0207643_1000001663 402
814 3300025908 Ga0207643_10000481 Ga0207643_1000048118 402
815 3300025908 Ga0207643_10054941 Ga0207643_100549412 402
816 3300025909 Ga0207705_10004189 Ga0207705_100041893 402
817 3300025909 Ga0207705_10032870 Ga0207705_100328703 402
818 3300025909 Ga0207705_10061824 Ga0207705_100618242 402
819 3300025911 Ga0207654_10001993 Ga0207654_100019935 402
820 3300025911 Ga0207654_10002732 Ga0207654_100027323 402
821 3300025911 Ga0207654_10014119 Ga0207654_100141193 402
822 3300025911 Ga0207654_10107215 Ga0207654_101072151 402
823 3300025912 Ga0207707_10008850 Ga0207707_100088507 402
824 3300025912 Ga0207707_10011083 Ga0207707_100110833 402
825 3300025912 Ga0207707_10027658 Ga0207707_100276582 402
826 3300025912 Ga0207707_10051463 Ga0207707_100514632 402
827 3300025913 Ga0207695_10036837 Ga0207695_100368374 402
828 3300025914 Ga0207671_10002205 Ga0207671_100022059 402
829 3300025914 Ga0207671_10094305 Ga0207671_100943052 402
830 3300025915 Ga0207693_10000988 Ga0207693_1000098815 402
831 3300025915 Ga0207693_10002485 Ga0207693_100024858 402
832 3300025915 Ga0207693_10042682 Ga0207693_100426822 402
833 3300025915 Ga0207693_10047632 Ga0207693_100476322 402
834 3300025915 Ga0207693_10058273 Ga0207693_100582732 402
835 3300025915 Ga0207693_10078155 Ga0207693_100781552 402
836 3300025916 Ga0207663_10078819 Ga0207663_100788191 402
837 3300025916 Ga0207663_10151817 Ga0207663_101518171 402
838 3300025917 Ga0207660_10000104 Ga0207660_1000010432 402
839 3300025917 Ga0207660_10046815 Ga0207660_100468153 402
840 3300025917 Ga0207660_10068916 Ga0207660_100689162 402
841 3300025917 Ga0207660_10136568 Ga0207660_101365682 402
842 3300025917 Ga0207660_10140162 Ga0207660_101401622 402
843 3300025917 Ga0207660_10158164 Ga0207660_101581641 402
844 3300025918 Ga0207662_10000003 Ga0207662_1000000333 402
845 3300025918 Ga0207662_10009440 Ga0207662_100094404 402
846 3300025918 Ga0207662_10178463 Ga0207662_101784631 402
847 3300025919 Ga0207657_10000009 Ga0207657_10000009126 402
848 3300025919 Ga0207657_10011458 Ga0207657_100114586 402
849 3300025919 Ga0207657_10012103 Ga0207657_100121035 402
850 3300025919 Ga0207657_10054965 Ga0207657_100549653 402
851 3300025919 Ga0207657_10056087 Ga0207657_100560872 402
852 3300025919 Ga0207657_10095342 Ga0207657_100953422 402
853 3300025920 Ga0207649_10000141 Ga0207649_1000014153 402
854 3300025920 Ga0207649_10001150 Ga0207649_1000115012 402
855 3300025921 Ga0207652_10001464 Ga0207652_1000146412 402
856 3300025921 Ga0207652_10016390 Ga0207652_100163902 402
857 3300025921 Ga0207652_10059621 Ga0207652_100596212 402
858 3300025922 Ga0207646_10189150 Ga0207646_101891502 402
859 3300025923 Ga0207681_10000545 Ga0207681_100005454 402
860 3300025924 Ga0207694_10004477 Ga0207694_100044773 402
861 3300025924 Ga0207694_10104548 Ga0207694_101045482 402
862 3300025925 Ga0207650_10000492 Ga0207650_1000049221 402
863 3300025925 Ga0207650_10013326 Ga0207650_100133263 402
864 3300025925 Ga0207650_10030995 Ga0207650_100309953 402
865 3300025925 Ga0207650_10093023 Ga0207650_100930231 402
866 3300025926 Ga0207659_10000052 Ga0207659_1000005271 402
867 3300025926 Ga0207659_10000729 Ga0207659_1000072912 402
868 3300025927 Ga0207687_10000097 Ga0207687_100000974 402
869 3300025927 Ga0207687_10000921 Ga0207687_1000092116 402
870 3300025927 Ga0207687_10142195 Ga0207687_101421951 402
871 3300025927 Ga0207687_10172428 Ga0207687_101724281 402
872 3300025928 Ga0207700_10001350 Ga0207700_1000135011 402
873 3300025928 Ga0207700_10021623 Ga0207700_100216232 402
874 3300025928 Ga0207700_10035397 Ga0207700_100353972 402
875 3300025928 Ga0207700_10047683 Ga0207700_100476832 402
876 3300025928 Ga0207700_10060502 Ga0207700_100605022 402
877 3300025928 Ga0207700_10067988 Ga0207700_100679882 402
878 3300025928 Ga0207700_10158297 Ga0207700_101582972 402
879 3300025929 Ga0207664_10212577 Ga0207664_102125771 402
880 3300025929 Ga0207664_10262621 Ga0207664_102626212 402
881 3300025931 Ga0207644_10000263 Ga0207644_100002634 402
882 3300025931 Ga0207644_10003247 Ga0207644_100032474 402
883 3300025931 Ga0207644_10027851 Ga0207644_100278512 402
884 3300025931 Ga0207644_10043821 Ga0207644_100438212 402
885 3300025931 Ga0207644_10047129 Ga0207644_100471292 402
886 3300025932 Ga0207690_10000631 Ga0207690_100006314 402
887 3300025932 Ga0207690_10001244 Ga0207690_1000124411 402
888 3300025932 Ga0207690_10117517 Ga0207690_101175171 402
889 3300025932 Ga0207690_10187287 Ga0207690_101872872 402
890 3300025933 Ga0207706_10001434 Ga0207706_100014349 402
891 3300025933 Ga0207706_10016803 Ga0207706_100168034 402
892 3300025933 Ga0207706_10082864 Ga0207706_100828642 402
893 3300025933 Ga0207706_10096313 Ga0207706_100963132 402
894 3300025933 Ga0207706_10180533 Ga0207706_101805331 402
895 3300025934 Ga0207686_10001329 Ga0207686_100013294 402
896 3300025934 Ga0207686_10006655 Ga0207686_100066553 402
897 3300025934 Ga0207686_10026054 Ga0207686_100260542 402
898 3300025934 Ga0207686_10130464 Ga0207686_101304642 402
899 3300025935 Ga0207709_10000349 Ga0207709_1000034941 402
900 3300025935 Ga0207709_10006983 Ga0207709_100069832 402
901 3300025935 Ga0207709_10032785 Ga0207709_100327852 402
902 3300025935 Ga0207709_10223328 Ga0207709_102233281 402
903 3300025936 Ga0207670_10000245 Ga0207670_1000024521 402
904 3300025936 Ga0207670_10002128 Ga0207670_100021286 402
905 3300025936 Ga0207670_10006779 Ga0207670_100067792 402
906 3300025936 Ga0207670_10066215 Ga0207670_100662151 402
907 3300025937 Ga0207669_10000547 Ga0207669_100005478 402
908 3300025938 Ga0207704_10000156 Ga0207704_100001564 402
909 3300025938 Ga0207704_10000175 Ga0207704_1000017512 402
910 3300025938 Ga0207704_10096144 Ga0207704_100961442 402
911 3300025939 Ga0207665_10001219 Ga0207665_1000121914 402
912 3300025939 Ga0207665_10002363 Ga0207665_100023635 402
913 3300025940 Ga0207691_10000730 Ga0207691_100007309 402
914 3300025940 Ga0207691_10013319 Ga0207691_100133194 402
915 3300025940 Ga0207691_10069796 Ga0207691_100697962 402
916 3300025940 Ga0207691_10244984 Ga0207691_102449841 402
917 3300025941 Ga0207711_10000070 Ga0207711_1000007021 402
918 3300025941 Ga0207711_10005864 Ga0207711_100058647 402
919 3300025941 Ga0207711_10013998 Ga0207711_100139985 402
920 3300025941 Ga0207711_10018100 Ga0207711_100181002 402
921 3300025941 Ga0207711_10027221 Ga0207711_100272212 402
922 3300025942 Ga0207689_10001326 Ga0207689_100013269 402
923 3300025942 Ga0207689_10004056 Ga0207689_100040567 402
924 3300025942 Ga0207689_10138168 Ga0207689_101381681 402
925 3300025944 Ga0207661_10002308 Ga0207661_100023087 402
926 3300025944 Ga0207661_10174866 Ga0207661_101748661 402
927 3300025945 Ga0207679_10000035 Ga0207679_1000003547 402
928 3300025945 Ga0207679_10000364 Ga0207679_1000036421 402
929 3300025945 Ga0207679_10016618 Ga0207679_100166182 402
930 3300025945 Ga0207679_10020337 Ga0207679_100203372 402
931 3300025945 Ga0207679_10323974 Ga0207679_103239741 402
932 3300025949 Ga0207667_10041576 Ga0207667_100415762 402
933 3300025949 Ga0207667_10094323 Ga0207667_100943232 402
934 3300025949 Ga0207667_10193255 Ga0207667_101932552 402
935 3300025960 Ga0207651_10000030 Ga0207651_1000003039 402
936 3300025960 Ga0207651_10000180 Ga0207651_1000018022 402
937 3300025960 Ga0207651_10283881 Ga0207651_102838811 402
938 3300025961 Ga0207712_10000318 Ga0207712_1000031816 402
939 3300025961 Ga0207712_10000807 Ga0207712_1000080716 402
940 3300025961 Ga0207712_10005766 Ga0207712_100057662 402
941 3300025961 Ga0207712_10096860 Ga0207712_100968602 402
942 3300025972 Ga0207668_10000354 Ga0207668_100003544 402
943 3300025981 Ga0207640_10000543 Ga0207640_1000054315 402
944 3300025986 Ga0207658_10000141 Ga0207658_1000014136 402
945 3300025986 Ga0207658_10007561 Ga0207658_100075614 402
946 3300025986 Ga0207658_10143294 Ga0207658_101432941 402
947 3300026023 Ga0207677_10000028 Ga0207677_1000002856 402
948 3300026035 Ga0207703_10000398 Ga0207703_1000039824 402
949 3300026035 Ga0207703_10007050 Ga0207703_100070504 402
950 3300026035 Ga0207703_10096500 Ga0207703_100965003 402
951 3300026041 Ga0207639_10003015 Ga0207639_100030159 402
952 3300026041 Ga0207639_10011648 Ga0207639_100116482 402
953 3300026067 Ga0207678_10000569 Ga0207678_1000056910 402
954 3300026067 Ga0207678_10011093 Ga0207678_100110933 402
955 3300026067 Ga0207678_10012284 Ga0207678_100122842 402
956 3300026067 Ga0207678_10021743 Ga0207678_100217432 402
957 3300026067 Ga0207678_10094277 Ga0207678_100942772 402
958 3300026075 Ga0207708_10001083 Ga0207708_100010831 402
959 3300026075 Ga0207708_10008426 Ga0207708_100084263 402
960 3300026075 Ga0207708_10043030 Ga0207708_100430303 402
961 3300026075 Ga0207708_10072078 Ga0207708_100720783 402
962 3300026075 Ga0207708_10161739 Ga0207708_101617391 402
963 3300026078 Ga0207702_10007732 Ga0207702_100077323 402
964 3300026078 Ga0207702_10185453 Ga0207702_101854531 402
965 3300026088 Ga0207641_10098827 Ga0207641_100988272 402
966 3300026088 Ga0207641_10269734 Ga0207641_102697342 402
967 3300026089 Ga0207648_10001728 Ga0207648_1000172817 402
968 3300026089 Ga0207648_10024446 Ga0207648_100244464 402
969 3300026089 Ga0207648_10065584 Ga0207648_100655841 402
970 3300026095 Ga0207676_10000540 Ga0207676_1000054024 402
971 3300026095 Ga0207676_10074742 Ga0207676_100747422 402
972 3300026116 Ga0207674_10000103 Ga0207674_1000010337 402
973 3300026116 Ga0207674_10030337 Ga0207674_100303373 402
974 3300026118 Ga0207675_100000005 Ga0207675_10000000517 402
975 3300026118 Ga0207675_100029681 Ga0207675_1000296812 402
976 3300026118 Ga0207675_100357712 Ga0207675_1003577121 402
977 3300026121 Ga0207683_10000089 Ga0207683_1000008917 402
978 3300026121 Ga0207683_10002434 Ga0207683_100024345 402
979 3300026121 Ga0207683_10029607 Ga0207683_100296072 402
980 3300026121 Ga0207683_10038437 Ga0207683_100384372 402
981 3300026121 Ga0207683_10047521 Ga0207683_100475213 402
982 3300026121 Ga0207683_10314626 Ga0207683_103146261 402
983 3300026142 Ga0207698_10002914 Ga0207698_100029145 402
984 3300026142 Ga0207698_10008587 Ga0207698_100085875 402
985 3300027665 Ga0209983_1008676 Ga0209983_10086762 402
986 3300027671 Ga0209588_1014155 Ga0209588_10141552 402
987 3300027682 Ga0209971_1003936 Ga0209971_10039362 402
988 3300027695 Ga0209966_1010017 Ga0209966_10100171 402
989 3300027717 Ga0209998_10005504 Ga0209998_100055041 402
990 3300027876 Ga0209974_10006900 Ga0209974_100069001 402
991 3300027907 Ga0207428_10000075 Ga0207428_1000007597 402
992 3300027907 Ga0207428_10000428 Ga0207428_100004284 402
993 3300027907 Ga0207428_10003864 Ga0207428_1000386410 402
994 3300028379 Ga0268266_10001132 Ga0268266_1000113221 402
995 3300028379 Ga0268266_10319663 Ga0268266_103196631 402
996 3300028380 Ga0268265_10000571 Ga0268265_1000057116 402
997 3300028380 Ga0268265_10002724 Ga0268265_100027247 402
998 3300028381 Ga0268264_10000173 Ga0268264_1000017345 402
999 3300028381 Ga0268264_10007738 Ga0268264_100077383 402
1000 3300028381 Ga0268264_10239177 Ga0268264_102391772 402
1001 3300028556 Ga0265337_1009316 Ga0265337_10093162 402
1002 3300031090 Ga0265760_10023089 Ga0265760_100230892 402
1003 3300031238 Ga0265332_10001304 Ga0265332_100013044 402
1004 3300031241 Ga0265325_10000675 Ga0265325_100006755 402
1005 3300031241 Ga0265325_10001165 Ga0265325_100011655 402
1006 3300031241 Ga0265325_10002317 Ga0265325_100023172 402
1007 3300031241 Ga0265325_10013642 Ga0265325_100136422 402
1008 3300031247 Ga0265340_10002000 Ga0265340_100020001 402
1009 3300031247 Ga0265340_10040003 Ga0265340_100400032 402
1010 3300031249 Ga0265339_10000078 Ga0265339_1000007870 402
1011 3300031249 Ga0265339_10004450 Ga0265339_100044505 402
1012 3300031249 Ga0265339_10025129 Ga0265339_100251292 402
1013 3300031250 Ga0265331_10008199 Ga0265331_100081992 402
1014 3300031344 Ga0265316_10034356 Ga0265316_100343563 402
1015 3300031595 Ga0265313_10001257 Ga0265313_1000125715 402
1016 3300031595 Ga0265313_10003528 Ga0265313_100035283 402
1017 3300031712 Ga0265342_10000073 Ga0265342_1000007353 402
1018 3300031712 Ga0265342_10009074 Ga0265342_100090741 402
1019 3300031712 Ga0265342_10040934 Ga0265342_100409342 402
1020 3300034957 Ga0373938_0002538 Ga0373938_0002538_366_1574 402
1021 3300035083 Ga0373926_0005557 Ga0373926_0005557_2437_3645 402
1022 3300035089 Ga0373944_0000336 Ga0373944_0000336_612_1820 402
1023 3300035089 Ga0373944_0002458 Ga0373944_0002458_302_1510 402
1024 3300035089 Ga0373944_0010703 Ga0373944_0010703_1224_2432 402
1025 3300035090 Ga0373949_0002002 Ga0373949_0002002_414_1622 402
1026 3300035091 Ga0373951_0003392 Ga0373951_0003392_2430_3638 402
1027 3300035092 Ga0373952_0001726 Ga0373952_0001726_2370_3578 402
1028 3300035092 Ga0373952_0003168 Ga0373952_0003168_1722_2930 402
1029 3300035111 Ga0373923_0003361 Ga0373923_0003361_526_1734 402
1030 3300035113 Ga0373936_0003948 Ga0373936_0003948_1226_2434 402
1031 3300035113 Ga0373936_0020990 Ga0373936_0020990_257_1465 402
1032 3300035114 Ga0373939_0001168 Ga0373939_0001168_4742_5950 402
1033 3300035114 Ga0373939_0003700 Ga0373939_0003700_713_1921 402
1034 3300035115 Ga0373941_0004243 Ga0373941_0004243_1037_2245 402
1035 3300035116 Ga0373945_0002929 Ga0373945_0002929_565_1773 402
1036 3300035116 Ga0373945_0023460 Ga0373945_0023460_247_1455 402
1037 3300035117 Ga0373953_0011278 Ga0373953_0011278_23_1231 402
1038 3300035118 Ga0373954_0010191 Ga0373954_0010191_2442_3650 402
1039 3300035118 Ga0373954_0010455 Ga0373954_0010455_2825_4033 402
1040 3300035118 Ga0373954_0045073 Ga0373954_0045073_606_1814 402
1041 3300035119 Ga0373956_0021791 Ga0373956_0021791_419_1627 402
1042 3300035120 Ga0373957_0004933 Ga0373957_0004933_720_1928 402
1043 3300035121 Ga0373960_0000460 Ga0373960_0000460_4383_5591 402
1044 3300035170 Ga0373943_0000208 Ga0373943_0000208_4354_5562 402
1045 3300035171 Ga0373946_0006762 Ga0373946_0006762_165_1373 402
1046 3300035171 Ga0373946_0038268 Ga0373946_0038268_422_1630 402
1047 3300035172 Ga0373955_0009876 Ga0373955_0009876_1192_2400 402
1048 3300035172 Ga0373955_0012269 Ga0373955_0012269_2764_3972 402
1049 3300035172 Ga0373955_0012943 Ga0373955_0012943_1326_2534 402
1050 3300035172 Ga0373955_0092178 Ga0373955_0092178_450_1658 402
1051 3300035242 Ga0373962_0001597 Ga0373962_0001597_3548_4756 402
1052 3300035691 Ga0373931_0001939 Ga0373931_0001939_4173_5381 402
1053 3300035691 Ga0373931_0005699 Ga0373931_0005699_4429_5637 402
1054 3300035691 Ga0373931_0022590 Ga0373931_0022590_17_1225 402
1055 3300035695 Ga0373927_0006191 Ga0373927_0006191_3660_4868 402
1056 3300035695 Ga0373927_0019402 Ga0373927_0019402_1118_2326 402
1057 3300035695 Ga0373927_0024353 Ga0373927_0024353_145_1353 402
1058 3300035724 Ga0373933_0009842 Ga0373933_0009842_3890_5098 402
1059 3300035724 Ga0373933_0031740 Ga0373933_0031740_1576_2784 402
1060 3300035724 Ga0373933_0074822 Ga0373933_0074822_760_1968 402
1061 3300035724 Ga0373933_0174652 Ga0373933_0174652_26_1234 402
1062 3300035725 Ga0373947_0002816 Ga0373947_0002816_8295_9503 402
1063 3300036401 Ga0373937_0002800 Ga0373937_0002800_4245_5453 402
1064 3300036401 Ga0373937_0005051 Ga0373937_0005051_6481_7689 402
1065 3300036401 Ga0373937_0009617 Ga0373937_0009617_4458_5666 402
1066 3300036401 Ga0373937_0020811 Ga0373937_0020811_3264_4472 402
1067 3300036401 Ga0373937_0031458 Ga0373937_0031458_1244_2452 402
1068 3300036401 Ga0373937_0045928 Ga0373937_0045928_299_1507 402
1069 3300037068 Ga0373925_0001482 Ga0373925_0001482_3116_4324 402
1070 3300037068 Ga0373925_0007213 Ga0373925_0007213_4415_5623 402
1071 3300037068 Ga0373925_0047998 Ga0373925_0047998_1656_2864 402
1072 3300037068 Ga0373925_0059697 Ga0373925_0059697_907_2115 402
1073 3300037068 Ga0373925_0072286 Ga0373925_0072286_444_1652 402
1074 3300037312 Ga0395899_0012752 Ga0395899_0012752_2062_3270 402
1075 3300037418 Ga0395900_0005902 Ga0395900_0005902_9515_10723 402
1076 3300037466 Ga0395898_0004247 Ga0395898_0004247_10112_11320 402
1077 3300037853 Ga0436364_0146559 Ga0436364_0146559_50_1258 402
1078 3300037853 Ga0436364_1179061 Ga0436364_1179061_467_1675 402
1079 3300038443 Ga0395901_0074958 Ga0395901_0074958_13_1221 402
1080 3300039437 Ga0436365_0042743 Ga0436365_0042743_1125_2333 402
1081 3300039437 Ga0436365_1613453 Ga0436365_1613453_18619_19827 402
1082 3300039453 Ga0436362_0143155 Ga0436362_0143155_100_1308 402
1083 3300041408 Ga0439453_0005243 Ga0439453_0005243_309_1517 402
1084 3300042005 Ga0439448_0014430 Ga0439448_0014430_498_1706 402
1085 3300044694 Ga0466963_0079248 Ga0466963_0079248_855_2063 402
1086 3300044719 Ga0466971_0034544 Ga0466971_0034544_537_1745 402
1087 3300044842 Ga0466957_0010694 Ga0466957_0010694_1042_2250 402
1088 3300044842 Ga0466957_0050636 Ga0466957_0050636_209_1417 402
1089 3300044901 Ga0466960_0044701 Ga0466960_0044701_458_1666 402
1090 3300045836 Ga0466958_0018514 Ga0466958_0018514_2773_3981 402
1091 3300046452 Ga0495617_008981 Ga0495617_008981_706_1914 402
1092 3300046452 Ga0495617_020387 Ga0495617_020387_687_1895 402
1093 3300046454 Ga0495592_0062601 Ga0495592_0062601_856_2064 402
1094 3300046455 Ga0495603_0027302 Ga0495603_0027302_842_2050 402
1095 3300046455 Ga0495603_0029965 Ga0495603_0029965_622_1830 402
1096 3300046459 Ga0495629_0007816 Ga0495629_0007816_1150_2358 402
1097 3300046459 Ga0495629_0098447 Ga0495629_0098447_293_1501 402
1098 3300046459 Ga0495629_0152922 Ga0495629_0152922_363_1571 402
1099 3300046461 Ga0495641_0006021 Ga0495641_0006021_579_1787 402
1100 3300046462 Ga0495651_0003743 Ga0495651_0003743_8135_9343 402
1101 3300046462 Ga0495651_0017511 Ga0495651_0017511_2222_3430 402
1102 3300046462 Ga0495651_0165244 Ga0495651_0165244_227_1435 402
1103 3300046463 Ga0495653_0002496 Ga0495653_0002496_9156_10364 402
1104 3300046463 Ga0495653_0009473 Ga0495653_0009473_145_1353 402
1105 3300046463 Ga0495653_0011016 Ga0495653_0011016_2851_4059 402
1106 3300046472 Ga0495580_0091021 Ga0495580_0091021_75_1283 402
1107 3300046472 Ga0495580_0167173 Ga0495580_0167173_71_1279 402
1108 3300046473 Ga0495582_0041558 Ga0495582_0041558_1226_2434 402
1109 3300046474 Ga0495605_0084584 Ga0495605_0084584_221_1429 402
1110 3300046475 Ga0495639_0008239 Ga0495639_0008239_1223_2431 402
1111 3300046475 Ga0495639_0074337 Ga0495639_0074337_35_1243 402
1112 3300046476 Ga0495662_0019079 Ga0495662_0019079_1818_3026 402
1113 3300046476 Ga0495662_0056650 Ga0495662_0056650_339_1547 402
1114 3300046477 Ga0495664_0006418 Ga0495664_0006418_3079_4287 402
1115 3300046477 Ga0495664_0010291 Ga0495664_0010291_674_1882 402
1116 3300046491 Ga0495584_0030822 Ga0495584_0030822_1264_2472 402
1117 3300046491 Ga0495584_0039135 Ga0495584_0039135_515_1723 402
1118 3300046491 Ga0495584_0044409 Ga0495584_0044409_472_1680 402
1119 3300046492 Ga0495585_0001626 Ga0495585_0001626_15669_16877 402
1120 3300046492 Ga0495585_0047972 Ga0495585_0047972_1019_2227 402
1121 3300046511 Ga0495608_0009086 Ga0495608_0009086_4088_5296 402
1122 3300046511 Ga0495608_0025821 Ga0495608_0025821_50_1258 402
1123 3300046511 Ga0495608_0063758 Ga0495608_0063758_129_1337 402
1124 3300046514 Ga0495618_0006484 Ga0495618_0006484_340_1548 402
1125 3300046514 Ga0495618_0041757 Ga0495618_0041757_1107_2315 402
1126 3300046514 Ga0495618_0046707 Ga0495618_0046707_1316_2524 402
1127 3300046516 Ga0495628_0010231 Ga0495628_0010231_37_1245 402
1128 3300046516 Ga0495628_0038927 Ga0495628_0038927_2443_3651 402
1129 3300046517 Ga0495630_0040689 Ga0495630_0040689_1661_2869 402
1130 3300046517 Ga0495630_0102908 Ga0495630_0102908_522_1730 402
1131 3300046517 Ga0495630_0129088 Ga0495630_0129088_348_1556 402
1132 3300046519 Ga0495632_0087319 Ga0495632_0087319_233_1441 402
1133 3300046520 Ga0495637_0046789 Ga0495637_0046789_523_1731 402
1134 3300046523 Ga0495644_0003879 Ga0495644_0003879_3487_4695 402
1135 3300046525 Ga0495663_0002724 Ga0495663_0002724_675_1883 402
1136 3300046526 Ga0495666_0005027 Ga0495666_0005027_3186_4394 402
1137 3300046526 Ga0495666_0016921 Ga0495666_0016921_155_1363 402
1138 3300046526 Ga0495666_0059989 Ga0495666_0059989_556_1764 402
1139 3300046528 Ga0495642_0046584 Ga0495642_0046584_357_1565 402
1140 3300046531 Ga0495665_0021287 Ga0495665_0021287_39_1247 402
1141 3300046533 Ga0495640_0010918 Ga0495640_0010918_165_1373 402
1142 3300046533 Ga0495640_0015636 Ga0495640_0015636_618_1826 402
1143 3300046533 Ga0495640_0030990 Ga0495640_0030990_573_1781 402
1144 3300046535 Ga0495586_0021860 Ga0495586_0021860_2108_3316 402
1145 3300046535 Ga0495586_0058892 Ga0495586_0058892_345_1553 402
1146 3300046536 Ga0495587_0000506 Ga0495587_0000506_3572_4780 402
1147 3300046536 Ga0495587_0011950 Ga0495587_0011950_3674_4882 402
1148 3300046536 Ga0495587_0014386 Ga0495587_0014386_2701_3909 402
1149 3300046536 Ga0495587_0071047 Ga0495587_0071047_136_1344 402
1150 3300046537 Ga0495598_0019932 Ga0495598_0019932_315_1523 402
1151 3300046543 Ga0495645_0042265 Ga0495645_0042265_1072_2280 402
1152 3300046543 Ga0495645_0046452 Ga0495645_0046452_699_1907 402
1153 3300046557 Ga0495622_0001095 Ga0495622_0001095_2428_3636 402
1154 3300046558 Ga0495633_0003560 Ga0495633_0003560_3655_4863 402
1155 3300046559 Ga0495667_0005439 Ga0495667_0005439_7231_8439 402
1156 3300046559 Ga0495667_0006498 Ga0495667_0006498_3271_4479 402
1157 3300046559 Ga0495667_0013469 Ga0495667_0013469_581_1789 402
1158 3300046615 Ga0495656_0000519 Ga0495656_0000519_5057_6265 402
1159 3300046615 Ga0495656_0010029 Ga0495656_0010029_659_1867 402
1160 3300046642 Ga0495634_0006515 Ga0495634_0006515_7613_8821 402
1161 3300046642 Ga0495634_0007380 Ga0495634_0007380_4959_6167 402
1162 3300046642 Ga0495634_0026402 Ga0495634_0026402_2450_3658 402
1163 3300046642 Ga0495634_0083591 Ga0495634_0083591_318_1526 402
1164 3300046642 Ga0495634_0172370 Ga0495634_0172370_19_1227 402
1165 3300046663 Ga0495635_0007866 Ga0495635_0007866_5088_6296 402
1166 3300046663 Ga0495635_0015292 Ga0495635_0015292_1661_2869 402
1167 3300046663 Ga0495635_0030948 Ga0495635_0030948_1627_2835 402
1168 3300046664 Ga0495659_0002230 Ga0495659_0002230_3915_5123 402
1169 3300046665 Ga0495661_0094460 Ga0495661_0094460_474_1682 402
1170 3300046674 Ga0495588_0029129 Ga0495588_0029129_1084_2292 402
1171 3300046674 Ga0495588_0129784 Ga0495588_0129784_98_1306 402
1172 3300046675 Ga0495657_0018501 Ga0495657_0018501_3333_4541 402
1173 3300046675 Ga0495657_0027977 Ga0495657_0027977_264_1472 402
1174 3300046675 Ga0495657_0096978 Ga0495657_0096978_126_1334 402
1175 3300046678 Ga0495599_0005246 Ga0495599_0005246_165_1373 402
1176 3300046678 Ga0495599_0024663 Ga0495599_0024663_2409_3617 402
1177 3300046678 Ga0495599_0039264 Ga0495599_0039264_81_1289 402
1178 3300046678 Ga0495599_0164780 Ga0495599_0164780_14_1222 402
1179 3300046679 Ga0495623_0003225 Ga0495623_0003225_5993_7201 402
1180 3300046679 Ga0495623_0010464 Ga0495623_0010464_4718_5926 402
1181 3300046679 Ga0495623_0026492 Ga0495623_0026492_173_1381 402
1182 3300046680 Ga0495646_0003643 Ga0495646_0003643_8235_9443 402
1183 3300046680 Ga0495646_0009489 Ga0495646_0009489_3192_4400 402
1184 3300046680 Ga0495646_0010180 Ga0495646_0010180_2570_3778 402
1185 3300046681 Ga0495647_0006912 Ga0495647_0006912_1036_2244 402
1186 3300046681 Ga0495647_0027746 Ga0495647_0027746_775_1983 402
1187 3300046683 Ga0495658_0021561 Ga0495658_0021561_415_1623 402
1188 3300046683 Ga0495658_0043719 Ga0495658_0043719_220_1449 402
1189 3300046684 Ga0495669_0056271 Ga0495669_0056271_447_1655 402
1190 3300046689 Ga0495613_0058212 Ga0495613_0058212_106_1335 402
1191 3300046689 Ga0495613_0070264 Ga0495613_0070264_1093_2301 402
1192 3300046689 Ga0495613_0082388 Ga0495613_0082388_484_1692 402
1193 3300046690 Ga0495624_0029594 Ga0495624_0029594_1895_3103 402
1194 3300046691 Ga0495670_0004031 Ga0495670_0004031_1265_2473 402
1195 3300046691 Ga0495670_0019915 Ga0495670_0019915_1330_2538 402
1196 3300046809 Ga0495600_0001615 Ga0495600_0001615_594_1802 402
1197 3300046809 Ga0495600_0006006 Ga0495600_0006006_3832_5040 402
1198 3300046809 Ga0495600_0028026 Ga0495600_0028026_1115_2323 402
1199 3300046809 Ga0495600_0035531 Ga0495600_0035531_814_2022 402
1200 3300047315 Ga0495581_0007026 Ga0495581_0007026_2500_3708 402
1201 3300047315 Ga0495581_0021213 Ga0495581_0021213_2130_3338 402
1202 3300047315 Ga0495581_0117695 Ga0495581_0117695_143_1351 402
1203 3300047317 Ga0495604_0000765 Ga0495604_0000765_167_1375 402
1204 3300047317 Ga0495604_0003474 Ga0495604_0003474_3067_4275 402
1205 3300047317 Ga0495604_0031190 Ga0495604_0031190_581_1789 402
1206 3300047319 Ga0495674_0008389 Ga0495674_0008389_4177_5385 402
1207 3300047319 Ga0495674_0036288 Ga0495674_0036288_2658_3866 402
1208 3300047319 Ga0495674_0066567 Ga0495674_0066567_780_1988 402
1209 3300047320 Ga0495672_0043636 Ga0495672_0043636_1275_2618 402
1210 3300047321 Ga0495676_0025340 Ga0495676_0025340_1223_2431 402
1211 3300047321 Ga0495676_0072883 Ga0495676_0072883_1319_2527 402
1212 3300047322 Ga0495680_0001188 Ga0495680_0001188_26203_27411 402
1213 3300047322 Ga0495680_0016535 Ga0495680_0016535_251_1459 402
1214 3300047444 Ga0495675_0001145 Ga0495675_0001145_10970_12178 402
1215 3300047444 Ga0495675_0021391 Ga0495675_0021391_1968_3176 402
1216 3300047444 Ga0495675_0086750 Ga0495675_0086750_82_1290 402
1217 3300047445 Ga0495677_0013508 Ga0495677_0013508_789_1997 402
1218 3300047446 Ga0495679_007558 Ga0495679_007558_675_1883 402
1219 3300047446 Ga0495679_023794 Ga0495679_023794_680_1888 402
1220 3300047471 Ga0495684_0003642 Ga0495684_0003642_7409_8617 402
1221 3300047471 Ga0495684_0023296 Ga0495684_0023296_35_1243 402
1222 3300047471 Ga0495684_0026702 Ga0495684_0026702_1268_2476 402
1223 3300047673 Ga0495593_0006926 Ga0495593_0006926_1043_2251 402
1224 3300047673 Ga0495593_0007999 Ga0495593_0007999_1686_2894 402
1225 3300047673 Ga0495593_0011406 Ga0495593_0011406_1927_3135 402
1226 3300047673 Ga0495593_0027345 Ga0495593_0027345_387_1595 402
1227 3300047673 Ga0495593_0045992 Ga0495593_0045992_845_2053 402
1228 3300048088 Ga0495602_0016494 Ga0495602_0016494_420_1628 402
1229 3300048088 Ga0495602_0044603 Ga0495602_0044603_167_1375 402
1230 3300048089 Ga0495614_0003010 Ga0495614_0003010_167_1375 402
1231 3300048903 Ga0496100_0000806 Ga0496100_0000806_3669_4877 402
1232 3300048903 Ga0496100_0012562 Ga0496100_0012562_1091_2299 402
1233 3300048903 Ga0496100_0040648 Ga0496100_0040648_768_1976 402
1234 3300048904 Ga0496101_0000218 Ga0496101_0000218_32971_34179 402
1235 3300048904 Ga0496101_0002910 Ga0496101_0002910_4772_5980 402
1236 3300048904 Ga0496101_0003293 Ga0496101_0003293_4011_5219 402
1237 3300048904 Ga0496101_0016402 Ga0496101_0016402_56_1267 402
1238 3300048904 Ga0496101_0090255 Ga0496101_0090255_30_1238 402
1239 3300048904 Ga0496101_0091091 Ga0496101_0091091_677_1885 402
1240 3300048904 Ga0496101_0167185 Ga0496101_0167185_89_1297 402
1241 3300048905 Ga0496102_0004765 Ga0496102_0004765_2809_4065 402
1242 3300048905 Ga0496102_0007777 Ga0496102_0007777_3780_4988 402
1243 3300048905 Ga0496102_0015827 Ga0496102_0015827_1200_2408 402
1244 3300048905 Ga0496102_0047952 Ga0496102_0047952_551_1762 402
1245 3300048905 Ga0496102_0228215 Ga0496102_0228215_87_1295 402
1246 3300048906 Ga0496103_0019951 Ga0496103_0019951_2787_3995 402
1247 3300048906 Ga0496103_0051376 Ga0496103_0051376_1311_2519 402
1248 3300048906 Ga0496103_0055446 Ga0496103_0055446_546_1802 402
1249 3300048906 Ga0496103_0070640 Ga0496103_0070640_483_1691 402
1250 3300048907 Ga0496104_0000517 Ga0496104_0000517_16805_18013 402
1251 3300048907 Ga0496104_0000660 Ga0496104_0000660_5408_6616 402
1252 3300048907 Ga0496104_0000706 Ga0496104_0000706_11632_12840 402
1253 3300048907 Ga0496104_0002368 Ga0496104_0002368_4108_5316 402
1254 3300048907 Ga0496104_0007271 Ga0496104_0007271_8122_9330 402
1255 3300048907 Ga0496104_0041980 Ga0496104_0041980_511_1719 402
1256 3300048907 Ga0496104_0060588 Ga0496104_0060588_2041_3249 402
1257 3300048908 Ga0496105_0002363 Ga0496105_0002363_5155_6363 402
1258 3300048908 Ga0496105_0004861 Ga0496105_0004861_308_1516 402
1259 3300048908 Ga0496105_0028772 Ga0496105_0028772_2345_3553 402
1260 3300048908 Ga0496105_0034800 Ga0496105_0034800_2828_4036 402
1261 3300048908 Ga0496105_0107773 Ga0496105_0107773_564_1772 402
1262 3300048909 Ga0496106_0000782 Ga0496106_0000782_3686_4894 402
1263 3300048909 Ga0496106_0004371 Ga0496106_0004371_6619_7827 402
1264 3300048909 Ga0496106_0092108 Ga0496106_0092108_64_1347 402
1265 3300048910 Ga0496107_0003226 Ga0496107_0003226_8438_9646 402
1266 3300048910 Ga0496107_0005153 Ga0496107_0005153_4154_5362 402
1267 3300048910 Ga0496107_0006743 Ga0496107_0006743_1288_2496 402
1268 3300048910 Ga0496107_0023538 Ga0496107_0023538_2396_3679 402
1269 3300048910 Ga0496107_0038390 Ga0496107_0038390_2065_3273 402
1270 3300048910 Ga0496107_0172834 Ga0496107_0172834_360_1568 402
1271 3300048910 Ga0496107_0195668 Ga0496107_0195668_238_1446 402
1272 3300048911 Ga0496108_0003546 Ga0496108_0003546_98_1306 402
1273 3300048911 Ga0496108_0019413 Ga0496108_0019413_917_2125 402
1274 3300048911 Ga0496108_0021647 Ga0496108_0021647_2124_3332 402
1275 3300048911 Ga0496108_0034889 Ga0496108_0034889_2020_3276 402
1276 3300048911 Ga0496108_0082432 Ga0496108_0082432_329_1537 402
1277 3300048911 Ga0496108_0211088 Ga0496108_0211088_295_1503 402
1278 3300048912 Ga0496109_0000536 Ga0496109_0000536_4131_5339 402
1279 3300048912 Ga0496109_0000979 Ga0496109_0000979_18258_19466 402
1280 3300048912 Ga0496109_0014375 Ga0496109_0014375_1521_2729 402
1281 3300048912 Ga0496109_0032080 Ga0496109_0032080_175_1383 402
1282 3300048912 Ga0496109_0148181 Ga0496109_0148181_308_1516 402
1283 3300048912 Ga0496109_0215938 Ga0496109_0215938_26_1234 402
1284 3300048913 Ga0496110_0003688 Ga0496110_0003688_5970_7178 402
1285 3300048913 Ga0496110_0023709 Ga0496110_0023709_617_1825 402
1286 3300048913 Ga0496110_0027734 Ga0496110_0027734_1070_2278 402
1287 3300048913 Ga0496110_0048608 Ga0496110_0048608_2147_3355 402
1288 3300048913 Ga0496110_0097052 Ga0496110_0097052_132_1340 402
1289 3300048913 Ga0496110_0140256 Ga0496110_0140256_390_1598 402
1290 3300048913 Ga0496110_0190825 Ga0496110_0190825_65_1273 402
1291 3300048914 Ga0496111_0001920 Ga0496111_0001920_1168_2376 402
1292 3300048914 Ga0496111_0012142 Ga0496111_0012142_739_1947 402
1293 3300048914 Ga0496111_0021812 Ga0496111_0021812_2151_3359 402
1294 3300048914 Ga0496111_0042289 Ga0496111_0042289_715_1923 402
1295 3300048914 Ga0496111_0242731 Ga0496111_0242731_40_1248 402
1296 3300048915 Ga0496112_0000321 Ga0496112_0000321_25463_26719 402
1297 3300048915 Ga0496112_0001698 Ga0496112_0001698_732_1940 402
1298 3300048915 Ga0496112_0256064 Ga0496112_0256064_477_1685 402
1299 3300048916 Ga0496113_0031501 Ga0496113_0031501_256_1512 402
1300 3300048916 Ga0496113_0060009 Ga0496113_0060009_555_1763 402
1301 3300048916 Ga0496113_0063469 Ga0496113_0063469_1496_2704 402
1302 3300048916 Ga0496113_0108354 Ga0496113_0108354_181_1389 402
1303 3300048917 Ga0496114_0001562 Ga0496114_0001562_14591_15799 402
1304 3300048917 Ga0496114_0005533 Ga0496114_0005533_5020_6228 402
1305 3300048917 Ga0496114_0009873 Ga0496114_0009873_2051_3259 402
1306 3300048917 Ga0496114_0056934 Ga0496114_0056934_1597_2805 402
1307 3300048917 Ga0496114_0199157 Ga0496114_0199157_196_1404 402
1308 3300048917 Ga0496114_0304461 Ga0496114_0304461_140_1348 402
1309 3300048918 Ga0496115_0004506 Ga0496115_0004506_793_2001 402
1310 3300048918 Ga0496115_0005759 Ga0496115_0005759_4127_5335 402
1311 3300048918 Ga0496115_0021040 Ga0496115_0021040_979_2187 402
1312 3300049568 Ga0501031_0094907 Ga0501031_0094907_230_1438 402
1313 3300049569 Ga0501032_0019895 Ga0501032_0019895_445_1653 402
1314 3300049569 Ga0501032_0043536 Ga0501032_0043536_1030_2238 402
1315 3300049569 Ga0501032_0049720 Ga0501032_0049720_1553_2761 402
1316 3300049569 Ga0501032_0073913 Ga0501032_0073913_541_1749 402
1317 3300049570 Ga0501033_0101440 Ga0501033_0101440_172_1380 402
1318 3300049571 Ga0501034_0001160 Ga0501034_0001160_11479_12687 402
1319 3300049571 Ga0501034_0041922 Ga0501034_0041922_528_1736 402
1320 3300049571 Ga0501034_0135610 Ga0501034_0135610_201_1409 402
1321 3300049572 Ga0501036_0000559 Ga0501036_0000559_24920_26128 402
1322 3300049572 Ga0501036_0044597 Ga0501036_0044597_177_1385 402
1323 3300049573 Ga0501037_0027932 Ga0501037_0027932_2356_3564 402
1324 3300049573 Ga0501037_0031175 Ga0501037_0031175_396_1604 402
1325 3300049575 Ga0501039_0029646 Ga0501039_0029646_2011_3219 402
1326 3300049575 Ga0501039_0037427 Ga0501039_0037427_2450_3658 402
1327 3300049575 Ga0501039_0205368 Ga0501039_0205368_155_1363 402
1328 3300049578 Ga0501042_0086589 Ga0501042_0086589_249_1457 402
1329 3300049579 Ga0501043_0008361 Ga0501043_0008361_5579_6787 402
1330 3300049580 Ga0501046_0023588 Ga0501046_0023588_432_1640 402
1331 3300049581 Ga0501047_0005615 Ga0501047_0005615_8272_9480 402
1332 3300049581 Ga0501047_0069777 Ga0501047_0069777_666_1874 402
1333 3300049583 Ga0501067_0025881 Ga0501067_0025881_435_1643 402
1334 3300049584 Ga0501068_0052822 Ga0501068_0052822_140_1348 402
1335 3300049584 Ga0501068_0158117 Ga0501068_0158117_87_1295 402
1336 3300049585 Ga0501069_0017483 Ga0501069_0017483_2515_3723 402
1337 3300049585 Ga0501069_0020685 Ga0501069_0020685_1093_2301 402
1338 3300049586 Ga0501070_0003185 Ga0501070_0003185_2534_3742 402
1339 3300049586 Ga0501070_0006950 Ga0501070_0006950_5895_7103 402
1340 3300049586 Ga0501070_0052623 Ga0501070_0052623_519_1727 402
1341 3300049587 Ga0501071_0059445 Ga0501071_0059445_189_1397 402
1342 3300049587 Ga0501071_0064805 Ga0501071_0064805_946_2154 402
1343 3300049587 Ga0501071_0155261 Ga0501071_0155261_14_1567 402
1344 3300049588 Ga0501072_0101263 Ga0501072_0101263_657_1865 402
1345 3300049589 Ga0501073_0029438 Ga0501073_0029438_2189_3397 402
1346 3300049589 Ga0501073_0035382 Ga0501073_0035382_403_1611 402
1347 3300049589 Ga0501073_0093585 Ga0501073_0093585_265_1476 402
1348 3300049589 Ga0501073_0115259 Ga0501073_0115259_509_1717 402
1349 3300049590 Ga0501074_0019276 Ga0501074_0019276_2138_3346 402
1350 3300049590 Ga0501074_0036306 Ga0501074_0036306_1070_2278 402
1351 3300049591 Ga0501075_0018301 Ga0501075_0018301_3688_4896 402
1352 3300049591 Ga0501075_0164669 Ga0501075_0164669_185_1456 402
1353 3300049592 Ga0501076_0012931 Ga0501076_0012931_4844_6052 402
1354 3300049592 Ga0501076_0076995 Ga0501076_0076995_1135_2343 402
1355 3300049742 Ga0501080_0021308 Ga0501080_0021308_3279_4487 402
1356 3300049742 Ga0501080_0120018 Ga0501080_0120018_121_1329 402
1357 3300049742 Ga0501080_0192597 Ga0501080_0192597_229_1437 402
1358 3300049742 Ga0501080_0243335 Ga0501080_0243335_31_1239 402
1359 3300049743 Ga0501081_0064826 Ga0501081_0064826_1176_2384 402
1360 3300049822 Ga0501035_0000127 Ga0501035_0000127_66697_67905 402
1361 3300049823 Ga0501044_0016835 Ga0501044_0016835_2072_3280 402
1362 3300049823 Ga0501044_0097252 Ga0501044_0097252_288_1496 402
1363 3300049823 Ga0501044_0106918 Ga0501044_0106918_114_1322 402
1364 3300050491 nmdc:mga00v17_127190_c1 nmdc:mga00v17_127190_c1_127_1335 402
1365 3300050492 nmdc:mga0yw44_108265_c1 nmdc:mga0yw44_108265_c1_523_1731 402
1366 3300050492 nmdc:mga0yw44_11835_c1 nmdc:mga0yw44_11835_c1_1601_2809 402
1367 3300050492 nmdc:mga0yw44_22213_c1 nmdc:mga0yw44_22213_c1_193_1401 402
1368 3300050492 nmdc:mga0yw44_35578_c1 nmdc:mga0yw44_35578_c1_923_2131 402
1369 3300050493 nmdc:mga0k408_77671_c1 nmdc:mga0k408_77671_c1_389_1597 402
1370 3300050494 nmdc:mga06z11_28384_c1 nmdc:mga06z11_28384_c1_37_1245 402
1371 3300050494 nmdc:mga06z11_85837_c1 nmdc:mga06z11_85837_c1_339_1547 402
1372 3300050496 nmdc:mga07m45_38690_c1 nmdc:mga07m45_38690_c1_782_1990 402
1373 3300050507 nmdc:mga05p37_294830_c1 nmdc:mga05p37_294830_c1_640_1848 402
1374 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_17435_18643 402
1375 3300050507 nmdc:mga05p37_46630_c1 nmdc:mga05p37_46630_c1_470_1678 402
1376 3300050508 nmdc:mga09592_1294_c1 nmdc:mga09592_1294_c1_5509_6717 402
1377 3300050509 nmdc:mga0qj67_24480_c1 nmdc:mga0qj67_24480_c1_2375_3583 402
1378 3300050509 nmdc:mga0qj67_52_c1 nmdc:mga0qj67_52_c1_29892_31100 402
1379 3300050510 nmdc:mga06r32_448_c1 nmdc:mga06r32_448_c1_5509_6717 402
1380 3300050511 nmdc:mga08y16_31199_c1 nmdc:mga08y16_31199_c1_3575_4783 402
1381 3300050511 nmdc:mga08y16_38697_c1 nmdc:mga08y16_38697_c1_637_1845 402
1382 3300050511 nmdc:mga08y16_997_c1 nmdc:mga08y16_997_c1_9698_10906 402
1383 3300050512 nmdc:mga0n895_12777_c1 nmdc:mga0n895_12777_c1_656_1864 402
1384 3300050512 nmdc:mga0n895_145644_c1 nmdc:mga0n895_145644_c1_85_1293 402
1385 3300050512 nmdc:mga0n895_275109_c1 nmdc:mga0n895_275109_c1_305_1513 402
1386 3300050512 nmdc:mga0n895_32961_c1 nmdc:mga0n895_32961_c1_505_1731 402
1387 3300050512 nmdc:mga0n895_3595_c1 nmdc:mga0n895_3595_c1_309_1517 402
1388 3300050513 nmdc:mga0rr50_12032_c2 nmdc:mga0rr50_12032_c2_2383_3591 402
1389 3300050513 nmdc:mga0rr50_20582_c1 nmdc:mga0rr50_20582_c1_1354_2562 402
1390 3300050513 nmdc:mga0rr50_86337_c1 nmdc:mga0rr50_86337_c1_906_2114 402
1391 3300050513 nmdc:mga0rr50_86552_c1 nmdc:mga0rr50_86552_c1_539_1810 402
1392 3300050514 nmdc:mga08x19_14439_c1 nmdc:mga08x19_14439_c1_522_1730 402
1393 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_106463_107671 402
1394 3300050515 nmdc:mga0a205_12561_c1 nmdc:mga0a205_12561_c1_3933_5141 402
1395 3300050515 nmdc:mga0a205_80086_c1 nmdc:mga0a205_80086_c1_1641_2915 402
1396 3300050516 nmdc:mga0sz30_43842_c1 nmdc:mga0sz30_43842_c1_172_1380 402
1397 3300053077 Ga0495601_0000848 Ga0495601_0000848_420_1628 402
1398 3300053077 Ga0495601_0004954 Ga0495601_0004954_2406_3614 402
1399 3300053077 Ga0495601_0027558 Ga0495601_0027558_1252_2460 402
1400 3300053077 Ga0495601_0050418 Ga0495601_0050418_518_1726 402
1401 3300053077 Ga0495601_0071861 Ga0495601_0071861_873_2081 402
1402 3300053078 Ga0495612_0014324 Ga0495612_0014324_760_1968 402
1403 3300053078 Ga0495612_0016661 Ga0495612_0016661_50_1258 402
1404 3300053083 Ga0495655_0005621 Ga0495655_0005621_297_1505 402
1405 3300053084 Ga0495595_0000585 Ga0495595_0000585_7680_8888 402
1406 3300053084 Ga0495595_0004473 Ga0495595_0004473_3463_4671 402
1407 3300053084 Ga0495595_0004734 Ga0495595_0004734_2023_3231 402
1408 3300053085 Ga0495619_0000016 Ga0495619_0000016_61469_62677 402
1409 3300053085 Ga0495619_0002388 Ga0495619_0002388_7105_8313 402
1410 3300053085 Ga0495619_0003397 Ga0495619_0003397_7552_8760 402
1411 3300053096 Ga0500641_0011105 Ga0500641_0011105_1084_2292 402
1412 3300053177 Ga0500636_0075475 Ga0500636_0075475_607_1821 402
1413 3300060353 Ga0501082_0028193 Ga0501082_0028193_3192_4400 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

57

396

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9681 4 393
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9547 14 373
2dr1-assembly1.cif.gz_B crystal structure of the ph1308 protein from pyrococcus horikoshii ot3 0.9521 11 372
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9441 14 373
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9419 4 393
ID Description Score Start End Superfamily
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9762 23 240 3.40.640.10
af_A0A1D6KIH4_267_382_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9754 278 391 3.90.1150.10
af_B6T171_24_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9729 26 266 3.40.640.10
af_Q2FXK2_10_249_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9611 17 255 3.40.640.10
af_Q58369_38_263_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9596 43 269 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A352SDU8-F1-model_v4 Serine--glyoxylate aminotransferase 0.9973 146 385 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A7W7VCS5-F1-model_v4 Alanine-glyoxylate transaminase/serine-glyoxylate transaminase/serine-pyruvate transaminase (EC 2.6.1.44, EC 2.6.1.45, EC 2.6.1.51) 0.995 27 391 GO:0004760
GO:0005777
GO:0008453
GO:0019265
GO:0050281
AF-A0A3M1JLU0-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9939 177 390 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A0M5LR04-F1-model_v4 Serine--glyoxylate aminotransferase 0.9935 202 389 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-D6VB40-F1-model_v4 Aminotransferase class V 0.9934 66 320 GO:0004760
GO:0005777
GO:0008453
GO:0019265

Feature Viewer

pLDDT pTM Quality
94.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map